BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP002G10 559 bp,

Length=559
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789110.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    129   1e-32   Nicotiana sylvestris
ref|XP_009609315.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    129   2e-32   Nicotiana tomentosiformis
ref|XP_006367419.1|  PREDICTED: nuA4 complex subunit EAF3 homolog       126   3e-31   Solanum tuberosum [potatoes]
ref|XP_004238121.1|  PREDICTED: nuA4 complex subunit EAF3 homolog       125   6e-31   
ref|XP_002283618.1|  PREDICTED: mortality factor 4-like protein 1...    122   5e-30   Vitis vinifera
ref|XP_010652767.1|  PREDICTED: mortality factor 4-like protein 1...    122   5e-30   Vitis vinifera
ref|XP_010652766.1|  PREDICTED: mortality factor 4-like protein 1...    123   6e-30   Vitis vinifera
ref|XP_010652764.1|  PREDICTED: mortality factor 4-like protein 1...    123   6e-30   Vitis vinifera
ref|XP_011074414.1|  PREDICTED: mortality factor 4-like protein 1...    121   7e-30   Sesamum indicum [beniseed]
ref|XP_010928390.1|  PREDICTED: mortality factor 4-like protein 1       122   1e-29   Elaeis guineensis
ref|XP_011074412.1|  PREDICTED: mortality factor 4-like protein 1...    121   2e-29   Sesamum indicum [beniseed]
ref|XP_011097238.1|  PREDICTED: mortality factor 4-like protein 1       121   2e-29   Sesamum indicum [beniseed]
ref|XP_003550033.1|  PREDICTED: nuA4 complex subunit EAF3 homolog       119   1e-28   Glycine max [soybeans]
gb|KDP32001.1|  hypothetical protein JCGZ_12462                         119   1e-28   Jatropha curcas
ref|XP_009798553.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    119   1e-28   Nicotiana sylvestris
ref|XP_007155884.1|  hypothetical protein PHAVU_003G239900g             116   1e-28   Phaseolus vulgaris [French bean]
ref|XP_009798546.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    119   1e-28   Nicotiana sylvestris
ref|XP_009588508.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    119   2e-28   Nicotiana tomentosiformis
ref|XP_009588509.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    118   2e-28   Nicotiana tomentosiformis
ref|XP_010271232.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    118   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010271225.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    118   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_006466542.1|  PREDICTED: mortality factor 4-like protein 1...    118   2e-28   Citrus sinensis [apfelsine]
ref|XP_006425992.1|  hypothetical protein CICLE_v10026104mg             118   2e-28   Citrus clementina
ref|XP_010526702.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    118   3e-28   Tarenaya hassleriana [spider flower]
ref|XP_003524665.1|  PREDICTED: nuA4 complex subunit EAF3 homolog       117   5e-28   Glycine max [soybeans]
ref|XP_007047399.1|  MRG family protein isoform 1                       117   7e-28   Theobroma cacao [chocolate]
ref|XP_010538132.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    115   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_010538131.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    115   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_009798562.1|  PREDICTED: mortality factor 4-like protein 1...    116   1e-27   Nicotiana sylvestris
ref|XP_009798569.1|  PREDICTED: mortality factor 4-like protein 1...    116   1e-27   Nicotiana sylvestris
ref|XP_010059757.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    116   2e-27   Eucalyptus grandis [rose gum]
ref|XP_004287991.1|  PREDICTED: mortality factor 4-like protein 1       115   2e-27   Fragaria vesca subsp. vesca
ref|XP_009588511.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    115   2e-27   Nicotiana tomentosiformis
ref|XP_009588510.1|  PREDICTED: mortality factor 4-like protein 1...    115   2e-27   Nicotiana tomentosiformis
ref|XP_009372446.1|  PREDICTED: chromatin modification-related pr...    115   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_008361407.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    115   2e-27   
ref|XP_008361406.1|  PREDICTED: mortality factor 4-like protein 1...    115   2e-27   Malus domestica [apple tree]
ref|XP_010538130.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    115   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_010059756.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    115   2e-27   Eucalyptus grandis [rose gum]
ref|XP_009367673.1|  PREDICTED: chromatin modification-related pr...    115   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_008391514.1|  PREDICTED: chromatin modification-related pr...    115   2e-27   Malus domestica [apple tree]
ref|XP_009367682.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    115   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_009372445.1|  PREDICTED: chromatin modification-related pr...    115   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_010059755.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    115   4e-27   Eucalyptus grandis [rose gum]
ref|XP_010059754.1|  PREDICTED: chromatin modification-related pr...    115   5e-27   Eucalyptus grandis [rose gum]
ref|XP_008238734.1|  PREDICTED: LOW QUALITY PROTEIN: nuA4 complex...    114   8e-27   Prunus mume [ume]
ref|XP_002524929.1|  chromatin binding protein, putative                114   9e-27   Ricinus communis
ref|XP_011006990.1|  PREDICTED: mortality factor 4-like protein 1...    114   1e-26   Populus euphratica
ref|XP_002310115.2|  hypothetical protein POPTR_0007s10460g             113   1e-26   Populus trichocarpa [western balsam poplar]
ref|XP_011074413.1|  PREDICTED: mortality factor 4-like protein 1...    113   2e-26   Sesamum indicum [beniseed]
ref|NP_568021.1|  MRG family protein                                    113   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866959.1|  MRG family protein                                 113   2e-26   Arabidopsis lyrata subsp. lyrata
ref|XP_004509101.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    112   2e-26   Cicer arietinum [garbanzo]
ref|XP_009137560.1|  PREDICTED: mortality factor 4-like protein 1       113   2e-26   Brassica rapa
ref|XP_004509100.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    112   2e-26   Cicer arietinum [garbanzo]
ref|XP_008391512.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...    112   2e-26   Malus domestica [apple tree]
ref|XP_008391513.1|  PREDICTED: chromatin modification-related pr...    112   2e-26   Malus domestica [apple tree]
ref|XP_010943212.1|  PREDICTED: mortality factor 4-like protein 1...    112   2e-26   Elaeis guineensis
gb|EYU34553.1|  hypothetical protein MIMGU_mgv1a010188mg                112   3e-26   Erythranthe guttata [common monkey flower]
gb|KFK30353.1|  hypothetical protein AALP_AA7G250500                    112   3e-26   Arabis alpina [alpine rockcress]
ref|XP_010943214.1|  PREDICTED: chromatin modification-related pr...    112   3e-26   Elaeis guineensis
ref|XP_006411907.1|  hypothetical protein EUTSA_v10025747mg             112   4e-26   Eutrema salsugineum
ref|XP_006283983.1|  hypothetical protein CARUB_v10005107mg             112   5e-26   Capsella rubella
ref|XP_002283143.2|  PREDICTED: mortality factor 4-like protein 1...    111   5e-26   Vitis vinifera
ref|XP_010664544.1|  PREDICTED: mortality factor 4-like protein 1...    111   6e-26   Vitis vinifera
ref|XP_006339844.1|  PREDICTED: nuA4 complex subunit EAF3 homolog       111   6e-26   Solanum tuberosum [potatoes]
ref|XP_010028169.1|  PREDICTED: mortality factor 4-like protein 1       111   7e-26   Eucalyptus grandis [rose gum]
ref|XP_004231884.1|  PREDICTED: nuA4 complex subunit EAF3 homolog       111   7e-26   
ref|XP_010943213.1|  PREDICTED: chromatin modification-related pr...    111   7e-26   Elaeis guineensis
ref|XP_010943211.1|  PREDICTED: chromatin modification-related pr...    111   8e-26   Elaeis guineensis
ref|XP_008799564.1|  PREDICTED: mortality factor 4-like protein 1       111   9e-26   Phoenix dactylifera
ref|XP_006857433.1|  hypothetical protein AMTR_s00067p00163830          111   1e-25   
gb|AFK35210.1|  unknown                                                 107   1e-25   Medicago truncatula
ref|XP_002510147.1|  chromatin binding protein, putative                110   2e-25   
ref|XP_008812831.1|  PREDICTED: mortality factor 4-like protein 1...    110   2e-25   
ref|XP_009396273.1|  PREDICTED: mortality factor 4-like protein 1...    110   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009354150.1|  PREDICTED: chromatin modification-related pr...    110   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_010432070.1|  PREDICTED: mortality factor 4-like protein 1       110   2e-25   Camelina sativa [gold-of-pleasure]
gb|KHN02628.1|  Mortality factor 4-like protein 1                       110   2e-25   Glycine soja [wild soybean]
ref|XP_010437242.1|  PREDICTED: mortality factor 4-like protein 1       110   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_008377994.1|  PREDICTED: chromatin modification-related pr...    110   2e-25   Malus domestica [apple tree]
ref|XP_008812832.1|  PREDICTED: mortality factor 4-like protein 1...    108   6e-25   
ref|XP_008812829.1|  PREDICTED: mortality factor 4-like protein 1...    108   8e-25   Phoenix dactylifera
ref|XP_008812828.1|  PREDICTED: mortality factor 4-like protein 1...    108   9e-25   Phoenix dactylifera
ref|XP_008452609.1|  PREDICTED: mortality factor 4-like protein 1...    108   1e-24   Cucumis melo [Oriental melon]
ref|XP_008452608.1|  PREDICTED: mortality factor 4-like protein 1...    108   1e-24   Cucumis melo [Oriental melon]
ref|XP_004141278.1|  PREDICTED: mortality factor 4-like protein 1...    108   1e-24   Cucumis sativus [cucumbers]
ref|XP_008220281.1|  PREDICTED: nuA4 complex subunit EAF3 homolog       108   1e-24   Prunus mume [ume]
ref|XP_008452607.1|  PREDICTED: mortality factor 4-like protein 1...    108   1e-24   
ref|XP_010446680.1|  PREDICTED: mortality factor 4-like protein 1       107   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_004952261.1|  PREDICTED: mortality factor 4-like protein 1...    107   2e-24   Setaria italica
gb|KEH31493.1|  chromatin-binding protein                               107   2e-24   Medicago truncatula
gb|KJB40286.1|  hypothetical protein B456_007G055700                    107   3e-24   Gossypium raimondii
gb|KJB40289.1|  hypothetical protein B456_007G055700                    107   3e-24   Gossypium raimondii
emb|CAB16772.1|  putative protein                                       107   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004952260.1|  PREDICTED: mortality factor 4-like protein 1...    106   5e-24   Setaria italica
gb|AFW70857.1|  hypothetical protein ZEAMMB73_236054                    103   6e-24   Zea mays [maize]
gb|AFW70859.1|  hypothetical protein ZEAMMB73_236054                    103   6e-24   Zea mays [maize]
ref|XP_010239670.1|  PREDICTED: mortality factor 4-like protein 1...    106   6e-24   Brachypodium distachyon [annual false brome]
gb|ABK26286.1|  unknown                                                 105   7e-24   Picea sitchensis
gb|KJB40290.1|  hypothetical protein B456_007G055700                    105   9e-24   Gossypium raimondii
ref|XP_010679547.1|  PREDICTED: nuA4 complex subunit EAF3 homolog       105   1e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002975945.1|  hypothetical protein SELMODRAFT_228384             105   1e-23   Selaginella moellendorffii
ref|XP_001784474.1|  predicted protein                                  105   1e-23   Physcomitrella patens
ref|XP_008440326.1|  PREDICTED: mortality factor 4-like protein 1...    105   2e-23   Cucumis melo [Oriental melon]
gb|KEH35756.1|  chromatin-binding protein                               104   2e-23   Medicago truncatula
gb|KEH35759.1|  chromatin-binding protein                               104   2e-23   Medicago truncatula
ref|XP_001759805.1|  predicted protein                                  104   2e-23   Physcomitrella patens
ref|XP_008440325.1|  PREDICTED: mortality factor 4-like protein 1...    104   2e-23   
gb|AFW70858.1|  hypothetical protein ZEAMMB73_236054                    104   2e-23   Zea mays [maize]
ref|XP_008643706.1|  PREDICTED: LOC100282973 isoform X7                 104   2e-23   Zea mays [maize]
ref|XP_008643707.1|  PREDICTED: LOC100282973 isoform X8                 104   2e-23   Zea mays [maize]
ref|NP_001149349.1|  LOC100282973                                       104   2e-23   Zea mays [maize]
ref|XP_010239669.1|  PREDICTED: mortality factor 4-like protein 1...    104   2e-23   Brachypodium distachyon [annual false brome]
ref|XP_008643700.1|  PREDICTED: LOC100282973 isoform X1                 104   3e-23   Zea mays [maize]
ref|XP_008643705.1|  PREDICTED: LOC100282973 isoform X6                 104   3e-23   Zea mays [maize]
ref|XP_008643702.1|  PREDICTED: LOC100282973 isoform X3                 104   3e-23   Zea mays [maize]
ref|XP_008643701.1|  PREDICTED: LOC100282973 isoform X2                 104   3e-23   Zea mays [maize]
ref|XP_008643704.1|  PREDICTED: LOC100282973 isoform X5                 104   3e-23   Zea mays [maize]
ref|XP_006652068.1|  PREDICTED: mortality factor 4-like protein 1...    103   5e-23   Oryza brachyantha
gb|KDP41674.1|  hypothetical protein JCGZ_16081                         103   5e-23   Jatropha curcas
gb|EPS71371.1|  hypothetical protein M569_03388                         103   5e-23   Genlisea aurea
ref|XP_002968541.1|  hypothetical protein SELMODRAFT_270711             103   6e-23   Selaginella moellendorffii
emb|CDX69290.1|  BnaC01g01630D                                          101   6e-23   Brassica napus [oilseed rape]
ref|XP_008643703.1|  PREDICTED: LOC100282973 isoform X4                 103   6e-23   Zea mays [maize]
gb|EEC68323.1|  hypothetical protein OsI_36419                          102   8e-23   Oryza sativa Indica Group [Indian rice]
gb|ABA94215.2|  MRG family protein, putative, expressed                 102   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|KFK42627.1|  hypothetical protein AALP_AA1G019800                    102   1e-22   Arabis alpina [alpine rockcress]
emb|CDX75637.1|  BnaA01g00650D                                          101   3e-22   Brassica napus [oilseed rape]
gb|EEE52246.1|  hypothetical protein OsJ_34189                          102   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009396272.1|  PREDICTED: chromatin modification-related pr...    101   4e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008371376.1|  PREDICTED: nuA4 complex subunit EAF3 homolog     97.4    7e-22   Malus domestica [apple tree]
ref|XP_004141897.1|  PREDICTED: mortality factor 4-like protein 1...  99.8    1e-21   Cucumis sativus [cucumbers]
gb|KGN48558.1|  hypothetical protein Csa_6G491700                     99.8    1e-21   Cucumis sativus [cucumbers]
gb|EPS69378.1|  hypothetical protein M569_05388                       99.4    2e-21   Genlisea aurea
ref|XP_003525912.1|  PREDICTED: nuA4 complex subunit EAF3 homolog     99.0    2e-21   Glycine max [soybeans]
ref|XP_004501548.1|  PREDICTED: nuA4 complex subunit EAF3 homolog     99.0    3e-21   Cicer arietinum [garbanzo]
ref|XP_002892122.1|  chromatin binding protein                        98.6    3e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_004291074.1|  PREDICTED: nuA4 complex subunit EAF3 homolog     97.1    1e-20   Fragaria vesca subsp. vesca
ref|XP_011029225.1|  PREDICTED: chromatin modification-related pr...  96.7    1e-20   Populus euphratica
ref|XP_006418310.1|  hypothetical protein EUTSA_v10008162mg           96.7    2e-20   Eutrema salsugineum
ref|NP_171774.2|  MRG family protein                                  96.7    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007018592.1|  MRG family protein, putative isoform 1           95.9    3e-20   Theobroma cacao [chocolate]
ref|XP_009789111.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...  95.5    3e-20   Nicotiana sylvestris
ref|XP_009609316.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...  94.7    5e-20   Nicotiana tomentosiformis
gb|EYU36317.1|  hypothetical protein MIMGU_mgv1a010803mg              94.7    6e-20   Erythranthe guttata [common monkey flower]
ref|XP_003523982.1|  PREDICTED: nuA4 complex subunit EAF3 homolog     94.4    8e-20   Glycine max [soybeans]
gb|KHN04469.1|  Chromatin modification-related protein EAF3           94.7    9e-20   Glycine soja [wild soybean]
ref|XP_007047400.1|  MRG family protein isoform 2                     94.4    1e-19   Theobroma cacao [chocolate]
ref|XP_010481223.1|  PREDICTED: nuA4 complex subunit EAF3 homolog     94.4    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010457263.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...  93.2    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010474852.1|  PREDICTED: nuA4 complex subunit EAF3 homolog     93.2    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_004287990.1|  PREDICTED: uncharacterized protein LOC101305978  96.3    3e-19   Fragaria vesca subsp. vesca
ref|XP_002320088.2|  hypothetical protein POPTR_0014s02250g           92.8    4e-19   Populus trichocarpa [western balsam poplar]
ref|XP_009118749.1|  PREDICTED: nuA4 complex subunit EAF3 homolog     91.3    1e-18   Brassica rapa
ref|XP_009372448.1|  PREDICTED: uncharacterized protein LOC103961605  92.4    3e-18   Pyrus x bretschneideri [bai li]
emb|CDY32476.1|  BnaA09g51200D                                        88.2    1e-17   Brassica napus [oilseed rape]
emb|CDP02542.1|  unnamed protein product                              87.4    3e-17   Coffea canephora [robusta coffee]
gb|EMS62229.1|  Mortality factor 4-like protein 1                     87.4    3e-17   Triticum urartu
emb|CDY37463.1|  BnaC08g46010D                                        85.9    9e-17   Brassica napus [oilseed rape]
gb|KDO84034.1|  hypothetical protein CISIN_1g0200392mg                84.0    2e-16   Citrus sinensis [apfelsine]
ref|XP_011505271.1|  PREDICTED: mortality factor 4-like protein 1     84.7    2e-16   Ceratosolen solmsi marchali
ref|XP_006473265.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...  84.3    3e-16   
ref|XP_006473263.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...  84.3    3e-16   Citrus sinensis [apfelsine]
ref|XP_006473264.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...  84.3    3e-16   Citrus sinensis [apfelsine]
ref|XP_006473262.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...  84.3    3e-16   Citrus sinensis [apfelsine]
ref|XP_006434696.1|  hypothetical protein CICLE_v10001792mg           84.3    4e-16   Citrus clementina
ref|XP_011300571.1|  PREDICTED: mortality factor 4-like protein 1     83.6    7e-16   Fopius arisanus
ref|XP_007018595.1|  MRG family protein, putative isoform 4           83.2    8e-16   Theobroma cacao [chocolate]
ref|XP_009360134.1|  PREDICTED: LOW QUALITY PROTEIN: nuA4 complex...  83.2    8e-16   Pyrus x bretschneideri [bai li]
ref|XP_007018593.1|  MRG family protein, putative isoform 2           83.2    1e-15   Theobroma cacao [chocolate]
ref|XP_008207612.1|  PREDICTED: LOW QUALITY PROTEIN: nuA4 complex...  82.0    2e-15   Nasonia vitripennis
ref|XP_396632.3|  PREDICTED: mortality factor 4-like protein 1-li...  81.6    3e-15   Apis mellifera [bee]
ref|XP_006621011.1|  PREDICTED: mortality factor 4-like protein 1...  81.6    3e-15   Apis dorsata [rock honeybee]
ref|XP_003690386.1|  PREDICTED: mortality factor 4-like protein 1...  81.6    3e-15   Apis florea [dwarf honeybee]
ref|XP_003398041.1|  PREDICTED: mortality factor 4-like protein 1...  81.6    3e-15   
ref|XP_003485396.1|  PREDICTED: mortality factor 4-like protein 1...  81.6    3e-15   
ref|XP_006621012.1|  PREDICTED: mortality factor 4-like protein 1...  81.6    3e-15   Apis dorsata [rock honeybee]
ref|XP_006561709.1|  PREDICTED: mortality factor 4-like protein 1...  81.6    3e-15   Apis mellifera [bee]
ref|XP_007205458.1|  hypothetical protein PRUPE_ppa007902mg           81.6    3e-15   Prunus persica
ref|XP_010095325.1|  Chromatin modification-related protein EAF3      80.9    4e-15   Morus notabilis
ref|XP_002053695.1|  GJ24036                                          82.8    4e-15   
ref|XP_005181092.1|  PREDICTED: mortality factor 4-like protein 1     81.6    7e-15   Musca domestica
ref|XP_011150963.1|  PREDICTED: mortality factor 4-like protein 1     80.1    1e-14   Harpegnathos saltator
ref|XP_006032508.1|  PREDICTED: mortality factor 4-like protein 1...  79.7    1e-14   
ref|XP_005521728.1|  PREDICTED: mortality factor 4-like protein 1...  79.7    1e-14   
ref|XP_001363195.1|  PREDICTED: mortality factor 4-like protein 1...  79.7    1e-14   Monodelphis domestica
ref|XP_010874224.1|  PREDICTED: mortality factor 4-like protein 1     80.1    1e-14   
emb|CAF98370.1|  unnamed protein product                              79.7    1e-14   Tetraodon nigroviridis
pdb|2EFI|A  Chain A, Solution Structure Of The Chromo Domain Of M...  76.6    1e-14   Homo sapiens [man]
ref|NP_001139993.1|  Mortality factor 4-like protein 1                79.7    1e-14   Salmo salar
ref|XP_003967506.1|  PREDICTED: mortality factor 4-like protein 1...  79.7    1e-14   Takifugu rubripes [tiger puffer]
gb|ACQ58325.1|  Mortality factor 4-like protein 1                     79.3    1e-14   Anoplopoma fimbria
ref|XP_005999759.1|  PREDICTED: mortality factor 4-like protein 1     79.3    2e-14   Latimeria chalumnae
gb|ACN10127.1|  Mortality factor 4-like protein 1                     79.7    2e-14   Salmo salar
ref|XP_002187229.2|  PREDICTED: mortality factor 4-like protein 1     80.1    2e-14   
ref|NP_001158545.1|  Mortality factor 4-like protein 1                79.7    2e-14   Oncorhynchus mykiss
ref|XP_003699592.1|  PREDICTED: mortality factor 4-like protein 1...  79.3    2e-14   Megachile rotundata
ref|XP_011474879.1|  PREDICTED: mortality factor 4-like protein 1     79.0    2e-14   Oryzias latipes [Japanese rice fish]
ref|XP_004387537.1|  PREDICTED: mortality factor 4-like protein 1...  79.0    2e-14   Trichechus manatus latirostris
ref|XP_011168895.1|  PREDICTED: mortality factor 4-like protein 1     79.3    2e-14   Solenopsis invicta [imported red fire ant]
ref|NP_001032253.1|  mortality factor 4 like 1 isoform 2              79.0    2e-14   Gallus gallus [bantam]
ref|XP_001999699.1|  GI24663                                          80.5    3e-14   Drosophila mojavensis
ref|XP_005806998.1|  PREDICTED: mortality factor 4-like protein 1...  79.0    3e-14   Xiphophorus maculatus
ref|XP_007556909.1|  PREDICTED: mortality factor 4-like protein 1     78.6    3e-14   Poecilia formosa
ref|XP_010733430.1|  PREDICTED: mortality factor 4-like protein 1     78.6    3e-14   Larimichthys crocea [croceine croaker]
ref|XP_008410405.1|  PREDICTED: mortality factor 4-like protein 1     78.6    3e-14   Poecilia reticulata
ref|XP_008300670.1|  PREDICTED: mortality factor 4-like protein 1     78.6    3e-14   Stegastes partitus
pdb|2F5K|A  Chain A, Crystal Structure Of The Chromo Domain Of Hu...  75.5    3e-14   Homo sapiens [man]
ref|XP_008819836.1|  PREDICTED: LOW QUALITY PROTEIN: mortality fa...  78.2    4e-14   Nannospalax galili
dbj|BAJ87278.1|  predicted protein                                    79.0    4e-14   Hordeum vulgare subsp. vulgare [barley]
dbj|BAE00783.1|  unnamed protein product                              78.2    4e-14   Macaca fascicularis [crab eating macaque]
gb|AAG17253.1|AF218011_1  unknown                                     78.2    4e-14   Homo sapiens [man]
ref|XP_001927776.1|  PREDICTED: mortality factor 4 like 1 isoform 1   78.2    4e-14   Sus scrofa [pigs]
ref|XP_010365659.1|  PREDICTED: LOW QUALITY PROTEIN: mortality fa...  78.2    4e-14   Rhinopithecus roxellana
ref|XP_008215971.1|  PREDICTED: mortality factor 4-like protein 1     78.6    4e-14   Nasonia vitripennis
ref|XP_004403649.1|  PREDICTED: mortality factor 4-like protein 1...  78.2    4e-14   Odobenus rosmarus divergens
dbj|BAE27430.1|  unnamed protein product                              78.2    4e-14   Mus musculus [mouse]
emb|CAJ82495.1|  mortality factor 4 like 1                            78.2    4e-14   Xenopus tropicalis [western clawed frog]
ref|XP_899406.1|  PREDICTED: mortality factor 4-like protein 1        78.2    4e-14   
ref|XP_010795677.1|  PREDICTED: mortality factor 4-like protein 1...  78.2    4e-14   Notothenia coriiceps [yellowbelly rockcod]
ref|NP_001011999.1|  mortality factor 4-like protein 1                78.2    4e-14   Rattus norvegicus [brown rat]
emb|CAB70879.2|  hypothetical protein                                 78.2    4e-14   Homo sapiens [man]
gb|AAH67826.1|  Mortality factor 4 like 1                             78.2    4e-14   Homo sapiens [man]
ref|XP_005366700.1|  PREDICTED: mortality factor 4-like protein 1...  78.2    4e-14   Microtus ochrogaster [prairie voles]
ref|XP_010982185.1|  PREDICTED: mortality factor 4-like protein 1     78.2    4e-14   Camelus dromedarius [camel]
ref|NP_006782.1|  mortality factor 4-like protein 1 isoform 1         78.2    4e-14   Homo sapiens [man]
gb|AAI41841.1|  Mortality factor 4 like 1                             78.2    4e-14   Homo sapiens [man]
ref|NP_001011155.1|  mortality factor 4 like 1                        78.2    4e-14   Xenopus tropicalis [western clawed frog]
ref|XP_006888316.1|  PREDICTED: mortality factor 4-like protein 1...  78.2    4e-14   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004625436.1|  PREDICTED: mortality factor 4-like protein 1...  78.2    4e-14   Octodon degus
ref|XP_003967507.1|  PREDICTED: mortality factor 4-like protein 1...  78.6    4e-14   
ref|XP_004480429.1|  PREDICTED: mortality factor 4-like protein 1...  77.8    5e-14   Dasypus novemcinctus
ref|XP_006789317.1|  PREDICTED: mortality factor 4-like protein 1...  77.8    5e-14   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004553110.1|  PREDICTED: mortality factor 4-like protein 1...  77.8    5e-14   Maylandia zebra
ref|XP_003440502.1|  PREDICTED: mortality factor 4-like protein 1...  77.8    5e-14   Oreochromis niloticus
ref|XP_001989538.1|  GH18746                                          79.0    6e-14   Drosophila grimshawi
ref|XP_008159043.1|  PREDICTED: mortality factor 4-like protein 1...  77.8    6e-14   Eptesicus fuscus
ref|XP_005974058.1|  PREDICTED: mortality factor 4-like protein 1...  77.8    6e-14   Pantholops hodgsonii
ref|XP_005221943.1|  PREDICTED: mortality factor 4-like protein 1...  77.8    7e-14   Bos taurus [bovine]
ref|XP_008308783.1|  PREDICTED: mortality factor 4-like protein 1...  77.0    7e-14   Cynoglossus semilaevis
ref|XP_004018121.1|  PREDICTED: mortality factor 4-like protein 1     77.4    7e-14   
pdb|2LRQ|A  Chain A, Chemical Shift Assignment And Solution Struc...  74.3    7e-14   Drosophila melanogaster
ref|XP_011341427.1|  PREDICTED: mortality factor 4-like protein 1     77.8    7e-14   Cerapachys biroi
gb|EHB06135.1|  Mortality factor 4-like protein 1                     76.3    7e-14   Heterocephalus glaber [naked mole rat]
ref|XP_011050489.1|  PREDICTED: mortality factor 4-like protein 1     77.8    7e-14   Acromyrmex echinatior
ref|XP_002031094.1|  GM25788                                          78.6    8e-14   Drosophila sechellia
ref|XP_007984162.1|  PREDICTED: LOW QUALITY PROTEIN: mortality fa...  77.4    9e-14   Chlorocebus sabaeus
ref|XP_008308781.1|  PREDICTED: mortality factor 4-like protein 1...  77.4    9e-14   Cynoglossus semilaevis
ref|XP_006628824.1|  PREDICTED: mortality factor 4-like protein 1...  77.4    9e-14   Lepisosteus oculatus
ref|XP_005521727.1|  PREDICTED: mortality factor 4-like protein 1...  77.4    9e-14   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005300737.1|  PREDICTED: mortality factor 4-like protein 1...  77.4    9e-14   Chrysemys picta bellii
ref|XP_002103346.1|  GD20365                                          78.6    9e-14   Drosophila simulans
ref|XP_010570444.1|  PREDICTED: mortality factor 4-like protein 1...  77.4    9e-14   Haliaeetus leucocephalus
ref|XP_006263077.1|  PREDICTED: mortality factor 4-like protein 1...  77.4    9e-14   
ref|NP_650442.1|  MRG15, isoform A                                    78.6    9e-14   Drosophila melanogaster
ref|XP_001980027.1|  GG20726                                          78.6    9e-14   Drosophila erecta
ref|XP_008310336.1|  PREDICTED: mortality factor 4-like protein 1     77.4    1e-13   Cynoglossus semilaevis
ref|XP_003440503.1|  PREDICTED: mortality factor 4-like protein 1...  77.4    1e-13   
ref|XP_007478091.1|  PREDICTED: mortality factor 4-like protein 1...  77.4    1e-13   Monodelphis domestica
ref|XP_010740197.1|  PREDICTED: mortality factor 4-like protein 1...  77.0    1e-13   Larimichthys crocea [croceine croaker]
ref|NP_001002604.2|  mortality factor 4-like protein 1                77.0    1e-13   Danio rerio [leopard danio]
ref|XP_008120268.1|  PREDICTED: mortality factor 4-like protein 1     77.4    1e-13   Anolis carolinensis [Carolina anole]
ref|XP_005941780.1|  PREDICTED: mortality factor 4-like protein 1...  77.4    1e-13   
ref|NP_001032250.1|  mortality factor 4 like 1 isoform 1              77.4    1e-13   Gallus gallus [bantam]
ref|XP_004896795.1|  PREDICTED: mortality factor 4-like protein 1...  75.9    1e-13   
ref|XP_010740196.1|  PREDICTED: mortality factor 4-like protein 1...  77.4    1e-13   Larimichthys crocea [croceine croaker]
ref|XP_007249206.1|  PREDICTED: mortality factor 4-like protein 1...  77.0    1e-13   Astyanax mexicanus [blind cave fish]
ref|XP_003461516.1|  PREDICTED: mortality factor 4-like protein 1     77.8    1e-13   
ref|XP_011256734.1|  PREDICTED: mortality factor 4-like protein 1     77.4    1e-13   Camponotus floridanus
ref|XP_010862351.1|  PREDICTED: mortality factor 4-like protein 1     77.0    1e-13   
ref|NP_001087656.1|  mortality factor 4 like 1                        77.0    1e-13   Xenopus laevis [clawed frog]
ref|XP_003969685.1|  PREDICTED: mortality factor 4-like protein 1...  77.0    1e-13   Takifugu rubripes [tiger puffer]
ref|XP_008274266.1|  PREDICTED: mortality factor 4-like protein 1     76.6    1e-13   Stegastes partitus
ref|XP_004066932.1|  PREDICTED: mortality factor 4-like protein 1...  76.6    1e-13   Oryzias latipes [Japanese rice fish]
ref|XP_004403650.1|  PREDICTED: mortality factor 4-like protein 1...  76.3    1e-13   Odobenus rosmarus divergens
ref|XP_005889828.1|  PREDICTED: mortality factor 4-like protein 1...  76.3    1e-13   Bos mutus
ref|XP_007564030.1|  PREDICTED: mortality factor 4-like protein 1     76.6    1e-13   Poecilia formosa
ref|XP_004040690.1|  PREDICTED: mortality factor 4-like protein 1...  76.6    2e-13   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_007458392.1|  PREDICTED: mortality factor 4-like protein 1...  76.3    2e-13   
ref|XP_005366701.1|  PREDICTED: mortality factor 4-like protein 1...  76.3    2e-13   
ref|XP_001965939.1|  GF11736                                          77.8    2e-13   
ref|XP_011486431.1|  PREDICTED: mortality factor 4-like protein 1...  76.6    2e-13   
ref|XP_007500051.1|  PREDICTED: mortality factor 4-like protein 1...  77.4    2e-13   
gb|ACO09550.1|  Mortality factor 4-like protein 1                     76.6    2e-13   
ref|NP_001127679.1|  mortality factor 4-like protein 1                76.3    2e-13   
ref|XP_008402863.1|  PREDICTED: mortality factor 4-like protein 1     76.3    2e-13   
ref|XP_005815020.1|  PREDICTED: mortality factor 4-like protein 1...  76.3    2e-13   
ref|XP_003456798.1|  PREDICTED: mortality factor 4-like protein 1...  76.3    2e-13   
gb|EHB06202.1|  Mortality factor 4-like protein 1                     75.9    2e-13   
ref|XP_002097768.1|  GE26393                                          77.0    3e-13   
ref|XP_002158229.1|  PREDICTED: mortality factor 4-like protein 1...  75.5    3e-13   
gb|EUB59179.1|  Mortality factor 4-like protein                       76.3    3e-13   
gb|KFM81339.1|  Mortality factor 4-like protein 1                     75.9    3e-13   
emb|CDJ05894.1|  Mortality factor 4 protein 1                         76.3    3e-13   
ref|NP_001262588.1|  MRG15, isoform B                                 77.0    3e-13   
gb|EKC34700.1|  Mortality factor 4-like protein 1                     75.9    4e-13   
ref|XP_007903387.1|  PREDICTED: mortality factor 4-like protein 1     75.5    4e-13   
ref|XP_001864241.1|  MRG15                                            76.3    5e-13   
ref|XP_003823471.1|  PREDICTED: mortality factor 4-like protein 1     75.5    5e-13   
ref|XP_011437434.1|  PREDICTED: mortality factor 4-like protein 1     75.9    5e-13   
ref|XP_010774580.1|  PREDICTED: mortality factor 4-like protein 1...  75.5    5e-13   
gb|KFB42380.1|  AGAP001795-PA-like protein                            76.3    6e-13   
ref|XP_010774581.1|  PREDICTED: mortality factor 4-like protein 1...  75.1    6e-13   
ref|XP_011497855.1|  PREDICTED: mortality factor 4-like protein 1...  75.1    7e-13   
ref|XP_011497856.1|  PREDICTED: mortality factor 4-like protein 1...  75.1    7e-13   
ref|XP_007504397.1|  PREDICTED: mortality factor 4-like protein 1...  75.5    7e-13   
ref|XP_008558399.1|  PREDICTED: mortality factor 4-like protein 1     75.1    7e-13   
ref|XP_010715938.1|  PREDICTED: mortality factor 4-like protein 1...  74.7    7e-13   
dbj|GAN11205.1|  conserved hypothetical protein                       74.7    7e-13   
ref|XP_790665.2|  PREDICTED: mortality factor 4-like protein 1-like   73.9    8e-13   
ref|XP_001655962.1|  AAEL002772-PA                                    75.5    8e-13   
gb|EHB05349.1|  Mortality factor 4-like protein 1                     73.9    9e-13   
ref|XP_007986307.1|  PREDICTED: LOW QUALITY PROTEIN: mortality fa...  75.9    9e-13   
ref|XP_002072802.1|  GK13489                                          75.5    1e-12   
ref|XP_011184080.1|  PREDICTED: nuA4 complex subunit EAF3 homolog     75.1    1e-12   
ref|XP_011203855.1|  PREDICTED: mortality factor 4-like protein 1     75.1    1e-12   
ref|XP_009044199.1|  hypothetical protein LOTGIDRAFT_177197           73.9    1e-12   
ref|XP_007432083.1|  PREDICTED: mortality factor 4-like protein 1     74.3    1e-12   
gb|EFX89937.1|  hypothetical protein DAPPUDRAFT_299826                74.7    1e-12   
gb|ETN60414.1|  chromo domain protein                                 75.1    1e-12   
ref|XP_006905436.1|  PREDICTED: mortality factor 4-like protein 1     73.6    1e-12   
ref|XP_004519789.1|  PREDICTED: nuA4 complex subunit EAF3 homolog     74.7    2e-12   
ref|XP_008987943.1|  PREDICTED: mortality factor 4-like protein 1     73.9    2e-12   
gb|ENN75371.1|  hypothetical protein YQE_08146                        73.6    2e-12   
gb|KFM79512.1|  Mortality factor 4-like protein 1                     73.6    2e-12   
ref|XP_007418611.1|  hypothetical protein MELLADRAFT_41013            73.2    2e-12   
ref|XP_003771668.1|  PREDICTED: mortality factor 4-like protein 1...  73.9    2e-12   
ref|XP_005560278.1|  PREDICTED: uncharacterized LOC101865446 isof...  73.9    2e-12   
ref|XP_004056665.1|  PREDICTED: mortality factor 4-like protein 1...  73.9    2e-12   
ref|XP_010377953.1|  PREDICTED: mortality factor 4-like protein 1     73.9    2e-12   
ref|XP_011227916.1|  PREDICTED: mortality factor 4-like protein 1     73.6    2e-12   
gb|EHJ73253.1|  mortality factor 4-like protein                       73.6    2e-12   
ref|XP_004763674.1|  PREDICTED: mortality factor 4-like protein 1...  73.6    2e-12   
ref|XP_009905027.1|  PREDICTED: mortality factor 4-like protein 1     72.8    2e-12   
ref|XP_007374431.1|  hypothetical protein SPAPADRAFT_54898            73.2    2e-12   
ref|XP_010630100.1|  PREDICTED: mortality factor 4-like protein 1...  73.2    2e-12   
gb|EMC81292.1|  Mortality factor 4-like protein 1                     72.4    3e-12   
ref|XP_007249205.1|  PREDICTED: mortality factor 4-like protein 1...  73.6    3e-12   
ref|NP_001030525.1|  mortality factor 4-like protein 1                72.8    3e-12   
ref|XP_009476889.1|  PREDICTED: mortality factor 4-like protein 1     73.6    3e-12   
ref|XP_005410432.1|  PREDICTED: mortality factor 4-like protein 1...  73.2    3e-12   
ref|XP_003030574.1|  hypothetical protein SCHCODRAFT_57285            72.8    3e-12   
ref|XP_001359900.2|  GA19541                                          73.9    3e-12   
ref|XP_002019707.1|  GL12068                                          73.9    4e-12   
gb|ABJ99462.1|  mrg                                                   73.2    4e-12   
ref|XP_008198934.1|  PREDICTED: mortality factor 4-like protein 1     72.8    4e-12   
ref|XP_007617279.1|  PREDICTED: LOW QUALITY PROTEIN: mortality fa...  73.2    4e-12   
ref|XP_004480428.1|  PREDICTED: mortality factor 4-like protein 1...  73.2    4e-12   
ref|XP_004421935.1|  PREDICTED: mortality factor 4-like protein 1...  73.6    4e-12   
ref|XP_007084058.1|  PREDICTED: mortality factor 4-like protein 1     72.8    4e-12   
gb|KDR10375.1|  Mortality factor 4-like protein 1                     72.8    4e-12   
ref|XP_006932244.1|  PREDICTED: mortality factor 4-like protein 1...  72.8    4e-12   
gb|EDL01607.1|  mCG6273                                               72.4    5e-12   
ref|XP_008500366.1|  PREDICTED: mortality factor 4-like protein 1     72.8    5e-12   
ref|XP_009278672.1|  PREDICTED: mortality factor 4-like protein 1...  72.8    5e-12   
ref|XP_009876869.1|  PREDICTED: mortality factor 4-like protein 1     72.8    5e-12   
ref|XP_009696253.1|  PREDICTED: LOW QUALITY PROTEIN: mortality fa...  72.8    5e-12   
ref|XP_009951179.1|  PREDICTED: mortality factor 4-like protein 1     72.8    6e-12   
ref|XP_001641828.1|  predicted protein                                72.0    6e-12   
ref|XP_010293559.1|  PREDICTED: mortality factor 4-like protein 1...  72.8    6e-12   
ref|XP_009319709.1|  PREDICTED: mortality factor 4-like protein 1...  72.8    6e-12   
ref|XP_010183333.1|  PREDICTED: mortality factor 4-like protein 1     72.4    6e-12   
ref|XP_010001130.1|  PREDICTED: mortality factor 4-like protein 1     72.8    6e-12   
ref|XP_010157718.1|  PREDICTED: mortality factor 4-like protein 1     72.8    6e-12   
ref|XP_009979971.1|  PREDICTED: mortality factor 4-like protein 1...  72.8    6e-12   
ref|XP_010215674.1|  PREDICTED: mortality factor 4-like protein 1     72.4    6e-12   
ref|XP_006132156.1|  PREDICTED: mortality factor 4-like protein 1...  72.4    6e-12   
ref|XP_010162814.1|  PREDICTED: LOW QUALITY PROTEIN: mortality fa...  72.4    6e-12   
ref|XP_009468280.1|  PREDICTED: mortality factor 4-like protein 1...  72.4    6e-12   
ref|XP_005052186.1|  PREDICTED: mortality factor 4-like protein 1     72.4    6e-12   
ref|XP_010016965.1|  PREDICTED: LOW QUALITY PROTEIN: mortality fa...  72.4    6e-12   
ref|XP_010715937.1|  PREDICTED: mortality factor 4-like protein 1...  72.4    6e-12   
ref|XP_010305189.1|  PREDICTED: mortality factor 4-like protein 1...  72.4    6e-12   
ref|XP_009565939.1|  PREDICTED: mortality factor 4-like protein 1     72.4    6e-12   
ref|XP_010135223.1|  PREDICTED: LOW QUALITY PROTEIN: mortality fa...  72.4    6e-12   
ref|XP_009643650.1|  PREDICTED: mortality factor 4-like protein 1     72.4    6e-12   
ref|XP_009814064.1|  PREDICTED: mortality factor 4-like protein 1...  72.4    7e-12   
ref|XP_009879454.1|  PREDICTED: mortality factor 4-like protein 1     72.4    7e-12   
ref|XP_009922094.1|  PREDICTED: mortality factor 4-like protein 1     72.4    7e-12   
emb|CAF99877.1|  unnamed protein product                              72.0    8e-12   
ref|XP_005695225.1|  PREDICTED: mortality factor 4-like protein 1     72.8    8e-12   
ref|XP_005978625.1|  PREDICTED: exocyst complex component 5           73.6    9e-12   
gb|EPB83073.1|  hypothetical protein HMPREF1544_10162                 71.2    1e-11   
emb|CCX11469.1|  Similar to Chromatin modification-related protei...  71.2    1e-11   
ref|NP_001139536.1|  mortality factor 4-like                          71.6    1e-11   
ref|XP_008686108.1|  PREDICTED: mortality factor 4-like protein 1     71.6    1e-11   
ref|XP_321270.5|  AGAP001795-PA                                       72.0    1e-11   
ref|XP_003737012.1|  PREDICTED: mortality factor 4-like protein 1...  71.2    2e-11   
ref|XP_010334484.1|  PREDICTED: LOW QUALITY PROTEIN: mortality fa...  70.9    2e-11   
ref|XP_004553109.1|  PREDICTED: mortality factor 4-like protein 1...  70.9    2e-11   
gb|ACO11643.1|  Mortality factor 4-like protein 1                     70.5    3e-11   
gb|ACO15529.1|  Mortality factor 4-like protein 1                     70.5    3e-11   
ref|XP_011029234.1|  PREDICTED: chromatin modification-related pr...  70.1    3e-11   
ref|XP_007526911.1|  PREDICTED: mortality factor 4-like protein 1     70.9    4e-11   
emb|CDS30678.1|  Mortality factor 4 protein 1                         70.5    4e-11   
ref|XP_005095396.1|  PREDICTED: mortality factor 4                    70.5    4e-11   
emb|CEG72316.1|  hypothetical protein RMATCC62417_07897               69.7    4e-11   
gb|KIO27401.1|  hypothetical protein M407DRAFT_191103                 70.1    4e-11   
emb|CDS13259.1|  hypothetical protein LRAMOSA05437                    68.9    5e-11   
ref|XP_002120071.1|  PREDICTED: mortality factor 4-like protein 1     69.7    5e-11   
emb|CAX73388.1|  Mortality factor 4-like protein 1                    70.1    5e-11   
emb|CCD75233.1|  transcription factor mrg-related                     70.5    5e-11   
gb|AAW24865.1|  SJCHGC00909 protein                                   70.1    5e-11   
gb|ELT89148.1|  hypothetical protein CAPTEDRAFT_221778                69.7    6e-11   
emb|CEI86397.1|  hypothetical protein RMCBS344292_00839               69.3    7e-11   
ref|XP_011404232.1|  PREDICTED: nuA4 complex subunit EAF3 homolog     67.4    8e-11   
ref|XP_009017445.1|  hypothetical protein HELRODRAFT_99671            69.3    1e-10   
emb|CEI93951.1|  hypothetical protein RMCBS344292_08175               69.7    1e-10   
ref|XP_006032507.1|  PREDICTED: mortality factor 4-like protein 1...  68.6    1e-10   
ref|XP_002428775.1|  conserved hypothetical protein                   68.2    2e-10   
ref|XP_005080977.1|  PREDICTED: mortality factor 4-like protein 1...  66.2    2e-10   
ref|XP_001365942.1|  PREDICTED: mortality factor 4-like protein 1...  68.6    2e-10   
gb|KGB38333.1|  Mortality factor 4-like protein 1                     64.7    3e-10   
ref|XP_003766828.1|  PREDICTED: mortality factor 4-like protein 1...  68.2    3e-10   
ref|XP_008168726.1|  PREDICTED: mortality factor 4-like protein 1...  67.8    3e-10   
gb|EPZ36594.1|  MRG domain-containing protein                         67.0    3e-10   
ref|XP_009494086.1|  hypothetical protein H696_01910                  68.2    4e-10   
emb|CDH54070.1|  mrg-domain-containing protein                        66.6    4e-10   
ref|XP_002116451.1|  hypothetical protein TRIADDRAFT_60384            67.0    4e-10   
ref|XP_003868651.1|  Eaf3 subunit of the NuA4 histone acetyltrans...  67.0    4e-10   
gb|KFH67405.1|  hypothetical protein MVEG_06138                       66.6    4e-10   
gb|EKG11133.1|  Chromo domain/shadow                                  65.9    5e-10   
ref|XP_007947994.1|  PREDICTED: LOW QUALITY PROTEIN: mortality fa...  66.6    7e-10   
ref|XP_001271939.1|  histone acetylase complex subunit MRG15-2        66.6    7e-10   
ref|XP_006076794.1|  PREDICTED: mortality factor 4-like protein 1...  66.6    7e-10   
ref|XP_002626359.1|  histone acetylase complex subunit                66.2    8e-10   
ref|XP_002547513.1|  predicted protein                                66.2    8e-10   
gb|KFW12522.1|  Mortality factor 4-like 1                             66.2    8e-10   
gb|ERL90441.1|  hypothetical protein D910_07790                       66.2    9e-10   
gb|EQL35707.1|  chromatin modification-like protein eaf3              66.2    1e-09   
ref|XP_002606249.1|  hypothetical protein BRAFLDRAFT_84009            65.9    1e-09   
dbj|BAE58239.1|  unnamed protein product                              65.9    1e-09   
emb|CEJ01694.1|  hypothetical protein RMCBS344292_15716               65.1    1e-09   
ref|XP_008180919.1|  PREDICTED: cell wall protein DAN4-like           67.4    1e-09   
ref|XP_003334123.2|  hypothetical protein PGTG_15360                  65.5    1e-09   
ref|XP_003334668.2|  hypothetical protein PGTG_16527                  65.5    1e-09   
gb|KIK16697.1|  hypothetical protein PISMIDRAFT_112896                65.5    1e-09   
gb|EGU13267.1|  Chromatin modification-related protein EAF3           67.0    1e-09   
ref|XP_007753261.1|  hypothetical protein A1O7_01032                  66.6    1e-09   
gb|KDQ52551.1|  hypothetical protein JAAARDRAFT_61857                 65.1    2e-09   
ref|XP_001266951.1|  histone acetylase complex subunit MRG15-2        65.5    2e-09   
emb|CEG84537.1|  hypothetical protein RMATCC62417_18326               64.3    2e-09   
ref|XP_008722716.1|  hypothetical protein G647_01093                  66.2    2e-09   
ref|XP_006457168.1|  hypothetical protein AGABI2DRAFT_196009          65.1    2e-09   
ref|XP_004859210.1|  PREDICTED: mortality factor 4-like protein 1...  61.6    2e-09   
ref|XP_001401967.1|  chromatin modification-related protein eaf3      65.1    2e-09   
gb|KIL58632.1|  hypothetical protein M378DRAFT_86233                  64.7    3e-09   
gb|KIO03171.1|  hypothetical protein M404DRAFT_146431                 64.7    3e-09   
ref|XP_007772158.1|  MRG-domain-containing protein                    64.3    3e-09   
gb|EPX74901.1|  Clr6 histone deacetylase complex subunit Alp13        64.7    3e-09   
gb|KIY48324.1|  MRG-domain-containing protein                         64.3    4e-09   
gb|AFD29601.1|  MRG-1                                                 64.7    4e-09   
ref|XP_002839944.1|  hypothetical protein                             63.9    4e-09   
ref|XP_751760.1|  histone acetylase complex subunit MRG15-2           64.3    5e-09   
gb|EWC48697.1|  hypothetical protein DRE_00002                        63.5    5e-09   
gb|KFY11276.1|  hypothetical protein V492_04545                       65.1    5e-09   
ref|XP_010688534.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...  63.5    5e-09   
ref|NP_593394.1|  MRG family Clr6 histone deacetylase complex sub...  63.9    5e-09   
gb|KIK38183.1|  hypothetical protein CY34DRAFT_91447                  63.9    5e-09   
gb|EPY51016.1|  Clr6 histone deacetylase complex subunit Alp13        63.9    7e-09   
gb|ESA23692.1|  hypothetical protein GLOINDRAFT_342044                63.2    7e-09   
ref|XP_001213180.1|  hypothetical protein ATEG_04002                  63.2    7e-09   
gb|ERZ99299.1|  hypothetical protein GLOINDRAFT_339167                63.5    7e-09   
ref|XP_005815019.1|  PREDICTED: mortality factor 4-like protein 1...  63.5    8e-09   
dbj|GAM84471.1|  hypothetical protein ANO11243_024670                 63.5    8e-09   
gb|ACO13094.1|  Mortality factor 4-like protein 1                     63.5    8e-09   
gb|ERZ95322.1|  hypothetical protein GLOINDRAFT_341286                63.5    8e-09   
gb|KFO53452.1|  Mortality factor 4-like 1                             63.5    8e-09   
ref|XP_010688502.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...  63.2    8e-09   
ref|XP_011106971.1|  hypothetical protein H072_979                    63.2    9e-09   
gb|KFZ15679.1|  hypothetical protein V501_02620                       63.9    9e-09   
gb|KFY39543.1|  hypothetical protein V494_03927                       63.9    9e-09   
gb|KIY45312.1|  MRG-domain-containing protein                         63.2    9e-09   
ref|XP_007269179.1|  MRG-domain-containing protein                    63.2    9e-09   
ref|XP_002125277.1|  PREDICTED: mortality factor 4-like protein 1     63.2    9e-09   
ref|XP_010457261.1|  PREDICTED: chromatin modification-related pr...  63.2    1e-08   
ref|XP_001840215.2|  hypothetical protein CC1G_02678                  63.5    1e-08   
ref|XP_010688528.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...  62.8    1e-08   
ref|XP_010688495.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...  62.8    1e-08   
ref|XP_010688510.1|  PREDICTED: nuA4 complex subunit EAF3 homolog...  62.8    1e-08   
gb|KIW06446.1|  hypothetical protein PV09_02890                       62.8    1e-08   
ref|XP_659580.1|  hypothetical protein AN1976.2                       62.8    1e-08   
ref|XP_006132154.1|  PREDICTED: mortality factor 4-like protein 1...  62.8    1e-08   
gb|KIM23965.1|  hypothetical protein M408DRAFT_76620                  62.8    1e-08   
ref|XP_006132155.1|  PREDICTED: mortality factor 4-like protein 1...  62.8    2e-08   
emb|CEP13820.1|  hypothetical protein                                 62.4    2e-08   
gb|KFY91591.1|  hypothetical protein V498_05394                       63.5    2e-08   
gb|EMG46254.1|  hypothetical protein G210_3506                        62.4    2e-08   
ref|XP_007502010.1|  PREDICTED: mortality factor 4-like protein 1...  62.8    2e-08   
gb|KFY55570.1|  hypothetical protein V496_06963                       63.5    2e-08   
gb|EFW21554.1|  histone acetylase complex subunit                     62.8    2e-08   
gb|KJA22704.1|  hypothetical protein HYPSUDRAFT_87295                 62.4    2e-08   
ref|XP_003065747.1|  MRG family protein                               62.8    2e-08   
ref|XP_004578359.1|  PREDICTED: mortality factor 4-like protein 1     61.2    2e-08   
emb|CCA70973.1|  related to Chromo domain protein MRG15               62.4    2e-08   
gb|KIK10220.1|  hypothetical protein K443DRAFT_143039                 62.4    2e-08   
dbj|GAD99776.1|  chromatin modification-related protein eaf3          62.4    2e-08   
gb|KDR72791.1|  hypothetical protein GALMADRAFT_252054                62.0    2e-08   
ref|XP_002341834.1|  histone acetylase complex subunit MRG15-2        62.0    2e-08   



>ref|XP_009789110.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X1 [Nicotiana 
sylvestris]
Length=315

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VLA+H+Q +Y+AKIQK  F   EW YFVHY GWNKNWDEW+GIDRLMK+TEEN+
Sbjct  36   FQEGERVLAFHSQQLYEAKIQKAEFQMREWRYFVHYLGWNKNWDEWVGIDRLMKLTEENI  95

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDV-QKDK  553
            +KQQEL  K D  K+ K  RGSQ+K K STG R +++K DV  KDK
Sbjct  96   QKQQELKKKQDTDKSSKGGRGSQMKTKGSTGGRGRKRKSDVPHKDK  141



>ref|XP_009609315.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=315

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE+VLA+H+Q +Y+AKIQK  F   EW YFVHY GWNKNWDEW+GIDRLMK+TEEN+
Sbjct  36   FQEGEKVLAFHSQQLYEAKIQKAEFQMREWRYFVHYLGWNKNWDEWVGIDRLMKLTEENI  95

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDV-QKDK  553
            +KQQEL  K D  K+ K  RGSQ+K K  TG R +++K DV QKDK
Sbjct  96   QKQQELKKKQDTDKSSKGGRGSQMKTKGYTGGRGRKRKSDVPQKDK  141



>ref|XP_006367419.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Solanum tuberosum]
Length=328

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLA+H+  +Y+AK+QK  +   EW YFVHY GWNK+WDEW+GIDRLMK T+EN+
Sbjct  50   FREGEKVLAFHSLQLYEAKVQKAVYHMREWRYFVHYLGWNKSWDEWVGIDRLMKHTQENV  109

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDK  553
            +KQQEL  K D  KNEKA RGSQ K K STG R +++K D+ KDK
Sbjct  110  QKQQELKKKQDTDKNEKAARGSQTKTKGSTGRRGRKRKSDIPKDK  154



>ref|XP_004238121.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Solanum lycopersicum]
Length=329

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLA+H+Q +Y+AK+QK  +   EW YFVHY GWNK+WDEW GIDRLMK TEEN+
Sbjct  50   FREGEKVLAFHSQQLYEAKVQKAVYQMREWRYFVHYLGWNKSWDEWAGIDRLMKHTEENV  109

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDV  541
            +KQQEL  K D  KNEKA RGSQ+K K STG R +++K DV
Sbjct  110  QKQQELKKKQDTDKNEKAARGSQMKTKGSTGKRGRKRKSDV  150



>ref|XP_002283618.1| PREDICTED: mortality factor 4-like protein 1 isoform X3 [Vitis 
vinifera]
 emb|CBI33766.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 75/102 (74%), Gaps = 2/102 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH   +Y+AK+QK  F K EW YFVHY GWNKNWDEW+G+DRLMK TEEN+
Sbjct  31   FSEGEKVLAYHGPRIYEAKVQKAEFRKKEWRYFVHYLGWNKNWDEWVGMDRLMKHTEENV  90

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
             KQQ L+ K   +KN K+ R +Q K K ST   AK +K+D++
Sbjct  91   LKQQALDKKQGAEKNPKSGRSAQAKPKSSTD--AKVEKEDLK  130



>ref|XP_010652767.1| PREDICTED: mortality factor 4-like protein 1 isoform X4 [Vitis 
vinifera]
Length=320

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 75/102 (74%), Gaps = 2/102 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH   +Y+AK+QK  F K EW YFVHY GWNKNWDEW+G+DRLMK TEEN+
Sbjct  31   FSEGEKVLAYHGPRIYEAKVQKAEFRKKEWRYFVHYLGWNKNWDEWVGMDRLMKHTEENV  90

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
             KQQ L+ K   +KN K+ R +Q K K ST   AK +K+D++
Sbjct  91   LKQQALDKKQGAEKNPKSGRSAQAKPKSSTD--AKVEKEDLK  130



>ref|XP_010652766.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Vitis 
vinifera]
Length=366

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 76/106 (72%), Gaps = 2/106 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH   +Y+AK+QK  F K EW YFVHY GWNKNWDEW+G+DRLMK TEEN+
Sbjct  31   FSEGEKVLAYHGPRIYEAKVQKAEFRKKEWRYFVHYLGWNKNWDEWVGMDRLMKHTEENV  90

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDKG  556
             KQQ L+ K   +KN K+ R +Q K K ST   AK +K+D++   G
Sbjct  91   LKQQALDKKQGAEKNPKSGRSAQAKPKSSTD--AKVEKEDLKSYDG  134



>ref|XP_010652764.1| PREDICTED: mortality factor 4-like protein 1 isoform X1 [Vitis 
vinifera]
 ref|XP_010652765.1| PREDICTED: mortality factor 4-like protein 1 isoform X1 [Vitis 
vinifera]
Length=367

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 76/106 (72%), Gaps = 2/106 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH   +Y+AK+QK  F K EW YFVHY GWNKNWDEW+G+DRLMK TEEN+
Sbjct  31   FSEGEKVLAYHGPRIYEAKVQKAEFRKKEWRYFVHYLGWNKNWDEWVGMDRLMKHTEENV  90

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDKG  556
             KQQ L+ K   +KN K+ R +Q K K ST   AK +K+D++   G
Sbjct  91   LKQQALDKKQGAEKNPKSGRSAQAKPKSSTD--AKVEKEDLKSYDG  134



>ref|XP_011074414.1| PREDICTED: mortality factor 4-like protein 1 isoform X3 [Sesamum 
indicum]
Length=286

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE+VLA+H  C+Y AK+QK  F   EW Y+VHY GWNK+WDEWLG+D L+K TEEN+
Sbjct  34   FQEGEQVLAFHGPCLYDAKVQKVEFHMEEWRYYVHYPGWNKHWDEWLGVDCLLKRTEENV  93

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQK  547
             KQ+EL  K+ + KN K  R SQ K K S G R K++K ++ K
Sbjct  94   CKQKELKEKHAVDKNAKLGRLSQDKTKNSIGVRGKKRKHEIIK  136



>ref|XP_010928390.1| PREDICTED: mortality factor 4-like protein 1 [Elaeis guineensis]
Length=324

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH   +Y+AK+QKT   K EW+YFVHY GW+KNWDEW+G DRLMK T EN+
Sbjct  37   FSEGEKVLAYHGPRIYEAKVQKTELRKDEWKYFVHYLGWSKNWDEWIGTDRLMKFTSENI  96

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
            RKQQEL  K +  KN K  R +Q K K S   +A ++
Sbjct  97   RKQQELAKKQNADKNPKPGRSTQYKPKGSNDAKADKE  133



>ref|XP_011074412.1| PREDICTED: mortality factor 4-like protein 1 isoform X1 [Sesamum 
indicum]
Length=309

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE+VLA+H  C+Y AK+QK  F   EW Y+VHY GWNK+WDEWLG+D L+K TEEN+
Sbjct  34   FQEGEQVLAFHGPCLYDAKVQKVEFHMEEWRYYVHYPGWNKHWDEWLGVDCLLKRTEENV  93

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQK  547
             KQ+EL  K+ + KN K  R SQ K K S G R K++K ++ K
Sbjct  94   CKQKELKEKHAVDKNAKLGRLSQDKTKNSIGVRGKKRKHEIIK  136



>ref|XP_011097238.1| PREDICTED: mortality factor 4-like protein 1 [Sesamum indicum]
Length=315

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH   +Y+AK+QK  F K EW YFVHY GWNKNWDEW+G+DRLMK TEEN+
Sbjct  29   FSEGEKVLAYHGPRIYEAKVQKAEFRKNEWRYFVHYLGWNKNWDEWVGMDRLMKHTEENI  88

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
            +KQQ L+ K  + KN K+ R +Q K K S   +  ++
Sbjct  89   QKQQALDKKAGVDKNTKSGRSAQTKPKGSADAKVDKE  125



>ref|XP_003550033.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Glycine max]
 gb|KHN27066.1| Mortality factor 4-like protein 1 [Glycine soja]
Length=319

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 77/102 (75%), Gaps = 2/102 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QKT   K+EW+YFVHY GW+KNWDEW+G +RLMK TEEN+
Sbjct  29   YSEGEKVLAYHGPRIYEAKVQKTEIRKSEWKYFVHYLGWSKNWDEWVGEERLMKHTEENV  88

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
             KQQ L+ K ++ KN K+ R SQ KAK ST   AK  K+DV+
Sbjct  89   LKQQALDKKQNVDKNVKSGRSSQGKAKISTD--AKMDKEDVK  128



>gb|KDP32001.1| hypothetical protein JCGZ_12462 [Jatropha curcas]
Length=318

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 71/107 (66%), Gaps = 2/107 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRL+K TEEN+
Sbjct  28   FSEGERVLAYHGPRIYEAKVQKAELRKKEWRYFVHYLGWNKNWDEWIGPDRLLKHTEENV  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR--QKKDVQKDK  553
             KQQ L NK  + K  K  R +Q K K ST  +A +  QK +V K K
Sbjct  88   MKQQALENKQGVDKTSKLGRSAQTKPKSSTDAKADKEDQKNNVGKGK  134



>ref|XP_009798553.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X2 [Nicotiana 
sylvestris]
Length=321

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRLMK TE+N+
Sbjct  27   YTEGEKVLAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGTDRLMKHTEDNV  86

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             KQQ L+ K  M+KN K+ R +Q K K S G  +   K D
Sbjct  87   LKQQALDKKQGMEKNTKSGRSAQAKPKSSAGVSSLDVKLD  126



>ref|XP_007155884.1| hypothetical protein PHAVU_003G239900g, partial [Phaseolus vulgaris]
 gb|ESW27878.1| hypothetical protein PHAVU_003G239900g, partial [Phaseolus vulgaris]
Length=213

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 75/102 (74%), Gaps = 2/102 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QKT   K+EW+YFVHY GW+KNWDEW+G DRLMK TEEN+
Sbjct  63   YSEGEKVLAYHGPRIYEAKVQKTEIRKSEWKYFVHYLGWSKNWDEWVGEDRLMKHTEENV  122

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
             KQ  L+ K ++ KN K+ R +Q K K  T T AK  K+DV+
Sbjct  123  MKQLALDKKQNVDKNVKSGRSTQAKGK--TSTDAKADKEDVK  162



>ref|XP_009798546.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X1 [Nicotiana 
sylvestris]
Length=322

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRLMK TE+N+
Sbjct  27   YTEGEKVLAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGTDRLMKHTEDNV  86

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             KQQ L+ K  M+KN K+ R +Q K K S G  +   K D
Sbjct  87   LKQQALDKKQGMEKNTKSGRSAQAKPKSSAGVSSLDVKLD  126



>ref|XP_009588508.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=322

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRLMK TE+N+
Sbjct  27   YTEGEKVLAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGTDRLMKHTEDNV  86

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             KQQ L+ K  M+KN K+ R +Q K K S G  +   K D
Sbjct  87   LKQQALDKKQGMEKNTKSGRSAQAKPKSSAGVSSLDVKLD  126



>ref|XP_009588509.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=321

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRLMK TE+N+
Sbjct  27   YTEGEKVLAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGTDRLMKHTEDNV  86

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             KQQ L+ K  M+KN K+ R +Q K K S G  +   K D
Sbjct  87   LKQQALDKKQGMEKNTKSGRSAQAKPKSSAGVSSLDVKLD  126



>ref|XP_010271232.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X2 [Nelumbo 
nucifera]
Length=309

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 73/102 (72%), Gaps = 2/102 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH   +Y+AK+ K    K EW+Y+VHY GW+KNWDEW+G+DRLMK TEEN+
Sbjct  31   FSEGEKVLAYHGPRIYEAKVLKVELGKKEWKYYVHYLGWSKNWDEWVGVDRLMKFTEENV  90

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQ L  +    KN K+ R +Q+K K S  T AK  K+DV+
Sbjct  91   RKQQTLEKRQGADKNPKSGRSTQIKPKNS--TDAKVDKEDVR  130



>ref|XP_010271225.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X1 [Nelumbo 
nucifera]
Length=321

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 73/102 (72%), Gaps = 2/102 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH   +Y+AK+ K    K EW+Y+VHY GW+KNWDEW+G+DRLMK TEEN+
Sbjct  31   FSEGEKVLAYHGPRIYEAKVLKVELGKKEWKYYVHYLGWSKNWDEWVGVDRLMKFTEENV  90

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQ L  +    KN K+ R +Q+K K S  T AK  K+DV+
Sbjct  91   RKQQTLEKRQGADKNPKSGRSTQIKPKNS--TDAKVDKEDVR  130



>ref|XP_006466542.1| PREDICTED: mortality factor 4-like protein 1-like isoform X2 
[Citrus sinensis]
Length=318

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH  C+Y+AK+QK    K EW Y+VHY GWNKNWDEW+G+DRL+K TEEN+
Sbjct  28   FSEGERVLAYHGPCIYEAKVQKAELRKKEWRYYVHYLGWNKNWDEWVGVDRLLKHTEENV  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L  K    ++ K+ R +Q K K ST  + +++
Sbjct  88   MKQQALQKKQGADRSSKSGRSAQTKQKSSTDVKVEKE  124



>ref|XP_006425992.1| hypothetical protein CICLE_v10026104mg [Citrus clementina]
 gb|ESR39232.1| hypothetical protein CICLE_v10026104mg [Citrus clementina]
 gb|KDO79063.1| hypothetical protein CISIN_1g021037mg [Citrus sinensis]
Length=318

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH  C+Y+AK+QK    K EW Y+VHY GWNKNWDEW+G+DRL+K TEEN+
Sbjct  28   FSEGERVLAYHGPCIYEAKVQKAELRKKEWRYYVHYLGWNKNWDEWVGVDRLLKHTEENV  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L  K    ++ K+ R +Q K K ST  + +++
Sbjct  88   MKQQALQKKQGADRSSKSGRSAQTKQKSSTDVKVEKE  124



>ref|XP_010526702.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X1 [Tarenaya 
hassleriana]
Length=320

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   VY+AKIQK    K EW+YFVHY GWNKNWDEW+G +RL+K TEEN+
Sbjct  29   FSEGERVLAYHGPRVYEAKIQKVELRKKEWKYFVHYLGWNKNWDEWVGAERLLKHTEENI  88

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCS  505
             KQQ LN K  ++KN K+ R +Q KAK S
Sbjct  89   MKQQALNKKQGVEKNTKSGRSAQAKAKSS  117



>ref|XP_003524665.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Glycine max]
Length=319

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 76/102 (75%), Gaps = 2/102 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K+EW+YFVHY GW+KNWDEW+G +RLMK TEEN+
Sbjct  29   YSEGEKVLAYHGPRIYEAKVQKAEIRKSEWKYFVHYLGWSKNWDEWVGEERLMKHTEENV  88

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
             KQQ L+ K ++ KN K+ R SQ KAK ST   AK  K+DV+
Sbjct  89   MKQQALDKKQNVDKNVKSGRSSQGKAKSSTD--AKMDKEDVK  128



>ref|XP_007047399.1| MRG family protein isoform 1 [Theobroma cacao]
 gb|EOX91556.1| MRG family protein isoform 1 [Theobroma cacao]
Length=313

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   +Y+AK+QK    K EW+YFVHY GWNKNWDEW+G DRLMK TEEN+
Sbjct  28   FSEGERVLAYHGPRIYEAKVQKAELRKKEWKYFVHYLGWNKNWDEWVGADRLMKHTEENV  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L+ K  + K+ K+ R +Q K K S   +A ++
Sbjct  88   IKQQALDKKQGVDKSSKSGRSAQTKPKSSADAKADKE  124



>ref|XP_010538132.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X3 [Tarenaya 
hassleriana]
Length=272

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            FE GE+VLA H+  +Y A++ K+ +   EW++FVHY GWNKNWDEW+G+DRLMK TEEN+
Sbjct  49   FEVGEKVLASHSSSIYDARVLKSDYRFKEWKFFVHYMGWNKNWDEWIGLDRLMKRTEENI  108

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
            +KQ+ELN K    KN  A R SQ+K +     R +++K+D
Sbjct  109  KKQEELNKKLGTLKNAMAWRVSQMKPRSPNVARGRKRKQD  148



>ref|XP_010538131.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X2 [Tarenaya 
hassleriana]
Length=290

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            FE GE+VLA H+  +Y A++ K+ +   EW++FVHY GWNKNWDEW+G+DRLMK TEEN+
Sbjct  49   FEVGEKVLASHSSSIYDARVLKSDYRFKEWKFFVHYMGWNKNWDEWIGLDRLMKRTEENI  108

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
            +KQ+ELN K    KN  A R SQ+K +     R +++K+D
Sbjct  109  KKQEELNKKLGTLKNAMAWRVSQMKPRSPNVARGRKRKQD  148



>ref|XP_009798562.1| PREDICTED: mortality factor 4-like protein 1 isoform X3 [Nicotiana 
sylvestris]
Length=317

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRLMK TE+N+
Sbjct  27   YTEGEKVLAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGTDRLMKHTEDNV  86

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ--KKDVQKDK  553
             KQQ L+ K  M+KN K+ R +Q K K S   +  ++  K +V K K
Sbjct  87   LKQQALDKKQGMEKNTKSGRSAQAKPKSSADVKLDKEDTKSNVPKGK  133



>ref|XP_009798569.1| PREDICTED: mortality factor 4-like protein 1 isoform X4 [Nicotiana 
sylvestris]
Length=316

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRLMK TE+N+
Sbjct  27   YTEGEKVLAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGTDRLMKHTEDNV  86

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ--KKDVQKDK  553
             KQQ L+ K  M+KN K+ R +Q K K S   +  ++  K +V K K
Sbjct  87   LKQQALDKKQGMEKNTKSGRSAQAKPKSSADVKLDKEDTKSNVPKGK  133



>ref|XP_010059757.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X4 [Eucalyptus 
grandis]
 gb|KCW66165.1| hypothetical protein EUGRSUZ_F00003 [Eucalyptus grandis]
Length=328

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + E E+VLA+H+  +Y+AK++K  +   EW Y+VHY GW+KNWDEW+G+DRLMK T+ENL
Sbjct  49   YAEEEKVLAFHSLHIYEAKVKKIEYRLKEWRYYVHYLGWSKNWDEWVGVDRLMKYTDENL  108

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD-VQKDKGV  559
            +KQ+ELNNK D +K+ K  R S  K K S   R K++K D + K+KG 
Sbjct  109  QKQRELNNKQDAEKSTKPSRVSYTKPKGSNVPRGKKRKHDSILKEKGA  156



>ref|XP_004287991.1| PREDICTED: mortality factor 4-like protein 1 [Fragaria vesca 
subsp. vesca]
Length=322

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 74/107 (69%), Gaps = 2/107 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE++LAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G+DR++K TEEN+
Sbjct  32   YSEGEKILAYHGPRIYEAKVQKAEIRKNEWRYFVHYLGWNKNWDEWVGVDRILKYTEENI  91

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR--QKKDVQKDK  553
             KQQ L+ K  + KN K+ R +  K K S   +A++  QK +V K K
Sbjct  92   MKQQALDKKQGVDKNTKSGRSAHTKPKSSADAKAEKEDQKNNVAKGK  138



>ref|XP_009588511.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X4 [Nicotiana 
tomentosiformis]
Length=316

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRLMK TE+N+
Sbjct  27   YTEGEKVLAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGTDRLMKHTEDNV  86

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ--KKDVQKDK  553
             KQQ L+ K  M+KN K+ R +Q K K S   +  ++  K +V K K
Sbjct  87   LKQQALDKKQGMEKNTKSGRSAQAKPKSSADVKLDKEDTKSNVPKGK  133



>ref|XP_009588510.1| PREDICTED: mortality factor 4-like protein 1 isoform X3 [Nicotiana 
tomentosiformis]
Length=317

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRLMK TE+N+
Sbjct  27   YTEGEKVLAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGTDRLMKHTEDNV  86

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ--KKDVQKDK  553
             KQQ L+ K  M+KN K+ R +Q K K S   +  ++  K +V K K
Sbjct  87   LKQQALDKKQGMEKNTKSGRSAQAKPKSSADVKLDKEDTKSNVPKGK  133



>ref|XP_009372446.1| PREDICTED: chromatin modification-related protein EAF3-like isoform 
X2 [Pyrus x bretschneideri]
Length=318

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE++LAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRL+K TE+N+
Sbjct  28   YSEGEKILAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGGDRLLKHTEDNI  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L+ K  + KN K+ R +Q K K ST  +A+++
Sbjct  88   LKQQALDKKQGVDKNTKSGRSAQTKPKISTDVKAEKE  124



>ref|XP_008361407.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X2 [Malus 
domestica]
Length=314

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE++LAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRL+K TE+N+
Sbjct  28   YSEGEKILAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGGDRLLKHTEDNI  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L+ K  + KN K+ R +Q K K ST  +A+++
Sbjct  88   LKQQALDKKQGVDKNTKSGRSAQTKPKISTDVKAEKE  124



>ref|XP_008361406.1| PREDICTED: mortality factor 4-like protein 1 isoform X1 [Malus 
domestica]
Length=317

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE++LAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRL+K TE+N+
Sbjct  28   YSEGEKILAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGGDRLLKHTEDNI  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L+ K  + KN K+ R +Q K K ST  +A+++
Sbjct  88   LKQQALDKKQGVDKNTKSGRSAQTKPKISTDVKAEKE  124



>ref|XP_010538130.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X1 [Tarenaya 
hassleriana]
Length=327

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            FE GE+VLA H+  +Y A++ K+ +   EW++FVHY GWNKNWDEW+G+DRLMK TEEN+
Sbjct  49   FEVGEKVLASHSSSIYDARVLKSDYRFKEWKFFVHYMGWNKNWDEWIGLDRLMKRTEENI  108

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
            +KQ+ELN K    KN  A R SQ+K +     R +++K+D
Sbjct  109  KKQEELNKKLGTLKNAMAWRVSQMKPRSPNVARGRKRKQD  148



>ref|XP_010059756.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X3 [Eucalyptus 
grandis]
 gb|KCW66166.1| hypothetical protein EUGRSUZ_F00003 [Eucalyptus grandis]
Length=334

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + E E+VLA+H+  +Y+AK++K  +   EW Y+VHY GW+KNWDEW+G+DRLMK T+ENL
Sbjct  49   YAEEEKVLAFHSLHIYEAKVKKIEYRLKEWRYYVHYLGWSKNWDEWVGVDRLMKYTDENL  108

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD-VQKDKGV  559
            +KQ+ELNNK D +K+ K  R S  K K S   R K++K D + K+KG 
Sbjct  109  QKQRELNNKQDAEKSTKPSRVSYTKPKGSNVPRGKKRKHDSILKEKGA  156



>ref|XP_009367673.1| PREDICTED: chromatin modification-related protein EAF3-like isoform 
X1 [Pyrus x bretschneideri]
Length=318

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE++LAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRL+K TE+N+
Sbjct  28   YSEGEKILAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGGDRLLKHTEDNI  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L+ K  + KN K+ R +Q K K ST  +A+++
Sbjct  88   LKQQALDKKQGVDKNTKSGRSAQTKPKSSTDVKAEKE  124



>ref|XP_008391514.1| PREDICTED: chromatin modification-related protein EAF3 isoform 
X3 [Malus domestica]
Length=318

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE++LAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRL+K TE+N+
Sbjct  28   YSEGEKILAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGGDRLLKHTEDNI  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L+ K  + KN K+ R +Q K K ST  +A+++
Sbjct  88   LKQQALDKKQGVDKNTKSGRSAQTKPKSSTDVKAEKE  124



>ref|XP_009367682.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X2 [Pyrus 
x bretschneideri]
Length=317

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE++LAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRL+K TE+N+
Sbjct  28   YSEGEKILAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGGDRLLKHTEDNI  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L+ K  + KN K+ R +Q K K ST  +A+++
Sbjct  88   LKQQALDKKQGVDKNTKSGRSAQTKPKSSTDVKAEKE  124



>ref|XP_009372445.1| PREDICTED: chromatin modification-related protein EAF3-like isoform 
X1 [Pyrus x bretschneideri]
Length=321

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE++LAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRL+K TE+N+
Sbjct  28   YSEGEKILAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGGDRLLKHTEDNI  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L+ K  + KN K+ R +Q K K ST  +A+++
Sbjct  88   LKQQALDKKQGVDKNTKSGRSAQTKPKISTDVKAEKE  124



>ref|XP_010059755.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X2 [Eucalyptus 
grandis]
Length=366

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + E E+VLA+H+  +Y+AK++K  +   EW Y+VHY GW+KNWDEW+G+DRLMK T+ENL
Sbjct  49   YAEEEKVLAFHSLHIYEAKVKKIEYRLKEWRYYVHYLGWSKNWDEWVGVDRLMKYTDENL  108

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD-VQKDKGV  559
            +KQ+ELNNK D +K+ K  R S  K K S   R K++K D + K+KG 
Sbjct  109  QKQRELNNKQDAEKSTKPSRVSYTKPKGSNVPRGKKRKHDSILKEKGA  156



>ref|XP_010059754.1| PREDICTED: chromatin modification-related protein EAF3-like isoform 
X1 [Eucalyptus grandis]
Length=372

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + E E+VLA+H+  +Y+AK++K  +   EW Y+VHY GW+KNWDEW+G+DRLMK T+ENL
Sbjct  49   YAEEEKVLAFHSLHIYEAKVKKIEYRLKEWRYYVHYLGWSKNWDEWVGVDRLMKYTDENL  108

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD-VQKDKGV  559
            +KQ+ELNNK D +K+ K  R S  K K S   R K++K D + K+KG 
Sbjct  109  QKQRELNNKQDAEKSTKPSRVSYTKPKGSNVPRGKKRKHDSILKEKGA  156



>ref|XP_008238734.1| PREDICTED: LOW QUALITY PROTEIN: nuA4 complex subunit EAF3 homolog 
[Prunus mume]
Length=321

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE++LAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRL+K TE+N+
Sbjct  28   YSEGEKILAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGGDRLLKNTEDNI  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L+ K  + KN K+ R +Q K K S+  +A+++
Sbjct  88   MKQQALDKKQGVDKNTKSGRSAQTKPKSSSDAKAEKE  124



>ref|XP_002524929.1| chromatin binding protein, putative [Ricinus communis]
 gb|EEF37426.1| chromatin binding protein, putative [Ricinus communis]
Length=318

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRL+K TEEN+
Sbjct  28   FSEGERVLAYHGPRIYEAKVQKAELRKKEWRYFVHYLGWNKNWDEWIGTDRLLKHTEENV  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L  K  + K+ K  R +Q K K ST  +  ++
Sbjct  88   VKQQALEKKQGVDKSSKLGRSAQTKPKTSTDAKVDKE  124



>ref|XP_011006990.1| PREDICTED: mortality factor 4-like protein 1 isoform X1 [Populus 
euphratica]
Length=317

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G+DRLMK T +N+
Sbjct  28   FSEGERVLAYHGPRIYEAKVQKAELRKKEWRYFVHYLGWNKNWDEWVGMDRLMKHTPDNV  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L  K  + K+ K  R SQ K K ST ++  ++
Sbjct  88   LKQQALEKKQGVDKSLKPGRSSQTKPKNSTDSKMDKE  124



>ref|XP_002310115.2| hypothetical protein POPTR_0007s10460g [Populus trichocarpa]
 ref|XP_006380685.1| MRG family protein [Populus trichocarpa]
 gb|EEE90565.2| hypothetical protein POPTR_0007s10460g [Populus trichocarpa]
 gb|ERP58482.1| MRG family protein [Populus trichocarpa]
Length=317

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G+DRLMK T +N+
Sbjct  28   FSEGERVLAYHGPRIYEAKVQKAELRKKEWRYFVHYLGWNKNWDEWVGMDRLMKHTPDNV  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L  K  + K+ K  R SQ K K ST ++  ++
Sbjct  88   LKQQALEKKQGVDKSLKPGRSSQTKPKNSTDSKMDKE  124



>ref|XP_011074413.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Sesamum 
indicum]
Length=306

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE+VLA+H  C+Y AK++   F   EW Y+VHY GWNK+WDEWLG+D L+K TEEN+
Sbjct  34   FQEGEQVLAFHGPCLYDAKVE---FHMEEWRYYVHYPGWNKHWDEWLGVDCLLKRTEENV  90

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQK  547
             KQ+EL  K+ + KN K  R SQ K K S G R K++K ++ K
Sbjct  91   CKQKELKEKHAVDKNAKLGRLSQDKTKNSIGVRGKKRKHEIIK  133



>ref|NP_568021.1| MRG family protein [Arabidopsis thaliana]
 gb|AAK59778.1| AT4g37280/C7A10_80 [Arabidopsis thaliana]
 gb|AAM98302.1| At4g37280/C7A10_80 [Arabidopsis thaliana]
 gb|AEE86776.1| MRG family protein [Arabidopsis thaliana]
Length=320

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 68/106 (64%), Gaps = 0/106 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   VY AK+QK    K EW+YFVHY GWNKNWDEW+  DRL+K TEENL
Sbjct  29   FSEGERVLAYHGPRVYGAKVQKVELRKKEWKYFVHYLGWNKNWDEWVSADRLLKHTEENL  88

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDKG  556
             KQ+ L+ K  ++K  K+ R +Q K + S  T+A +        KG
Sbjct  89   VKQKALDKKQGVEKGTKSGRSAQTKTRSSADTKADKDDTKTNAAKG  134



>ref|XP_002866959.1| MRG family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43218.1| MRG family protein [Arabidopsis lyrata subsp. lyrata]
Length=320

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 68/106 (64%), Gaps = 0/106 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   VY AK+QK    K EW+YFVHY GWNKNWDEW+  DRL+K TEENL
Sbjct  29   FSEGERVLAYHGPRVYGAKVQKVELRKKEWKYFVHYLGWNKNWDEWVSADRLLKHTEENL  88

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDKG  556
             KQ+ L+ K  ++K  K+ R +Q K + S  T+A +        KG
Sbjct  89   VKQKALDKKQGVEKGTKSGRSAQTKTRSSADTKADKDDTKTNAAKG  134



>ref|XP_004509101.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X2 [Cicer 
arietinum]
Length=317

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 72/102 (71%), Gaps = 2/102 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G  RLMK+TEEN+
Sbjct  28   YSEGEKVLAYHGPRIYEAKVQKAEIRKNEWRYFVHYLGWNKNWDEWVGESRLMKLTEENV  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
             KQ+ ++ K    KN K+ R +Q KAK ST   AK  K+DV+
Sbjct  88   VKQRSVDKKQGADKNVKSGRSNQAKAKSSTD--AKVDKEDVK  127



>ref|XP_009137560.1| PREDICTED: mortality factor 4-like protein 1 [Brassica rapa]
Length=322

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   VY AKIQK    K EW+YFVHY GWNKNWDEW+  DRL+K TEENL
Sbjct  29   FTEGERVLAYHGPRVYGAKIQKVELRKKEWKYFVHYLGWNKNWDEWVSADRLLKHTEENL  88

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR  526
             KQ+ L+ K  ++K  K+ R +Q K + S  T+A++
Sbjct  89   VKQKALDKKQGVEKGAKSGRSAQTKTRSSADTKAEK  124



>ref|XP_004509100.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X1 [Cicer 
arietinum]
Length=318

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 72/102 (71%), Gaps = 2/102 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G  RLMK+TEEN+
Sbjct  28   YSEGEKVLAYHGPRIYEAKVQKAEIRKNEWRYFVHYLGWNKNWDEWVGESRLMKLTEENV  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
             KQ+ ++ K    KN K+ R +Q KAK ST   AK  K+DV+
Sbjct  88   VKQRSVDKKQGADKNVKSGRSNQAKAKSSTD--AKVDKEDVK  127



>ref|XP_008391512.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X1 [Malus 
domestica]
Length=322

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE++LAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRL+K TE+N+
Sbjct  28   YSEGEKILAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGGDRLLKHTEDNI  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCST  508
             KQQ L+ K  + KN K+ R +Q K K ST
Sbjct  88   LKQQALDKKQGVDKNTKSGRSAQTKPKSST  117



>ref|XP_008391513.1| PREDICTED: chromatin modification-related protein EAF3 isoform 
X2 [Malus domestica]
Length=321

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE++LAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRL+K TE+N+
Sbjct  28   YSEGEKILAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGGDRLLKHTEDNI  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCST  508
             KQQ L+ K  + KN K+ R +Q K K ST
Sbjct  88   LKQQALDKKQGVDKNTKSGRSAQTKPKSST  117



>ref|XP_010943212.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Elaeis 
guineensis]
Length=326

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F +GE+VLAYH   +Y+AK+QK    K EW YFVHY GW+KNWDEW+G DRLMK T EN+
Sbjct  37   FSDGEKVLAYHGPRIYEAKVQKAELRKTEWRYFVHYLGWSKNWDEWVGTDRLMKFTPENV  96

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR  526
            RKQQEL    +  K  K+ R +Q K K S   +A +
Sbjct  97   RKQQELAKNQNADKIPKSGRSTQNKPKGSNDAKADK  132



>gb|EYU34553.1| hypothetical protein MIMGU_mgv1a010188mg [Erythranthe guttata]
Length=319

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 68/106 (64%), Gaps = 0/106 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLA+H   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRLMK TEEN+
Sbjct  29   FTEGEKVLAFHGPRIYEAKVQKAEIRKKEWRYFVHYLGWNKNWDEWVGKDRLMKHTEENI  88

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDKG  556
             KQQ ++ K  + KN K+ R +  K K S   +  + +      KG
Sbjct  89   LKQQAVDKKAGVDKNTKSGRSAHTKPKSSADAKVDKDEPKTTSAKG  134



>gb|KFK30353.1| hypothetical protein AALP_AA7G250500 [Arabis alpina]
Length=320

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   VY AK+QK    K EW+YFVHY GWNKNWDEW+  DRL+K TEENL
Sbjct  29   FSEGERVLAYHGPRVYGAKVQKVELRKKEWKYFVHYLGWNKNWDEWVSADRLLKHTEENL  88

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR  526
             KQ+ L+ K  ++K  K+ R +Q K + S  T+A++
Sbjct  89   VKQKALDKKQGVEKGTKSGRSAQTKTRSSADTKAEK  124



>ref|XP_010943214.1| PREDICTED: chromatin modification-related protein EAF3-like isoform 
X4 [Elaeis guineensis]
Length=307

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F +GE+VLAYH   +Y+AK+QK    K EW YFVHY GW+KNWDEW+G DRLMK T EN+
Sbjct  37   FSDGEKVLAYHGPRIYEAKVQKAELRKTEWRYFVHYLGWSKNWDEWVGTDRLMKFTPENV  96

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR  526
            RKQQEL    +  K  K+ R +Q K K S   +A +
Sbjct  97   RKQQELAKNQNADKIPKSGRSTQNKPKGSNDAKADK  132



>ref|XP_006411907.1| hypothetical protein EUTSA_v10025747mg [Eutrema salsugineum]
 gb|ESQ53360.1| hypothetical protein EUTSA_v10025747mg [Eutrema salsugineum]
Length=320

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   VY AK+QK    K EW+YFVHY GWNKNWDEW+  DRL+K TEENL
Sbjct  29   FSEGERVLAYHGPRVYGAKVQKVELRKKEWKYFVHYLGWNKNWDEWVSADRLLKHTEENL  88

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR  526
             KQ+ L+ K  ++K  K+ R +Q K + S  T+A++
Sbjct  89   VKQKALDKKQGVEKGTKSGRSAQTKTRSSADTKAEK  124



>ref|XP_006283983.1| hypothetical protein CARUB_v10005107mg, partial [Capsella rubella]
 gb|EOA16881.1| hypothetical protein CARUB_v10005107mg, partial [Capsella rubella]
Length=363

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   VY AK+QK    K EW+YFVHY GWNKNWDEW+  DRL+K TEENL
Sbjct  72   FTEGERVLAYHGPRVYGAKVQKVELRKKEWKYFVHYLGWNKNWDEWVSADRLLKHTEENL  131

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR  526
             KQ+ L+ K  ++K  K+ R +Q K + S  T+A++
Sbjct  132  VKQKALDKKQGVEKGTKSGRSAQTKTRSSADTKAEK  167



>ref|XP_002283143.2| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Vitis 
vinifera]
Length=305

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYHN  +Y AK+++  F   EW+YFVHY GW+KNWDEW+G+DRL+K +EEN+
Sbjct  41   FSEGEKVLAYHNLRIYPAKVRRIEFQMNEWKYFVHYLGWSKNWDEWVGMDRLLKFSEENV  100

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAK  499
            +KQ+ L  K  + KN K  R SQ+K K
Sbjct  101  QKQKALGKKQGIDKNTKPVRASQIKPK  127



>ref|XP_010664544.1| PREDICTED: mortality factor 4-like protein 1 isoform X1 [Vitis 
vinifera]
 emb|CBI19454.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYHN  +Y AK+++  F   EW+YFVHY GW+KNWDEW+G+DRL+K +EEN+
Sbjct  41   FSEGEKVLAYHNLRIYPAKVRRIEFQMNEWKYFVHYLGWSKNWDEWVGMDRLLKFSEENV  100

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAK  499
            +KQ+ L  K  + KN K  R SQ+K K
Sbjct  101  QKQKALGKKQGIDKNTKPVRASQIKPK  127



>ref|XP_006339844.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Solanum tuberosum]
Length=317

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = +2

Query  245  EGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENLRK  424
            EGE+VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRLMK TE+N+ K
Sbjct  29   EGEKVLAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGADRLMKHTEDNVLK  88

Query  425  QQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDKG  556
            QQ L+ K  M+K+ K+ R +  K K S   +  +++      KG
Sbjct  89   QQALDKKQGMEKSTKSGRSAPAKPKSSADVKLDKEETKSNVPKG  132



>ref|XP_010028169.1| PREDICTED: mortality factor 4-like protein 1 [Eucalyptus grandis]
Length=327

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLA+H   +Y+AK+QK    K EW+YFVHY GWNKNWDEW+G +RLMK TEEN+
Sbjct  35   FSEGEKVLAFHGPRIYEAKVQKAEVRKNEWKYFVHYLGWNKNWDEWVGPERLMKYTEENI  94

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L+ K  + KN K+ R +Q K K  T  +  ++
Sbjct  95   MKQQVLDKKQGVDKNPKSGRMTQNKPKSITDVKVDKE  131



>ref|XP_004231884.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Solanum lycopersicum]
Length=317

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = +2

Query  245  EGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENLRK  424
            EGE+VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G DRLMK TE+N+ K
Sbjct  29   EGEKVLAYHGPRIYEAKVQKAELRKNEWRYFVHYLGWNKNWDEWVGADRLMKHTEDNVLK  88

Query  425  QQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDKG  556
            QQ L+ K  M+K+ K+ R +  K K S   +  +++      KG
Sbjct  89   QQALDKKQGMEKSTKSGRSAPAKPKSSADVKLDKEETKSNVPKG  132



>ref|XP_010943213.1| PREDICTED: chromatin modification-related protein EAF3-like isoform 
X3 [Elaeis guineensis]
Length=324

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F +GE+VLAYH   +Y+AK+QK    K EW YFVHY GW+KNWDEW+G DRLMK T EN+
Sbjct  37   FSDGEKVLAYHGPRIYEAKVQKAELRKTEWRYFVHYLGWSKNWDEWVGTDRLMKFTPENV  96

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR  526
            RKQQEL    +  K  K+ R +Q K K S   +A +
Sbjct  97   RKQQELAKNQNADKIPKSGRSTQNKPKGSNDAKADK  132



>ref|XP_010943211.1| PREDICTED: chromatin modification-related protein EAF3-like isoform 
X1 [Elaeis guineensis]
Length=347

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F +GE+VLAYH   +Y+AK+QK    K EW YFVHY GW+KNWDEW+G DRLMK T EN+
Sbjct  37   FSDGEKVLAYHGPRIYEAKVQKAELRKTEWRYFVHYLGWSKNWDEWVGTDRLMKFTPENV  96

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR  526
            RKQQEL    +  K  K+ R +Q K K S   +A +
Sbjct  97   RKQQELAKNQNADKIPKSGRSTQNKPKGSNDAKADK  132



>ref|XP_008799564.1| PREDICTED: mortality factor 4-like protein 1 [Phoenix dactylifera]
Length=316

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH   +Y+AK+QK    K EW+YFVHY GW+KNWDEW+G DRLMK T EN+
Sbjct  28   FSEGEKVLAYHGPRIYEAKVQKAELRKDEWKYFVHYLGWSKNWDEWVGTDRLMKFTPENI  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQEL    +  +N K+ R +Q K K S   +A ++
Sbjct  88   CKQQELAKNQNADRNLKSGRSTQNKPKGSNDAKADKE  124



>ref|XP_006857433.1| hypothetical protein AMTR_s00067p00163830 [Amborella trichopoda]
 gb|ERN18900.1| hypothetical protein AMTR_s00067p00163830 [Amborella trichopoda]
Length=348

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH   +Y+AK+Q+    K EW+YFVHY GWNKNWDEW+  DRL+K+ EEN+
Sbjct  28   FSEGEKVLAYHGPLIYEAKVQRAEVRKKEWKYFVHYLGWNKNWDEWVTADRLLKINEENV  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
            ++QQEL       KN K  R +Q K K ST  + +++
Sbjct  88   QRQQELLKNKSTDKNIKLGRAAQSKPKSSTDAKVEKE  124



>gb|AFK35210.1| unknown [Medicago truncatula]
Length=161

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 2/102 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            +  GE+VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G  RLMK  +EN+
Sbjct  29   YSAGEKVLAYHGPRIYEAKVQKAEIGKNEWRYFVHYLGWNKNWDEWVGESRLMKHNDENV  88

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
             KQ+ L+ K  + KN K+ R +Q+KAK S    AK +K+D++
Sbjct  89   VKQRALDKKQGVDKNVKSGRSAQVKAKSSAD--AKVEKEDIK  128



>ref|XP_002510147.1| chromatin binding protein, putative [Ricinus communis]
 gb|EEF52334.1| chromatin binding protein, putative [Ricinus communis]
Length=341

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 77/108 (71%), Gaps = 3/108 (3%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            +E GE+VLAYH+Q +Y+AK+    +   EW+Y+VHY GWNKNWDEW+G++RLMK  +EN+
Sbjct  48   YEVGEKVLAYHSQQIYEAKVIIADYQSKEWQYYVHYPGWNKNWDEWVGVNRLMKYNDENV  107

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD-VQKDKGV  559
              Q+ L  K   +KN KA RGS +K K S+  R +++K D + K+KG+
Sbjct  108  --QKFLVTKQGQEKNTKAGRGSHIKPKSSSAARGRKRKSDSLSKEKGI  153



>ref|XP_008812831.1| PREDICTED: mortality factor 4-like protein 1 isoform X3 [Phoenix 
dactylifera]
Length=320

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 0/99 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH   +Y+AK+QK    K EW YFVHY GW+KNWDEW+G +RLMK T EN+
Sbjct  43   FSEGEKVLAYHGPRIYEAKVQKAEPRKDEWRYFVHYLGWSKNWDEWVGTNRLMKFTLENV  102

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKK  535
            RKQQEL       K  K+ R +Q K K S   + K++K 
Sbjct  103  RKQQELAKNQSADKIPKSGRSTQNKPKGSNAAKGKKRKP  141



>ref|XP_009396273.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=326

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH   +Y+AK+QK    K EW YFVHY GW+KNWDEW+G DRL+K+T+EN+
Sbjct  42   FVEGEKVLAYHGPLIYEAKVQKAELRKDEWRYFVHYLGWSKNWDEWVGTDRLLKLTDENI  101

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCS  505
             KQQ L    +  KN K+ R +Q K K S
Sbjct  102  HKQQALEKNQNTDKNPKSGRSTQNKPKDS  130



>ref|XP_009354150.1| PREDICTED: chromatin modification-related protein EAF3-like [Pyrus 
x bretschneideri]
Length=332

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 73/106 (69%), Gaps = 2/106 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+V+A+HN  +Y AK+   R+ K EWE++VHY GW+KNWDEW+G+DRLMK TEEN 
Sbjct  54   FAEGEKVIAFHNHRLYAAKVTNIRY-KMEWEFYVHYLGWSKNWDEWVGVDRLMKNTEENR  112

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD-VQKDK  553
            +KQ+ +  K    KN K +  SQ K K    +R K++K D V KDK
Sbjct  113  KKQEAIKQKQGTDKNAKLKHMSQTKPKSYHASRGKKRKNDSVNKDK  158



>ref|XP_010432070.1| PREDICTED: mortality factor 4-like protein 1 [Camelina sativa]
Length=320

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   VY AK+QK    K EW+YFVHY GWNKNWDEW+  DRL+K TEENL
Sbjct  29   FSEGERVLAYHGPRVYGAKVQKVELRKKEWKYFVHYLGWNKNWDEWVSTDRLLKHTEENL  88

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR  526
             KQ+ L  K   +K  K+ R +Q + + S  T+A +
Sbjct  89   VKQKALEKKQGTEKGSKSGRSAQTRTRSSADTKADK  124



>gb|KHN02628.1| Mortality factor 4-like protein 1 [Glycine soja]
Length=327

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 76/110 (69%), Gaps = 10/110 (9%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAK--------IQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRL  394
            + EGE+VLAYH   +Y+AK        +QK    K+EW+YFVHY GW+KNWDEW+G +RL
Sbjct  29   YSEGEKVLAYHGPRIYEAKASFTSPLPVQKAEIRKSEWKYFVHYLGWSKNWDEWVGEERL  88

Query  395  MKVTEENLRKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            MK TEEN+ KQQ L+ K ++ KN K+ R SQ KAK S  T AK  K+DV+
Sbjct  89   MKHTEENVMKQQALDKKQNVDKNVKSGRSSQGKAKSS--TDAKMDKEDVK  136



>ref|XP_010437242.1| PREDICTED: mortality factor 4-like protein 1 [Camelina sativa]
Length=320

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   VY AKIQK    K EW+YFVHY GWNKNWDEW+  DRL+K TEENL
Sbjct  29   FSEGERVLAYHGPRVYGAKIQKVELRKKEWKYFVHYLGWNKNWDEWVSTDRLLKHTEENL  88

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR  526
             KQ+ L  K   +K  K+ R +Q + + S  T+A +
Sbjct  89   VKQKALEKKRVAEKGTKSGRSAQTRTRSSADTKADK  124



>ref|XP_008377994.1| PREDICTED: chromatin modification-related protein EAF3-like [Malus 
domestica]
Length=332

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 72/106 (68%), Gaps = 2/106 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE V+A+HN  +Y AK+   R+ K EWE++VHY GW+KNWDEW+G+DRLMK TEEN 
Sbjct  54   FAEGERVIAFHNHRLYAAKVTNIRY-KMEWEFYVHYLGWSKNWDEWVGVDRLMKNTEENR  112

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD-VQKDK  553
            +KQ+ +  K    KN K +  SQ K K    +R K++K D V KDK
Sbjct  113  KKQEAIKQKQGADKNAKLKHMSQTKPKSYHASRGKKRKNDSVNKDK  158



>ref|XP_008812832.1| PREDICTED: mortality factor 4-like protein 1 isoform X4 [Phoenix 
dactylifera]
Length=297

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH   +Y+AK+QK    K EW YFVHY GW+KNWDEW+G +RLMK T EN+
Sbjct  43   FSEGEKVLAYHGPRIYEAKVQKAEPRKDEWRYFVHYLGWSKNWDEWVGTNRLMKFTLENV  102

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
            RKQQEL       K  K+ R +Q K K S   +A ++
Sbjct  103  RKQQELAKNQSADKIPKSGRSTQNKPKGSNDAKADKE  139



>ref|XP_008812829.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Phoenix 
dactylifera]
Length=323

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH   +Y+AK+QK    K EW YFVHY GW+KNWDEW+G +RLMK T EN+
Sbjct  43   FSEGEKVLAYHGPRIYEAKVQKAEPRKDEWRYFVHYLGWSKNWDEWVGTNRLMKFTLENV  102

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
            RKQQEL       K  K+ R +Q K K S   +A ++
Sbjct  103  RKQQELAKNQSADKIPKSGRSTQNKPKGSNDAKADKE  139



>ref|XP_008812828.1| PREDICTED: mortality factor 4-like protein 1 isoform X1 [Phoenix 
dactylifera]
Length=332

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH   +Y+AK+QK    K EW YFVHY GW+KNWDEW+G +RLMK T EN+
Sbjct  43   FSEGEKVLAYHGPRIYEAKVQKAEPRKDEWRYFVHYLGWSKNWDEWVGTNRLMKFTLENV  102

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
            RKQQEL       K  K+ R +Q K K S   +A ++
Sbjct  103  RKQQELAKNQSADKIPKSGRSTQNKPKGSNDAKADKE  139



>ref|XP_008452609.1| PREDICTED: mortality factor 4-like protein 1 isoform X3 [Cucumis 
melo]
Length=307

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 4/106 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLA+H+  +Y+AK+ KT +   EW  +VHY GW+K WDEW+G+DRL+K TEEN+
Sbjct  39   FSEGEKVLAFHSFVIYEAKVLKTEYQLKEWRCYVHYLGWSKTWDEWVGLDRLLKFTEENV  98

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDKG  556
            +KQQELN K    K  KA R S +K K     + K++K D  K+KG
Sbjct  99   QKQQELNEKRGTDK--KASRASHIKPK--NVVKGKKRKNDASKEKG  140



>ref|XP_008452608.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Cucumis 
melo]
Length=313

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 4/106 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLA+H+  +Y+AK+ KT +   EW  +VHY GW+K WDEW+G+DRL+K TEEN+
Sbjct  39   FSEGEKVLAFHSFVIYEAKVLKTEYQLKEWRCYVHYLGWSKTWDEWVGLDRLLKFTEENV  98

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDKG  556
            +KQQELN K    K  KA R S +K K     + K++K D  K+KG
Sbjct  99   QKQQELNEKRGTDK--KASRASHIKPK--NVVKGKKRKNDASKEKG  140



>ref|XP_004141278.1| PREDICTED: mortality factor 4-like protein 1-like [Cucumis sativus]
 ref|XP_004163239.1| PREDICTED: mortality factor 4-like protein 1-like [Cucumis sativus]
 gb|KGN55238.1| hypothetical protein Csa_4G641700 [Cucumis sativus]
Length=313

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 4/106 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLA+H+  +Y+AK+ KT +   EW  +VHY GW+K WDEW+G+DRL+K TEEN+
Sbjct  39   FSEGEKVLAFHSFVIYEAKVLKTEYQLKEWRCYVHYLGWSKTWDEWVGLDRLLKFTEENV  98

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDKG  556
            +KQQELN K    K  KA R S +K K     + K++K D  K+KG
Sbjct  99   QKQQELNEKRGTDK--KASRASHIKPK--NVVKGKKRKNDASKEKG  140



>ref|XP_008220281.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Prunus mume]
Length=322

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 70/105 (67%), Gaps = 2/105 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLA+H   +Y+AK+ K  F   EW ++VHY GW+KNWDEW+ +DRLMK T+EN+
Sbjct  47   FSEGEKVLAFHETQIYEAKVTKVDFKMNEWRFYVHYLGWSKNWDEWVHLDRLMKNTDENV  106

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDK  553
            RKQ++LN      KN K  R SQ K K S G   KR+   V KDK
Sbjct  107  RKQKQLNANQRTHKNAKLTRTSQTKQKVSRG--KKRKNDSVIKDK  149



>ref|XP_008452607.1| PREDICTED: mortality factor 4-like protein 1 isoform X1 [Cucumis 
melo]
Length=315

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 4/106 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLA+H+  +Y+AK+ KT +   EW  +VHY GW+K WDEW+G+DRL+K TEEN+
Sbjct  39   FSEGEKVLAFHSFVIYEAKVLKTEYQLKEWRCYVHYLGWSKTWDEWVGLDRLLKFTEENV  98

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDKG  556
            +KQQELN K    K  KA R S +K K     + K++K D  K+KG
Sbjct  99   QKQQELNEKRGTDK--KASRASHIKPK--NVVKGKKRKNDASKEKG  140



>ref|XP_010446680.1| PREDICTED: mortality factor 4-like protein 1 [Camelina sativa]
Length=320

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   VY AK+QK    K EW+YFVHY GWNKNWDEW+  DRL+K TEENL
Sbjct  29   FSEGERVLAYHGPRVYGAKVQKVELRKKEWKYFVHYLGWNKNWDEWVSADRLLKHTEENL  88

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR  526
             KQ+ L  K   +K  K+ R +Q + + S  ++A +
Sbjct  89   VKQKALEKKQVSEKGTKSGRSAQTRTRSSADSKADK  124



>ref|XP_004952261.1| PREDICTED: mortality factor 4-like protein 1-like isoform X2 
[Setaria italica]
Length=321

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EG+ VLAYH   +Y+AK+Q+   ++ EW YFVHY GWNKNWDEW+  DRL+K+TEEN+
Sbjct  34   FKEGDRVLAYHGPLLYEAKVQRIENLEDEWRYFVHYLGWNKNWDEWVANDRLLKLTEENV  93

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR  526
            RKQQEL     + K+ K+ R +Q K K +   +A +
Sbjct  94   RKQQELEKNQVVDKSMKSGRSTQHKLKGANDAKADK  129



>gb|KEH31493.1| chromatin-binding protein [Medicago truncatula]
Length=319

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 2/102 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            +  GE+VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+G  RLMK  +EN+
Sbjct  29   YSAGEKVLAYHGPRIYEAKVQKAEIRKNEWRYFVHYLGWNKNWDEWVGESRLMKHNDENV  88

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
             KQ+ L+ K  + KN K+ R +Q+KAK S    AK +K+D++
Sbjct  89   VKQRALDKKQGVDKNVKSGRSAQVKAKSSAD--AKVEKEDIK  128



>gb|KJB40286.1| hypothetical protein B456_007G055700 [Gossypium raimondii]
Length=319

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   +Y+AK+QK    K EW+YFVHY GWNKNWDEW+G DRLMK+TEEN+
Sbjct  28   FSEGERVLAYHGPRIYEAKVQKAELRKKEWKYFVHYLGWNKNWDEWVGADRLMKLTEENV  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L+ K  + K+ K+ R SQ K K S   +A ++
Sbjct  88   MKQQALDKKQGVDKSSKSGRSSQSKPKSSADAKADKE  124



>gb|KJB40289.1| hypothetical protein B456_007G055700 [Gossypium raimondii]
Length=318

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   +Y+AK+QK    K EW+YFVHY GWNKNWDEW+G DRLMK+TEEN+
Sbjct  28   FSEGERVLAYHGPRIYEAKVQKAELRKKEWKYFVHYLGWNKNWDEWVGADRLMKLTEENV  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L+ K  + K+ K+ R SQ K K S   +A ++
Sbjct  88   MKQQALDKKQGVDKSSKSGRSSQSKPKSSADAKADKE  124



>emb|CAB16772.1| putative protein [Arabidopsis thaliana]
 emb|CAB80394.1| putative protein [Arabidopsis thaliana]
Length=327

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 68/113 (60%), Gaps = 7/113 (6%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKI-------QKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLM  397
            F EGE VLAYH   VY AKI       QK    K EW+YFVHY GWNKNWDEW+  DRL+
Sbjct  29   FSEGERVLAYHGPRVYGAKIIDIPLQVQKVELRKKEWKYFVHYLGWNKNWDEWVSADRLL  88

Query  398  KVTEENLRKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDKG  556
            K TEENL KQ+ L+ K  ++K  K+ R +Q K + S  T+A +        KG
Sbjct  89   KHTEENLVKQKALDKKQGVEKGTKSGRSAQTKTRSSADTKADKDDTKTNAAKG  141



>ref|XP_004952260.1| PREDICTED: mortality factor 4-like protein 1-like isoform X1 
[Setaria italica]
Length=322

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 70/102 (69%), Gaps = 1/102 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EG+ VLAYH   +Y+AK+Q+   ++ EW YFVHY GWNKNWDEW+  DRL+K+TEEN+
Sbjct  34   FKEGDRVLAYHGPLLYEAKVQRIENLEDEWRYFVHYLGWNKNWDEWVANDRLLKLTEENV  93

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQEL     + K+ K+ R +Q K K +    AK  K D +
Sbjct  94   RKQQELEKNQVVDKSMKSGRSTQHKLKGANAD-AKADKDDTK  134



>gb|AFW70857.1| hypothetical protein ZEAMMB73_236054 [Zea mays]
Length=197

 Score =   103 bits (258),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+E E VLAYH   +Y+AK+Q+    + EW YFVHY GWNKNWDEW+  DRL+++TEEN+
Sbjct  35   FKENERVLAYHGPLLYEAKVQRIENHEDEWRYFVHYLGWNKNWDEWVANDRLLELTEENV  94

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQEL+    + K  K+ R +Q K K S    AK  K D +
Sbjct  95   RKQQELDKNQVVDKTMKSGRSTQHKPKVSNAD-AKADKDDTK  135



>gb|AFW70859.1| hypothetical protein ZEAMMB73_236054 [Zea mays]
Length=181

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+E E VLAYH   +Y+AK+Q+    + EW YFVHY GWNKNWDEW+  DRL+++TEEN+
Sbjct  35   FKENERVLAYHGPLLYEAKVQRIENHEDEWRYFVHYLGWNKNWDEWVANDRLLELTEENV  94

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQEL+    + K  K+ R +Q K K S    AK  K D +
Sbjct  95   RKQQELDKNQVVDKTMKSGRSTQHKPKVSNAD-AKADKDDTK  135



>ref|XP_010239670.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Brachypodium 
distachyon]
Length=314

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 67/101 (66%), Gaps = 0/101 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EG+ VLAYH   +Y+AK+QKT   + EW YFVHY GWNKNWDEW+  DRL+K++E+N+
Sbjct  26   FMEGDRVLAYHGPLLYEAKVQKTENREDEWRYFVHYLGWNKNWDEWVASDRLLKLSEDNV  85

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDV  541
            RKQQEL     + K  K+ R +Q   K S   +A ++   V
Sbjct  86   RKQQELQKNQTVDKTIKSGRSAQHNPKGSNEPKADKEDTKV  126



>gb|ABK26286.1| unknown [Picea sitchensis]
Length=280

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 71/102 (70%), Gaps = 3/102 (3%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE+VLAYH   +Y+AK+Q+    K EW+Y+VHY GW+KNWDEW+G DRLM  TEEN+
Sbjct  46   FKEGEKVLAYHGPLIYEAKVQRAELRKKEWKYYVHYLGWSKNWDEWVGADRLMHFTEENV  105

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQ L      +  +K+ +G   ++K  + T  K +K+DV+
Sbjct  106  RKQQGL---LKNQSGDKSFKGRISQSKPRSSTDVKVEKEDVK  144



>gb|KJB40290.1| hypothetical protein B456_007G055700 [Gossypium raimondii]
Length=343

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH   +Y+AK+QK    K EW+YFVHY GWNKNWDEW+G DRLMK+TEEN+
Sbjct  28   FSEGERVLAYHGPRIYEAKVQKAELRKKEWKYFVHYLGWNKNWDEWVGADRLMKLTEENV  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQQ L+ K  + K+ K+ R SQ K K S   +A ++
Sbjct  88   MKQQALDKKQGVDKSSKSGRSSQSKPKSSADAKADKE  124



>ref|XP_010679547.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679548.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Beta vulgaris subsp. 
vulgaris]
Length=317

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K EW YFVHY GWNKNWDEW+  DRLMK+T+EN+
Sbjct  33   YSEGEKVLAYHGPRIYEAKVQKIETRKKEWRYFVHYLGWNKNWDEWVSADRLMKITDENI  92

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAK  499
            +KQ  L  K    K+ K+ R +Q K K
Sbjct  93   QKQLALEKKLGADKHHKSGRSAQTKPK  119



>ref|XP_002975945.1| hypothetical protein SELMODRAFT_228384 [Selaginella moellendorffii]
 gb|EFJ22850.1| hypothetical protein SELMODRAFT_228384 [Selaginella moellendorffii]
Length=288

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 71/105 (68%), Gaps = 2/105 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F++G++VLAYH   +Y+AKIQK    K EW+YFVHY GW+KNWDEW+G +RL+ + EENL
Sbjct  24   FKDGDKVLAYHGPLIYEAKIQKAELRKNEWKYFVHYLGWSKNWDEWIGEERLLPLNEENL  83

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK-RQKKDVQKD  550
             KQ+ L N     K  K R G Q K K +T T  K R++K  +KD
Sbjct  84   EKQKHLVNTQAADKRGKGRMG-QGKPKGATSTATKGRKRKSEEKD  127



>ref|XP_001784474.1| predicted protein [Physcomitrella patens]
 gb|EDQ50687.1| predicted protein [Physcomitrella patens]
Length=297

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 67/111 (60%), Gaps = 11/111 (10%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE+VLAYH   VY  KIQK  F K EW+YFVHY GW+KNWDEW+G DRLMK TE NL
Sbjct  19   FKEGEKVLAYHGPLVYDTKIQKAEFQKNEWKYFVHYLGWSKNWDEWVGADRLMKPTEGNL  78

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCS-----------TGTRAKRQKKD  538
             KQ++L       K  K R  +  +   S           +GTR K++K D
Sbjct  79   EKQKKLFKSQTGDKQSKGRVPAGKQKSASERDELKNENKLSGTRGKKRKSD  129



>ref|XP_008440326.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Cucumis 
melo]
Length=316

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 70/106 (66%), Gaps = 1/106 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K EW YF+HY GWNKNWDEW+ +DRLMK T+EN 
Sbjct  28   YSEGEKVLAYHGPRIYEAKVQKVELRKKEWRYFLHYLGWNKNWDEWVSVDRLMKCTDENR  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDKG  556
             KQ+ L   Y ++K+ K+ R +Q K K  T  R ++++      KG
Sbjct  88   LKQRALEKGY-VEKSSKSGRSAQAKPKNLTDARVEKEEHKNNAPKG  132



>gb|KEH35756.1| chromatin-binding protein [Medicago truncatula]
Length=314

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 68/100 (68%), Gaps = 3/100 (3%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            ++EGE+V AYH  C+Y+AK+++  +    W +F+HY GW K WDEW+GIDRLMK TEEN+
Sbjct  32   YDEGEKVFAYHTSCLYEAKVKQIEYKHKRWSFFLHYLGWKKTWDEWVGIDRLMKHTEENM  91

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
            R +  L+ KY   KN +  RGS   +K S   R++++K D
Sbjct  92   RIKLALDEKYGNDKNARKPRGS---SKSSNVARSRKRKND  128



>gb|KEH35759.1| chromatin-binding protein [Medicago truncatula]
Length=282

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 68/100 (68%), Gaps = 3/100 (3%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            ++EGE+V AYH  C+Y+AK+++  +    W +F+HY GW K WDEW+GIDRLMK TEEN+
Sbjct  32   YDEGEKVFAYHTSCLYEAKVKQIEYKHKRWSFFLHYLGWKKTWDEWVGIDRLMKHTEENM  91

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
            R +  L+ KY   KN +  RGS   +K S   R++++K D
Sbjct  92   RIKLALDEKYGNDKNARKPRGS---SKSSNVARSRKRKND  128



>ref|XP_001759805.1| predicted protein [Physcomitrella patens]
 gb|EDQ75309.1| predicted protein [Physcomitrella patens]
Length=303

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE+VLAYH   +Y  KIQK  F K EW+YFVHY GW+KNWDEW+G DRLMK TEENL
Sbjct  25   FKEGEKVLAYHGPLIYDTKIQKAEFRKKEWKYFVHYLGWSKNWDEWVGADRLMKPTEENL  84

Query  419  RKQQEL  436
             KQ++L
Sbjct  85   EKQKKL  90



>ref|XP_008440325.1| PREDICTED: mortality factor 4-like protein 1 isoform X1 [Cucumis 
melo]
Length=319

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K EW YF+HY GWNKNWDEW+ +DRLMK T+EN 
Sbjct  28   YSEGEKVLAYHGPRIYEAKVQKVELRKKEWRYFLHYLGWNKNWDEWVSVDRLMKCTDENR  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQ+ L   Y ++K+ K+ R +Q K K  T  R +++
Sbjct  88   LKQRALEKGY-VEKSSKSGRSAQAKPKNLTDARVEKE  123



>gb|AFW70858.1| hypothetical protein ZEAMMB73_236054 [Zea mays]
Length=326

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+E E VLAYH   +Y+AK+Q+    + EW YFVHY GWNKNWDEW+  DRL+++TEEN+
Sbjct  35   FKENERVLAYHGPLLYEAKVQRIENHEDEWRYFVHYLGWNKNWDEWVANDRLLELTEENV  94

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQEL+    + K  K+ R +Q K K S    AK  K D +
Sbjct  95   RKQQELDKNQVVDKTMKSGRSTQHKPKVSNAD-AKADKDDTK  135



>ref|XP_008643706.1| PREDICTED: LOC100282973 isoform X7 [Zea mays]
Length=328

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+E E VLAYH   +Y+AK+Q+    + EW YFVHY GWNKNWDEW+  DRL+++TEEN+
Sbjct  35   FKENERVLAYHGPLLYEAKVQRIENHEDEWRYFVHYLGWNKNWDEWVANDRLLELTEENV  94

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQEL+    + K  K+ R +Q K K S    AK  K D +
Sbjct  95   RKQQELDKNQVVDKTMKSGRSTQHKPKVSNAD-AKADKDDTK  135



>ref|XP_008643707.1| PREDICTED: LOC100282973 isoform X8 [Zea mays]
 gb|AFW70860.1| hypothetical protein ZEAMMB73_236054 [Zea mays]
Length=312

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+E E VLAYH   +Y+AK+Q+    + EW YFVHY GWNKNWDEW+  DRL+++TEEN+
Sbjct  35   FKENERVLAYHGPLLYEAKVQRIENHEDEWRYFVHYLGWNKNWDEWVANDRLLELTEENV  94

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQEL+    + K  K+ R +Q K K S    AK  K D +
Sbjct  95   RKQQELDKNQVVDKTMKSGRSTQHKPKVSNAD-AKADKDDTK  135



>ref|NP_001149349.1| LOC100282973 [Zea mays]
 gb|ACG35128.1| chromatin modification-related protein EAF3 [Zea mays]
 gb|AFW70861.1| chromatin modification protein EAF3 [Zea mays]
Length=326

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+E E VLAYH   +Y+AK+Q+    + EW YFVHY GWNKNWDEW+  DRL+++TEEN+
Sbjct  35   FKENERVLAYHGPLLYEAKVQRIENHEDEWRYFVHYLGWNKNWDEWVANDRLLELTEENV  94

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQEL+    + K  K+ R +Q K K S    AK  K D +
Sbjct  95   RKQQELDKNQVVDKTMKSGRSTQHKPKVSNAD-AKADKDDTK  135



>ref|XP_010239669.1| PREDICTED: mortality factor 4-like protein 1 isoform X1 [Brachypodium 
distachyon]
Length=315

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EG+ VLAYH   +Y+AK+QKT   + EW YFVHY GWNKNWDEW+  DRL+K++E+N+
Sbjct  26   FMEGDRVLAYHGPLLYEAKVQKTENREDEWRYFVHYLGWNKNWDEWVASDRLLKLSEDNV  85

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTG  511
            RKQQEL     + K  K+ R +Q   K S  
Sbjct  86   RKQQELQKNQTVDKTIKSGRSAQHNPKGSNA  116



>ref|XP_008643700.1| PREDICTED: LOC100282973 isoform X1 [Zea mays]
Length=349

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+E E VLAYH   +Y+AK+Q+    + EW YFVHY GWNKNWDEW+  DRL+++TEEN+
Sbjct  35   FKENERVLAYHGPLLYEAKVQRIENHEDEWRYFVHYLGWNKNWDEWVANDRLLELTEENV  94

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQEL+    + K  K+ R +Q K K S    AK  K D +
Sbjct  95   RKQQELDKNQVVDKTMKSGRSTQHKPKVSNAD-AKADKDDTK  135



>ref|XP_008643705.1| PREDICTED: LOC100282973 isoform X6 [Zea mays]
Length=331

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+E E VLAYH   +Y+AK+Q+    + EW YFVHY GWNKNWDEW+  DRL+++TEEN+
Sbjct  35   FKENERVLAYHGPLLYEAKVQRIENHEDEWRYFVHYLGWNKNWDEWVANDRLLELTEENV  94

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQEL+    + K  K+ R +Q K K S    AK  K D +
Sbjct  95   RKQQELDKNQVVDKTMKSGRSTQHKPKVSNAD-AKADKDDTK  135



>ref|XP_008643702.1| PREDICTED: LOC100282973 isoform X3 [Zea mays]
Length=347

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+E E VLAYH   +Y+AK+Q+    + EW YFVHY GWNKNWDEW+  DRL+++TEEN+
Sbjct  35   FKENERVLAYHGPLLYEAKVQRIENHEDEWRYFVHYLGWNKNWDEWVANDRLLELTEENV  94

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQEL+    + K  K+ R +Q K K S    AK  K D +
Sbjct  95   RKQQELDKNQVVDKTMKSGRSTQHKPKVSNAD-AKADKDDTK  135



>ref|XP_008643701.1| PREDICTED: LOC100282973 isoform X2 [Zea mays]
Length=348

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+E E VLAYH   +Y+AK+Q+    + EW YFVHY GWNKNWDEW+  DRL+++TEEN+
Sbjct  35   FKENERVLAYHGPLLYEAKVQRIENHEDEWRYFVHYLGWNKNWDEWVANDRLLELTEENV  94

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQEL+    + K  K+ R +Q K K S    AK  K D +
Sbjct  95   RKQQELDKNQVVDKTMKSGRSTQHKPKVSNAD-AKADKDDTK  135



>ref|XP_008643704.1| PREDICTED: LOC100282973 isoform X5 [Zea mays]
Length=333

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+E E VLAYH   +Y+AK+Q+    + EW YFVHY GWNKNWDEW+  DRL+++TEEN+
Sbjct  35   FKENERVLAYHGPLLYEAKVQRIENHEDEWRYFVHYLGWNKNWDEWVANDRLLELTEENV  94

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQEL+    + K  K+ R +Q K K S    AK  K D +
Sbjct  95   RKQQELDKNQVVDKTMKSGRSTQHKPKVSNAD-AKADKDDTK  135



>ref|XP_006652068.1| PREDICTED: mortality factor 4-like protein 1-like [Oryza brachyantha]
Length=320

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VLAYH   +Y+AK+QK+   + EW Y VHY GW+K+WDEW+  DRL+K+TEEN+
Sbjct  31   FKEGERVLAYHGPLLYEAKVQKSENKEDEWRYHVHYLGWSKSWDEWVTNDRLLKLTEENI  90

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQEL       K+ K+ R SQ K K S    AK  K+D +
Sbjct  91   RKQQELEKSQSADKSVKSGRSSQHKPKGSND--AKTDKEDTK  130



>gb|KDP41674.1| hypothetical protein JCGZ_16081 [Jatropha curcas]
Length=317

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 67/100 (67%), Gaps = 2/100 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            FE GE+VLA+HN   Y+AK+ K  +    W+YFVHY GWNK WDEW+G+ RLMK  +EN+
Sbjct  40   FEVGEKVLAFHNHLPYEAKVIKAEYQLNGWKYFVHYPGWNKYWDEWVGVKRLMKHNDENV  99

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
              QQ L  K D++K  KA R S +K K S+  R K++K D
Sbjct  100  --QQFLKKKQDLEKTAKAGRASHIKPKSSSVPRGKKRKGD  137



>gb|EPS71371.1| hypothetical protein M569_03388, partial [Genlisea aurea]
Length=321

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 65/103 (63%), Gaps = 11/103 (11%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAK----------IQKTRFVKAEWEYFVHYTGWNKNWDEWLGID  388
            F EGE+VLAYH   +Y+AK          +QK    K EW Y+VHY GWNKNWDEW+G D
Sbjct  29   FSEGEKVLAYHGPRIYEAKAFHYSPLLLRVQKAEVRKNEWRYYVHYLGWNKNWDEWVGPD  88

Query  389  RLMKVTEENLRKQQELNNKYD-MKKNEKARRGSQLKAKCSTGT  514
            RLMK TEEN+ KQQ L+ K   + KN K+ R +Q K K  TG 
Sbjct  89   RLMKHTEENILKQQALDKKVGVVDKNSKSGRPAQPKGKALTGI  131



>ref|XP_002968541.1| hypothetical protein SELMODRAFT_270711 [Selaginella moellendorffii]
 gb|EFJ30795.1| hypothetical protein SELMODRAFT_270711 [Selaginella moellendorffii]
Length=288

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 71/105 (68%), Gaps = 2/105 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F++G++VLAYH   +Y+AKIQK    K EW+YFVHY GW+KNWDEW+G +RL+ + EENL
Sbjct  24   FKDGDKVLAYHGPLIYEAKIQKAELRKNEWKYFVHYLGWSKNWDEWIGEERLLPLNEENL  83

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK-RQKKDVQKD  550
             KQ+ L N     K  K R  +Q K K +T T  K R++K  +KD
Sbjct  84   EKQKHLVNTQAADKRGKGRM-AQGKPKGATSTATKGRKRKSEEKD  127



>emb|CDX69290.1| BnaC01g01630D [Brassica napus]
Length=209

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 5/96 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH       +IQK    K EW+YFVHY GWNKNWDEW+  DRL+K TEENL
Sbjct  29   FTEGERVLAYHG-----PRIQKVELRKKEWKYFVHYLGWNKNWDEWVSADRLLKHTEENL  83

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR  526
             KQ+ L+ K  ++K  K+ R +Q K + S  T+A++
Sbjct  84   VKQKALDKKQGVEKGAKSGRSAQTKTRSSADTKAEK  119



>ref|XP_008643703.1| PREDICTED: LOC100282973 isoform X4 [Zea mays]
Length=342

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+E E VLAYH   +Y+AK+Q+    + EW YFVHY GWNKNWDEW+  DRL+++TEEN+
Sbjct  35   FKENERVLAYHGPLLYEAKVQRIENHEDEWRYFVHYLGWNKNWDEWVANDRLLELTEENV  94

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            RKQQEL+    + K  K+ R +Q K K S    AK  K D +
Sbjct  95   RKQQELDKNQVVDKTMKSGRSTQHKPKVSNAD-AKADKDDTK  135



>gb|EEC68323.1| hypothetical protein OsI_36419 [Oryza sativa Indica Group]
Length=278

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 69/101 (68%), Gaps = 2/101 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VLAYH   +Y+AK+QK+   + EW Y VHY GWNK+WDEW+  DRL+K+T+EN+
Sbjct  16   FKEGERVLAYHGPLLYEAKVQKSENKEDEWRYHVHYLGWNKSWDEWVTNDRLLKLTDENI  75

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDV  541
            RKQQEL     + K+ K+ R +Q K K S    AK  K+D 
Sbjct  76   RKQQELEKSQVVDKSVKSGRSAQHKPKGSND--AKTDKEDT  114



>gb|ABA94215.2| MRG family protein, putative, expressed [Oryza sativa Japonica 
Group]
Length=305

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 69/101 (68%), Gaps = 2/101 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VLAYH   +Y+AK+QK+   + EW Y VHY GWNK+WDEW+  DRL+K+T+EN+
Sbjct  16   FKEGERVLAYHGPLLYEAKVQKSENKEDEWRYHVHYLGWNKSWDEWVTNDRLLKLTDENI  75

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDV  541
            RKQQEL     + K+ K+ R +Q K K S    AK  K+D 
Sbjct  76   RKQQELEKSQVVDKSVKSGRSAQHKPKGSND--AKTDKEDT  114



>gb|KFK42627.1| hypothetical protein AALP_AA1G019800 [Arabis alpina]
Length=332

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            FEEGE+V A H+ C Y+AKI K      EW+YFVHY GWNKNWDEW+G+D LMK TEEN+
Sbjct  53   FEEGEKVFAKHSDCFYEAKIIKVENQVNEWKYFVHYIGWNKNWDEWIGMDCLMKHTEENI  112

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             KQ+EL  K    K+  A + +++K KC    R +++K++
Sbjct  113  EKQRELGMKQG-GKSAMAWKVTKMKPKCPNVARGRKRKQE  151



>emb|CDX75637.1| BnaA01g00650D [Brassica napus]
Length=317

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 5/96 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE VLAYH       +IQK    K EW+YFVHY GWNKNWDEW+  DRL+K TEENL
Sbjct  29   FTEGERVLAYHG-----PRIQKVELRKKEWKYFVHYLGWNKNWDEWVSADRLLKHTEENL  83

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKR  526
             KQ+ L+ K  ++K  K+ R +Q K + S  T+A++
Sbjct  84   VKQKALDKKQGVEKGAKSGRSAQTKTRSSADTKAEK  119



>gb|EEE52246.1| hypothetical protein OsJ_34189 [Oryza sativa Japonica Group]
Length=433

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 69/101 (68%), Gaps = 2/101 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VLAYH   +Y+AK+QK+   + EW Y VHY GWNK+WDEW+  DRL+K+T+EN+
Sbjct  144  FKEGERVLAYHGPLLYEAKVQKSENKEDEWRYHVHYLGWNKSWDEWVTNDRLLKLTDENI  203

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDV  541
            RKQQEL     + K+ K+ R +Q K K S    AK  K+D 
Sbjct  204  RKQQELEKSQVVDKSVKSGRSAQHKPKGSND--AKTDKEDT  242



>ref|XP_009396272.1| PREDICTED: chromatin modification-related protein EAF3 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=332

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 62/95 (65%), Gaps = 6/95 (6%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKN------WDEWLGIDRLMK  400
            F EGE+VLAYH   +Y+AK+QK    K EW YFVHY GW+K       WDEW+G DRL+K
Sbjct  42   FVEGEKVLAYHGPLIYEAKVQKAELRKDEWRYFVHYLGWSKKYVLVQLWDEWVGTDRLLK  101

Query  401  VTEENLRKQQELNNKYDMKKNEKARRGSQLKAKCS  505
            +T+EN+ KQQ L    +  KN K+ R +Q K K S
Sbjct  102  LTDENIHKQQALEKNQNTDKNPKSGRSTQNKPKDS  136



>ref|XP_008371376.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Malus domestica]
 ref|XP_008361130.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Malus domestica]
Length=157

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 61/91 (67%), Gaps = 1/91 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+ LA+H   +Y+AK+   R+ K +WE++VHY GWNK+WDEW+G+DRLMK T+EN 
Sbjct  54   FTEGEKALAFHKARLYEAKVTDVRY-KMDWEFYVHYAGWNKSWDEWVGLDRLMKNTDENK  112

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTG  511
            +K Q LN K    KN K  R +  K K   G
Sbjct  113  KKHQYLNQKQGTDKNAKLIRTAHAKPKSYNG  143



>ref|XP_004141897.1| PREDICTED: mortality factor 4-like protein 1-like [Cucumis sativus]
 ref|XP_004168549.1| PREDICTED: mortality factor 4-like protein 1-like [Cucumis sativus]
Length=316

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K E+ YF+HY GWNKNWDEW+ +DRLMK T+EN 
Sbjct  28   YSEGEKVLAYHGPRIYEAKVQKVELRKKEFRYFLHYLGWNKNWDEWVSVDRLMKCTDENR  87

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQ+ L   Y ++K+ K+ R +Q K K     R +++
Sbjct  88   LKQRALEKGY-VEKSSKSGRSAQAKPKNLNDARVEKE  123



>gb|KGN48558.1| hypothetical protein Csa_6G491700 [Cucumis sativus]
Length=347

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+VLAYH   +Y+AK+QK    K E+ YF+HY GWNKNWDEW+ +DRLMK T+EN 
Sbjct  56   YSEGEKVLAYHGPRIYEAKVQKVELRKKEFRYFLHYLGWNKNWDEWVSVDRLMKCTDENR  115

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
             KQ+ L   Y ++K+ K+ R +Q K K     R +++
Sbjct  116  LKQRALEKGY-VEKSSKSGRSAQAKPKNLNDARVEKE  151



>gb|EPS69378.1| hypothetical protein M569_05388 [Genlisea aurea]
Length=318

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 67/110 (61%), Gaps = 10/110 (9%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAK----------IQKTRFVKAEWEYFVHYTGWNKNWDEWLGID  388
            F EGE+VLAYH   +Y+AK          +QK    K EW Y+VHY GWNKNWDEW+G D
Sbjct  29   FSEGEKVLAYHGPRIYEAKATLILHCFLGVQKAEVRKNEWRYYVHYLGWNKNWDEWVGTD  88

Query  389  RLMKVTEENLRKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
            RL+K  E+N+ +Q+ L+ K  + KN K  R  Q K K STG   K + ++
Sbjct  89   RLLKHNEKNILEQKALDKKAGVDKNTKTGRPVQTKGKGSTGMSDKEETRN  138



>ref|XP_003525912.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Glycine max]
 gb|KHN45174.1| Chromatin modification-related protein EAF3 [Glycine soja]
Length=325

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 71/104 (68%), Gaps = 2/104 (2%)
 Frame = +2

Query  248  GEEVLAYHNQCVYKAKIQKTRFVKAE-WEYFVHYTGWNKNWDEWLGIDRLMKVTEENLRK  424
            GE+VL YH+ C+Y+AK+++  +   + W + VHY GW K+WDEWL +DRLMK TEEN+RK
Sbjct  48   GEKVLVYHSDCLYEAKLRQAEYHNTKGWHFLVHYLGWKKSWDEWLDLDRLMKHTEENMRK  107

Query  425  QQELNNKYDMKKNEKARRGSQLKAKCSTGTRA-KRQKKDVQKDK  553
            + +L+ K    KN K  RGS  K+K +  +R  KR+ + V K+K
Sbjct  108  KHDLDEKLGNDKNAKIPRGSLAKSKTTNVSRGRKRRNESVIKEK  151



>ref|XP_004501548.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Cicer arietinum]
Length=317

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 71/109 (65%), Gaps = 5/109 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            + EGE+V AYH  C+Y+AK+++  +    W +++HY GW K+WDEW+ +DRLMK TEEN+
Sbjct  34   YTEGEKVFAYHTTCIYEAKVRQIEYKHKRWRFYLHYLGWKKSWDEWVVLDRLMKHTEENM  93

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD--VQKDKGV  559
            R +  L+ KY   KN +  R S   +K S G R +++K D  +++  GV
Sbjct  94   RIKLALDEKYGNDKNARKPRAS---SKASNGARGRKRKNDSVIKEKSGV  139



>ref|XP_002892122.1| chromatin binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68381.1| chromatin binding protein [Arabidopsis lyrata subsp. lyrata]
Length=327

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            FEEGE VLA H+ C Y+AK+ K  +   EW+YFVHY GWNK+WDEW+ +D L+K +EEN+
Sbjct  52   FEEGERVLAKHSDCFYEAKVLKVEYKDNEWKYFVHYIGWNKSWDEWISLDCLLKHSEENI  111

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             KQ+E   K    K+  A R S++K +     R +++K+D
Sbjct  112  EKQKEQGLKQQGIKSAMAWRVSKMKPRSPNVARGRKRKQD  151



>ref|XP_004291074.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Fragaria vesca 
subsp. vesca]
Length=348

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 1/100 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F  GE+VL YHN  +Y AK+ KT+  K EW  F+HY GW+K WDEW+ +DRL+K TEENL
Sbjct  73   FSIGEKVLVYHNTRIYDAKVIKTQ-CKNEWRIFIHYLGWSKTWDEWVRLDRLLKYTEENL  131

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             KQ+ +  +    KN K  + SQ K K   G R +++K D
Sbjct  132  EKQKLIIKEEGTDKNPKPSQTSQTKLKSHNGKRGRKRKND  171



>ref|XP_011029225.1| PREDICTED: chromatin modification-related protein EAF3-like isoform 
X1 [Populus euphratica]
Length=325

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F   E+VLA+H+   Y+AK+ +  + + +W +FVHYTGWNK WDEW+G DRL+K TEEN+
Sbjct  46   FVNDEKVLAFHSGQYYEAKVIRALYEENKWGFFVHYTGWNKTWDEWVGTDRLLKHTEENV  105

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
            +KQ+ L  + +M+   KA +  Q+K K S  +R +++K D
Sbjct  106  QKQKALKERLEMEMKTKAVQAPQMKLKNSGVSRGRKRKND  145



>ref|XP_006418310.1| hypothetical protein EUTSA_v10008162mg [Eutrema salsugineum]
 gb|ESQ36663.1| hypothetical protein EUTSA_v10008162mg [Eutrema salsugineum]
Length=331

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            FEEGE +LA H+ C Y+AKI K  +   EW+Y VHY GWNK+WDEW+G D ++K TEEN+
Sbjct  52   FEEGEIILAKHSDCFYEAKILKVAYQDNEWKYLVHYIGWNKSWDEWIGFDCVLKHTEENI  111

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             KQ++L  K  +K +  A + S++K +     R +++K+D
Sbjct  112  EKQRKLGMKQGVKSS-MAWKVSKMKPRSPNVARGRKRKQD  150



>ref|NP_171774.2| MRG family protein [Arabidopsis thaliana]
 gb|AAY56405.1| At1g02740 [Arabidopsis thaliana]
 gb|AEE27465.1| MRG family protein [Arabidopsis thaliana]
Length=327

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            FEEGE VLA H+ C Y+AK+ K  F   EW+YFVHY GWNK+WDEW+ +D L+K ++EN+
Sbjct  52   FEEGERVLAKHSDCFYEAKVLKVEFKDNEWKYFVHYIGWNKSWDEWIRLDCLLKHSDENI  111

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             KQ+E   K    K+  A + S++K +     R +++K+D
Sbjct  112  EKQKEQGLKQQGIKSAMAWKVSKMKPRSPNVARGRKRKQD  151



>ref|XP_007018592.1| MRG family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY15817.1| MRG family protein, putative isoform 1 [Theobroma cacao]
Length=337

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 66/107 (62%), Gaps = 7/107 (7%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLA+HN  +Y+AK+ K       W YFVHY GWNKNWDEW+ +DRLMK TEEN 
Sbjct  51   FREGEKVLAFHNLRIYEAKVLKFDNRSNGWHYFVHYLGWNKNWDEWVAVDRLMKFTEENR  110

Query  419  RKQQELNNKYDMKKN---EKARRGS----QLKAKCSTGTRAKRQKKD  538
            +KQ+ LN     +K      ++RG+      K K   G R K++K D
Sbjct  111  QKQEALNKTLAEEKKVEFHTSKRGTGRVFHFKLKHPKGGRGKKRKND  157



>ref|XP_009789111.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X2 [Nicotiana 
sylvestris]
Length=297

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 71/106 (67%), Gaps = 19/106 (18%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VLA+H+Q +Y+AK                  GWNKNWDEW+GIDRLMK+TEEN+
Sbjct  36   FQEGERVLAFHSQQLYEAK------------------GWNKNWDEWVGIDRLMKLTEENI  77

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDV-QKDK  553
            +KQQEL  K D  K+ K  RGSQ+K K STG R +++K DV  KDK
Sbjct  78   QKQQELKKKQDTDKSSKGGRGSQMKTKGSTGGRGRKRKSDVPHKDK  123



>ref|XP_009609316.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=297

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 72/106 (68%), Gaps = 19/106 (18%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE+VLA+H+Q +Y+AK                  GWNKNWDEW+GIDRLMK+TEEN+
Sbjct  36   FQEGEKVLAFHSQQLYEAK------------------GWNKNWDEWVGIDRLMKLTEENI  77

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDV-QKDK  553
            +KQQEL  K D  K+ K  RGSQ+K K  TG R +++K DV QKDK
Sbjct  78   QKQQELKKKQDTDKSSKGGRGSQMKTKGYTGGRGRKRKSDVPQKDK  123



>gb|EYU36317.1| hypothetical protein MIMGU_mgv1a010803mg [Erythranthe guttata]
Length=301

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 64/101 (63%), Gaps = 11/101 (11%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLAYH  C+Y AK+QK  F         H   W   WDEWLG+D L+K TEEN+
Sbjct  34   FREGEQVLAYHGLCLYDAKVQKVEF---------HIDVWR--WDEWLGVDCLLKHTEENV  82

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDV  541
            RKQ+EL  K+ M+KN  A R SQ K K   G R K++K+++
Sbjct  83   RKQKELKEKHAMEKNVNAARLSQDKTKSPIGVRGKKRKQEI  123



>ref|XP_003523982.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Glycine max]
Length=322

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 69/104 (66%), Gaps = 2/104 (2%)
 Frame = +2

Query  248  GEEVLAYHNQCVYKAKIQKTRFVKAE-WEYFVHYTGWNKNWDEWLGIDRLMKVTEENLRK  424
            GE+VL  H+ C+Y+AK+++  +   + W++ VHY GW K WDEWL +DRLMK TEEN+RK
Sbjct  42   GEKVLTNHSDCLYEAKVRQVEYRNTKGWQFLVHYLGWKKRWDEWLDLDRLMKHTEENMRK  101

Query  425  QQELNNKYDMKKNEKARRGSQLKAKCSTGTRA-KRQKKDVQKDK  553
            + +L+ K    KN K  RGS  K+K +  +R  KR+ + V K K
Sbjct  102  KHDLDEKLGNDKNAKVPRGSLAKSKPTNVSRGRKRRNESVIKGK  145



>gb|KHN04469.1| Chromatin modification-related protein EAF3 [Glycine soja]
Length=361

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 69/104 (66%), Gaps = 2/104 (2%)
 Frame = +2

Query  248  GEEVLAYHNQCVYKAKIQKTRFVKAE-WEYFVHYTGWNKNWDEWLGIDRLMKVTEENLRK  424
            GE+VL  H+ C+Y+AK+++  +   + W++ VHY GW K WDEWL +DRLMK TEEN+RK
Sbjct  42   GEKVLTNHSDCLYEAKVRQVEYRNTKGWQFLVHYLGWKKRWDEWLDLDRLMKHTEENMRK  101

Query  425  QQELNNKYDMKKNEKARRGSQLKAKCSTGTRA-KRQKKDVQKDK  553
            + +L+ K    KN K  RGS  K+K +  +R  KR+ + V K K
Sbjct  102  KHDLDEKLGNDKNAKVPRGSLAKSKPTNVSRGRKRRNESVIKGK  145



>ref|XP_007047400.1| MRG family protein isoform 2 [Theobroma cacao]
 gb|EOX91557.1| MRG family protein isoform 2 [Theobroma cacao]
Length=332

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 65/111 (59%), Gaps = 14/111 (13%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNK--------------NWDEW  376
            F EGE VLAYH   +Y+AK+QK    K EW+YFVHY    K              +WDEW
Sbjct  28   FSEGERVLAYHGPRIYEAKVQKAELRKKEWKYFVHYLVSIKGKQKSLLWLGHLANSWDEW  87

Query  377  LGIDRLMKVTEENLRKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
            +G DRLMK TEEN+ KQQ L+ K  + K+ K+ R +Q K K S   +A ++
Sbjct  88   VGADRLMKHTEENVIKQQALDKKQGVDKSSKSGRSAQTKPKSSADAKADKE  138



>ref|XP_010481223.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Camelina sativa]
Length=328

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 67/100 (67%), Gaps = 1/100 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            FEEGE VLA H+ C Y+AK+ K  +   EW+YFVHY GWNK+WDEW+ +D L+K T+EN+
Sbjct  54   FEEGERVLANHSDCFYEAKVLKIEYKDDEWKYFVHYIGWNKSWDEWISLDCLLKHTDENI  113

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             KQ+E   K  + K   A + +++K +     R +++K+D
Sbjct  114  EKQKEQGLKQGI-KTATAWKVTKMKPRSPNVARGRKRKQD  152



>ref|XP_010457263.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X2 [Camelina 
sativa]
Length=327

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 67/100 (67%), Gaps = 1/100 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VLA H+ C Y+AK+ K  +   EW+YFVHY GWNK+WDEW+ +D L+K T+EN+
Sbjct  53   FKEGERVLANHSDCFYEAKVLKIEYRDEEWKYFVHYIGWNKSWDEWISLDFLLKHTDENI  112

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             KQ+E   K  + K   A + +++K +     R +++K+D
Sbjct  113  EKQKEQGMKQGI-KTATAWKVTKMKPRSPNVARGRKRKQD  151



>ref|XP_010474852.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Camelina sativa]
Length=328

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 67/100 (67%), Gaps = 1/100 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            FEEGE VLA H+ C Y+AK+ K  +   EW+YFVHY GWNK+WDEW+ +D L+K T+EN+
Sbjct  54   FEEGERVLANHSDCFYEAKVLKIEYRDEEWKYFVHYIGWNKSWDEWISLDCLLKHTDENI  113

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             K++E   K  + K   A + +++K +     R +++K+D
Sbjct  114  EKEKEQGMKQGI-KTATAWKVTKMKPRSPNVARGRKRKQD  152



>ref|XP_004287990.1| PREDICTED: uncharacterized protein LOC101305978 [Fragaria vesca 
subsp. vesca]
Length=1100

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 69/114 (61%), Gaps = 13/114 (11%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYT----------GWNKNWDEWLGID  388
            F  GE+VLA+HN  +Y+AK+QK    K EW++FVHY           GWNK WDEW+G+D
Sbjct  19   FSAGEKVLAFHNSRIYEAKVQKVELRKNEWKFFVHYLVPRSLGTYSKGWNKVWDEWVGVD  78

Query  389  RLMKVTEENLRKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKD  550
            +L+K  E NL KQQ LN K D+ K    RR +Q K K S     K++K D  +D
Sbjct  79   QLLKHNEGNLMKQQALNKKQDIIKC--GRRSNQTKPKSSVA-EGKKRKNDCSED  129



>ref|XP_002320088.2| hypothetical protein POPTR_0014s02250g [Populus trichocarpa]
 gb|EEE98403.2| hypothetical protein POPTR_0014s02250g [Populus trichocarpa]
Length=334

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F   E+VLA+H+   Y+AK+ +  + + +W +FVHYTGWNK WDEW+G DRL+K TEEN+
Sbjct  46   FVNDEKVLAFHSGQYYEAKVIRALYEENKWGFFVHYTGWNKTWDEWVGTDRLLKHTEENV  105

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTG  511
            +KQ+ L  + +M+   KA +  Q+K K S G
Sbjct  106  QKQKALKERLEMEMKTKAVQAPQMKLKNSGG  136



>ref|XP_009118749.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Brassica rapa]
Length=327

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            FEEGE+VLA H  C Y+AK+ +  F   EW Y+VHY GWNK+WDEW+G D ++K TEEN+
Sbjct  50   FEEGEKVLANHKGCFYEAKVLEIAFKDNEWNYYVHYIGWNKSWDEWIGHDCVLKHTEENI  109

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             +Q          K+  A R S++K +C +  R +++K+D
Sbjct  110  EEQ----GIKQGVKSAMAWRVSKVKPRCPSVARGRKRKQD  145



>ref|XP_009372448.1| PREDICTED: uncharacterized protein LOC103961605 [Pyrus x bretschneideri]
Length=682

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 67/101 (66%), Gaps = 1/101 (1%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNK-NWDEWLGIDRLMKVTEEN  415
            + EGE+VLAYH + +Y AK+QK      +W YFVHY GWNK +WDEW+G+DRL+K  EEN
Sbjct  28   YSEGEKVLAYHGKRIYDAKVQKLELRNNKWTYFVHYLGWNKVSWDEWVGVDRLLKQNEEN  87

Query  416  LRKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
            + +QQ L  +  +  N K+ + +Q+  K S   + +++K +
Sbjct  88   IIRQQTLAKQPCVDDNTKSGQLTQMNPKSSAVGKERKRKNN  128



>emb|CDY32476.1| BnaA09g51200D [Brassica napus]
Length=326

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            FEEGE+VLA H  C Y+AK+ +  F   EW Y+VHY GWNK+WDEW+G   ++K TEEN+
Sbjct  53   FEEGEKVLANHKGCFYEAKVLEIAFKDNEWNYYVHYIGWNKSWDEWIGHGCVLKHTEENI  112

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             +Q          K+  A R S++K +C +  R +++K+D
Sbjct  113  EEQ----GIKQGVKSAMAWRVSKVKPRCPSVARGRKRKQD  148



>emb|CDP02542.1| unnamed protein product [Coffea canephora]
Length=339

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 64/120 (53%), Gaps = 25/120 (21%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAK-----------------------IQKTRFVKAEWEYFVHYT  349
            F EGE+VLAYH   +Y+AK                        + T   K EW YFVHY 
Sbjct  28   FSEGEKVLAYHGPKIYEAKACPKTLIFSIFRIEISIPLFFFNFKYTEVRKNEWRYFVHYL  87

Query  350  GWNKNWDEWLGIDRLMKVTEENLRKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQ  529
            GWNKNWDEW+   RLMK TEEN+ KQ+ L+ K  +  N K+ R +Q K K S  T+  ++
Sbjct  88   GWNKNWDEWVDAGRLMKYTEENVLKQKALDKKKGV--NTKSGRSTQSKPKTSADTKVDKE  145



>gb|EMS62229.1| Mortality factor 4-like protein 1 [Triticum urartu]
Length=362

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 67/136 (49%), Gaps = 35/136 (26%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKN------------------  364
            F EGE+VLAYH   +Y+AK+QKT   + EW YFVHY GWNKN                  
Sbjct  32   FTEGEKVLAYHGPLLYEAKVQKTENREDEWRYFVHYLGWNKNRAFHFLKFEDCGNEGILD  91

Query  365  ----------------WDEWLGIDRLMKVTEENLRKQQELNNKYDMKKNEKARRGSQLKA  496
                            WDEW+  DRL+K+TEEN+RKQ EL N+   K      R +Q   
Sbjct  92   RLYTFFSTYSVFNGYSWDEWVASDRLLKLTEENVRKQLELKNQSGDKTVRTGGRSAQHNP  151

Query  497  KCSTGTRAKRQKKDVQ  544
            K S    AK  K+D +
Sbjct  152  KGSNAD-AKGDKEDTK  166



>emb|CDY37463.1| BnaC08g46010D [Brassica napus]
Length=331

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            FEEGE+VLA H    Y+AK+ +  F   EW Y+VHY GWNK+WDEW+G D ++K TEEN+
Sbjct  50   FEEGEKVLANHKGRFYEAKVLEIAFKDNEWNYYVHYIGWNKSWDEWIGHDCVLKHTEENI  109

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
            ++Q          K+  A R S++K +C    R +++K+D
Sbjct  110  KEQ----GIKQGVKSAMAWRVSKVKPRCPNVARGRKRKQD  145



>gb|KDO84034.1| hypothetical protein CISIN_1g0200392mg, partial [Citrus sinensis]
 gb|KDO84035.1| hypothetical protein CISIN_1g0200392mg, partial [Citrus sinensis]
 gb|KDO84036.1| hypothetical protein CISIN_1g0200392mg, partial [Citrus sinensis]
 gb|KDO84037.1| hypothetical protein CISIN_1g0200392mg, partial [Citrus sinensis]
 gb|KDO84038.1| hypothetical protein CISIN_1g0200392mg, partial [Citrus sinensis]
 gb|KDO84039.1| hypothetical protein CISIN_1g0200392mg, partial [Citrus sinensis]
 gb|KDO84040.1| hypothetical protein CISIN_1g0200392mg, partial [Citrus sinensis]
Length=216

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 61/100 (61%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            ++  E+VLA+    VY+AK+ + ++   EW + VHY GWNK+WDEW+G+ RLMK TE N 
Sbjct  52   YQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANR  111

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             +Q     K D  KN K+    Q+K + S   R +++K D
Sbjct  112  HRQPVFTKKRDEDKNLKSGHALQMKPRSSNVGRGRKRKND  151



>ref|XP_011505271.1| PREDICTED: mortality factor 4-like protein 1 [Ceratosolen solmsi 
marchali]
Length=339

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 70/112 (63%), Gaps = 5/112 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAE--WEYFVHYTGWNKNWDEWLGIDRLMKVTEE  412
            F+EGE+VL +H   +Y+AK  K+ F K E   +Y++HY GWNKNWDEW+  DR++K  + 
Sbjct  7    FQEGEKVLCFHGPLIYEAKCLKSSFSKDEKQIKYYIHYAGWNKNWDEWVPEDRVLKFNDT  66

Query  413  NLRKQQELNNKYDMKKNEKARRG---SQLKAKCSTGTRAKRQKKDVQKDKGV  559
            N++KQ+E+   ++   N++ R+    S+++ + S G R K +  D +    V
Sbjct  67   NVQKQKEVQKVHEQASNKQNRKSGGTSKVQGRRSEGGRDKEKDSDSRASTPV  118



>ref|XP_006473265.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X4 [Citrus 
sinensis]
Length=275

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 61/100 (61%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            ++  E+VLA+    VY+AK+ + ++   EW + VHY GWNK+WDEW+G+ RLMK TE N 
Sbjct  52   YQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANR  111

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             +Q     K D  KN K+    Q+K + S   R +++K D
Sbjct  112  HRQPVFTKKRDEDKNLKSGHALQMKPRSSNVGRGRKRKND  151



>ref|XP_006473263.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X2 [Citrus 
sinensis]
Length=326

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 61/100 (61%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            ++  E+VLA+    VY+AK+ + ++   EW + VHY GWNK+WDEW+G+ RLMK TE N 
Sbjct  52   YQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANR  111

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             +Q     K D  KN K+    Q+K + S   R +++K D
Sbjct  112  HRQPVFTKKRDEDKNLKSGHALQMKPRSSNVGRGRKRKND  151



>ref|XP_006473264.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X3 [Citrus 
sinensis]
Length=317

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 61/100 (61%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            ++  E+VLA+    VY+AK+ + ++   EW + VHY GWNK+WDEW+G+ RLMK TE N 
Sbjct  52   YQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANR  111

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             +Q     K D  KN K+    Q+K + S   R +++K D
Sbjct  112  HRQPVFTKKRDEDKNLKSGHALQMKPRSSNVGRGRKRKND  151



>ref|XP_006473262.1| PREDICTED: nuA4 complex subunit EAF3 homolog isoform X1 [Citrus 
sinensis]
Length=332

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 61/100 (61%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            ++  E+VLA+    VY+AK+ + ++   EW + VHY GWNK+WDEW+G+ RLMK TE N 
Sbjct  52   YQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANR  111

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             +Q     K D  KN K+    Q+K + S   R +++K D
Sbjct  112  HRQPVFTKKRDEDKNLKSGHALQMKPRSSNVGRGRKRKND  151



>ref|XP_006434696.1| hypothetical protein CICLE_v10001792mg [Citrus clementina]
 gb|ESR47936.1| hypothetical protein CICLE_v10001792mg [Citrus clementina]
Length=332

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 61/100 (61%), Gaps = 0/100 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            ++  E+VLA+    VY+AK+ + ++   EW + VHY GWNK+WDEW+G+ RLMK TE N 
Sbjct  52   YQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANR  111

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD  538
             +Q     K D  KN K+    Q+K + S   R +++K D
Sbjct  112  HRQPVFTKKRDEDKNLKSGHALQMKPRSSNVGRGRKRKND  151



>ref|XP_011300571.1| PREDICTED: mortality factor 4-like protein 1 [Fopius arisanus]
Length=337

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 66/107 (62%), Gaps = 7/107 (7%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKA-EWEYFVHYTGWNKNWDEWLGIDRLMKVTEEN  415
            F EGE+VL +H   +Y+AK  K+   K  + +YF+HY GWNKNWDEW+   R++K  E N
Sbjct  7    FTEGEKVLCFHGPLIYEAKCLKSSVSKEKQVKYFIHYAGWNKNWDEWVPESRVLKYNEAN  66

Query  416  LRKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDKG  556
            ++KQ+E+   +D      A++ +Q   K ++  +   +K DV KDKG
Sbjct  67   VQKQKEVQRAHD------AQQSTQKGKKGTSVVKTTGRKSDVIKDKG  107



>ref|XP_007018595.1| MRG family protein, putative isoform 4 [Theobroma cacao]
 gb|EOY15820.1| MRG family protein, putative isoform 4 [Theobroma cacao]
Length=309

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 67/114 (59%), Gaps = 8/114 (7%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLA+HN  +Y+AK+ K       W YFVHY    K+WDEW+ +DRLMK TEEN 
Sbjct  51   FREGEKVLAFHNLRIYEAKVLKFDNRSNGWHYFVHYLVSIKSWDEWVAVDRLMKFTEENR  110

Query  419  RKQQELNNKYDMKKN---EKARRGS----QLKAKCSTGTRAKRQKKD-VQKDKG  556
            +KQ+ LN     +K      ++RG+      K K   G R K++K D + K+K 
Sbjct  111  QKQEALNKTLAEEKKVEFHTSKRGTGRVFHFKLKHPKGGRGKKRKNDSISKEKS  164



>ref|XP_009360134.1| PREDICTED: LOW QUALITY PROTEIN: nuA4 complex subunit EAF3 homolog 
[Pyrus x bretschneideri]
Length=331

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+ LA+H   +Y+AK+   R+ K +WE++VHY GWNK+ DEW  +DRL K T++N 
Sbjct  54   FTEGEKALAFHKARLYEAKVTDVRY-KMDWEFYVHYAGWNKSRDEWARLDRLTKNTDKNK  112

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKD-VQKDKGV  559
            +K Q LN K    KN K    +  K K    +R K++K D V KDKG 
Sbjct  113  KKHQYLNQKQGTDKNAKLTHTAHTKPKSYHASRGKKRKNDSVCKDKGA  160



>ref|XP_007018593.1| MRG family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY15818.1| MRG family protein, putative isoform 2 [Theobroma cacao]
Length=337

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 67/114 (59%), Gaps = 8/114 (7%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F EGE+VLA+HN  +Y+AK+ K       W YFVHY    K+WDEW+ +DRLMK TEEN 
Sbjct  51   FREGEKVLAFHNLRIYEAKVLKFDNRSNGWHYFVHYLVSIKSWDEWVAVDRLMKFTEENR  110

Query  419  RKQQELNNKYDMKKN---EKARRGS----QLKAKCSTGTRAKRQKKD-VQKDKG  556
            +KQ+ LN     +K      ++RG+      K K   G R K++K D + K+K 
Sbjct  111  QKQEALNKTLAEEKKVEFHTSKRGTGRVFHFKLKHPKGGRGKKRKNDSISKEKS  164



>ref|XP_008207612.1| PREDICTED: LOW QUALITY PROTEIN: nuA4 complex subunit EAF3 homolog 
[Nasonia vitripennis]
Length=316

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 69/112 (62%), Gaps = 5/112 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAE--WEYFVHYTGWNKNWDEWLGIDRLMKVTEE  412
            F+EGE+VL +H   +Y+AK  K+ F K E   +Y++HY GWNKNWDEW+  +R++K  + 
Sbjct  27   FQEGEKVLCFHGPLIYEAKCLKSSFSKDEKQIKYYIHYAGWNKNWDEWVPEERVLKFNDT  86

Query  413  NLRKQQELNNKYDMKKNEKARRG---SQLKAKCSTGTRAKRQKKDVQKDKGV  559
            N++KQ E+   ++   N++ R+    S+++ + S G R K +  D +    V
Sbjct  87   NVQKQNEVRKVHEQASNKQNRKSGGTSKVQGRRSEGGRDKEKDSDSRASTPV  138



>ref|XP_396632.3| PREDICTED: mortality factor 4-like protein 1-like isoform X2 
[Apis mellifera]
Length=339

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (60%), Gaps = 10/117 (9%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKA-EWEYFVHYTGWNKNWDEWLGIDRLMKVTEEN  415
            F+EGE+VL +H   +Y+AK  K+   K  + +YF+HY GWNKNWDEW+   R++K  E N
Sbjct  7    FQEGEKVLCFHGPLIYEAKCLKSSITKEKQIKYFIHYAGWNKNWDEWVPESRVLKYNEAN  66

Query  416  LRKQQEL----NNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQK-DKGV  559
            +++Q+E+    +N+   +KN+K    S+ + + S G R K    R    V   DKGV
Sbjct  67   VQRQREVQRAHSNQQSAQKNKKGSTSSKTQGRRSEGGREKDTDSRASTPVATVDKGV  123



>ref|XP_006621011.1| PREDICTED: mortality factor 4-like protein 1-like isoform X1 
[Apis dorsata]
Length=339

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (60%), Gaps = 10/117 (9%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKA-EWEYFVHYTGWNKNWDEWLGIDRLMKVTEEN  415
            F+EGE+VL +H   +Y+AK  K+   K  + +YF+HY GWNKNWDEW+   R++K  E N
Sbjct  7    FQEGEKVLCFHGPLIYEAKCLKSSITKEKQIKYFIHYAGWNKNWDEWVPESRVLKYNEAN  66

Query  416  LRKQQEL----NNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQK-DKGV  559
            +++Q+E+    +N+   +KN+K    S+ + + S G R K    R    V   DKGV
Sbjct  67   VQRQREVQRAHSNQQSAQKNKKGSTSSKTQGRRSEGGREKDTDSRASTPVATVDKGV  123



>ref|XP_003690386.1| PREDICTED: mortality factor 4-like protein 1-like [Apis florea]
Length=339

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (60%), Gaps = 10/117 (9%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKA-EWEYFVHYTGWNKNWDEWLGIDRLMKVTEEN  415
            F+EGE+VL +H   +Y+AK  K+   K  + +YF+HY GWNKNWDEW+   R++K  E N
Sbjct  7    FQEGEKVLCFHGPLIYEAKCLKSSITKEKQIKYFIHYAGWNKNWDEWVPESRVLKYNEAN  66

Query  416  LRKQQEL----NNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQK-DKGV  559
            +++Q+E+    +N+   +KN+K    S+ + + S G R K    R    V   DKGV
Sbjct  67   VQRQREVQKAHSNQQSAQKNKKGSTSSKTQGRRSEGGREKDTDSRASTPVATVDKGV  123



>ref|XP_003398041.1| PREDICTED: mortality factor 4-like protein 1-like [Bombus terrestris]
Length=336

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (60%), Gaps = 10/117 (9%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKA-EWEYFVHYTGWNKNWDEWLGIDRLMKVTEEN  415
            F+EGE+VL +H   +Y+AK  K+   K  + +YF+HY GWNKNWDEW+   R++K  E N
Sbjct  7    FQEGEKVLCFHGPLIYEAKCLKSSITKEKQIKYFIHYAGWNKNWDEWVPESRVLKYNEAN  66

Query  416  LRKQQEL----NNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQK-DKGV  559
            +++Q+E+    +N+   +KN+K    S+ + + S G R K    R    V   DKGV
Sbjct  67   VQRQREVQRAHSNQQSAQKNKKGSTSSKTQGRRSEGGREKDTDSRASTPVATVDKGV  123



>ref|XP_003485396.1| PREDICTED: mortality factor 4-like protein 1-like [Bombus impatiens]
Length=336

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (60%), Gaps = 10/117 (9%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKA-EWEYFVHYTGWNKNWDEWLGIDRLMKVTEEN  415
            F+EGE+VL +H   +Y+AK  K+   K  + +YF+HY GWNKNWDEW+   R++K  E N
Sbjct  7    FQEGEKVLCFHGPLIYEAKCLKSSITKEKQIKYFIHYAGWNKNWDEWVPESRVLKYNEAN  66

Query  416  LRKQQEL----NNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQK-DKGV  559
            +++Q+E+    +N+   +KN+K    S+ + + S G R K    R    V   DKGV
Sbjct  67   VQRQREVQRAHSNQQSAQKNKKGSTSSKTQGRRSEGGREKDTDSRASTPVATVDKGV  123



>ref|XP_006621012.1| PREDICTED: mortality factor 4-like protein 1-like isoform X2 
[Apis dorsata]
Length=336

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (60%), Gaps = 10/117 (9%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKA-EWEYFVHYTGWNKNWDEWLGIDRLMKVTEEN  415
            F+EGE+VL +H   +Y+AK  K+   K  + +YF+HY GWNKNWDEW+   R++K  E N
Sbjct  7    FQEGEKVLCFHGPLIYEAKCLKSSITKEKQIKYFIHYAGWNKNWDEWVPESRVLKYNEAN  66

Query  416  LRKQQEL----NNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQK-DKGV  559
            +++Q+E+    +N+   +KN+K    S+ + + S G R K    R    V   DKGV
Sbjct  67   VQRQREVQRAHSNQQSAQKNKKGSTSSKTQGRRSEGGREKDTDSRASTPVATVDKGV  123



>ref|XP_006561709.1| PREDICTED: mortality factor 4-like protein 1-like isoform X1 
[Apis mellifera]
Length=336

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (60%), Gaps = 10/117 (9%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKA-EWEYFVHYTGWNKNWDEWLGIDRLMKVTEEN  415
            F+EGE+VL +H   +Y+AK  K+   K  + +YF+HY GWNKNWDEW+   R++K  E N
Sbjct  7    FQEGEKVLCFHGPLIYEAKCLKSSITKEKQIKYFIHYAGWNKNWDEWVPESRVLKYNEAN  66

Query  416  LRKQQEL----NNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQK-DKGV  559
            +++Q+E+    +N+   +KN+K    S+ + + S G R K    R    V   DKGV
Sbjct  67   VQRQREVQRAHSNQQSAQKNKKGSTSSKTQGRRSEGGREKDTDSRASTPVATVDKGV  123



>ref|XP_007205458.1| hypothetical protein PRUPE_ppa007902mg [Prunus persica]
 gb|EMJ06657.1| hypothetical protein PRUPE_ppa007902mg [Prunus persica]
Length=352

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 68/131 (52%), Gaps = 34/131 (26%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAK--------IQKTRFVKAEWEYFVHY---------------T  349
            + EGE++LAYH   +Y+AK        +QK    K EW YFVHY                
Sbjct  28   YSEGEKILAYHGPRIYEAKASPTNPPFVQKAELRKNEWRYFVHYLHGIPMNGIKRIIIKV  87

Query  350  GW-----------NKNWDEWLGIDRLMKVTEENLRKQQELNNKYDMKKNEKARRGSQLKA  496
            G            NK WDEW+G DRL+K TE+N+ KQQ L+ K  + KN K+ R +Q K 
Sbjct  88   GMVLSFFYFLSFDNKCWDEWVGGDRLLKNTEDNIMKQQALDKKQGVDKNTKSGRSAQTKP  147

Query  497  KCSTGTRAKRQ  529
            K S+  +A+++
Sbjct  148  KSSSDAKAEKE  158



>ref|XP_010095325.1| Chromatin modification-related protein EAF3 [Morus notabilis]
 gb|EXB59536.1| Chromatin modification-related protein EAF3 [Morus notabilis]
Length=278

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 60/98 (61%), Gaps = 12/98 (12%)
 Frame = +2

Query  293  KIQKTRFVKAEWEYFVHYTGWNKN----------WDEWLGIDRLMKVTEENLRKQQELNN  442
            K+Q+    K EW+YFVHY G  K+          WDEW+G+DRLMK TEEN+ KQQ L+ 
Sbjct  33   KVQRAELRKKEWKYFVHYLGIQKSLLWLGHLANSWDEWVGVDRLMKYTEENVLKQQTLDK  92

Query  443  KYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDKG  556
            K  + KN K+ R +Q K K S    AK +K+DV+ + G
Sbjct  93   KQGVDKNSKSGRSAQTKPKSSAD--AKVEKEDVKTNVG  128



>ref|XP_002053695.1| GJ24036 [Drosophila virilis]
 gb|EDW67215.1| GJ24036 [Drosophila virilis]
Length=459

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (61%), Gaps = 5/104 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F +GE VL +H   +Y+AK+ KT+   +  EY++HY GW+KNWDEW+   R++K  E+N+
Sbjct  21   FADGERVLCFHGPLIYEAKVLKTKPESSPVEYYIHYAGWSKNWDEWVPESRVLKYNEDNV  80

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAK----CSTGTRAKRQKKD  538
            ++Q+EL   Y  +  +  ++GS  KAK        +RA    KD
Sbjct  81   KRQKELARVYGERSKKDNKKGSA-KAKKMEQVGNESRASTPSKD  123



>ref|XP_005181092.1| PREDICTED: mortality factor 4-like protein 1 [Musca domestica]
Length=407

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 57/83 (69%), Gaps = 2/83 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVK-AEWEYFVHYTGWNKNWDEWLGIDRLMKVTEEN  415
            F EGE+VL +H   +Y+AK  K+   K  + +YFVHY GWNKNWDEW+   R++K  E N
Sbjct  7    FAEGEKVLCFHGPLIYEAKALKSTVTKDKQLKYFVHYAGWNKNWDEWVPEHRVLKYNETN  66

Query  416  LRKQQELNNKYDMKKNEKARRGS  484
            L++Q++L  ++D KK EK R+ +
Sbjct  67   LQRQKDLQKEHDAKK-EKNRKNT  88



>ref|XP_011150963.1| PREDICTED: mortality factor 4-like protein 1 [Harpegnathos saltator]
 gb|EFN76902.1| Mortality factor 4-like protein 1 [Harpegnathos saltator]
Length=337

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 64/100 (64%), Gaps = 5/100 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKA-EWEYFVHYTGWNKNWDEWLGIDRLMKVTEEN  415
            F+EGE+VL +H   +Y+AK  K+   K  + +YF+HY GWNKNWDEW+   R++K  E N
Sbjct  7    FQEGEKVLCFHGPLIYEAKCLKSSITKEKQIKYFIHYAGWNKNWDEWVPESRVLKYNEAN  66

Query  416  LRKQQEL----NNKYDMKKNEKARRGSQLKAKCSTGTRAK  523
            +++Q+E+    +N+   +KN+K    ++ + + S G R K
Sbjct  67   VQRQREVQRAHSNQQSTQKNKKGSATTKTQGRRSEGVREK  106



>ref|XP_006032508.1| PREDICTED: mortality factor 4-like protein 1-like isoform X2 
[Alligator sinensis]
Length=323

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 65/111 (59%), Gaps = 5/111 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKGV  559
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G+
Sbjct  71   QKQKELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPGI  120



>ref|XP_005521728.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Pseudopodoces 
humilis]
 ref|XP_008635610.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Corvus 
brachyrhynchos]
 ref|XP_008921338.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Manacus 
vitellinus]
 ref|XP_010570445.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Haliaeetus 
leucocephalus]
Length=323

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 65/111 (59%), Gaps = 5/111 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKGV  559
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G+
Sbjct  71   QKQKELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPGI  120



>ref|XP_001363195.1| PREDICTED: mortality factor 4-like protein 1-like isoform X2 
[Monodelphis domestica]
Length=323

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 65/111 (59%), Gaps = 5/111 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKGV  559
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G+
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEAKTKKNKQKTPGI  120



>ref|XP_010874224.1| PREDICTED: mortality factor 4-like protein 1 [Esox lucius]
Length=364

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  KT   + + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKAVKTNIKEKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNL  70

Query  419  RKQQEL  436
            +KQ+EL
Sbjct  71   QKQKEL  76



>emb|CAF98370.1| unnamed protein product [Tetraodon nigroviridis]
Length=323

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 2/108 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  E NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKISIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVESNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK--RQKKDVQKDKG  556
            +KQ+EL         E   RG+    K    ++    + KK+ QK  G
Sbjct  71   QKQKELQRANQDHYVEGRMRGAAPNKKIPAASQKNEVKTKKNKQKTPG  118



>pdb|2EFI|A Chain A, Solution Structure Of The Chromo Domain Of Mortality 
Factor 4-Like Protein 1 From Human
Length=100

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  18   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  77

Query  419  RKQQELNNKYDMKKNEKARRGS  484
            +KQ+EL      +  E   RG+
Sbjct  78   QKQRELQKANQEQYAEGKMRGA  99



>ref|NP_001139993.1| Mortality factor 4-like protein 1 [Salmo salar]
 gb|ACM09084.1| Mortality factor 4-like protein 1 [Salmo salar]
Length=335

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  KT   + + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKAVKTNIKEKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNL  70

Query  419  RKQQEL  436
            +KQ+EL
Sbjct  71   QKQKEL  76



>ref|XP_003967506.1| PREDICTED: mortality factor 4-like protein 1-like isoform 1 [Takifugu 
rubripes]
Length=323

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 2/108 (2%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  E NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKISIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVESNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK--RQKKDVQKDKG  556
            +KQ+EL         E   RG+    K    ++    + KK+ QK  G
Sbjct  71   QKQKELQRANQDHYVEGRMRGAAPNKKIPAASQKNEVKTKKNKQKAPG  118



>gb|ACQ58325.1| Mortality factor 4-like protein 1 [Anoplopoma fimbria]
Length=323

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 60/105 (57%), Gaps = 4/105 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  KT   + + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKTNIKEKQIKYFIHYSGWNKNWDEWVPESRVLKYVDGNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDK  553
            +KQ+EL         E   RG+    K      A  QK D++  K
Sbjct  71   QKQKELQRANQDHYVEGRMRGAAPNKKIP----APPQKNDLKTKK  111



>ref|XP_005999759.1| PREDICTED: mortality factor 4-like protein 1 [Latimeria chalumnae]
Length=323

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCST  508
            +KQ+EL      +  E   RG+    K ST
Sbjct  71   QKQKELQKANQEQYAEGKMRGAAPGKKTST  100



>gb|ACN10127.1| Mortality factor 4-like protein 1 [Salmo salar]
 gb|ACN12478.1| Mortality factor 4-like protein 1 [Salmo salar]
Length=335

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  KT   + + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKAVKTNIKEKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNL  70

Query  419  RKQQEL  436
            +KQ+EL
Sbjct  71   QKQKEL  76



>ref|XP_002187229.2| PREDICTED: mortality factor 4-like protein 1 [Taeniopygia guttata]
Length=356

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 65/111 (59%), Gaps = 5/111 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  44   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  103

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKGV  559
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G+
Sbjct  104  QKQKELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPGI  153



>ref|NP_001158545.1| Mortality factor 4-like protein 1 [Oncorhynchus mykiss]
 gb|ACO08227.1| Mortality factor 4-like protein 1 [Oncorhynchus mykiss]
Length=335

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  KT   + + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKAVKTNIKERQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNL  70

Query  419  RKQQEL  436
            +KQ+EL
Sbjct  71   QKQKEL  76



>ref|XP_003699592.1| PREDICTED: mortality factor 4-like protein 1-like [Megachile 
rotundata]
Length=336

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 69/117 (59%), Gaps = 10/117 (9%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKA-EWEYFVHYTGWNKNWDEWLGIDRLMKVTEEN  415
            F+EGE+VL +H   +Y+AK  K+   K  + +YF+HY GWNKNWDEW+   R++K  E N
Sbjct  7    FQEGEKVLCFHGPLIYEAKCLKSSITKEKQIKYFIHYAGWNKNWDEWVPESRVLKYNEAN  66

Query  416  LRKQQEL----NNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQK-DKGV  559
            +++Q+E+    +N+   +K +K    S+ + + S G R K    R    V   DKGV
Sbjct  67   VQRQREVQRAHSNQQSAQKAKKGSTSSKTQGRRSEGVREKDTDSRASTPVATVDKGV  123



>ref|XP_011474879.1| PREDICTED: mortality factor 4-like protein 1 [Oryzias latipes]
Length=304

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  KT     + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKTNIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNL  70

Query  419  RKQQEL  436
            +KQ+EL
Sbjct  71   QKQKEL  76



>ref|XP_004387537.1| PREDICTED: mortality factor 4-like protein 1 isoform 2 [Trichechus 
manatus latirostris]
Length=323

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 65/110 (59%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+ +  K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGA-VPGKKTSGLQQKNVEVKTKKNKQKTPG  119



>ref|XP_011168895.1| PREDICTED: mortality factor 4-like protein 1 [Solenopsis invicta]
 gb|EFZ22045.1| hypothetical protein SINV_01922 [Solenopsis invicta]
Length=334

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 65/100 (65%), Gaps = 5/100 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKA-EWEYFVHYTGWNKNWDEWLGIDRLMKVTEEN  415
            F+EGE+VL +H   +Y+AK  K+   K  + +YF+HY GWNKNWDEW+  +R++K  E N
Sbjct  7    FQEGEKVLCFHGPLIYEAKCLKSSIGKEKQVKYFIHYAGWNKNWDEWVPENRVLKYNEAN  66

Query  416  LRKQQEL----NNKYDMKKNEKARRGSQLKAKCSTGTRAK  523
            ++KQ+E+    +N+   +KN+K    ++ + + S G R K
Sbjct  67   VQKQKEVQRAHSNQQSAQKNKKGNSTTKTQGRRSEGGREK  106



>ref|NP_001032253.1| mortality factor 4 like 1 isoform 2 [Gallus gallus]
Length=323

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 65/111 (59%), Gaps = 5/111 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKGV  559
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G+
Sbjct  71   QKQKELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPGL  120



>ref|XP_001999699.1| GI24663 [Drosophila mojavensis]
 gb|EDW15160.1| GI24663 [Drosophila mojavensis]
Length=462

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 63/104 (61%), Gaps = 5/104 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F +GE VL +H   +Y+AK+ KT+   +  EY++HY GW+KNWDEW+   R++K  ++N+
Sbjct  21   FADGERVLCFHGPLIYEAKVLKTKPESSPVEYYIHYAGWSKNWDEWVPESRVLKYNDDNV  80

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAK----CSTGTRAKRQKKD  538
            ++Q+EL   Y  +  +  ++GS  KAK        +RA    KD
Sbjct  81   KRQKELARLYVERSKKDNKKGSA-KAKKMEHIGNESRASTPSKD  123



>ref|XP_005806998.1| PREDICTED: mortality factor 4-like protein 1-like [Xiphophorus 
maculatus]
Length=323

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 58/105 (55%), Gaps = 4/105 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKISIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDK  553
            +KQ+EL         E   RG+    K      A  QK DV+  K
Sbjct  71   QKQKELQRANQDHYVEGRMRGAAPNKKIP----AASQKNDVKTKK  111



>ref|XP_007556909.1| PREDICTED: mortality factor 4-like protein 1 [Poecilia formosa]
Length=323

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 58/105 (55%), Gaps = 4/105 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKINIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDK  553
            +KQ+EL         E   RG+    K    +    QK DV+  K
Sbjct  71   QKQKELQRANQDHYVEGRMRGAAPNKKIPAAS----QKNDVKTKK  111



>ref|XP_010733430.1| PREDICTED: mortality factor 4-like protein 1 [Larimichthys crocea]
Length=323

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 58/105 (55%), Gaps = 4/105 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKINIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDK  553
            +KQ+EL         E   RG+    K      A  QK DV+  K
Sbjct  71   QKQKELQKANQDHYVEGRMRGAAPNKKIP----AAPQKNDVKTKK  111



>ref|XP_008410405.1| PREDICTED: mortality factor 4-like protein 1 [Poecilia reticulata]
Length=323

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 58/105 (55%), Gaps = 4/105 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKINIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDK  553
            +KQ+EL         E   RG+    K      A  QK DV+  K
Sbjct  71   QKQKELQRANQDHYVEGRMRGAAPNKKIP----AASQKNDVKTKK  111



>ref|XP_008300670.1| PREDICTED: mortality factor 4-like protein 1 [Stegastes partitus]
Length=323

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 58/105 (55%), Gaps = 4/105 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKINIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDK  553
            +KQ+EL         E   RG+    K    +    QK DV+  K
Sbjct  71   QKQKELQRANQDHYVEGRMRGAAPNKKLPAAS----QKNDVKTKK  111



>pdb|2F5K|A Chain A, Crystal Structure Of The Chromo Domain Of Human Mrg15
 pdb|2F5K|B Chain B, Crystal Structure Of The Chromo Domain Of Human Mrg15
 pdb|2F5K|C Chain C, Crystal Structure Of The Chromo Domain Of Human Mrg15
 pdb|2F5K|D Chain D, Crystal Structure Of The Chromo Domain Of Human Mrg15
 pdb|2F5K|E Chain E, Crystal Structure Of The Chromo Domain Of Human Mrg15
 pdb|2F5K|F Chain F, Crystal Structure Of The Chromo Domain Of Human Mrg15
Length=102

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  23   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  82

Query  419  RKQQEL  436
            +KQ+EL
Sbjct  83   QKQREL  88



>ref|XP_008819836.1| PREDICTED: LOW QUALITY PROTEIN: mortality factor 4-like protein 
1 [Nannospalax galili]
Length=317

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>dbj|BAJ87278.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=358

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +2

Query  287  KAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENLRKQQELNNKYDMKKNE  466
            + + +KT   + EW YFVHY GWNKNWDEW+  DRL+K+TEEN+RKQ EL N+   K   
Sbjct  85   RPRFKKTENREDEWRYFVHYLGWNKNWDEWVASDRLLKLTEENVRKQLELKNQSGDKTVR  144

Query  467  KARRGSQLKAKCSTGTRAKRQKKDVQ  544
               R +Q   K S    AK  K+D +
Sbjct  145  TGGRSAQHNPKASNAD-AKVDKEDTK  169



>dbj|BAE00783.1| unnamed protein product [Macaca fascicularis]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>gb|AAG17253.1|AF218011_1 unknown [Homo sapiens]
Length=311

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>ref|XP_001927776.1| PREDICTED: mortality factor 4 like 1 isoform 1 [Sus scrofa]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>ref|XP_010365659.1| PREDICTED: LOW QUALITY PROTEIN: mortality factor 4-like protein 
1 [Rhinopithecus roxellana]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>ref|XP_008215971.1| PREDICTED: mortality factor 4-like protein 1 [Nasonia vitripennis]
Length=338

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 63/106 (59%), Gaps = 7/106 (7%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKA-EWEYFVHYTGWNKNWDEWLGIDRLMKVTEEN  415
            F+EGE VL +H   +Y+AK  KT   K  + +Y +HY GWNKNWDEW+   R+MK  E N
Sbjct  9    FQEGERVLCFHGPLIYEAKCLKTNVTKEKQVKYLIHYAGWNKNWDEWVPESRVMKYNEVN  68

Query  416  LRKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDK  553
            +++Q+      D++K   A++  Q   K +  ++   + K+V KDK
Sbjct  69   VQRQK------DLQKTHAAQQIGQKGKKSTVFSKVSLKGKEVSKDK  108



>ref|XP_004403649.1| PREDICTED: mortality factor 4-like protein 1 isoform 2 [Odobenus 
rosmarus divergens]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>dbj|BAE27430.1| unnamed protein product [Mus musculus]
Length=314

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  2    FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  61

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  62   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  110



>emb|CAJ82495.1| mortality factor 4 like 1 [Xenopus (Silurana) tropicalis]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 5/102 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            +KQ+EL      K N+      +++A       A  Q+K+V+
Sbjct  71   QKQKELQ-----KANQDQYVEGKMRAAAPGKKTAALQQKNVE  107



>ref|XP_899406.1| PREDICTED: mortality factor 4-like protein 1 [Mus musculus]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>ref|XP_010795677.1| PREDICTED: mortality factor 4-like protein 1 isoform X1 [Notothenia 
coriiceps]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 57/105 (54%), Gaps = 4/105 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K        +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKINIKDKHIKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDK  553
            +KQ+EL         E   RG+    K      A  QK DV+  K
Sbjct  71   QKQKELQRANQDHYVEGRMRGAAPNKKIP----APPQKNDVKTKK  111



>ref|NP_001011999.1| mortality factor 4-like protein 1 [Rattus norvegicus]
 sp|Q6AYU1.1|MO4L1_RAT RecName: Full=Mortality factor 4-like protein 1; AltName: Full=MORF-related 
gene 15 protein; AltName: Full=Transcription 
factor-like protein MRG15 [Rattus norvegicus]
 gb|AAH78910.1| Mortality factor 4 like 1 [Rattus norvegicus]
 gb|EDL77560.1| mortality factor 4 like 1, isoform CRA_c [Rattus norvegicus]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDANL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>emb|CAB70879.2| hypothetical protein [Homo sapiens]
Length=324

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>gb|AAH67826.1| Mortality factor 4 like 1 [Homo sapiens]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>ref|XP_005366700.1| PREDICTED: mortality factor 4-like protein 1 isoform X3 [Microtus 
ochrogaster]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>ref|XP_010982185.1| PREDICTED: mortality factor 4-like protein 1 [Camelus dromedarius]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>ref|NP_006782.1| mortality factor 4-like protein 1 isoform 1 [Homo sapiens]
 ref|NP_077751.1| mortality factor 4-like protein 1 isoform b [Mus musculus]
 ref|NP_001240678.1| mortality factor 4-like protein 1 [Oryctolagus cuniculus]
 ref|NP_001253112.1| mortality factor 4-like protein 1 [Macaca mulatta]
 ref|XP_002753410.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Callithrix 
jacchus]
 ref|XP_003413897.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Loxodonta 
africana]
 ref|XP_003901327.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Papio 
anubis]
 ref|XP_004056663.1| PREDICTED: mortality factor 4-like protein 1 isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004088377.1| PREDICTED: mortality factor 4-like protein 1 isoform 2 [Nomascus 
leucogenys]
 ref|XP_004278394.1| PREDICTED: mortality factor 4-like protein 1 isoform 2 [Orcinus 
orca]
 ref|XP_004317875.1| PREDICTED: mortality factor 4-like protein 1 isoform 2 [Tursiops 
truncatus]
 ref|XP_004421937.1| PREDICTED: mortality factor 4-like protein 1 isoform 3 [Ceratotherium 
simum simum]
 ref|XP_004874862.1| PREDICTED: mortality factor 4-like protein 1 [Heterocephalus 
glaber]
 ref|XP_005080766.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Mesocricetus 
auratus]
 ref|XP_005316923.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Ictidomys 
tridecemlineatus]
 ref|XP_005560279.1| PREDICTED: uncharacterized LOC101865446 isoform X3 [Macaca fascicularis]
 ref|XP_006142682.1| PREDICTED: mortality factor 4-like protein 1-like [Tupaia chinensis]
 ref|XP_007100249.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Physeter 
catodon]
 ref|XP_007167573.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007458391.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Lipotes 
vexillifer]
 ref|XP_007950020.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Orycteropus 
afer afer]
 ref|XP_008530544.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Equus 
przewalskii]
 ref|XP_008589483.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Galeopterus 
variegatus]
 ref|XP_008821615.1| PREDICTED: mortality factor 4-like protein 1 isoform X3 [Nannospalax 
galili]
 ref|XP_009427925.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Pan 
troglodytes]
 ref|XP_010953480.1| PREDICTED: mortality factor 4-like protein 1 [Camelus bactrianus]
 gb|AAD29872.1|AF100615_1 MRG15 protein [Homo sapiens]
 gb|AAF29033.1|AF161546_1 HSPC061 [Homo sapiens]
 gb|AAF80854.1|AF167173_1 MSL3-1 protein [Homo sapiens]
 gb|AAK07406.1|AF319620_1 histone acetylase complex subunit MRG15-1 [Mus musculus]
 gb|AAQ13497.1|AF109188_1 FWP006 [Homo sapiens]
 gb|AAD20970.1| HSPC008 [Homo sapiens]
 gb|AAH02936.1| Mortality factor 4 like 1 [Homo sapiens]
 dbj|BAB30219.1| unnamed protein product [Mus musculus]
 gb|AAH03894.1| Mortality factor 4 like 1 [Mus musculus]
 dbj|BAB58904.1| MRG15 [Mus musculus]
 gb|AAH17619.1| Mortality factor 4 like 1 [Mus musculus]
 gb|AAH22845.1| Mortality factor 4 like 1 [Homo sapiens]
 gb|AAH83118.1| Mortality factor 4 like 1 [Mus musculus]
 gb|AAH92293.1| Mortality factor 4 like 1 [Mus musculus]
 dbj|BAE40852.1| unnamed protein product [Mus musculus]
 dbj|BAE39239.1| unnamed protein product [Mus musculus]
 dbj|BAE40266.1| unnamed protein product [Mus musculus]
 dbj|BAE40454.1| unnamed protein product [Mus musculus]
 dbj|BAE40475.1| unnamed protein product [Mus musculus]
 dbj|BAE40524.1| unnamed protein product [Mus musculus]
 dbj|BAE26980.1| unnamed protein product [Mus musculus]
 gb|AAI03784.1| Mortality factor 4 like 1 [Mus musculus]
 gb|EAW99144.1| mortality factor 4 like 1, isoform CRA_a [Homo sapiens]
 gb|EAW99146.1| mortality factor 4 like 1, isoform CRA_a [Homo sapiens]
 gb|EAW99147.1| mortality factor 4 like 1, isoform CRA_a [Homo sapiens]
 gb|ABM83528.1| mortality factor 4 like 1 [synthetic construct]
 gb|ABM86763.1| mortality factor 4 like 1 [synthetic construct]
 gb|EDK97678.1| mCG125079 [Mus musculus]
 gb|EDL20904.1| mCG7766, isoform CRA_c [Mus musculus]
 dbj|BAG11434.1| mortality factor 4-like protein 1 [synthetic construct]
 gb|AIC50757.1| MORF4L1, partial [synthetic construct]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>gb|AAI41841.1| Mortality factor 4 like 1 [Homo sapiens]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>ref|NP_001011155.1| mortality factor 4 like 1 [Xenopus (Silurana) tropicalis]
 gb|AAH84908.1| mortality factor 4 like 2 [Xenopus (Silurana) tropicalis]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 5/102 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            +KQ+EL      K N+      +++A       A  Q+K+V+
Sbjct  71   QKQKELQ-----KANQDQYVEGKMRAAAPGKKTAALQQKNVE  107



>ref|XP_006888316.1| PREDICTED: mortality factor 4-like protein 1-like isoform X2 
[Elephantulus edwardii]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>ref|XP_004625436.1| PREDICTED: mortality factor 4-like protein 1-like [Octodon degus]
Length=323

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>ref|XP_003967507.1| PREDICTED: mortality factor 4-like protein 1-like isoform 2 [Takifugu 
rubripes]
Length=339

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  E NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKISIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVESNL  70

Query  419  RKQQEL  436
            +KQ+EL
Sbjct  71   QKQKEL  76



>ref|XP_004480429.1| PREDICTED: mortality factor 4-like protein 1 isoform 3 [Dasypus 
novemcinctus]
 ref|XP_004617676.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Sorex 
araneus]
 dbj|BAE29963.1| unnamed protein product [Mus musculus]
Length=323

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKAPG  119



>ref|XP_006789317.1| PREDICTED: mortality factor 4-like protein 1-like [Neolamprologus 
brichardi]
Length=323

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 4/105 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKINIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDK  553
            +KQ+EL         E   RG     K    +    QK DV+  K
Sbjct  71   QKQRELQRANQDHYVEGKMRGQAPNKKIPAAS----QKNDVKTKK  111



>ref|XP_004553110.1| PREDICTED: mortality factor 4-like protein 1-like isoform X2 
[Maylandia zebra]
Length=323

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 4/105 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKINIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDK  553
            +KQ+EL         E   RG     K    +    QK DV+  K
Sbjct  71   QKQRELQRANQDHYVEGKMRGQAPNKKIPAAS----QKNDVKTKK  111



>ref|XP_003440502.1| PREDICTED: mortality factor 4-like protein 1-like isoformX1 [Oreochromis 
niloticus]
 ref|XP_005730122.1| PREDICTED: mortality factor 4-like protein 1-like [Pundamilia 
nyererei]
 ref|XP_005941781.1| PREDICTED: mortality factor 4-like protein 1-like isoform X2 
[Haplochromis burtoni]
Length=323

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 4/105 (4%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKINIKDKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQKDK  553
            +KQ+EL         E   RG     K    +    QK DV+  K
Sbjct  71   QKQRELQRANQDHYVEGKMRGQAPNKKIPAAS----QKNDVKTKK  111



>ref|XP_001989538.1| GH18746 [Drosophila grimshawi]
 gb|EDV92600.1| GH18746 [Drosophila grimshawi]
Length=451

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 63/104 (61%), Gaps = 5/104 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F +GE VL +H   +Y+AK+ KT+   +  EY++HY GW+KNWDEW+   R++K  ++N+
Sbjct  21   FADGERVLCFHGPLIYEAKVLKTKPESSPVEYYIHYAGWSKNWDEWVPESRVLKYNDDNV  80

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAK----CSTGTRAKRQKKD  538
            ++Q+EL   +  +  +  ++GS  KAK        +RA    KD
Sbjct  81   KRQKELARLHGERSKKDNKKGSA-KAKKMEQVGNESRASTPSKD  123



>ref|XP_008159043.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Eptesicus 
fuscus]
Length=323

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 63/110 (57%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K + G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTAGLQQKSVEVKTKKNKQKTPG  119



>ref|XP_005974058.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Pantholops 
hodgsonii]
Length=323

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 63/110 (57%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K + G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTAGLQQKNVEVKTKKNKQKTPG  119



>ref|XP_005221943.1| PREDICTED: mortality factor 4-like protein 1 isoform X3 [Bos 
taurus]
 ref|XP_005889827.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Bos 
mutus]
 ref|XP_006044079.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Bubalus 
bubalis]
 ref|XP_010841518.1| PREDICTED: mortality factor 4-like protein 1 isoform X1 [Bison 
bison bison]
Length=323

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 63/110 (57%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K + G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTAGLQQKNLDVKTKKNKQKTPG  119



>ref|XP_008308783.1| PREDICTED: mortality factor 4-like protein 1 isoform X2 [Cynoglossus 
semilaevis]
Length=273

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K    + + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKISIKEKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNL  70

Query  419  RKQQEL  436
             KQ+EL
Sbjct  71   AKQKEL  76



>ref|XP_004018121.1| PREDICTED: mortality factor 4-like protein 1 [Ovis aries]
Length=317

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 63/110 (57%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  5    FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  64

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K + G + K    + KK+ QK  G
Sbjct  65   QKQRELQKANQEQYAEGKMRGAA-PGKKTAGLQQKNVEVKTKKNKQKTPG  113



>pdb|2LRQ|A Chain A, Chemical Shift Assignment And Solution Structure Of 
Fr822a From Drosophila Melanogaster. Northeast Structural Genomics 
Consortium Target Fr822a
Length=85

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F +GE VL +H   +Y+AK+ KT+      EY++HY GW+KNWDEW+  +R++K  ++N+
Sbjct  13   FVDGERVLCFHGPLIYEAKVLKTKPDATPVEYYIHYAGWSKNWDEWVPENRVLKYNDDNV  72

Query  419  RKQQEL  436
            +++QEL
Sbjct  73   KRRQEL  78



>ref|XP_011341427.1| PREDICTED: mortality factor 4-like protein 1 [Cerapachys biroi]
 gb|EZA61890.1| Mortality factor 4-like protein [Cerapachys biroi]
Length=336

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 64/100 (64%), Gaps = 5/100 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVK-AEWEYFVHYTGWNKNWDEWLGIDRLMKVTEEN  415
            F+EGE+VL +H   +Y+AK  K+   K  + +YF+HY GWNKNWDEW+   R++K  E N
Sbjct  7    FQEGEKVLCFHGPLIYEAKCLKSSINKDKQIKYFIHYAGWNKNWDEWVPESRVLKYNEAN  66

Query  416  LRKQQEL----NNKYDMKKNEKARRGSQLKAKCSTGTRAK  523
            +++Q+E+    +N+   +KN+K    ++ + + S G R K
Sbjct  67   VQRQREVQRAHSNQQSAQKNKKGNTTTKTQGRRSDGGREK  106



>gb|EHB06135.1| Mortality factor 4-like protein 1 [Heterocephalus glaber]
Length=190

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF++Y+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIYYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCS  505
            +KQ+EL      +  E+  RG+    K S
Sbjct  71   QKQRELQKANQEQYAERKMRGAAPGKKTS  99



>ref|XP_011050489.1| PREDICTED: mortality factor 4-like protein 1 [Acromyrmex echinatior]
 gb|EGI67962.1| Mortality factor 4-like protein 1 [Acromyrmex echinatior]
Length=334

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKA-EWEYFVHYTGWNKNWDEWLGIDRLMKVTEEN  415
            F+EGE+VL +H   +Y+AK  K+   K  + +Y +HY GWNKNWDEW+   R++K  E N
Sbjct  7    FQEGEKVLCFHGPLIYEAKCLKSSITKEKQVKYLIHYAGWNKNWDEWVPESRVLKYNEAN  66

Query  416  LRKQQEL----NNKYDMKKNEKARRGSQLKAKCSTGTRAK  523
            ++KQ+E+    +N+   +KN+K    ++ + + S G R K
Sbjct  67   VQKQREVQRAHSNQQSAQKNKKGNTTTKTQGRRSEGGREK  106



>ref|XP_002031094.1| GM25788 [Drosophila sechellia]
 gb|EDW42080.1| GM25788 [Drosophila sechellia]
Length=424

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 65/102 (64%), Gaps = 7/102 (7%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F +GE VL +H   +Y+AK+ KT+      EY++HY GW+KNWDEW+  +R++K  ++N+
Sbjct  22   FVDGERVLCFHGPLIYEAKVLKTKPDATPVEYYIHYAGWSKNWDEWVPENRVLKYNDDNV  81

Query  419  RKQQEL------NNKYDMKK-NEKARRGSQLKAKCSTGTRAK  523
            +++QEL       +K D KK + KA++  Q++ +    T +K
Sbjct  82   KRRQELARQCGERSKKDNKKGSAKAKKMEQMRNESRASTPSK  123



>ref|XP_007984162.1| PREDICTED: LOW QUALITY PROTEIN: mortality factor 4-like protein 
1 [Chlorocebus sabaeus]
Length=323

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGEXVLCFHGPLLYEAKCVKVAIKDKQVKYFLHYSGWNKNWDEWVPESRVLKYMDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAK----RQKKDVQKDKG  556
            +KQ+EL      +  E   RG+    K ++G + K    + KK+ QK  G
Sbjct  71   QKQRELQKANQEQYAEGKMRGAA-PGKKTSGLQQKNVEVKTKKNKQKTPG  119



>ref|XP_008308781.1| PREDICTED: mortality factor 4-like protein 1 isoform X1 [Cynoglossus 
semilaevis]
Length=323

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K    + + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKISIKEKQIKYFIHYSGWNKNWDEWVPESRVLKYVDSNL  70

Query  419  RKQQEL  436
             KQ+EL
Sbjct  71   AKQKEL  76



>ref|XP_006628824.1| PREDICTED: mortality factor 4-like protein 1-like isoform X2 
[Lepisosteus oculatus]
Length=323

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 5/102 (5%)
 Frame = +2

Query  239  FEEGEEVLAYHNQCVYKAKIQKTRFVKAEWEYFVHYTGWNKNWDEWLGIDRLMKVTEENL  418
            F+EGE VL +H   +Y+AK  K      + +YF+HY+GWNKNWDEW+   R++K  + NL
Sbjct  11   FQEGERVLCFHGPLLYEAKCVKVNIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL  70

Query  419  RKQQELNNKYDMKKNEKARRGSQLKAKCSTGTRAKRQKKDVQ  544
            +KQ+EL      K N++     +++    +   A  Q+K+V+
Sbjct  71   QKQKELQ-----KANQEQYAEGKMRGVAPSKKIAAVQQKNVE  107



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840