BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP002E04 549 bp,

Length=510
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606023.1|  PREDICTED: universal stress protein A-like p...    211   3e-66   Nicotiana tomentosiformis
ref|XP_009758839.1|  PREDICTED: universal stress protein A-like p...    210   8e-66   Nicotiana sylvestris
ref|XP_009606017.1|  PREDICTED: uncharacterized protein C167.05-like    209   2e-65   Nicotiana tomentosiformis
gb|AID16042.1|  putative universal stress protein                       207   1e-64   Catharanthus roseus [chatas]
ref|XP_009783752.1|  PREDICTED: uncharacterized protein C167.05-like    206   3e-64   Nicotiana sylvestris
ref|XP_004246377.1|  PREDICTED: universal stress protein A-like p...    204   2e-63   Solanum lycopersicum
ref|XP_006357577.1|  PREDICTED: universal stress protein A-like p...    202   7e-63   Solanum tuberosum [potatoes]
ref|XP_004246376.1|  PREDICTED: uncharacterized protein C167.05-like    202   2e-62   Solanum lycopersicum
gb|AGT78204.1|  universal stress protein                                201   2e-62   Solanum torvum [berenjena cimarrona]
ref|XP_006357578.1|  PREDICTED: universal stress protein A-like p...    200   6e-62   Solanum tuberosum [potatoes]
gb|EYU41796.1|  hypothetical protein MIMGU_mgv1a015230mg                199   2e-61   Erythranthe guttata [common monkey flower]
emb|CDP06551.1|  unnamed protein product                                197   9e-61   Coffea canephora [robusta coffee]
gb|AHL20266.1|  universal stress protein                                195   7e-60   Olea europaea
ref|XP_011077614.1|  PREDICTED: universal stress protein A-like p...    194   2e-59   Sesamum indicum [beniseed]
ref|XP_009602951.1|  PREDICTED: universal stress protein A-like p...    192   1e-58   Nicotiana tomentosiformis
ref|XP_009776099.1|  PREDICTED: universal stress protein A-like p...    191   2e-58   Nicotiana sylvestris
ref|NP_001238489.1|  uncharacterized protein LOC100499951               187   1e-56   Glycine max [soybeans]
gb|KHN06032.1|  Universal stress protein                                187   1e-56   Glycine soja [wild soybean]
ref|XP_004249840.1|  PREDICTED: universal stress protein A-like p...    186   3e-56   Solanum lycopersicum
ref|XP_006349538.1|  PREDICTED: universal stress protein A-like p...    186   3e-56   Solanum tuberosum [potatoes]
gb|KHN15657.1|  Universal stress protein A-like protein                 185   6e-56   Glycine soja [wild soybean]
ref|XP_008442491.1|  PREDICTED: uncharacterized protein C167.05         185   8e-56   Cucumis melo [Oriental melon]
ref|XP_002275745.1|  PREDICTED: universal stress protein A-like p...    184   1e-55   Vitis vinifera
ref|XP_006850424.1|  hypothetical protein AMTR_s00165p00044350          184   2e-55   Amborella trichopoda
ref|NP_001236136.1|  uncharacterized protein LOC100306513               184   2e-55   Glycine max [soybeans]
ref|XP_004163858.1|  PREDICTED: uncharacterized protein C167.05-l...    183   2e-55   
ref|XP_010101861.1|  hypothetical protein L484_023651                   183   2e-55   Morus notabilis
ref|XP_006429235.1|  hypothetical protein CICLE_v10012955mg             183   2e-55   Citrus clementina
ref|XP_011094934.1|  PREDICTED: universal stress protein A-like p...    182   5e-55   Sesamum indicum [beniseed]
ref|XP_008370018.1|  PREDICTED: uncharacterized protein C167.05         181   2e-54   Malus domestica [apple tree]
ref|XP_007206040.1|  hypothetical protein PRUPE_ppa012560mg             181   2e-54   Prunus persica
ref|XP_010671709.1|  PREDICTED: uncharacterized protein C167.05         181   3e-54   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|AFK43920.1|  unknown                                                 180   4e-54   Lotus japonicus
ref|XP_010044014.1|  PREDICTED: universal stress protein A-like p...    180   7e-54   Eucalyptus grandis [rose gum]
ref|XP_004961892.1|  PREDICTED: universal stress protein A-like p...    179   1e-53   Setaria italica
ref|XP_009378881.1|  PREDICTED: uncharacterized protein C167.05-like    179   1e-53   Pyrus x bretschneideri [bai li]
ref|XP_008240065.1|  PREDICTED: uncharacterized protein C167.05-like    179   1e-53   Prunus mume [ume]
ref|XP_007133981.1|  hypothetical protein PHAVU_010G008900g             179   1e-53   Phaseolus vulgaris [French bean]
ref|XP_008359768.1|  PREDICTED: uncharacterized protein C167.05-like    178   3e-53   Malus domestica [apple tree]
ref|XP_008350501.1|  PREDICTED: uncharacterized protein C167.05-like    178   3e-53   Malus domestica [apple tree]
ref|XP_004507182.1|  PREDICTED: universal stress protein A-like p...    177   5e-53   Cicer arietinum [garbanzo]
ref|XP_009358793.1|  PREDICTED: uncharacterized protein C167.05         177   5e-53   Pyrus x bretschneideri [bai li]
gb|ACG42306.1|  USP family protein                                      177   6e-53   Zea mays [maize]
ref|NP_001142159.1|  USP family protein                                 177   8e-53   Zea mays [maize]
ref|XP_002439902.1|  hypothetical protein SORBIDRAFT_09g022230          176   1e-52   Sorghum bicolor [broomcorn]
ref|XP_010256749.1|  PREDICTED: uncharacterized protein C167.05         176   1e-52   Nelumbo nucifera [Indian lotus]
gb|KJB17332.1|  hypothetical protein B456_003G127300                    176   2e-52   Gossypium raimondii
ref|XP_008811502.1|  PREDICTED: uncharacterized protein C167.05         175   4e-52   Phoenix dactylifera
gb|KHG19158.1|  hypothetical protein F383_06056                         175   4e-52   Gossypium arboreum [tree cotton]
ref|XP_007026861.1|  Adenine nucleotide alpha hydrolases-like sup...    175   5e-52   Theobroma cacao [chocolate]
ref|XP_006403631.1|  hypothetical protein EUTSA_v10010778mg             174   7e-52   Eutrema salsugineum
gb|KJB11222.1|  hypothetical protein B456_001G247900                    171   7e-52   Gossypium raimondii
gb|ACJ84043.1|  unknown                                                 174   1e-51   Medicago truncatula
gb|ACJ83924.1|  unknown                                                 174   1e-51   Medicago truncatula
ref|XP_010905389.1|  PREDICTED: universal stress protein A-like p...    174   1e-51   Elaeis guineensis
gb|KHG25151.1|  hypothetical protein F383_09728                         174   1e-51   Gossypium arboreum [tree cotton]
ref|XP_002877951.1|  universal stress protein family protein            173   2e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_004137751.1|  PREDICTED: uncharacterized protein C167.05-l...    173   2e-51   
ref|XP_010529788.1|  PREDICTED: uncharacterized protein C167.05         173   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_007140453.1|  hypothetical protein PHAVU_008G113500g             172   3e-51   Phaseolus vulgaris [French bean]
ref|XP_011000055.1|  PREDICTED: uncharacterized protein LOC105107721    172   7e-51   Populus euphratica
ref|XP_007016274.1|  Adenine nucleotide alpha hydrolases-like sup...    172   7e-51   Theobroma cacao [chocolate]
ref|XP_002534082.1|  conserved hypothetical protein                     169   8e-51   Ricinus communis
ref|NP_566991.2|  Adenine nucleotide alpha hydrolases-like superf...    172   8e-51   Arabidopsis thaliana [mouse-ear cress]
gb|ABQ42110.1|  NOD18 protein                                           169   1e-50   Sonneratia caseolaris
gb|KFK34646.1|  hypothetical protein AALP_AA5G172700                    171   1e-50   Arabis alpina [alpine rockcress]
ref|XP_010905911.1|  PREDICTED: universal stress protein A-like p...    171   2e-50   Elaeis guineensis
gb|ABQ42109.1|  NOD18 protein                                           169   2e-50   Sonneratia alba
ref|XP_007026862.1|  Adenine nucleotide alpha hydrolases-like sup...    171   2e-50   Theobroma cacao [chocolate]
ref|XP_009392694.1|  PREDICTED: uncharacterized protein C167.05         171   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006291961.1|  hypothetical protein CARUB_v10018150mg             171   3e-50   Capsella rubella
gb|KHG13508.1|  hypothetical protein F383_20265                         169   3e-50   Gossypium arboreum [tree cotton]
gb|ABK22721.1|  unknown                                                 170   3e-50   Picea sitchensis
ref|XP_010553266.1|  PREDICTED: universal stress protein A-like p...    170   4e-50   Tarenaya hassleriana [spider flower]
gb|EMT01474.1|  Universal stress protein A-like protein                 170   4e-50   Aegilops tauschii
ref|XP_010923192.1|  PREDICTED: universal stress protein A-like p...    170   5e-50   Elaeis guineensis
ref|NP_001055716.1|  Os05g0453700                                       170   5e-50   
ref|XP_006654496.1|  PREDICTED: universal stress protein A-like p...    169   7e-50   Oryza brachyantha
ref|XP_010515911.1|  PREDICTED: universal stress protein A family...    169   9e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010427062.1|  PREDICTED: universal stress protein A family...    169   1e-49   Camelina sativa [gold-of-pleasure]
ref|NP_001236015.1|  uncharacterized protein LOC100306505               168   2e-49   Glycine max [soybeans]
ref|XP_010043475.1|  PREDICTED: universal stress protein A-like p...    168   2e-49   Eucalyptus grandis [rose gum]
ref|XP_004302689.1|  PREDICTED: uncharacterized protein C167.05         168   2e-49   Fragaria vesca subsp. vesca
gb|KJB19521.1|  hypothetical protein B456_003G127400                    168   2e-49   Gossypium raimondii
gb|KHG19157.1|  hypothetical protein F383_06055                         168   2e-49   Gossypium arboreum [tree cotton]
ref|XP_010504187.1|  PREDICTED: uncharacterized protein LOC104781260    168   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_003568332.1|  PREDICTED: universal stress protein A-like p...    168   3e-49   Brachypodium distachyon [annual false brome]
ref|NP_001235190.1|  uncharacterized protein LOC100499728               168   3e-49   Glycine max [soybeans]
gb|KHN05122.1|  Universal stress protein A-like protein                 167   3e-49   Glycine soja [wild soybean]
gb|AFK49059.1|  unknown                                                 167   4e-49   Lotus japonicus
gb|ABY84681.1|  universal stress protein 1                              167   4e-49   Gossypium arboreum [tree cotton]
emb|CDX73512.1|  BnaC08g24910D                                          164   6e-49   Brassica napus [oilseed rape]
ref|XP_009405844.1|  PREDICTED: universal stress protein A-like p...    167   7e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009116089.1|  PREDICTED: uncharacterized protein LOC103841315    164   7e-49   Brassica rapa
ref|XP_006373900.1|  ENOD18 family protein                              166   1e-48   Populus trichocarpa [western balsam poplar]
ref|XP_004507155.1|  PREDICTED: uncharacterized protein C167.05-like    166   1e-48   Cicer arietinum [garbanzo]
gb|AFK43282.1|  unknown                                                 166   2e-48   Lotus japonicus
emb|CDY13163.1|  BnaC04g26720D                                          166   2e-48   Brassica napus [oilseed rape]
ref|XP_009139276.1|  PREDICTED: universal stress protein A-like p...    166   2e-48   Brassica rapa
ref|XP_004137750.1|  PREDICTED: uncharacterized protein C167.05-l...    166   2e-48   
ref|XP_002309096.1|  ENOD18 family protein                              165   2e-48   Populus trichocarpa [western balsam poplar]
ref|NP_001236285.1|  uncharacterized protein LOC100527197               163   3e-48   Glycine max [soybeans]
ref|XP_011019203.1|  PREDICTED: universal stress protein A-like p...    165   4e-48   Populus euphratica
ref|XP_006424952.1|  hypothetical protein CICLE_v10029414mg             165   5e-48   Citrus clementina
ref|XP_002323532.2|  hypothetical protein POPTR_0016s10110g             166   6e-48   Populus trichocarpa [western balsam poplar]
gb|KDO66689.1|  hypothetical protein CISIN_1g041485mg                   165   6e-48   Citrus sinensis [Valencia orange]
ref|NP_001288953.1|  uncharacterized protein C167.05-like               162   1e-47   Brassica rapa
gb|ABK22475.1|  unknown                                                 164   1e-47   Picea sitchensis
ref|XP_007132029.1|  hypothetical protein PHAVU_011G060700g             163   2e-47   Phaseolus vulgaris [French bean]
ref|XP_004163857.1|  PREDICTED: uncharacterized protein C167.05-l...    162   5e-47   
ref|XP_008221790.1|  PREDICTED: uncharacterized protein LOC103321737    162   6e-47   Prunus mume [ume]
emb|CDY07565.1|  BnaC06g14990D                                          161   7e-47   Brassica napus [oilseed rape]
ref|XP_008384901.1|  PREDICTED: universal stress protein A-like p...    161   1e-46   Malus domestica [apple tree]
ref|XP_007206045.1|  hypothetical protein PRUPE_ppa012585mg             161   1e-46   Prunus persica
ref|XP_002520471.1|  conserved hypothetical protein                     161   1e-46   Ricinus communis
gb|AFK45410.1|  unknown                                                 160   2e-46   Medicago truncatula
ref|XP_009350161.1|  PREDICTED: universal stress protein A-like p...    160   2e-46   Pyrus x bretschneideri [bai li]
ref|XP_004492382.1|  PREDICTED: uncharacterized protein C167.05-like    159   3e-46   Cicer arietinum [garbanzo]
gb|KDP24530.1|  hypothetical protein JCGZ_25094                         158   4e-46   Jatropha curcas
gb|EEE63940.1|  hypothetical protein OsJ_18765                          160   5e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008386015.1|  PREDICTED: uncharacterized protein LOC103448528    158   2e-45   Malus domestica [apple tree]
emb|CAC18558.1|  ENOD18 protein                                         157   2e-45   Vicia faba [broad bean]
gb|EPS57397.1|  hypothetical protein M569_17421                         157   6e-45   Genlisea aurea
emb|CAC18556.1|  early nodulin ENOD18                                   155   8e-45   Vicia faba [broad bean]
ref|XP_003623213.1|  Early nodulin ENOD18                               154   9e-45   Medicago truncatula
gb|AFK37746.1|  unknown                                                 150   2e-44   Lotus japonicus
ref|XP_004291522.1|  PREDICTED: universal stress protein A-like p...    155   2e-44   Fragaria vesca subsp. vesca
ref|XP_002281607.1|  PREDICTED: uncharacterized protein C167.05         155   3e-44   Vitis vinifera
gb|AFK47553.1|  unknown                                                 151   7e-44   Medicago truncatula
ref|XP_008657063.1|  PREDICTED: universal stress protein A-like p...    153   1e-43   Zea mays [maize]
emb|CAC18557.1|  early nodulin ENOD18                                   150   1e-43   Vicia faba [broad bean]
ref|XP_008791855.1|  PREDICTED: universal stress protein A-like p...    153   2e-43   Phoenix dactylifera
ref|XP_004137752.1|  PREDICTED: uncharacterized protein C167.05-l...    148   3e-43   
gb|AID16037.1|  putative universal stress protein                       152   6e-43   Catharanthus roseus [chatas]
ref|XP_010917276.1|  PREDICTED: universal stress protein A-like p...    152   6e-43   Elaeis guineensis
ref|XP_011071386.1|  PREDICTED: uncharacterized protein C167.05-like    151   9e-43   Sesamum indicum [beniseed]
ref|XP_010062315.1|  PREDICTED: universal stress protein A-like p...    150   1e-42   Eucalyptus grandis [rose gum]
gb|KCW69440.1|  hypothetical protein EUGRSUZ_F02899                     151   4e-42   Eucalyptus grandis [rose gum]
ref|XP_010259285.1|  PREDICTED: uncharacterized protein C167.05         149   5e-42   Nelumbo nucifera [Indian lotus]
ref|XP_003567271.1|  PREDICTED: universal stress protein A-like p...    149   6e-42   
ref|XP_002458767.1|  hypothetical protein SORBIDRAFT_03g039910          148   1e-41   Sorghum bicolor [broomcorn]
dbj|BAK06554.1|  predicted protein                                      147   4e-41   Hordeum vulgare subsp. vulgare [barley]
gb|KJB17335.1|  hypothetical protein B456_003G127300                    146   4e-41   Gossypium raimondii
ref|XP_007147360.1|  hypothetical protein PHAVU_006G117600g             146   6e-41   Phaseolus vulgaris [French bean]
gb|AGT02387.1|  UspA-like protein                                       146   6e-41   Calotropis procera
ref|XP_006432876.1|  hypothetical protein CICLE_v10002725mg             146   6e-41   Citrus clementina
ref|XP_003547361.1|  PREDICTED: universal stress protein A-like p...    145   1e-40   Glycine max [soybeans]
ref|XP_010262906.1|  PREDICTED: uncharacterized protein C167.05-like    147   1e-40   Nelumbo nucifera [Indian lotus]
ref|XP_006645015.1|  PREDICTED: uncharacterized protein C167.05-like    145   1e-40   Oryza brachyantha
ref|XP_007026864.1|  Adenine nucleotide alpha hydrolases-like sup...    152   2e-40   Theobroma cacao [chocolate]
ref|XP_004487759.1|  PREDICTED: universal stress protein A-like p...    145   2e-40   Cicer arietinum [garbanzo]
ref|XP_006384122.1|  hypothetical protein POPTR_0004s07380g             145   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_008811359.1|  PREDICTED: uncharacterized protein C167.05-l...    144   3e-40   
ref|XP_006841013.1|  hypothetical protein AMTR_s00085p00099740          145   3e-40   Amborella trichopoda
ref|XP_010685657.1|  PREDICTED: universal stress protein A-like p...    144   4e-40   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008797443.1|  PREDICTED: universal stress protein A-like p...    145   5e-40   Phoenix dactylifera
gb|KHG02876.1|  hypothetical protein F383_26328                         144   8e-40   Gossypium arboreum [tree cotton]
ref|NP_001044810.1|  Os01g0849600                                       143   1e-39   
ref|XP_004970581.1|  PREDICTED: uncharacterized protein C167.05-like    143   1e-39   Setaria italica
gb|KJB34724.1|  hypothetical protein B456_006G080000                    143   2e-39   Gossypium raimondii
ref|XP_011005923.1|  PREDICTED: universal stress protein A-like p...    142   2e-39   Populus euphratica
ref|XP_008227919.1|  PREDICTED: universal stress protein A-like p...    143   2e-39   Prunus mume [ume]
gb|KJB19522.1|  hypothetical protein B456_003G127400                    136   3e-39   Gossypium raimondii
ref|XP_009780200.1|  PREDICTED: uncharacterized protein C167.05         142   3e-39   Nicotiana sylvestris
ref|XP_008811357.1|  PREDICTED: uncharacterized protein LOC103722...    141   4e-39   Phoenix dactylifera
ref|XP_010558670.1|  PREDICTED: universal stress protein A-like p...    141   5e-39   Tarenaya hassleriana [spider flower]
ref|XP_002305257.2|  hypothetical protein POPTR_0004s07380g             141   5e-39   Populus trichocarpa [western balsam poplar]
ref|XP_002528512.1|  conserved hypothetical protein                     141   6e-39   Ricinus communis
ref|XP_006298705.1|  hypothetical protein CARUB_v10014810mg             140   9e-39   Capsella rubella
gb|KJB17333.1|  hypothetical protein B456_003G127300                    138   1e-38   Gossypium raimondii
emb|CDX75899.1|  BnaC03g39820D                                          140   2e-38   Brassica napus [oilseed rape]
ref|XP_010931741.1|  PREDICTED: universal stress protein A-like p...    140   2e-38   Elaeis guineensis
ref|XP_007035783.1|  Adenine nucleotide alpha hydrolases-like sup...    140   2e-38   Theobroma cacao [chocolate]
gb|EPS64036.1|  hypothetical protein M569_10742                         140   2e-38   Genlisea aurea
ref|XP_009630214.1|  PREDICTED: uncharacterized protein C167.05 i...    140   2e-38   Nicotiana tomentosiformis
emb|CDO98772.1|  unnamed protein product                                138   2e-38   Coffea canephora [robusta coffee]
gb|KJB34720.1|  hypothetical protein B456_006G079900                    140   2e-38   Gossypium raimondii
emb|CDY52729.1|  BnaC01g44140D                                          140   2e-38   Brassica napus [oilseed rape]
ref|NP_001288846.1|  universal stress protein A-like protein            140   2e-38   Brassica rapa
gb|KDP35746.1|  hypothetical protein JCGZ_10518                         140   2e-38   Jatropha curcas
ref|XP_008797442.1|  PREDICTED: universal stress protein A-like p...    141   3e-38   Phoenix dactylifera
ref|XP_009381389.1|  PREDICTED: universal stress protein A-like p...    139   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006419393.1|  hypothetical protein CICLE_v10006081mg             139   3e-38   Citrus clementina
ref|XP_010548996.1|  PREDICTED: universal stress protein A-like p...    139   3e-38   Tarenaya hassleriana [spider flower]
ref|XP_011005922.1|  PREDICTED: universal stress protein A-like p...    139   3e-38   Populus euphratica
emb|CDX82383.1|  BnaA03g34380D                                          139   3e-38   Brassica napus [oilseed rape]
ref|XP_010276270.1|  PREDICTED: universal stress protein A-like p...    139   4e-38   Nelumbo nucifera [Indian lotus]
ref|XP_009146047.1|  PREDICTED: universal stress protein A-like p...    139   4e-38   Brassica rapa
gb|KDO71923.1|  hypothetical protein CISIN_1g031168mg                   139   4e-38   Citrus sinensis [Valencia orange]
ref|XP_009135511.1|  PREDICTED: universal stress protein A-like p...    139   5e-38   Brassica rapa
gb|EYU29653.1|  hypothetical protein MIMGU_mgv1a015303mg                139   6e-38   Erythranthe guttata [common monkey flower]
ref|XP_002271154.1|  PREDICTED: universal stress protein A-like p...    139   6e-38   Vitis vinifera
gb|KHG02877.1|  hypothetical protein F383_26329                         138   8e-38   Gossypium arboreum [tree cotton]
ref|XP_011085896.1|  PREDICTED: universal stress protein A-like p...    138   8e-38   Sesamum indicum [beniseed]
ref|XP_006373899.1|  hypothetical protein POPTR_0016s10110g             137   8e-38   Populus trichocarpa [western balsam poplar]
ref|XP_010064666.1|  PREDICTED: uncharacterized protein C167.05         138   9e-38   Eucalyptus grandis [rose gum]
ref|XP_008797478.1|  PREDICTED: uncharacterized protein LOC103712673    145   9e-38   
ref|XP_006298702.1|  hypothetical protein CARUB_v10014797mg             138   1e-37   Capsella rubella
ref|XP_010101064.1|  Universal stress protein A-like protein            138   1e-37   Morus notabilis
ref|XP_010504913.1|  PREDICTED: universal stress protein A-like p...    138   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_011038407.1|  PREDICTED: universal stress protein A-like p...    137   1e-37   Populus euphratica
emb|CDP01682.1|  unnamed protein product                                137   2e-37   Coffea canephora [robusta coffee]
gb|ACR38280.1|  unknown                                                 137   2e-37   Zea mays [maize]
ref|NP_850506.1|  adenine nucleotide alpha hydrolases-like protein      137   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009761731.1|  PREDICTED: universal stress protein A-like p...    137   2e-37   Nicotiana sylvestris
ref|XP_010465732.1|  PREDICTED: universal stress protein A-like p...    137   2e-37   Camelina sativa [gold-of-pleasure]
emb|CBI22890.3|  unnamed protein product                                135   3e-37   Vitis vinifera
ref|XP_002519217.1|  conserved hypothetical protein                     137   3e-37   Ricinus communis
ref|XP_002316036.1|  universal stress family protein                    137   3e-37   Populus trichocarpa [western balsam poplar]
ref|XP_009602053.1|  PREDICTED: universal stress protein A-like p...    137   4e-37   Nicotiana tomentosiformis
ref|XP_003570541.1|  PREDICTED: uncharacterized protein C167.05-like    137   4e-37   Brachypodium distachyon [annual false brome]
ref|XP_006357579.1|  PREDICTED: uncharacterized protein LOC102602636    130   4e-37   
gb|EMT31927.1|  hypothetical protein F775_31141                         136   5e-37   Aegilops tauschii
ref|XP_002452902.1|  hypothetical protein SORBIDRAFT_04g034630          136   5e-37   Sorghum bicolor [broomcorn]
ref|XP_002885183.1|  universal stress protein family protein            136   5e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_002277653.1|  PREDICTED: universal stress protein A-like p...    136   6e-37   Vitis vinifera
ref|XP_002323966.2|  hypothetical protein POPTR_0017s01470g             136   6e-37   Populus trichocarpa [western balsam poplar]
gb|AFK43932.1|  unknown                                                 136   7e-37   Lotus japonicus
ref|XP_003568882.1|  PREDICTED: universal stress protein A-like p...    136   8e-37   Brachypodium distachyon [annual false brome]
ref|NP_001132238.1|  hypothetical protein                               136   8e-37   Zea mays [maize]
ref|XP_002884367.1|  universal stress protein family protein            135   8e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_004954077.1|  PREDICTED: uncharacterized protein C167.05-l...    135   1e-36   Setaria italica
ref|XP_008438946.1|  PREDICTED: uncharacterized protein C167.05         135   1e-36   Cucumis melo [Oriental melon]
ref|XP_004954078.1|  PREDICTED: uncharacterized protein C167.05-l...    135   1e-36   
ref|XP_007141947.1|  hypothetical protein PHAVU_008G239500g             135   1e-36   Phaseolus vulgaris [French bean]
dbj|BAJ86638.1|  predicted protein                                      135   1e-36   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006406778.1|  hypothetical protein EUTSA_v10021673mg             135   1e-36   Eutrema salsugineum
ref|NP_566564.1|  Adenine nucleotide alpha hydrolases-like superf...    135   2e-36   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ92234.1|  predicted protein                                      135   2e-36   Hordeum vulgare subsp. vulgare [barley]
gb|ADB54804.1|  universal stress protein 7364                           135   2e-36   Hordeum vulgare subsp. vulgare [barley]
gb|AAQ02914.1|AF396464_1  C2.6 protein                                  135   2e-36   Pisum sativum [garden pea]
ref|XP_011010266.1|  PREDICTED: universal stress protein A-like p...    135   2e-36   Populus euphratica
ref|XP_006408321.1|  hypothetical protein EUTSA_v10021680mg             134   2e-36   Eutrema salsugineum
ref|NP_001237890.1|  uncharacterized protein LOC100500682               134   3e-36   Glycine max [soybeans]
gb|KDP42177.1|  hypothetical protein JCGZ_02907                         128   3e-36   Jatropha curcas
emb|CDX95890.1|  BnaC05g36410D                                          135   4e-36   Brassica napus [oilseed rape]
gb|EYU41387.1|  hypothetical protein MIMGU_mgv1a015186mg                134   4e-36   Erythranthe guttata [common monkey flower]
gb|KHN39491.1|  Universal stress protein A-like protein                 134   4e-36   Glycine soja [wild soybean]
dbj|BAJ86930.1|  predicted protein                                      134   5e-36   Hordeum vulgare subsp. vulgare [barley]
gb|EMT05701.1|  Universal stress protein A-like protein                 134   5e-36   Aegilops tauschii
ref|NP_001148736.1|  LOC100282352                                       134   5e-36   Zea mays [maize]
ref|XP_009383705.1|  PREDICTED: uncharacterized protein C167.05         134   6e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006298706.1|  hypothetical protein CARUB_v10014810mg             134   6e-36   Capsella rubella
gb|AFK33464.1|  unknown                                                 134   6e-36   Lotus japonicus
ref|XP_010508189.1|  PREDICTED: universal stress protein A-like p...    133   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_004295087.1|  PREDICTED: universal stress protein A-like p...    133   6e-36   Fragaria vesca subsp. vesca
gb|EEC74090.1|  hypothetical protein OsI_09119                          134   6e-36   Oryza sativa Indica Group [Indian rice]
ref|NP_001048266.1|  Os02g0773200                                       133   7e-36   
ref|XP_004134244.1|  PREDICTED: uncharacterized protein C167.05-like    133   7e-36   Cucumis sativus [cucumbers]
ref|XP_008223352.1|  PREDICTED: universal stress protein A-like p...    133   7e-36   Prunus mume [ume]
gb|ADB54803.1|  universal stress protein 7364                           133   8e-36   Hordeum vulgare subsp. vulgare [barley]
gb|KFK37768.1|  hypothetical protein AALP_AA3G027100                    133   8e-36   Arabis alpina [alpine rockcress]
ref|XP_007223599.1|  hypothetical protein PRUPE_ppa012490mg             133   9e-36   Prunus persica
gb|AAX13276.1|  USP family protein                                      133   9e-36   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011100770.1|  PREDICTED: uncharacterized protein LOC105178893    133   1e-35   Sesamum indicum [beniseed]
ref|XP_003616191.1|  Universal stress protein A-like protein            133   1e-35   Medicago truncatula
ref|NP_001054704.1|  Os05g0157200                                       133   1e-35   
ref|XP_009370564.1|  PREDICTED: universal stress protein A-like p...    133   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_004236679.1|  PREDICTED: universal stress protein A-like p...    132   2e-35   Solanum lycopersicum
ref|XP_006654074.1|  PREDICTED: universal stress protein A-like p...    132   2e-35   Oryza brachyantha
ref|XP_002973995.1|  hypothetical protein SELMODRAFT_267677             132   2e-35   Selaginella moellendorffii
emb|CDY50688.1|  BnaC05g47950D                                          132   2e-35   Brassica napus [oilseed rape]
ref|XP_006346765.1|  PREDICTED: uncharacterized protein C167.05-like    131   2e-35   Solanum tuberosum [potatoes]
ref|XP_008340610.1|  PREDICTED: uncharacterized protein LOC103403544    132   2e-35   Malus domestica [apple tree]
ref|XP_010485662.1|  PREDICTED: universal stress protein A-like p...    132   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010097787.1|  Universal stress protein A-like protein            132   2e-35   Morus notabilis
gb|EEC78561.1|  hypothetical protein OsI_18538                          132   2e-35   Oryza sativa Indica Group [Indian rice]
dbj|BAG74754.1|  universal stress protein                               132   3e-35   Hordeum bulbosum
gb|KFK39040.1|  hypothetical protein AALP_AA3G193100                    132   3e-35   Arabis alpina [alpine rockcress]
ref|XP_010463777.1|  PREDICTED: universal stress protein A-like p...    131   4e-35   Camelina sativa [gold-of-pleasure]
gb|ADB54801.1|  universal stress protein 3739                           132   4e-35   Hordeum vulgare subsp. vulgare [barley]
gb|ADB54802.1|  universal stress protein 3739                           131   4e-35   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006647984.1|  PREDICTED: uncharacterized protein C167.05-like    131   4e-35   Oryza brachyantha
dbj|BAG93543.1|  unnamed protein product                                132   5e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002440642.1|  hypothetical protein SORBIDRAFT_09g004470          131   5e-35   Sorghum bicolor [broomcorn]
gb|AFW82961.1|  putative USP family protein                             133   5e-35   Zea mays [maize]
gb|ADB93063.1|  universal stress protein                                131   7e-35   Jatropha curcas
ref|XP_009367132.1|  PREDICTED: universal stress protein A-like p...    131   7e-35   Pyrus x bretschneideri [bai li]
ref|XP_009416216.1|  PREDICTED: universal stress protein A-like p...    130   8e-35   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY43136.1|  BnaA05g32500D                                          130   9e-35   
ref|NP_001288857.1|  universal stress protein A-like protein            130   1e-34   
ref|XP_004229006.1|  PREDICTED: uncharacterized protein C167.05         130   1e-34   
gb|KJB34721.1|  hypothetical protein B456_006G079900                    130   1e-34   
gb|KDP27925.1|  hypothetical protein JCGZ_19005                         130   1e-34   
gb|AFW77248.1|  USP family protein                                      130   1e-34   
gb|ACG34645.1|  USP family protein                                      130   1e-34   
gb|KEH28228.1|  adenine nucleotide alpha hydrolase superfamily pr...    130   2e-34   
ref|XP_006840426.1|  hypothetical protein AMTR_s00045p00160510          129   2e-34   
ref|XP_008381381.1|  PREDICTED: universal stress protein A-like p...    129   3e-34   
ref|XP_010267982.1|  PREDICTED: uncharacterized protein LOC104605065    129   4e-34   
ref|XP_006576091.1|  PREDICTED: universal stress protein A-like p...    130   4e-34   
ref|XP_006358203.1|  PREDICTED: uncharacterized protein LOC102605897    128   6e-34   
gb|ABY84682.1|  universal stress protein 2                              116   7e-34   
ref|XP_004490794.1|  PREDICTED: universal stress protein A-like p...    127   2e-33   
ref|NP_001132553.1|  uncharacterized protein LOC100194018               126   4e-33   
gb|ACF81811.1|  unknown                                                 129   8e-33   
ref|XP_009369937.1|  PREDICTED: uncharacterized protein LOC103959310    125   1e-32   
ref|XP_003594749.1|  Universal stress protein A-like protein            125   1e-32   
gb|AID16043.1|  putative universal stress protein                       125   1e-32   
gb|ABN07974.1|  Universal stress protein (Usp)                          124   2e-32   
ref|XP_008463151.1|  PREDICTED: universal stress protein A-like p...    124   4e-32   
ref|XP_010671711.1|  PREDICTED: universal stress protein A-like p...    122   1e-31   
ref|XP_008390540.1|  PREDICTED: universal stress protein A-like p...    122   3e-31   
ref|XP_008791856.1|  PREDICTED: universal stress protein A-like p...    118   4e-30   
ref|XP_009780825.1|  PREDICTED: universal stress protein A-like p...    118   8e-30   
gb|ACZ74623.1|  cold stress protein-like protein                        116   3e-29   
ref|XP_003569311.1|  PREDICTED: universal stress protein A-like p...    115   6e-29   
ref|NP_001042142.2|  Os01g0170600                                       115   7e-29   
gb|ADB54812.1|  universal stress protein 5327                           114   1e-28   
gb|ABK25105.1|  unknown                                                 115   1e-28   
gb|AFG67370.1|  hypothetical protein 0_7326_01                          114   1e-28   
gb|AFG67365.1|  hypothetical protein 0_7326_01                          114   1e-28   
ref|XP_006643808.1|  PREDICTED: universal stress protein A-like p...    114   1e-28   
gb|AFG67364.1|  hypothetical protein 0_7326_01                          114   1e-28   
gb|AFG67363.1|  hypothetical protein 0_7326_01                          114   1e-28   
gb|AFG67369.1|  hypothetical protein 0_7326_01                          114   1e-28   
gb|EMT06684.1|  Universal stress protein A-like protein                 114   2e-28   
ref|XP_009631357.1|  PREDICTED: universal stress protein A-like p...    114   3e-28   
gb|AFG67362.1|  hypothetical protein 0_7326_01                          112   3e-28   
emb|CDM81416.1|  unnamed protein product                                113   4e-28   
ref|XP_006849511.1|  hypothetical protein AMTR_s00024p00142420          109   5e-28   
ref|XP_001751293.1|  predicted protein                                  112   7e-28   
gb|AAU44327.1|  unknown protein                                         110   1e-27   
ref|XP_007217382.1|  hypothetical protein PRUPE_ppa024511mg             106   2e-27   
gb|AFG67371.1|  hypothetical protein 0_7326_01                          110   2e-27   
gb|AFG46345.1|  hypothetical protein 2_896_01                           110   2e-27   
gb|AFG46339.1|  hypothetical protein 2_896_01                           110   3e-27   
gb|AFG46349.1|  hypothetical protein 2_896_01                           110   3e-27   
gb|EEE53950.1|  hypothetical protein OsJ_00543                          115   4e-27   
gb|EEC70016.1|  hypothetical protein OsI_00575                          115   4e-27   
gb|AFG46346.1|  hypothetical protein 2_896_01                           109   5e-27   
gb|KJB34725.1|  hypothetical protein B456_006G080000                    106   6e-27   
ref|XP_001763629.1|  predicted protein                                  110   8e-27   
ref|XP_010940209.1|  PREDICTED: uncharacterized protein C167.05-like    109   2e-26   
gb|KDO71924.1|  hypothetical protein CISIN_1g031168mg                   108   2e-26   
gb|EYU41393.1|  hypothetical protein MIMGU_mgv1a023533mg                108   3e-26   
ref|XP_009780827.1|  PREDICTED: uncharacterized protein LOC104229...    108   3e-26   
gb|EYU41394.1|  hypothetical protein MIMGU_mgv1a020570mg                107   4e-26   
ref|XP_009630215.1|  PREDICTED: uncharacterized protein LOC104120...    106   1e-25   
ref|XP_001784304.1|  predicted protein                                  105   3e-25   
ref|XP_002971813.1|  hypothetical protein SELMODRAFT_412437             105   4e-25   
gb|KJB28727.1|  hypothetical protein B456_005G066600                    105   4e-25   
ref|XP_002457269.1|  hypothetical protein SORBIDRAFT_03g004490          103   4e-25   
ref|XP_007223598.1|  hypothetical protein PRUPE_ppa012490mg             102   5e-25   
ref|NP_566198.1|  adenine nucleotide alpha hydrolases-like protein      102   7e-25   
ref|XP_004960811.1|  PREDICTED: universal stress protein A-like p...    104   1e-24   
ref|XP_002972333.1|  hypothetical protein SELMODRAFT_97437              103   2e-24   
ref|NP_001144087.1|  uncharacterized protein LOC100276920               101   2e-24   
ref|XP_002439361.1|  hypothetical protein SORBIDRAFT_09g005140          102   2e-24   
gb|EMS48553.1|  hypothetical protein TRIUR3_20184                       102   3e-24   
ref|XP_004968344.1|  PREDICTED: universal stress protein A-like p...    103   3e-24   
ref|XP_008795999.1|  PREDICTED: universal stress protein A-like p...    101   8e-24   
ref|XP_008655671.1|  PREDICTED: universal stress protein A-like p...  97.8    2e-23   
ref|XP_008388090.1|  PREDICTED: uncharacterized protein LOC103450503  79.0    2e-23   
ref|NP_974427.1|  Adenine nucleotide alpha hydrolases-like superf...  80.1    9e-23   
ref|XP_009390300.1|  PREDICTED: universal stress protein A-like p...  97.8    3e-22   
ref|XP_006373898.1|  hypothetical protein POPTR_0016s10110g           83.2    1e-21   
ref|NP_001237724.1|  uncharacterized protein LOC100306368             92.0    3e-20   
ref|XP_001766198.1|  predicted protein                                91.7    8e-20   
gb|KJB17336.1|  hypothetical protein B456_003G127300                  73.9    2e-19   
gb|EEC78600.1|  hypothetical protein OsI_18625                        87.8    1e-18   
gb|KHN41040.1|  Hypothetical protein glysoja_013382                   87.0    6e-18   
ref|XP_003623214.1|  Early nodulin ENOD18                             61.6    4e-17   
emb|CDY69106.1|  BnaAnng29340D                                        81.3    9e-17   
gb|ADB54816.1|  universal stress protein 9308                         74.3    3e-13   
gb|ADB54817.1|  universal stress protein 9308                         74.3    3e-13   
gb|EMT31582.1|  Universal stress protein A-like protein               71.6    2e-12   
gb|EMS48379.1|  Universal stress protein A-like protein               71.6    2e-12   
gb|EMS67984.1|  Universal stress protein A-like protein               69.7    4e-12   
ref|NP_001051280.1|  Os03g0750000                                     68.2    2e-11   
ref|XP_001774448.1|  predicted protein                                67.4    3e-11   
gb|AAR87267.1|  putative stress-related protein                       68.2    4e-11   
gb|EYU18171.1|  hypothetical protein MIMGU_mgv1a026609mg              67.8    4e-11   
ref|XP_006650590.1|  PREDICTED: universal stress protein A-like p...  67.8    4e-11   
ref|WP_023509057.1|  universal stress protein UspA                    67.4    4e-11   
gb|EMS53028.1|  Universal stress protein A-like protein               68.6    5e-11   
ref|XP_010916396.1|  PREDICTED: universal stress protein A-like p...  67.4    6e-11   
ref|WP_023176082.1|  universal stress protein UspG                    66.6    8e-11   
ref|XP_010668291.1|  PREDICTED: universal stress protein A-like p...  66.2    9e-11   
ref|XP_006647942.1|  PREDICTED: uncharacterized protein C167.05-like  61.6    2e-10   
ref|NP_001048190.1|  Os02g0760500                                     60.8    3e-10   
ref|XP_002889767.1|  hypothetical protein ARALYDRAFT_471075           62.4    4e-10   
ref|XP_004237985.1|  PREDICTED: universal stress protein A-like p...  64.7    4e-10   
gb|AAD46412.1|AF096262_1  ER6 protein                                 64.7    4e-10   
ref|XP_010490289.1|  PREDICTED: universal stress protein A-like p...  61.6    5e-10   
ref|XP_011016913.1|  PREDICTED: uncharacterized protein LOC105120...  64.7    6e-10   
ref|XP_006481853.1|  PREDICTED: universal stress protein A-like p...  64.7    6e-10   
ref|XP_006338073.1|  PREDICTED: universal stress protein A-like p...  64.3    6e-10   
ref|XP_009588034.1|  PREDICTED: universal stress protein A-like p...  64.3    6e-10   
ref|XP_008454297.1|  PREDICTED: uncharacterized protein C167.05       64.3    7e-10   
gb|EPZ31257.1|  UspA domain-containing protein                        64.3    7e-10   
ref|XP_006305720.1|  hypothetical protein CARUB_v10010470mg           64.3    7e-10   
gb|KDO35866.1|  hypothetical protein CISIN_1g038513mg                 62.4    8e-10   
gb|KHN12874.1|  hypothetical protein glysoja_029408                   62.0    8e-10   
emb|CDP11494.1|  unnamed protein product                              63.9    9e-10   
ref|XP_002302337.2|  ethylene-responsive family protein               63.9    1e-09   
gb|EEC76183.1|  hypothetical protein OsI_13519                        63.9    1e-09   
ref|XP_006417542.1|  hypothetical protein EUTSA_v10008924mg           60.8    1e-09   
gb|EMT31581.1|  Universal stress protein A-like protein               63.9    1e-09   
ref|XP_010475820.1|  PREDICTED: universal stress protein A-like p...  63.5    1e-09   
ref|XP_009770125.1|  PREDICTED: universal stress protein A-like p...  63.5    1e-09   
gb|KEH41788.1|  adenine nucleotide alpha hydrolase superfamily pr...  63.5    1e-09   
ref|WP_010631091.1|  universal stress protein UspA                    63.2    1e-09   
ref|NP_172445.2|  adenine nucleotide alpha hydrolases-like protein    60.5    1e-09   
ref|XP_002882756.1|  universal stress protein family protein          63.5    1e-09   
ref|XP_004299723.1|  PREDICTED: uncharacterized protein LOC101293000  63.5    1e-09   
ref|XP_006407394.1|  hypothetical protein EUTSA_v10021565mg           63.5    1e-09   
ref|XP_002467191.1|  hypothetical protein SORBIDRAFT_01g021200        63.2    1e-09   
ref|XP_006407393.1|  hypothetical protein EUTSA_v10021565mg           63.5    2e-09   
ref|WP_013623663.1|  universal stress protein UspA                    62.8    2e-09   
ref|XP_004152228.1|  PREDICTED: universal stress protein MJ0531-like  63.2    2e-09   
ref|XP_006677779.1|  hypothetical protein BATDEDRAFT_16272            63.5    2e-09   
ref|XP_006429979.1|  hypothetical protein CICLE_v10013408mg           63.5    2e-09   
ref|XP_009395576.1|  PREDICTED: universal stress protein A-like p...  63.2    2e-09   
gb|AGT17355.1|  hypothetical protein SHCRBa_260_G18_F_60              63.2    2e-09   
ref|WP_028976070.1|  universal stress protein UspA                    62.8    2e-09   
ref|WP_015261174.1|  universal stress protein UspA                    62.4    2e-09   
ref|XP_011094182.1|  PREDICTED: universal stress protein A-like p...  63.2    2e-09   
ref|XP_009393020.1|  PREDICTED: universal stress protein A-like p...  62.8    2e-09   
ref|XP_004983044.1|  PREDICTED: universal stress protein A-like p...  62.8    2e-09   
ref|XP_004300460.1|  PREDICTED: uncharacterized protein LOC101301587  62.8    2e-09   
ref|XP_007141257.1|  hypothetical protein PHAVU_008G180800g           62.8    3e-09   
ref|XP_006422530.1|  hypothetical protein CICLE_v10030411mg           62.4    3e-09   
ref|XP_006486684.1|  PREDICTED: uncharacterized protein C167.05-like  62.4    3e-09   
ref|WP_011142683.1|  hypothetical protein                             62.0    3e-09   
ref|XP_006444481.1|  hypothetical protein CICLE_v10022542mg           62.0    3e-09   
ref|XP_006841415.1|  hypothetical protein AMTR_s00003p00027540        62.0    3e-09   
gb|KHG27977.1|  hypothetical protein F383_14126                       62.0    3e-09   
ref|XP_010107691.1|  Universal stress protein A-like protein          62.0    4e-09   
ref|XP_010060094.1|  PREDICTED: uncharacterized protein LOC104448021  62.0    4e-09   
emb|CDY08484.1|  BnaA05g27200D                                        62.4    4e-09   
ref|XP_010675243.1|  PREDICTED: universal stress protein A-like p...  62.0    4e-09   
gb|AFK43196.1|  unknown                                               62.0    4e-09   
ref|XP_003615271.1|  Universal stress protein A-like protein          62.0    5e-09   
ref|XP_003615270.1|  Universal stress protein A-like protein          62.0    5e-09   
ref|XP_009146670.1|  PREDICTED: uncharacterized protein LOC103870298  62.0    5e-09   
ref|XP_007029145.1|  Adenine nucleotide alpha hydrolases-like sup...  61.6    5e-09   
dbj|BAF63495.1|  universal stress protein                             60.5    5e-09   
gb|KJB77133.1|  hypothetical protein B456_012G122100                  61.6    6e-09   
ref|XP_004148419.1|  PREDICTED: universal stress protein A-like p...  59.3    6e-09   
ref|NP_001030675.1|  universal stress protein-like protein            62.0    6e-09   
gb|EEE62486.1|  hypothetical protein OsJ_17283                        60.8    6e-09   
gb|AAM66054.1|  ethylene-responsive protein, putative                 61.6    6e-09   
emb|CDY44517.1|  BnaC01g10320D                                        59.7    6e-09   
ref|NP_850562.1|  universal stress protein-like protein               61.6    6e-09   
ref|NP_566406.1|  universal stress protein-like protein               61.6    6e-09   
emb|CDY47907.1|  BnaAnng09390D                                        61.6    7e-09   
ref|XP_003570587.1|  PREDICTED: uncharacterized protein C167.05 i...  61.2    8e-09   
ref|XP_006296619.1|  hypothetical protein CARUB_v10014583mg           61.6    8e-09   
ref|XP_006296620.1|  hypothetical protein CARUB_v10014583mg           61.6    8e-09   
gb|EEE59934.1|  hypothetical protein OsJ_12581                        63.9    8e-09   
ref|XP_010921785.1|  PREDICTED: universal stress protein A-like p...  61.2    8e-09   
ref|XP_010264158.1|  PREDICTED: universal stress protein A-like p...  60.8    8e-09   
gb|ABK21527.1|  unknown                                               61.2    8e-09   
ref|XP_010921509.1|  PREDICTED: uncharacterized protein LOC105045047  60.8    8e-09   
ref|XP_009121035.1|  PREDICTED: uncharacterized protein LOC103845...  61.2    8e-09   
ref|XP_010458272.1|  PREDICTED: universal stress protein A-like p...  61.2    9e-09   
ref|XP_009121027.1|  PREDICTED: uncharacterized protein LOC103845...  61.2    9e-09   
ref|XP_008797807.1|  PREDICTED: universal stress protein A-like p...  60.8    1e-08   
ref|XP_010464928.1|  PREDICTED: universal stress protein A-like p...  60.8    1e-08   
ref|XP_010486864.1|  PREDICTED: uncharacterized protein LOC104764...  61.2    1e-08   
emb|CDP00635.1|  unnamed protein product                              60.8    1e-08   
ref|XP_010498281.1|  PREDICTED: uncharacterized protein LOC104775...  61.2    1e-08   
ref|XP_010486863.1|  PREDICTED: uncharacterized protein LOC104764...  61.2    1e-08   
ref|XP_010464931.1|  PREDICTED: universal stress protein A-like p...  60.8    1e-08   
ref|XP_010486865.1|  PREDICTED: uncharacterized protein LOC104764...  61.2    1e-08   
ref|XP_010464930.1|  PREDICTED: universal stress protein A-like p...  60.8    1e-08   
ref|XP_010498264.1|  PREDICTED: uncharacterized protein LOC104775...  61.2    1e-08   
ref|XP_010498273.1|  PREDICTED: uncharacterized protein LOC104775...  61.2    1e-08   
ref|XP_009135196.1|  PREDICTED: uncharacterized protein LOC103859...  60.8    1e-08   
emb|CDY01070.1|  BnaC05g41300D                                        60.5    1e-08   
ref|XP_009135195.1|  PREDICTED: uncharacterized protein LOC103859...  60.8    1e-08   
gb|KDP29425.1|  hypothetical protein JCGZ_18346                       60.5    1e-08   
gb|KEH41787.1|  adenine nucleotide alpha hydrolase superfamily pr...  60.8    1e-08   
ref|XP_007018204.1|  Adenine nucleotide alpha hydrolases-like sup...  60.5    1e-08   
ref|XP_010917884.1|  PREDICTED: universal stress protein A-like p...  60.8    1e-08   
ref|XP_003544826.1|  PREDICTED: uncharacterized protein LOC100805...  60.5    1e-08   
gb|KFK41240.1|  hypothetical protein AALP_AA2G104000                  60.5    1e-08   
ref|XP_010087250.1|  Universal stress protein A-like protein          60.5    1e-08   
emb|CDS09283.1|  hypothetical protein LRAMOSA10643                    60.5    1e-08   
gb|KHN25064.1|  Universal stress protein A-like protein               60.8    1e-08   
ref|XP_010464927.1|  PREDICTED: uncharacterized protein LOC104745...  60.8    1e-08   
emb|CDY67360.1|  BnaAnng24100D                                        58.5    1e-08   
ref|XP_011094180.1|  PREDICTED: universal stress protein A-like p...  60.5    1e-08   
ref|XP_007051086.1|  Adenine nucleotide alpha hydrolases-like sup...  60.1    2e-08   
gb|ADE77419.1|  unknown                                               60.1    2e-08   
ref|WP_010471144.1|  MULTISPECIES: universal stress protein           60.1    2e-08   
ref|XP_002515296.1|  conserved hypothetical protein                   60.1    2e-08   
ref|XP_010542168.1|  PREDICTED: universal stress protein A-like p...  60.1    2e-08   
ref|XP_009389841.1|  PREDICTED: universal stress protein A-like p...  60.1    2e-08   
gb|AID16041.1|  putative universal stress protein                     59.7    2e-08   
ref|WP_010024656.1|  universal stress protein UspA                    59.7    2e-08   
ref|NP_850717.1|  adenine nucleotide alpha hydrolases-like superf...  56.2    2e-08   
ref|XP_010544073.1|  PREDICTED: uncharacterized protein C167.05       59.7    2e-08   
gb|KJB36208.1|  hypothetical protein B456_006G146300                  59.7    2e-08   
ref|XP_004135089.1|  PREDICTED: universal stress protein A-like p...  59.7    2e-08   
ref|XP_009758852.1|  PREDICTED: universal stress protein A-like p...  60.1    2e-08   
ref|XP_004981765.1|  PREDICTED: universal stress protein A-like p...  59.7    3e-08   
ref|NP_191404.2|  adenine nucleotide alpha hydrolases-like superf...  56.2    3e-08   
ref|XP_007044293.1|  Adenine nucleotide alpha hydrolases-like sup...  59.3    3e-08   



>ref|XP_009606023.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
Length=164

 Score =   211 bits (538),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H+S+ESRNKLW+QSG PLIPL EFRE E+L+KY+VK +++VLDLLDTATRQKEI VVAKL
Sbjct  43   HSSDESRNKLWAQSGSPLIPLVEFRELEVLEKYDVKTDIDVLDLLDTATRQKEINVVAKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDAREKLCD+IEDLKLDS VMG+RGL+++QRI +GSVTNYV++ ATCP+TVVK PDFH
Sbjct  103  YWGDAREKLCDAIEDLKLDSLVMGSRGLTTIQRIFLGSVTNYVMSNATCPVTVVKDPDFH  162

Query  456  KH  461
            KH
Sbjct  163  KH  164


 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ AL+WAIDNLADK DTFYIIH+
Sbjct  12  DFSKSSKTALQWAIDNLADKDDTFYIIHI  40



>ref|XP_009758839.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=164

 Score =   210 bits (535),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H+S+ESRNKLW+QSG PLIPL EFRE E+L+KY+VK +++VLDLLDTATRQKEI VV KL
Sbjct  43   HSSDESRNKLWAQSGSPLIPLVEFREAEVLEKYDVKTDIDVLDLLDTATRQKEINVVTKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDAREKLCD+IEDLKLDS VMG+RGL+++QRI +GSVTNYV++ ATCP+TVVK PDFH
Sbjct  103  YWGDAREKLCDAIEDLKLDSLVMGSRGLTTIQRIFLGSVTNYVMSNATCPVTVVKDPDFH  162

Query  456  KH  461
            KH
Sbjct  163  KH  164


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ ALKWAIDNLADKGDTFYIIH+
Sbjct  12  DFSKSSKTALKWAIDNLADKGDTFYIIHI  40



>ref|XP_009606017.1| PREDICTED: uncharacterized protein C167.05-like [Nicotiana tomentosiformis]
Length=164

 Score =   209 bits (532),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H+S+ESRNKLW++SG PLIPL+EFREPE++KKY+V+ +++VLDLLDTATRQKEI VV KL
Sbjct  43   HSSDESRNKLWAKSGSPLIPLAEFREPEVMKKYDVETDIDVLDLLDTATRQKEIKVVTKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDAREKL D+ EDLKLDS VMG+RGL +LQRIIMGSVTNYVLT ATC +TVVK PDFH
Sbjct  103  YWGDAREKLIDATEDLKLDSLVMGSRGLGTLQRIIMGSVTNYVLTNATCAVTVVKDPDFH  162

Query  456  KH  461
            KH
Sbjct  163  KH  164


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ ALKWAIDNLADK DTFYIIH+
Sbjct  12  DFSKSSKTALKWAIDNLADKDDTFYIIHI  40



>gb|AID16042.1| putative universal stress protein [Catharanthus roseus]
Length=164

 Score =   207 bits (526),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H  +ESRN+LW++SG PLIPL+EFR+PE++KKY+VK ++EVLDLLDT++RQKEITVV KL
Sbjct  43   HFLDESRNQLWAKSGSPLIPLAEFRQPEVMKKYDVKTDIEVLDLLDTSSRQKEITVVTKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDAREKLC+ IEDLKLDS VMG+RGL +LQRII+GSVTNYV+T ATCP+TVVK PDFH
Sbjct  103  YWGDAREKLCECIEDLKLDSLVMGSRGLGTLQRIILGSVTNYVITNATCPVTVVKDPDFH  162

Query  456  KH  461
            KH
Sbjct  163  KH  164


 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ AL WAI+NLADKGDTFYIIH+
Sbjct  12  DFSKSSKMALLWAIENLADKGDTFYIIHI  40



>ref|XP_009783752.1| PREDICTED: uncharacterized protein C167.05-like [Nicotiana sylvestris]
Length=164

 Score =   206 bits (525),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H+S+ESRNKLW++SG PLIPL+EFREPE++KKY+V+ +++VLDLLDTATRQKEI VV KL
Sbjct  43   HSSDESRNKLWAKSGSPLIPLAEFREPEVMKKYDVETDIDVLDLLDTATRQKEIKVVTKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDAREKL D+  DLKLDS VMG+RGL +LQRIIMGSVTNYVLT ATC +TVVK PDFH
Sbjct  103  YWGDAREKLIDATGDLKLDSLVMGSRGLGTLQRIIMGSVTNYVLTNATCAVTVVKDPDFH  162

Query  456  KH  461
            KH
Sbjct  163  KH  164


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ ALKWAIDNLADKGDTFYIIH+
Sbjct  12  DFSKSSKTALKWAIDNLADKGDTFYIIHI  40



>ref|XP_004246377.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
 ref|XP_010325820.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
Length=164

 Score =   204 bits (519),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H+S+ESRNKLW+QSG PLIPL EFRE E+LKKY+V+ ++E+LDLLDTATRQKEI +V KL
Sbjct  43   HSSDESRNKLWAQSGSPLIPLVEFREAEVLKKYDVETDIELLDLLDTATRQKEIKIVIKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDAREKLC+++E LKL+S VMG+RGLS+LQRI +GSVTNYVL+ ATCP+TVVK PDFH
Sbjct  103  YWGDAREKLCEAVEHLKLNSLVMGSRGLSTLQRIFLGSVTNYVLSVATCPVTVVKDPDFH  162

Query  456  KH  461
            KH
Sbjct  163  KH  164


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ ALKWAIDNLADKGDTFYIIH+
Sbjct  12  DFSKSSKTALKWAIDNLADKGDTFYIIHI  40



>ref|XP_006357577.1| PREDICTED: universal stress protein A-like protein-like [Solanum 
tuberosum]
Length=164

 Score =   202 bits (515),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H+S+ESRNKLW+QSG PLIPL+EFREPE+L+KY V+ ++E+LD+LDTA+RQKEI VV KL
Sbjct  43   HSSDESRNKLWAQSGSPLIPLAEFREPEVLEKYGVEIDIELLDMLDTASRQKEIKVVTKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDARE+LC+++EDLKL+  VMG+RGL++LQRI MGSVTNYV++ ATCP+TVVK PDFH
Sbjct  103  YWGDARERLCEAVEDLKLNCLVMGSRGLTTLQRIFMGSVTNYVMSHATCPVTVVKDPDFH  162

Query  456  KH  461
            KH
Sbjct  163  KH  164


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ ALKWAIDNLADK DTFYIIH+
Sbjct  12  DFSKSSKTALKWAIDNLADKDDTFYIIHI  40



>ref|XP_004246376.1| PREDICTED: uncharacterized protein C167.05-like [Solanum lycopersicum]
Length=164

 Score =   202 bits (513),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H+S+ESRNKLW++SG PLIPL+EFREPE+L+KY V+ ++E+LD+LDTA+RQKEI  V KL
Sbjct  43   HSSDESRNKLWAKSGSPLIPLAEFREPEVLEKYGVEIDIELLDMLDTASRQKEIKFVTKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDARE+LC+++EDLKL+S VMG+RGL++LQRI MGSVTNYV++ ATCP+TVVK PDFH
Sbjct  103  YWGDARERLCEAVEDLKLNSLVMGSRGLTTLQRIFMGSVTNYVMSHATCPVTVVKDPDFH  162

Query  456  KH  461
            KH
Sbjct  163  KH  164


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ ALKWAIDNLADK D FYIIH+
Sbjct  12  DFSKSSKTALKWAIDNLADKDDIFYIIHI  40



>gb|AGT78204.1| universal stress protein [Solanum torvum]
Length=164

 Score =   201 bits (512),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H S+ESRNKLW+QSG PLIPL EFRE E+L+KY+V+ + EVLDLLDTATRQKEI VV KL
Sbjct  43   HTSDESRNKLWAQSGSPLIPLVEFREAEVLQKYDVETDAEVLDLLDTATRQKEIKVVIKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDAREKLC+++E+LKL+  VMG+RGLS++QRI +GSVTNYVL+ ATCP+TVVK PDFH
Sbjct  103  YWGDAREKLCEAVEELKLNCLVMGSRGLSTIQRIFLGSVTNYVLSVATCPVTVVKDPDFH  162

Query  456  KH  461
            KH
Sbjct  163  KH  164


 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ ALKWAIDNLADKGDTFYIIH+
Sbjct  12  DFSKSSKAALKWAIDNLADKGDTFYIIHI  40



>ref|XP_006357578.1| PREDICTED: universal stress protein A-like protein-like [Solanum 
tuberosum]
Length=164

 Score =   200 bits (509),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H+S+ESRNKLW+QSG PLIPL EFRE E+L KY+V+ ++E+LDLLDTA+RQKEI +V KL
Sbjct  43   HSSDESRNKLWAQSGSPLIPLVEFREAEVLHKYDVETDIELLDLLDTASRQKEIKIVIKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDAREKLC+++EDLKL+S VMG+RGLS++QRI +GSVTNYVL+ ATCP+TVVK PDFH
Sbjct  103  YWGDAREKLCEAVEDLKLNSLVMGSRGLSTIQRIFLGSVTNYVLSVATCPVTVVKDPDFH  162

Query  456  K  458
            K
Sbjct  163  K  163


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ ALKWAIDNLADK DTFYIIH+
Sbjct  12  DFSKSSKTALKWAIDNLADKDDTFYIIHI  40



>gb|EYU41796.1| hypothetical protein MIMGU_mgv1a015230mg [Erythranthe guttata]
Length=164

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            +ESR+KLWS+SG PLIPL EFREPE++KKY V  ++EVLD+LDTA RQKEITVV KLYWG
Sbjct  46   DESRSKLWSKSGSPLIPLVEFREPEVMKKYEVPIDIEVLDILDTAARQKEITVVTKLYWG  105

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  461
            DAREKLC+++EDLKLDS VMG+RGLSS++RII+GSVTNYV+T+A CP+T+VK PDFHK+
Sbjct  106  DAREKLCEAVEDLKLDSLVMGSRGLSSIKRIILGSVTNYVMTSANCPVTIVKDPDFHKN  164


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFSKSS  AL+W+IDNLAD GDTFYI+H+  S
Sbjct  12  DFSKSSRAALRWSIDNLADSGDTFYILHIKSS  43



>emb|CDP06551.1| unnamed protein product [Coffea canephora]
Length=164

 Score =   197 bits (501),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H  +ESRN+LWSQSG PLIPL EFREPE++K+Y VK ++EVLD+LDTA RQKEI +V KL
Sbjct  43   HPLDESRNQLWSQSGSPLIPLVEFREPEVMKQYGVKTDIEVLDMLDTAARQKEIIIVWKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDAREKLC ++EDLKLDS VMG+RGLSS++RII+GSVT+Y+L  ATCP+TVVK PD H
Sbjct  103  YWGDAREKLCQAVEDLKLDSVVMGSRGLSSIRRIILGSVTDYLLANATCPVTVVKDPDLH  162

Query  456  KH  461
            +H
Sbjct  163  RH  164


 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 2/33 (6%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL--HP  94
           DFSKSS+ AL+WAI+NLADKGDTF++IH+  HP
Sbjct  12  DFSKSSKLALQWAIENLADKGDTFFVIHVNSHP  44



>gb|AHL20266.1| universal stress protein [Olea europaea]
Length=161

 Score =   195 bits (495),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +3

Query  102  SNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW  281
            S+ES NKL S+SG PLIPL+EFR PE++KKY+++ ++EVLD+LDTA RQKEI++V KLYW
Sbjct  42   SHESTNKLCSKSGSPLIPLAEFRVPEMMKKYDIQTDIEVLDMLDTAARQKEISIVTKLYW  101

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  461
            GDARE+LCD+IEDLKLDS VMG+RGL +LQRII+GSVTNY+++ A CP+T+VK PDFHKH
Sbjct  102  GDAREQLCDAIEDLKLDSLVMGSRGLGTLQRIILGSVTNYIISNAACPVTIVKDPDFHKH  161


 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ AL+WAIDNLADKGDTFYIIH+
Sbjct  12  DFSKSSKMALQWAIDNLADKGDTFYIIHI  40



>ref|XP_011077614.1| PREDICTED: universal stress protein A-like protein [Sesamum indicum]
Length=164

 Score =   194 bits (492),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H+ +ES  K+WS+SG PLIPL+EFREPE++ KY VK ++EVLD+LDTATRQKEI VV KL
Sbjct  43   HSLDESAQKIWSESGSPLIPLAEFREPEVMNKYQVKTDIEVLDMLDTATRQKEIHVVTKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDAR+KLC + +DLKLDS VMG+RGLS+L+RII+GSV+NYV+ TA+CP+T+VK PDFH
Sbjct  103  YWGDARDKLCQAADDLKLDSLVMGSRGLSALKRIILGSVSNYVIATASCPVTIVKDPDFH  162

Query  456  KH  461
            K+
Sbjct  163  KN  164


 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ AL+WA++NLADKGDT YI+H+
Sbjct  12  DFSKSSKAALQWALENLADKGDTVYILHI  40



>ref|XP_009602951.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
Length=168

 Score =   192 bits (488),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H  +ESR++LW+++G PL+P  EFREP++LK Y++K++++VLDLLDTA +QKEI ++AK+
Sbjct  47   HTLSESRDQLWAKTGSPLVPWVEFREPDVLKYYDIKSDVQVLDLLDTAAKQKEINIMAKV  106

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDAREK+CDSIEDLKL+S VMG+RGLS++QRI++GSVTNYVL  A CP+T+VK PDFH
Sbjct  107  YWGDAREKVCDSIEDLKLNSLVMGSRGLSTIQRIMLGSVTNYVLANAACPVTIVKDPDFH  166

Query  456  KH  461
            KH
Sbjct  167  KH  168


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFSKSS+ ALKW I+NLA KGDT YIIH+    L
Sbjct  16   DFSKSSKAALKWTIENLAAKGDTIYIIHIKTHTL  49



>ref|XP_009776099.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=164

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H   ESR++LW+++G PL+P  EFREP++LK Y++K+++ VLDLLDTA +QKEI +VAK+
Sbjct  43   HTLGESRDQLWAKTGSPLVPWVEFREPDVLKYYDIKSDVHVLDLLDTAAKQKEIKIVAKV  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDAREK+CDSIEDLKL+S VMG+RGLS++QRI++GSVTNYVL  A CP+T+VK PDFH
Sbjct  103  YWGDAREKVCDSIEDLKLNSLVMGSRGLSTIQRIMLGSVTNYVLANAACPVTIVKDPDFH  162

Query  456  KH  461
            KH
Sbjct  163  KH  164


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ AL+W I+NLA KGDT YIIH+
Sbjct  12  DFSKSSKAALRWTIENLAAKGDTIYIIHI  40



>ref|NP_001238489.1| uncharacterized protein LOC100499951 [Glycine max]
 gb|ACU14311.1| unknown [Glycine max]
Length=164

 Score =   187 bits (474),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++ +ESRNKLW++SG PLIPL EFREPE++KKY+V+ ++EVLD+LDTA+RQKEI +V K
Sbjct  42   PNSLDESRNKLWAKSGSPLIPLVEFREPEIMKKYDVEIDIEVLDMLDTASRQKEIHIVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            +YWGDAREKL D+IEDLKLDS VMG+RGLS++QRII+GSV+N+V+T A CP+T+VK P
Sbjct  102  IYWGDAREKLLDAIEDLKLDSLVMGSRGLSTIQRIILGSVSNFVMTNAPCPVTIVKEP  159


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFSKSS+ ALKWA +NLADKGDT Y+IH++P+ L
Sbjct  12   DFSKSSKNALKWAFENLADKGDTIYVIHINPNSL  45



>gb|KHN06032.1| Universal stress protein [Glycine soja]
Length=164

 Score =   187 bits (474),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++ +ESRNKLW++SG PLIPL EFREPE++KKY+V+ ++EVLD+LDTA+RQKEI +V K
Sbjct  42   PNSLDESRNKLWAKSGSPLIPLVEFREPEIMKKYDVEIDIEVLDMLDTASRQKEIHIVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            +YWGDAREKL D+IEDLKLDS VMG+RGLS++QRII+GSV+N+V+T A CP+T+VK P
Sbjct  102  IYWGDAREKLLDAIEDLKLDSLVMGSRGLSTIQRIILGSVSNFVMTNAPCPVTIVKEP  159


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFSKSS+ ALKWA +NLADKGDT Y+IH++P+ L
Sbjct  12   DFSKSSKNALKWAFENLADKGDTIYVIHINPNSL  45



>ref|XP_004249840.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
Length=166

 Score =   186 bits (472),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 108/123 (88%), Gaps = 1/123 (1%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVK-ANMEVLDLLDTATRQKEITVVAK  272
            H  +ESR++LW+++G PLIP  EFR+PE++K Y++K  +++V+DLLD AT+QK+I +VAK
Sbjct  44   HTLSESRDQLWAKTGSPLIPWVEFRDPEVMKYYDIKKTDVQVVDLLDAATKQKQINIVAK  103

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            +YWGDAREK+CDSIEDL+LDS VMG+RGLS++QRI++GSVTNYVL  A CP+T+VK PDF
Sbjct  104  VYWGDAREKVCDSIEDLRLDSLVMGSRGLSAIQRIMLGSVTNYVLNNAACPVTIVKDPDF  163

Query  453  HKH  461
            HKH
Sbjct  164  HKH  166



>ref|XP_006349538.1| PREDICTED: universal stress protein A-like protein-like [Solanum 
tuberosum]
Length=166

 Score =   186 bits (472),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 108/123 (88%), Gaps = 1/123 (1%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVK-ANMEVLDLLDTATRQKEITVVAK  272
            H  +ESR++LWS++G PLIP  EFR+PE++K Y++K  +++V+DLLD AT+QKEI +VAK
Sbjct  44   HTLSESRDQLWSKTGSPLIPWVEFRDPEVMKYYDIKKTDVQVVDLLDAATKQKEINIVAK  103

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            +YWGDAREK+CDSIEDL+L+S VMG+RGLS++QRI++GSVTNYVL  A CP+T+VK PDF
Sbjct  104  VYWGDAREKVCDSIEDLRLNSLVMGSRGLSTIQRIMLGSVTNYVLNNAACPVTIVKDPDF  163

Query  453  HKH  461
            HKH
Sbjct  164  HKH  166



>gb|KHN15657.1| Universal stress protein A-like protein [Glycine soja]
Length=167

 Score =   185 bits (470),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            +ESRNKLW++SG PLIPL EFREPE++KKY+V+ ++EVLDLLDTA+RQKEI +V K+YWG
Sbjct  46   DESRNKLWAESGSPLIPLVEFREPEIMKKYDVQIDIEVLDLLDTASRQKEIHIVTKIYWG  105

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            DAREKL D+IEDLKLDS VMG+RGLS++QRII+GSV+N+V+T A+CP+T+VK
Sbjct  106  DAREKLLDAIEDLKLDSLVMGSRGLSTIQRIILGSVSNFVMTHASCPVTIVK  157


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFSKSS+ ALKWA++NLADKGDT Y+IH++ + L
Sbjct  12   DFSKSSKNALKWALENLADKGDTIYVIHINSNSL  45



>ref|XP_008442491.1| PREDICTED: uncharacterized protein C167.05 [Cucumis melo]
Length=164

 Score =   185 bits (469),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++ NES ++LW++SG PLIPLSEFREPE+LKKY+VK +++ LD+LDT  RQKEITVV+K
Sbjct  42   PNSLNESAHRLWAESGSPLIPLSEFREPEVLKKYDVKIDIDALDILDTGARQKEITVVSK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREK+ D+IEDLKLDS VMG+RGLS+++RI++GSV+NYV+T A CP+TVVK  +F
Sbjct  102  LYWGDAREKIVDAIEDLKLDSLVMGSRGLSTIRRILLGSVSNYVITHAPCPVTVVKDSNF  161

Query  453  HKH  461
              H
Sbjct  162  PHH  164


 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFS SS+ ALKWAIDNLADKGDT YII+++P+ L
Sbjct  12   DFSDSSKNALKWAIDNLADKGDTLYIIYVNPNSL  45



>ref|XP_002275745.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 emb|CAN81966.1| hypothetical protein VITISV_034082 [Vitis vinifera]
 emb|CBI30465.3| unnamed protein product [Vitis vinifera]
Length=164

 Score =   184 bits (467),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +3

Query  99   ASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLY  278
            + +ESR+ LW+  G PLIPL+EFR+PE++KKY VK ++EVLD LDTA+RQKE+ +V KLY
Sbjct  44   SGDESRDVLWTTHGSPLIPLTEFRQPEIMKKYGVKTDIEVLDTLDTASRQKEVKIVTKLY  103

Query  279  WGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFHK  458
            WGDAR+KLC+++EDLKLDS VMG+RGLS+++RI++GSVTNYV+T ATCP+T+VK P  HK
Sbjct  104  WGDARDKLCEAVEDLKLDSLVMGSRGLSTIRRILLGSVTNYVMTNATCPVTIVKDPSSHK  163

Query  459  H  461
             
Sbjct  164  Q  164


 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFS SS+ AL+WAIDNLADKGD  YIIH+  S
Sbjct  12  DFSSSSKLALQWAIDNLADKGDLLYIIHIKSS  43



>ref|XP_006850424.1| hypothetical protein AMTR_s00165p00044350 [Amborella trichopoda]
 gb|ERN12005.1| hypothetical protein AMTR_s00165p00044350 [Amborella trichopoda]
Length=164

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 109/120 (91%), Gaps = 1/120 (1%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKK-YNVKANMEVLDLLDTATRQKEITVVAK  272
            H  +E +N+LW++SG PLIPLSEFR+P++LKK Y+V+++MEVLDLLDT +RQKE+T++AK
Sbjct  43   HRGDEEKNQLWAKSGSPLIPLSEFRDPDMLKKHYDVQSDMEVLDLLDTTSRQKEVTMLAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            +YWGDAREKLC+++EDLKLDS VMG+RGL  ++RI++GSV+NYVL+TA CP+T+VK P+F
Sbjct  103  IYWGDAREKLCEAVEDLKLDSLVMGSRGLGQIKRILLGSVSNYVLSTAACPVTIVKEPNF  162



>ref|NP_001236136.1| uncharacterized protein LOC100306513 [Glycine max]
 gb|ACU14717.1| unknown [Glycine max]
Length=167

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            +ESRNKLW+ SG PLIPL EFREPE++KKY+V+ ++EVLDLLDTA+RQKEI +V K+YWG
Sbjct  46   DESRNKLWAGSGSPLIPLVEFREPEIMKKYDVQIDIEVLDLLDTASRQKEIHIVTKIYWG  105

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            DAREKL D+IEDLKLDS VMG+RGLS++QRII+GSV+N+V+T A+CP+T+VK
Sbjct  106  DAREKLLDAIEDLKLDSLVMGSRGLSTIQRIILGSVSNFVMTHASCPVTIVK  157


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFSKSS+ ALKWA++NLADKGDT Y+IH++ + L
Sbjct  12   DFSKSSKNALKWALENLADKGDTIYVIHINSNSL  45



>ref|XP_004163858.1| PREDICTED: uncharacterized protein C167.05-like isoform 2 [Cucumis 
sativus]
 gb|KGN58822.1| hypothetical protein Csa_3G733270 [Cucumis sativus]
Length=164

 Score =   183 bits (465),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++  ES ++LW++SG PLIPLSEFREPE+LKKY+VK ++E LD+LDT  RQKEITVV+K
Sbjct  42   PNSLEESAHRLWAESGSPLIPLSEFREPEVLKKYDVKIDIEALDILDTGARQKEITVVSK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREK+ D+IEDLKLDS VMG+RGLS+++RI++GSV+NYV+T A CP+TVVK  +F
Sbjct  102  LYWGDAREKIVDAIEDLKLDSLVMGSRGLSTIRRILLGSVSNYVITHAPCPVTVVKDSNF  161

Query  453  HKH  461
              H
Sbjct  162  PHH  164


 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFS SS+ AL+WAIDNLADKGDT +II+++P+ L
Sbjct  12   DFSNSSKNALRWAIDNLADKGDTLFIIYVNPNSL  45



>ref|XP_010101861.1| hypothetical protein L484_023651 [Morus notabilis]
 gb|EXB89998.1| hypothetical protein L484_023651 [Morus notabilis]
Length=164

 Score =   183 bits (465),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +3

Query  90   TPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVA  269
            +P++ +ESRNKLW++SG PLIPL+EFR+PE+LKKY+VK +++VLDLLDT +R KE+T+VA
Sbjct  41   SPNSLDESRNKLWAKSGAPLIPLAEFRQPEILKKYDVKTDIQVLDLLDTGSRTKEVTIVA  100

Query  270  KLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
            K+YWGDAREK+  +IEDLKLDS VMG+RGL ++QR+IMGSV+N+V++ A CP+T+VK   
Sbjct  101  KIYWGDAREKILYAIEDLKLDSLVMGSRGLGTIQRLIMGSVSNHVISLAECPVTIVKDSS  160

Query  450  FHKH  461
            F  H
Sbjct  161  FKHH  164


 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFS+SS+ ALKWAIDNLADKGDT Y+I++ P+ L
Sbjct  12   DFSESSKNALKWAIDNLADKGDTLYVIYVSPNSL  45



>ref|XP_006429235.1| hypothetical protein CICLE_v10012955mg [Citrus clementina]
 ref|XP_006480914.1| PREDICTED: uncharacterized protein C167.05-like [Citrus sinensis]
 gb|ESR42475.1| hypothetical protein CICLE_v10012955mg [Citrus clementina]
 gb|KDO57980.1| hypothetical protein CISIN_1g031195mg [Citrus sinensis]
Length=164

 Score =   183 bits (465),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++ +ESRN +W++SG PLIPL+EFREPE ++KYNVK +++ LDLLDTA+RQKE  +VAK
Sbjct  42   PNSLDESRNLMWAKSGSPLIPLTEFREPETMEKYNVKTDIDALDLLDTASRQKEANIVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            +YWGDARE+L ++IEDLKLDS VMG+RGL +++RII+GSV+NYV+T A CP+T+VK P F
Sbjct  102  IYWGDARERLLEAIEDLKLDSLVMGSRGLGTVRRIILGSVSNYVMTHAPCPVTIVKDPSF  161

Query  453  HKH  461
             KH
Sbjct  162  GKH  164


 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFS SS+ AL WA++NL DKGDT YIIH++P+ L
Sbjct  12   DFSPSSKFALSWAVNNLLDKGDTLYIIHINPNSL  45



>ref|XP_011094934.1| PREDICTED: universal stress protein A-like protein [Sesamum indicum]
Length=165

 Score =   182 bits (463),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H+ +ES ++LWS+SG PLIPL+EFREP+++ KY V  ++EVLD LDTA RQKEI VV KL
Sbjct  43   HSLSESLHQLWSESGSPLIPLAEFREPQVMNKYGVPIDIEVLDTLDTAARQKEIKVVTKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDAREKLC+++EDLKLDS VMG+RGL+++QRII+GSVT+YV+  A CP+T+VK P+F+
Sbjct  103  YWGDAREKLCEAVEDLKLDSLVMGSRGLTTIQRIILGSVTSYVMAHAACPVTIVKDPNFY  162

Query  456  K  458
            K
Sbjct  163  K  163


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ AL+W+IDNLADKGD FYI+H+
Sbjct  12  DFSKSSKAALQWSIDNLADKGDIFYILHV  40



>ref|XP_008370018.1| PREDICTED: uncharacterized protein C167.05 [Malus domestica]
Length=164

 Score =   181 bits (459),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++  ESR++LW+QSG PLIPL+EFREP+++K Y V+ +MEVLD LDT +RQKE+ VV K
Sbjct  42   PNSLGESRSQLWAQSGSPLIPLTEFREPQIMKNYGVQTDMEVLDTLDTVSRQKEVIVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREKL  ++EDLKLDS VMG+RGLS+++RI++GSV+N+VLT A+ P+T+VK P  
Sbjct  102  LYWGDAREKLLQAVEDLKLDSLVMGSRGLSTIKRIVLGSVSNFVLTNASIPVTIVKDPSM  161

Query  453  HKH  461
             +H
Sbjct  162  QQH  164


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFSKSS+ AL+WAI NLADKGDT YIIH+ P+ L
Sbjct  12   DFSKSSKNALEWAIANLADKGDTLYIIHIKPNSL  45



>ref|XP_007206040.1| hypothetical protein PRUPE_ppa012560mg [Prunus persica]
 gb|EMJ07239.1| hypothetical protein PRUPE_ppa012560mg [Prunus persica]
Length=164

 Score =   181 bits (458),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++ +ESR +LW+QSG PLIPL+EFREPE++KKY+V+ ++EVLD LDTA+RQKE+ +V K
Sbjct  42   PNSLDESRTQLWAQSGSPLIPLTEFREPEIMKKYDVRTDIEVLDTLDTASRQKEVNIVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREKL  +IEDLKLDS VMG+RGL +++RI++GSV+NYVLT A  P+T+VK P  
Sbjct  102  LYWGDAREKLLQAIEDLKLDSLVMGSRGLGTIKRILLGSVSNYVLTNAPIPVTIVKDPSL  161

Query  453  HKH  461
              H
Sbjct  162  QHH  164


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFSKSS+ AL+WA+DNL DKGDT YIIH++P+ L
Sbjct  12   DFSKSSKNALEWAVDNLLDKGDTLYIIHINPNSL  45



>ref|XP_010671709.1| PREDICTED: uncharacterized protein C167.05 [Beta vulgaris subsp. 
vulgaris]
Length=164

 Score =   181 bits (458),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            PH+ +ESR+ LW++SG PLIPL EFR+P +LKKY+V+ ++EVLD+ DTA+RQKEIT+VAK
Sbjct  42   PHSHDESRHLLWAKSGSPLIPLVEFRDPNILKKYDVQTDIEVLDMCDTASRQKEITIVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            +YWGDAREKL ++IEDLKLD+ VMG+RGL+ L+RIIMGSV NYV++ A  P+T+VK P  
Sbjct  102  VYWGDAREKLMEAIEDLKLDTLVMGSRGLTGLKRIIMGSVANYVMSNAHIPVTIVKEPGV  161

Query  453  HK  458
            HK
Sbjct  162  HK  163


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           DFSKSS+ AL+WAIDNLADKGDT YIIH+ P
Sbjct  12  DFSKSSKCALQWAIDNLADKGDTLYIIHVQP  42



>gb|AFK43920.1| unknown [Lotus japonicus]
Length=164

 Score =   180 bits (457),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++ +ESRNKLW +SG PLIPL EFREPE++ KY+V+ ++EVLDLLDTA+RQKE+ +V K
Sbjct  42   PNSLDESRNKLWGKSGSPLIPLKEFREPEVMTKYDVQIDIEVLDLLDTASRQKEVNIVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGDARE+L D++EDLKLDS VMG+RGLS++QRII+GSV+N+V+T A CP+T+VK
Sbjct  102  IYWGDAREQLLDAVEDLKLDSLVMGSRGLSTIQRIILGSVSNFVMTHAPCPVTIVK  157


 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFSKSS+ ALKWA++NLADKGD  YIIH++P+ L
Sbjct  12   DFSKSSKNALKWALENLADKGDNIYIIHINPNSL  45



>ref|XP_010044014.1| PREDICTED: universal stress protein A-like protein [Eucalyptus 
grandis]
 gb|KCW86028.1| hypothetical protein EUGRSUZ_B02732 [Eucalyptus grandis]
Length=164

 Score =   180 bits (456),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            ++++ESR++LWS+SG PLIPLSEFREP L+KKY+V  +MEVLD LDTA+RQKE+ +V KL
Sbjct  43   NSNDESRDQLWSKSGAPLIPLSEFREPHLMKKYDVPTDMEVLDTLDTASRQKEVKIVTKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDAREKL  +I+DLKLDS VMG+RGL +L+RII+GSVT+YV   A CP+TVVK P F+
Sbjct  103  YWGDAREKLLQAIDDLKLDSLVMGSRGLGTLKRIILGSVTSYVTNHAPCPVTVVKEPGFN  162

Query  456  K  458
            K
Sbjct  163  K  163


 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ AL+WA+DNLADKGDT YIIH+
Sbjct  12  DFSKSSKCALQWAVDNLADKGDTLYIIHI  40



>ref|XP_004961892.1| PREDICTED: universal stress protein A-like protein-like [Setaria 
italica]
Length=164

 Score =   179 bits (455),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H   E+++ LW++SG PLIPLSEFREPE++K Y VK + EVLD++DTA RQK++ VVAKL
Sbjct  48   HGGEETKHTLWAKSGSPLIPLSEFREPEVMKNYGVKTDAEVLDMIDTAARQKQLKVVAKL  107

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGDAREKLCD +E+LK+DS VMG+RGL  +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  108  YWGDAREKLCDGVEELKIDSLVMGSRGLGPIQRILLGSVTNYVLSNASCPVTVVK  162



>ref|XP_009378881.1| PREDICTED: uncharacterized protein C167.05-like [Pyrus x bretschneideri]
Length=164

 Score =   179 bits (455),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++  ESR++LW+QSG PLIPLSEFREP+++K Y V+ +MEVLD LDTA+RQKE+ VV K
Sbjct  42   PNSLGESRSQLWAQSGSPLIPLSEFREPQIMKNYGVQTDMEVLDTLDTASRQKEVDVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREKL  ++EDLKLDS VMG+RGLS+++RI++GSV+N+VLT A  P+T+VK    
Sbjct  102  LYWGDAREKLLQAVEDLKLDSLVMGSRGLSTIKRIVLGSVSNFVLTNAAIPVTIVKDLSM  161

Query  453  HKH  461
             +H
Sbjct  162  QQH  164


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFSKSS+ AL+WAI NLADKGDT YIIH+ P+ L
Sbjct  12   DFSKSSKNALEWAIANLADKGDTLYIIHIKPNSL  45



>ref|XP_008240065.1| PREDICTED: uncharacterized protein C167.05-like [Prunus mume]
Length=164

 Score =   179 bits (455),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++ +ESR +LW+QSG PLIPL+EFREPE++KKY+V+ ++EVLD LDTA+RQKE  +V K
Sbjct  42   PNSLDESRTQLWAQSGSPLIPLTEFREPEIMKKYDVQTDIEVLDTLDTASRQKEANIVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREKL  +IEDLKLDS VMG+RGL +++RI++GSV+NYVLT A  P+T+VK P  
Sbjct  102  LYWGDAREKLLQAIEDLKLDSLVMGSRGLGTIKRILLGSVSNYVLTNAPIPVTIVKDPSL  161

Query  453  HKH  461
              H
Sbjct  162  QHH  164


 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFSKSS+ AL+WA+DNL DKGDT YIIH++P+ L
Sbjct  12   DFSKSSKNALEWAVDNLLDKGDTLYIIHINPNSL  45



>ref|XP_007133981.1| hypothetical protein PHAVU_010G008900g [Phaseolus vulgaris]
 gb|ESW05975.1| hypothetical protein PHAVU_010G008900g [Phaseolus vulgaris]
Length=162

 Score =   179 bits (454),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  90   TPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVA  269
            +P++ +ESRN+LW++SG PLIPL EFREPE++ KY V+ ++EVLD LDTA+RQKE+ +V 
Sbjct  41   SPNSLDESRNQLWAKSGSPLIPLQEFREPEIMSKYGVQIDIEVLDTLDTASRQKEVHIVT  100

Query  270  KLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            K+YWGDAREKL D+IEDLKLDS VMG+RGL++++RII+GSV+N+V+  A+CP+T+VK P
Sbjct  101  KIYWGDAREKLLDAIEDLKLDSLVMGSRGLTTIKRIILGSVSNFVMAHASCPVTIVKEP  159


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFSKSS+ ALKWA++NLADKGDT Y+IH+ P+ L
Sbjct  12   DFSKSSKNALKWALENLADKGDTIYVIHISPNSL  45



>ref|XP_008359768.1| PREDICTED: uncharacterized protein C167.05-like [Malus domestica]
Length=164

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++ +ESR +LW+QSG PLIPL+EFREPE++ KY V+ + EVLD LDTA+RQKE+ VV K
Sbjct  42   PNSLDESRTQLWAQSGSPLIPLTEFREPEIMTKYGVQTDTEVLDTLDTASRQKEVNVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREKL  ++EDLKLDS VMG+RGL +++RI++GSV+NYVLT A  P+TVVK P  
Sbjct  102  LYWGDAREKLLQAVEDLKLDSLVMGSRGLGTIKRILLGSVSNYVLTNAPIPVTVVKDPSM  161

Query  453  HKH  461
              H
Sbjct  162  QHH  164


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFSKSS+ A +WAI NLADKGDT YIIH++P+ L
Sbjct  12   DFSKSSKNAXEWAIANLADKGDTLYIIHINPNSL  45



>ref|XP_008350501.1| PREDICTED: uncharacterized protein C167.05-like [Malus domestica]
Length=164

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++ +ESR +LW+QSG PLIPL+EFREPE++ KY V+ + EVLD LDTA+RQKE+ VV K
Sbjct  42   PNSLDESRTQLWAQSGSPLIPLTEFREPEIMTKYGVQTDTEVLDTLDTASRQKEVNVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREKL  ++EDLKLDS VMG+RGL +++RI++GSV+NYVLT A  P+TVVK P  
Sbjct  102  LYWGDAREKLLQAVEDLKLDSLVMGSRGLGTIKRILLGSVSNYVLTNAPIPVTVVKDPSM  161

Query  453  HKH  461
              H
Sbjct  162  QHH  164


 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFSKSS+ A++WAI NLADKGDT YIIH++P+ L
Sbjct  12   DFSKSSKNAMEWAIANLADKGDTLYIIHINPNSL  45



>ref|XP_004507182.1| PREDICTED: universal stress protein A-like protein-like [Cicer 
arietinum]
Length=165

 Score =   177 bits (450),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            +ESRN++W++SG PLIPL EFREPE++KKY V+ ++EVLDLLDT +RQKE+ +VAK+YWG
Sbjct  46   DESRNQIWAKSGSPLIPLKEFREPEIMKKYGVQIDIEVLDLLDTVSRQKEVNIVAKVYWG  105

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            DAREKL D+I+DLKLDS VMG+RGLS++QRI++GSV+N+V+T A CP+T+VK
Sbjct  106  DAREKLLDAIDDLKLDSLVMGSRGLSTIQRILLGSVSNFVMTHAPCPVTIVK  157


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFS SS+ ALKWA++NLA+KGD  YIIH+
Sbjct  12  DFSNSSKNALKWALENLAEKGDNIYIIHI  40



>ref|XP_009358793.1| PREDICTED: uncharacterized protein C167.05 [Pyrus x bretschneideri]
Length=164

 Score =   177 bits (450),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++ +ESR +LW+QSG PLIPL+EFREPE++ KY V+ +MEVLD LDTA+RQKE+ VV K
Sbjct  42   PNSLDESRTQLWAQSGSPLIPLTEFREPEIMTKYGVQTDMEVLDTLDTASRQKEVNVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREKL  ++EDLKLD+ VMG+RGL +++RI++GSV++YVLT A  P+T+VK P  
Sbjct  102  LYWGDAREKLLQAVEDLKLDTLVMGSRGLGTIKRILLGSVSDYVLTNAPIPVTIVKDPSM  161

Query  453  HKH  461
              H
Sbjct  162  QHH  164


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFSKSS+ AL+WAI NLADKGDT YIIH++P+ L
Sbjct  12   DFSKSSKNALEWAIANLADKGDTLYIIHINPNSL  45



>gb|ACG42306.1| USP family protein [Zea mays]
Length=164

 Score =   177 bits (449),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H + E+++ LW++SG PLIPLSEFREPE+++ Y V+ + EVLD +DTA RQK++ VVAKL
Sbjct  48   HGAEETKHTLWAKSGSPLIPLSEFREPEVMQGYGVRPDAEVLDAIDTAARQKQLKVVAKL  107

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGDAREKLCD++EDL++DS VMG+RGL  +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  108  YWGDAREKLCDAVEDLRIDSLVMGSRGLGPIQRILLGSVTNYVLSNASCPVTVVK  162



>ref|NP_001142159.1| USP family protein [Zea mays]
 gb|ACF87780.1| unknown [Zea mays]
 gb|AFW78218.1| USP family protein [Zea mays]
Length=164

 Score =   177 bits (449),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H + E+++ LW++SG PLIPLSEFREPE+++ Y V+ + EVLD +DTA RQK++ VVAKL
Sbjct  48   HGAEETKHTLWAKSGSPLIPLSEFREPEVMQGYGVRPDAEVLDAIDTAARQKQLKVVAKL  107

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGDAREKLCD++EDL++DS VMG+RGL  +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  108  YWGDAREKLCDAVEDLRIDSLVMGSRGLGPIQRILLGSVTNYVLSNASCPVTVVK  162



>ref|XP_002439902.1| hypothetical protein SORBIDRAFT_09g022230 [Sorghum bicolor]
 gb|EES18332.1| hypothetical protein SORBIDRAFT_09g022230 [Sorghum bicolor]
Length=166

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H+  E+++ LW++SG PLIPLSEFREPE+++ Y V+ + EVLD++DTA RQK++ VVAKL
Sbjct  50   HSGEETKHALWAKSGSPLIPLSEFREPEVMQGYGVRTDAEVLDMIDTAARQKQLKVVAKL  109

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGDAREKLCD++ DLK+DS VMG+RGL  +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  110  YWGDAREKLCDAVGDLKIDSLVMGSRGLGPIQRILLGSVTNYVLSNASCPVTVVK  164



>ref|XP_010256749.1| PREDICTED: uncharacterized protein C167.05 [Nelumbo nucifera]
Length=164

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H ++++   L +  G PLIPL+EFR PEL+KKY+V+ + EVLD+LDTA+RQKE T+V KL
Sbjct  43   HGAHDAAKLLSANGGVPLIPLTEFRVPELMKKYDVEIDPEVLDILDTASRQKEATIVTKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            YWGDAREKLC++IEDLKLDS VMG+RGL ++QRI++GSVTN+V+T A CPITVVK P F+
Sbjct  103  YWGDAREKLCEAIEDLKLDSLVMGSRGLGTIQRILLGSVTNHVITHANCPITVVKDPSFN  162

Query  456  KH  461
            KH
Sbjct  163  KH  164


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFS+SS+ AL+WAIDNL DKGDT  +IH+
Sbjct  12  DFSQSSKRALQWAIDNLLDKGDTLLVIHV  40



>gb|KJB17332.1| hypothetical protein B456_003G127300 [Gossypium raimondii]
Length=164

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            PH S+ESRN LWS SG PLIPLSEFRE E++K Y V+ + E+LDL+D A+RQK+ T+VAK
Sbjct  42   PHQSDESRNLLWSTSGSPLIPLSEFREKEVMKHYEVEPDPEILDLVDIASRQKQGTLVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            +YWGDAR+K+C+S+EDLKLD  VMG+RGL ++QR+++GSV+NYV+  ATCP+T+VK P  
Sbjct  102  IYWGDARDKICESVEDLKLDCLVMGSRGLGTIQRVLIGSVSNYVMVNATCPVTIVKDPSA  161

Query  453  H  455
            H
Sbjct  162  H  162


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           D+SK S+ ALKW+IDNL ++GDT Y+IH+ P
Sbjct  12  DYSKGSKAALKWSIDNLLNQGDTLYLIHVKP  42



>ref|XP_008811502.1| PREDICTED: uncharacterized protein C167.05 [Phoenix dactylifera]
Length=163

 Score =   175 bits (443),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  54   LIRGTLSISSTSTPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLD  233
            L +G + +     P    ES++ LW +SG PLIPL+EFREPE+   Y+++ ++E LD+LD
Sbjct  29   LHKGDMLVVLHVMPPKKGESKHGLWVKSGSPLIPLAEFREPEVTTHYDLEVDIEALDMLD  88

Query  234  TATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTT  413
            TA+RQKE T+VAKLYWGDAREKLC+++EDLKLDS VMG+RGLS +QRI++GSVTNY+L+ 
Sbjct  89   TASRQKEATIVAKLYWGDAREKLCEAVEDLKLDSLVMGSRGLSQIQRILLGSVTNYILSN  148

Query  414  ATCPITVVK  440
            A CP+T+VK
Sbjct  149  AACPVTIVK  157



>gb|KHG19158.1| hypothetical protein F383_06056 [Gossypium arboreum]
Length=164

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            PH S+ESRN LWS +G PLIPLSEFRE E++K Y V+ + E+LDL+D A+RQK+ T+VAK
Sbjct  42   PHQSDESRNLLWSTTGSPLIPLSEFREKEVMKHYEVEPDPEILDLVDIASRQKQGTLVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            +YWGDAR+K+C+S+EDLKLD  VMG+RGL ++QR+++GSV+NYV+  ATCP+T+VK P  
Sbjct  102  IYWGDARDKICESVEDLKLDCLVMGSRGLGTIQRVLIGSVSNYVMVNATCPVTIVKDPSA  161

Query  453  H  455
            H
Sbjct  162  H  162


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           D+SK S+ ALKW+IDNL ++GDT Y+IH+ P
Sbjct  12  DYSKGSKAALKWSIDNLLNQGDTLYLIHVKP  42



>ref|XP_007026861.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY07363.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
Length=165

 Score =   175 bits (443),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-  281
            +ES N LW++SG PLIPL+EFREPE++KKY+VK ++EVLD+LDTA+RQKEI +V KLYW 
Sbjct  46   DESHNALWAKSGSPLIPLTEFREPEIMKKYDVKPDIEVLDMLDTASRQKEIHIVTKLYWG  105

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  461
            GDAREK+ D++E LKLDS VMG+RGL ++QRII+GSV+NYV+T A+CP+T+VK     KH
Sbjct  106  GDAREKILDAVEGLKLDSLVMGSRGLGTVQRIILGSVSNYVMTHASCPVTIVKESSSMKH  165


 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFS SS+ AL+WA+DNLADKGDT YIIH++ + L
Sbjct  12   DFSPSSKNALQWAVDNLADKGDTLYIIHINANSL  45



>ref|XP_006403631.1| hypothetical protein EUTSA_v10010778mg [Eutrema salsugineum]
 gb|ESQ45084.1| hypothetical protein EUTSA_v10010778mg [Eutrema salsugineum]
Length=162

 Score =   174 bits (442),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P +  ESRN LW ++G PLIPL EFREPE++KKY VK ++E LD+LDT +RQKE+ VV K
Sbjct  42   PSSDAESRNALWLKTGSPLIPLVEFREPEIMKKYGVKIDIECLDILDTGSRQKEVHVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREKL D++++LKLDS VMGNRGLS+LQRIIMGSV+++V+  A CP+TVVK  D 
Sbjct  102  LYWGDAREKLVDAVKELKLDSIVMGNRGLSALQRIIMGSVSSFVIQHAPCPVTVVKDNDS  161

Query  453  H  455
            H
Sbjct  162  H  162


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFS SS+ ALKWAI+NLADKGDT YIIH  PS
Sbjct  12  DFSDSSKNALKWAIENLADKGDTLYIIHTLPS  43



>gb|KJB11222.1| hypothetical protein B456_001G247900 [Gossypium raimondii]
Length=165

 Score =   171 bits (433),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 102/119 (86%), Gaps = 1/119 (1%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P +SN+S N   +QSG PLIPL++FR+PE++ KY+VK ++ VLD+LDTA+RQKEI VV+K
Sbjct  42   PSSSNDSTNTHLAQSGSPLIPLAQFRQPEIMNKYDVKVDIAVLDMLDTASRQKEIQVVSK  101

Query  273  LYW-GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            LYW GDAREK+ D+IE+LKLDS VMG+RGL +LQRII+GSV+NYVLT A CP+T+VK P
Sbjct  102  LYWGGDAREKILDAIENLKLDSLVMGSRGLGTLQRIILGSVSNYVLTYAPCPVTIVKEP  160


 Score = 59.7 bits (143),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFS SS+ AL+WAIDNLADKGDTFYIIH++PS
Sbjct  12  DFSCSSKSALRWAIDNLADKGDTFYIIHINPS  43



>gb|ACJ84043.1| unknown [Medicago truncatula]
Length=165

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            +E+RN+LW++ G PLIPL EFREPE++KKY V+ ++EVLDLLDT +RQKE+ VV K+YWG
Sbjct  46   DEARNQLWAKDGSPLIPLKEFREPEIMKKYGVQIDIEVLDLLDTFSRQKEVNVVTKVYWG  105

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            DAREKL D++EDLKLDS VMG+RGLS++QRI++GSV+N+V+T A CP+T+VK
Sbjct  106  DAREKLMDAVEDLKLDSLVMGSRGLSTIQRILLGSVSNFVMTNAPCPVTIVK  157


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ ALKWA++NLADKGD  YIIH+
Sbjct  12  DFSKSSKNALKWALENLADKGDNIYIIHI  40



>gb|ACJ83924.1| unknown [Medicago truncatula]
 gb|AFK46761.1| unknown [Medicago truncatula]
 gb|KEH28981.1| adenine nucleotide alpha hydrolase superfamily protein [Medicago 
truncatula]
Length=165

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            +E+RN+LW++ G PLIPL EFREPE++KKY V+ ++EVLDLLDT +RQKE+ VV K+YWG
Sbjct  46   DEARNQLWAKDGSPLIPLKEFREPEIMKKYGVQIDIEVLDLLDTFSRQKEVNVVTKVYWG  105

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            DAREKL D++EDLKLDS VMG+RGLS++QRI++GSV+N+V+T A CP+T+VK
Sbjct  106  DAREKLMDAVEDLKLDSLVMGSRGLSTIQRILLGSVSNFVMTNAPCPVTIVK  157


 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ ALKWA++NLADKGD  YIIH+
Sbjct  12  DFSKSSKNALKWALENLADKGDNIYIIHI  40



>ref|XP_010905389.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=163

 Score =   174 bits (440),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            +ES++ LW++SG  LIPL+EFR+PE++K Y+++ ++EVLD+LDTA+RQKE T+VAKLYWG
Sbjct  46   DESKHGLWAKSGSSLIPLTEFRQPEVMKHYDLEVDIEVLDMLDTASRQKEATIVAKLYWG  105

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            DAREKLC+++EDLKLDS VMG+RGLS +QRI++GSVTNY+L+ A CP+TVVK
Sbjct  106  DAREKLCEAVEDLKLDSLVMGSRGLSQIQRILLGSVTNYMLSNAACPVTVVK  157



>gb|KHG25151.1| hypothetical protein F383_09728 [Gossypium arboreum]
 gb|KJB76826.1| hypothetical protein B456_012G108900 [Gossypium raimondii]
Length=166

 Score =   174 bits (440),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 103/113 (91%), Gaps = 1/113 (1%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-  281
            +ESRN LW++SG PLIPL+EFR PE++KKY+V+ ++EVLD+LDTA+RQKEI VV+K+YW 
Sbjct  46   DESRNALWAKSGSPLIPLTEFRVPEIMKKYDVETDIEVLDMLDTASRQKEINVVSKIYWG  105

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            GDAREK+ D+IEDLKLDS VMG+RGL +++RII+GSV+NYV+T ATCP+T+VK
Sbjct  106  GDAREKILDAIEDLKLDSLVMGSRGLGTVRRIILGSVSNYVVTHATCPVTIVK  158


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFS SS+ ALKWAIDNLADKGDT YIIH++ + L
Sbjct  12   DFSASSKNALKWAIDNLADKGDTLYIIHINNNSL  45



>ref|XP_002877951.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54210.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=162

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P + +ESRN LW +SG PLIPL+EFREPE+++KY VK ++  LD+LDT +RQKE+ VV K
Sbjct  42   PLSDDESRNSLWFKSGSPLIPLAEFREPEVMEKYGVKIDIACLDMLDTGSRQKEVHVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREKL D+++DLKLDS VMG+RGLS+LQRIIMGSV+++V+  A CP+TVVK  D 
Sbjct  102  LYWGDAREKLVDAVKDLKLDSIVMGSRGLSALQRIIMGSVSSFVIQHAPCPVTVVKDNDS  161

Query  453  H  455
            H
Sbjct  162  H  162


 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           DFS+SS+ AL+WAI+NLADKGDT YIIH  P
Sbjct  12  DFSESSKNALQWAIENLADKGDTLYIIHTLP  42



>ref|XP_004137751.1| PREDICTED: uncharacterized protein C167.05-like isoform 2 [Cucumis 
sativus]
Length=162

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++  ES ++LW++S   LIPLSEFREPE+LKKY+VK ++E LD+LDT  RQKEITVV+K
Sbjct  42   PNSLEESAHRLWAESA--LIPLSEFREPEVLKKYDVKIDIEALDILDTGARQKEITVVSK  99

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREK+ D+IEDLKLDS VMG+RGLS+++RI++GSV+NYV+T A CP+TVVK  +F
Sbjct  100  LYWGDAREKIVDAIEDLKLDSLVMGSRGLSTIRRILLGSVSNYVITHAPCPVTVVKDSNF  159

Query  453  HKH  461
              H
Sbjct  160  PHH  162


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFS SS+ AL+WAIDNLADKGDT +II+++P+ L
Sbjct  12   DFSNSSKNALRWAIDNLADKGDTLFIIYVNPNSL  45



>ref|XP_010529788.1| PREDICTED: uncharacterized protein C167.05 [Tarenaya hassleriana]
Length=159

 Score =   173 bits (438),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            +ES N LWS+SG PLIPL+EFREPE L KY VK ++ VLDLLDTA+RQKE+ +V+KLYWG
Sbjct  43   DESANNLWSKSGSPLIPLTEFREPETLHKYGVKVDIPVLDLLDTASRQKEVHIVSKLYWG  102

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            DAREKL D+I+DLKLDS VMG+RGLS+++RII+GSV+N+++T A CP+TVVK
Sbjct  103  DAREKLLDAIDDLKLDSIVMGSRGLSTIKRIILGSVSNFMVTHAACPVTVVK  154


 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           DFS SS  AL+WAI+NLADKGDT YIIH +P
Sbjct  12  DFSDSSRNALRWAIENLADKGDTLYIIHTNP  42



>ref|XP_007140453.1| hypothetical protein PHAVU_008G113500g [Phaseolus vulgaris]
 gb|ESW12447.1| hypothetical protein PHAVU_008G113500g [Phaseolus vulgaris]
Length=157

 Score =   172 bits (437),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +3

Query  102  SNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW  281
            S++ RN+LW++SG PLIPL+EFRE E++K Y V+++ EVLDLLDTATRQK+++VV KLYW
Sbjct  44   SSDDRNQLWAKSGSPLIPLNEFREAEVMKNYGVQSDAEVLDLLDTATRQKQVSVVVKLYW  103

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            GD REKL DSIEDLKLDS V+G+RGLS++QR+I+GSV+N+V+T A CP+T+VK
Sbjct  104  GDVREKLLDSIEDLKLDSLVIGSRGLSTIQRMILGSVSNFVMTHAPCPVTIVK  156


 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           DFSKSS+ ALKWAI+NLAD+G TFYI+H++P
Sbjct  12  DFSKSSKVALKWAIENLADEGHTFYIVHVNP  42



>ref|XP_011000055.1| PREDICTED: uncharacterized protein LOC105107721 [Populus euphratica]
Length=161

 Score =   172 bits (435),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-  281
            +ESRNKLW++SGCPLIPL EF++PE+LKKY VK ++EVLD+LDT +RQK++TVV+KLYW 
Sbjct  46   DESRNKLWAESGCPLIPLDEFKDPEILKKYGVKVDIEVLDMLDTISRQKKVTVVSKLYWG  105

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKH  443
            GDAREKL D+++DLKLDS VMG+RGL ++QRI++GSV++YV+  A CP+T+VK 
Sbjct  106  GDAREKLLDAVQDLKLDSLVMGSRGLGTVQRILLGSVSSYVMANAPCPVTIVKE  159


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFS SS+ ALKWAIDNL D GDT Y+I+++ + L
Sbjct  12   DFSPSSKNALKWAIDNLVDDGDTLYLINVNSNSL  45



>ref|XP_007016274.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Theobroma cacao]
 gb|EOY33893.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Theobroma cacao]
Length=164

 Score =   172 bits (435),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +ESRN LWS +G PLIPL+EFRE E+++KY V  + EVLDL+DTA+RQK++T+VAK
Sbjct  42   PQQGDESRNLLWSTTGSPLIPLAEFREKEVMQKYEVNLDPEVLDLVDTASRQKQVTIVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            +YWGDAR+++C+++ DLKLD  VMG+RGL ++QR+++GSV+NYV+  ATCP+T+VK P  
Sbjct  102  IYWGDARDRICEAVGDLKLDCLVMGSRGLGTIQRVLIGSVSNYVMVNATCPVTIVKDPSA  161

Query  453  H  455
            H
Sbjct  162  H  162


 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSR  100
           DFSK S+ AL+WAIDNL DKGDT Y+IH+ P +
Sbjct  12  DFSKGSKLALQWAIDNLLDKGDTLYLIHVKPQQ  44



>ref|XP_002534082.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28298.1| conserved hypothetical protein [Ricinus communis]
Length=164

 Score =   169 bits (428),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = +3

Query  90   TPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVA  269
            +P++ +ESRN+LW++SG PLIPL++FREPE+++ Y+VK ++EVLD+LDT  RQK++ VV 
Sbjct  41   SPNSLDESRNQLWAKSGSPLIPLAQFREPEVMRGYDVKIDIEVLDMLDTVHRQKDVNVVT  100

Query  270  KLYW-GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            KLYW GDAREKL D++EDLKLD  VMG+RGL ++QRI++GSV+ YV+T ATCP+TVVK  
Sbjct  101  KLYWGGDAREKLLDAVEDLKLDCLVMGSRGLGTVQRILLGSVSTYVMTHATCPVTVVKDQ  160

Query  447  DFHK  458
            +  K
Sbjct  161  ESQK  164


 Score = 57.8 bits (138),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFSKSS+ ALKWAIDNLAD+GDT Y+IH+ P+ L
Sbjct  12   DFSKSSKSALKWAIDNLADRGDTLYLIHVSPNSL  45



>ref|NP_566991.2| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Arabidopsis thaliana]
 gb|AAG40033.1|AF324682_1 AT3g53990 [Arabidopsis thaliana]
 gb|AAG40390.1|AF325038_1 AT3g53990 [Arabidopsis thaliana]
 gb|AAG41484.1|AF326902_1 unknown protein [Arabidopsis thaliana]
 gb|AAK00403.1|AF339721_1 unknown protein [Arabidopsis thaliana]
 gb|AAK32867.1|AF361855_1 AT3g53990/F5K20_290 [Arabidopsis thaliana]
 emb|CAB88361.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAK96518.1| AT3g53990/F5K20_290 [Arabidopsis thaliana]
 gb|AAL31227.1| AT3g53990/F5K20_290 [Arabidopsis thaliana]
 gb|AAL49942.1| AT3g53990/F5K20_290 [Arabidopsis thaliana]
 dbj|BAD94963.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH19759.1| AT3G53990 [Arabidopsis thaliana]
 gb|AEE79170.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Arabidopsis thaliana]
Length=160

 Score =   172 bits (435),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P + +ESRN LW +SG PLIPL+EFREPE+++KY VK ++  LD+LDT +RQKE+ VV K
Sbjct  42   PLSGDESRNSLWFKSGSPLIPLAEFREPEIMEKYGVKTDIACLDMLDTGSRQKEVHVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            LYWGDAREKL D+++DLKLDS VMG+RGLS+LQRIIMGSV+++V+  A CP+TVVK
Sbjct  102  LYWGDAREKLVDAVKDLKLDSIVMGSRGLSALQRIIMGSVSSFVIQHAPCPVTVVK  157


 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           DFS+SS+ ALKWAI+NLADKGDT YIIH  P
Sbjct  12  DFSESSKNALKWAIENLADKGDTIYIIHTLP  42



>gb|ABQ42110.1| NOD18 protein [Sonneratia caseolaris]
Length=106

 Score =   169 bits (429),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +3

Query  111  SRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDA  290
            SRN LWS++G PLIPLSE+REPE +KKY+ + +MEVLD+LDTA+RQKE+ VV KLYWGDA
Sbjct  1    SRNLLWSKTGSPLIPLSEYREPEAMKKYDAETDMEVLDMLDTASRQKEMKVVTKLYWGDA  60

Query  291  REKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPI  428
            REKL  S EDLKLDS VMG+RGLS++QRII+GSVTNYVL  ATCP+
Sbjct  61   REKLVQSTEDLKLDSLVMGSRGLSTIQRIILGSVTNYVLNHATCPV  106



>gb|KFK34646.1| hypothetical protein AALP_AA5G172700 [Arabis alpina]
Length=162

 Score =   171 bits (434),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P + +ESRN LW ++G PLIPL EFREPE+++KY VK ++  LD+LDT +RQKE+ VV K
Sbjct  42   PISDDESRNSLWFKTGSPLIPLVEFREPEVMQKYGVKLDIACLDILDTGSRQKEVHVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREKL D+++DLKLDS VMG+RGLS+LQRIIMGSV+++V+  A CP+TVVK  D 
Sbjct  102  LYWGDAREKLVDAVKDLKLDSIVMGSRGLSALQRIIMGSVSSFVIQHAPCPVTVVKDNDS  161

Query  453  H  455
            H
Sbjct  162  H  162


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           DFS+SS+ ALKWA +NLADKGDT YIIH  P
Sbjct  12  DFSESSKNALKWAFENLADKGDTLYIIHTLP  42



>ref|XP_010905911.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=163

 Score =   171 bits (433),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            +ES++ LW+ SG PLIPL+E R+PE++K Y+++ ++EVLD+LDTA+RQKE T+V KLYWG
Sbjct  46   DESKHALWAASGSPLIPLTELRQPEVMKHYDLEVDIEVLDILDTASRQKEATIVVKLYWG  105

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            DAREKLC++ EDLK+DS VMG+RGLS +QRI++GSV NYVL+ A CP+T+VK  +F
Sbjct  106  DAREKLCEAAEDLKVDSLVMGSRGLSQIQRILLGSVANYVLSNAACPVTIVKDSNF  161



>gb|ABQ42109.1| NOD18 protein [Sonneratia alba]
 gb|ABQ42111.1| NOD18 protein [Sonneratia ovata]
 gb|ABQ42112.1| NOD18 protein [Sonneratia apetala]
Length=106

 Score =   169 bits (428),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +3

Query  111  SRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDA  290
            SRN LWS++G PLIPLSE+REPE +KKY+ + +MEVLD+LDTA+RQKE+ VV KLYWGDA
Sbjct  1    SRNLLWSKTGSPLIPLSEYREPEAMKKYDAETDMEVLDMLDTASRQKEMKVVTKLYWGDA  60

Query  291  REKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPI  428
            REKL  S EDLKLDS VMG+RGLS++QRII+GSVTNYV+  ATCP+
Sbjct  61   REKLVQSTEDLKLDSLVMGSRGLSTIQRIILGSVTNYVMNHATCPV  106



>ref|XP_007026862.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 2, partial [Theobroma cacao]
 gb|EOY07364.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 2, partial [Theobroma cacao]
Length=157

 Score =   171 bits (432),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 99/112 (88%), Gaps = 1/112 (1%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-  281
            +ES N LW++SG PLIPL+EFREPE++KKY+VK ++EVLD+LDTA+RQKEI +V KLYW 
Sbjct  46   DESHNALWAKSGSPLIPLTEFREPEIMKKYDVKPDIEVLDMLDTASRQKEIHIVTKLYWG  105

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVV  437
            GDAREK+ D++E LKLDS VMG+RGL ++QRII+GSV+NYV+T A CP+T+V
Sbjct  106  GDAREKILDAVEGLKLDSLVMGSRGLGTVQRIILGSVSNYVMTHAPCPVTIV  157


 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFS SS+ AL+WA+DNLADKGDT YIIH++ + L
Sbjct  12   DFSPSSKNALQWAVDNLADKGDTLYIIHINANSL  45



>ref|XP_009392694.1| PREDICTED: uncharacterized protein C167.05 [Musa acuminata subsp. 
malaccensis]
Length=166

 Score =   171 bits (432),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +E+++ LWSQSG PLIPL EFR+PE++K Y++  + EVLD+LDT++RQKE T+V K
Sbjct  50   PTTGDEAKHLLWSQSGSPLIPLMEFRQPEVMKHYDLDVDSEVLDMLDTSSRQKEATIVTK  109

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKH  443
            LYWGDAREKLC + EDL LD  VMG+RGLS +QRI++GSVTNYVLT A CP+TVVK 
Sbjct  110  LYWGDAREKLCHAAEDLNLDLLVMGSRGLSQIQRIMLGSVTNYVLTYAPCPVTVVKQ  166



>ref|XP_006291961.1| hypothetical protein CARUB_v10018150mg [Capsella rubella]
 gb|EOA24859.1| hypothetical protein CARUB_v10018150mg [Capsella rubella]
Length=163

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +ESRN LW +SG PLIPL EFREPE+++KY VK ++  LD+LDT +RQKE+ VV K
Sbjct  42   PIPDDESRNSLWFKSGSPLIPLVEFREPEIMEKYGVKTDIACLDILDTGSRQKEVNVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREKL D+++DLKLDS VMG+RGLS+L+RIIMGSV+++V+  A CP+T+VK  D 
Sbjct  102  LYWGDAREKLVDAVKDLKLDSIVMGSRGLSALRRIIMGSVSSFVMQNAHCPVTIVKDNDS  161

Query  453  H  455
            H
Sbjct  162  H  162


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           DFS+SS+ AL+WA DNLADKGDT YIIH  P
Sbjct  12  DFSESSKNALQWAFDNLADKGDTLYIIHTLP  42



>gb|KHG13508.1| hypothetical protein F383_20265 [Gossypium arboreum]
Length=165

 Score =   169 bits (429),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 100/119 (84%), Gaps = 1/119 (1%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P + N+S N   +Q+G PLIPL++FR+PE++ KY+VK ++ VLD+LDTA+RQKEI VV K
Sbjct  42   PSSPNDSTNTHLAQAGSPLIPLAQFRQPEIMNKYDVKVDIAVLDMLDTASRQKEIQVVTK  101

Query  273  LYWG-DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            LYWG DAREK+ D+IEDLKLDS VMG+RGL +LQRII+GSV+NYVLT A CP+T+VK P
Sbjct  102  LYWGGDAREKILDAIEDLKLDSLVMGSRGLGTLQRIILGSVSNYVLTYAPCPVTIVKEP  160


 Score = 55.8 bits (133),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFS SS+ AL+WAIDNLAD GDTFYIIH++PS
Sbjct  12  DFSWSSKSALRWAIDNLADIGDTFYIIHINPS  43



>gb|ABK22721.1| unknown [Picea sitchensis]
Length=164

 Score =   170 bits (431),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +3

Query  99   ASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLY  278
            AS   +++LW +SG PLIPL+EFRE  L K Y +  + EVLD+LDTATRQKE+ V+AK+Y
Sbjct  45   ASESGQSQLWEKSGSPLIPLAEFREGNLSKHYELTPDAEVLDMLDTATRQKELEVIAKVY  104

Query  279  WGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            WGDAREKLCD++EDLKLDS VMG+RGL  L+R+ +GSV+NYV++ A+CP+TVVK P F
Sbjct  105  WGDAREKLCDAVEDLKLDSLVMGSRGLGQLKRVFLGSVSNYVISNASCPVTVVKEPGF  162



>ref|XP_010553266.1| PREDICTED: universal stress protein A-like protein [Tarenaya 
hassleriana]
Length=160

 Score =   170 bits (430),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            +ES NKL+S+SG PLIPL+EFREPE L KY V+ ++ VLD+LDTA+RQKE+ +V+KLYWG
Sbjct  43   DESSNKLFSESGSPLIPLAEFREPETLNKYGVQIDIIVLDMLDTASRQKEVNIVSKLYWG  102

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            DAREKL D++ DLKLDS VMG+RGL++LQRIIMGSV+++++T A CP+T+VK
Sbjct  103  DAREKLLDAVADLKLDSLVMGSRGLTTLQRIIMGSVSDFIMTHAPCPVTIVK  154


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           DFS SS+ AL+WAI+NLADKGDT +IIH +P
Sbjct  12  DFSDSSKNALRWAIENLADKGDTLFIIHTNP  42



>gb|EMT01474.1| Universal stress protein A-like protein [Aegilops tauschii]
Length=166

 Score =   170 bits (430),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +3

Query  54   LIRGTLSISSTSTPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLD  233
            L RG   +      H   E+++ +W++SG PLIPLSE+REPE++K Y V  + EVLD+LD
Sbjct  35   LRRGDTVVVLHVQRHGGEEAKHAVWAKSGSPLIPLSEYREPEVMKNYGVTCDAEVLDMLD  94

Query  234  TATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTT  413
            TA RQ E+ VVAK+YWGDAREKLCD++E+ K+D+ VMG+RGL ++QRI++GSVTNYVL+ 
Sbjct  95   TAARQLELKVVAKVYWGDAREKLCDAVEEQKIDTIVMGSRGLGTIQRILLGSVTNYVLSN  154

Query  414  ATCPITVVK  440
            A+CP+TVVK
Sbjct  155  ASCPVTVVK  163



>ref|XP_010923192.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=163

 Score =   170 bits (430),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            +E+R+ LWSQSG PLIPL+E R+PE++K Y+++ ++EVLD+LDTA+RQK+ T+V K YWG
Sbjct  46   DEARHALWSQSGSPLIPLTELRQPEVMKNYDLEVDIEVLDMLDTASRQKQATIVGKFYWG  105

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            DAREKLC + EDLKLDS VMG+RG S L RI++GSVT+YVL+  +CP+T+VK PDF
Sbjct  106  DAREKLCQAEEDLKLDSLVMGSRGHSRLLRILLGSVTSYVLSNVSCPVTIVKDPDF  161



>ref|NP_001055716.1| Os05g0453700 [Oryza sativa Japonica Group]
 dbj|BAC78561.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAT47039.1| putative universal stress protein (USP) [Oryza sativa Japonica 
Group]
 dbj|BAF17630.1| Os05g0453700 [Oryza sativa Japonica Group]
 gb|EEC79327.1| hypothetical protein OsI_20177 [Oryza sativa Indica Group]
Length=165

 Score =   170 bits (430),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = +3

Query  54   LIRGTLSISSTSTPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLD  233
            L RG   +      H   E+++ LW +SG PLIPLSEFR+P  +++Y V  + EVLD+LD
Sbjct  35   LRRGDHLVVLHVLHHGGEEAKHALWGKSGSPLIPLSEFRDPTAMQQYGVHCDAEVLDMLD  94

Query  234  TATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTT  413
            TA RQ E+TVVAKLYWGDAREKLCD++E+ K+D+ VMG+RGL S+QRI++GSVTNYVL+ 
Sbjct  95   TAARQLELTVVAKLYWGDAREKLCDAVEEQKIDTLVMGSRGLGSIQRILLGSVTNYVLSN  154

Query  414  ATCPITVVK  440
            A+CP+TVVK
Sbjct  155  ASCPVTVVK  163



>ref|XP_006654496.1| PREDICTED: universal stress protein A-like protein-like [Oryza 
brachyantha]
Length=166

 Score =   169 bits (429),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = +3

Query  54   LIRGTLSISSTSTPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLD  233
            L RG   +      H   E+++ LW +SG PLIPLSEFR+P  +++Y +  + EVLD+LD
Sbjct  36   LRRGDTVVVVHVLHHGGEEAKHALWGKSGSPLIPLSEFRDPTAMQQYGIHCDAEVLDMLD  95

Query  234  TATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTT  413
            TA RQ E+TVVAKLYWGDAREKLCD++E+ K+D+ VMG+RGL S+QRI++GSVTNYVL+ 
Sbjct  96   TAARQFELTVVAKLYWGDAREKLCDAVEEQKIDTLVMGSRGLGSIQRILLGSVTNYVLSN  155

Query  414  ATCPITVVK  440
            A+CP+TVVK
Sbjct  156  ASCPVTVVK  164



>ref|XP_010515911.1| PREDICTED: universal stress protein A family protein C25B2.10-like 
[Camelina sativa]
Length=164

 Score =   169 bits (428),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P + +E+RN LW +SG PLIPL+EFREPE ++KY VK ++  LD+LDT +RQKE+ VV K
Sbjct  42   PISEDEARNSLWFKSGSPLIPLAEFREPETMEKYGVKIDIACLDMLDTGSRQKEVHVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREKL D+++DLKLDS VMG+RGLS+L+RIIMGSV+++V+  A CP+TVVK  D 
Sbjct  102  LYWGDAREKLVDAVKDLKLDSIVMGSRGLSALRRIIMGSVSSFVIQHAPCPVTVVKDNDS  161

Query  453  HK  458
            +K
Sbjct  162  YK  163


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           DFS+SS+ AL+WA DNLADKGDT Y+IH  P
Sbjct  12  DFSESSKNALQWAFDNLADKGDTIYVIHTLP  42



>ref|XP_010427062.1| PREDICTED: universal stress protein A family protein C25B2.10-like 
[Camelina sativa]
Length=163

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P + +E+RN LW +SG PLIPL EFREPE ++KY VK ++  LD+LDT +RQKE+ VV K
Sbjct  42   PMSDDEARNSLWFKSGSPLIPLVEFREPETMEKYGVKIDIACLDMLDTGSRQKEVHVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREKL D+++DLKLDS VMG+RGLS+L+RIIMGSV+++V+  A CP+TVVK  D 
Sbjct  102  LYWGDAREKLVDAVKDLKLDSIVMGSRGLSALRRIIMGSVSSFVIQHAPCPVTVVKDNDS  161

Query  453  H  455
            H
Sbjct  162  H  162


 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           DFS+SS+ AL+WA DNLADKGDT Y+IH  P
Sbjct  12  DFSESSKNALQWAFDNLADKGDTIYVIHTLP  42



>ref|NP_001236015.1| uncharacterized protein LOC100306505 [Glycine max]
 gb|ACU14709.1| unknown [Glycine max]
 gb|KHN25235.1| Universal stress protein A-like protein [Glycine soja]
Length=164

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +E RN LWS +G PLIPLSEFRE E++  Y V  + EVLDLLDTA+R+K++TVVAK
Sbjct  42   PSGGSEFRNLLWSTTGSPLIPLSEFREKEVMHHYEVDTDAEVLDLLDTASREKQVTVVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            LYWGDAREK+ +++ DLKLDS VMG+RGL ++QR+++GSVTNYV T A+CPIT+VK
Sbjct  102  LYWGDAREKIVEAVGDLKLDSLVMGSRGLGAIQRVLLGSVTNYVTTNASCPITIVK  157


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFSK S+ ALKWAIDNL   GD  YI+H+ PS
Sbjct  12  DFSKGSKIALKWAIDNLLRNGDILYIVHIKPS  43



>ref|XP_010043475.1| PREDICTED: universal stress protein A-like protein [Eucalyptus 
grandis]
 gb|KCW85492.1| hypothetical protein EUGRSUZ_B02294 [Eucalyptus grandis]
 gb|KCW85493.1| hypothetical protein EUGRSUZ_B02294 [Eucalyptus grandis]
Length=164

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +ESRN LWS +G PLIPLSEFRE  + +KY+V+ + EVLD+LDT  RQK +TVV K
Sbjct  42   PFVGDESRNLLWSATGSPLIPLSEFREKAVAQKYDVELDPEVLDMLDTGCRQKHVTVVVK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            +YWGDAR+KLC ++ DLKLD  VMG+RGL S+QR+I+GSVT++V+ TATCP+T+VK P  
Sbjct  102  IYWGDARDKLCAAVGDLKLDCLVMGSRGLGSIQRVILGSVTSHVMATATCPVTIVKEPTS  161

Query  453  H  455
            H
Sbjct  162  H  162


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           DFSK S+ ALKWAIDNL DK DT Y++H+ P
Sbjct  12  DFSKGSKLALKWAIDNLVDKDDTLYMLHVKP  42



>ref|XP_004302689.1| PREDICTED: uncharacterized protein C167.05 [Fragaria vesca subsp. 
vesca]
Length=161

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 99/117 (85%), Gaps = 2/117 (2%)
 Frame = +3

Query  102  SNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW  281
             +ESRN LW++SG PLIPLSEFRE E++KKY V  +MEVLD+LDT +RQKE+T++ K+YW
Sbjct  45   HDESRNVLWAKSGSPLIPLSEFRELEVMKKYGVPTDMEVLDMLDTVSRQKEVTIITKVYW  104

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            GDAREKL  ++EDLKLDS VMG+RGL +L+RI++GSV+NYV+T A  P+T+VK  DF
Sbjct  105  GDAREKLLQAVEDLKLDSLVMGSRGLGTLKRIVLGSVSNYVMTQAPIPVTIVK--DF  159


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSR  100
           DFSKSS+ AL+WAIDNL DKGDT +IIH++ ++
Sbjct  12  DFSKSSKNALQWAIDNLVDKGDTLHIIHINNNK  44



>gb|KJB19521.1| hypothetical protein B456_003G127400 [Gossypium raimondii]
Length=159

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P+ S+ESRN LWS SG PLIPLSEFRE E++K Y V+ + EVLDL+DTA+RQKE+ +V K
Sbjct  42   PNQSDESRNLLWSTSGSPLIPLSEFREKEVMKHYEVEPDPEVLDLVDTASRQKEVNIVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGDAR+K+C+S+ DLKLD  VMG+RGL ++QR+++GSV+N+V+  ATCP+T+VK
Sbjct  102  IYWGDARDKICESVADLKLDCLVMGSRGLGTIQRVLIGSVSNHVMVNATCPVTIVK  157


 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSR  100
           DFSK S+ ALKW+ DNL DKGDT Y+IH+ P++
Sbjct  12  DFSKGSKAALKWSTDNLVDKGDTLYLIHVKPNQ  44



>gb|KHG19157.1| hypothetical protein F383_06055 [Gossypium arboreum]
Length=159

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P+ S+ESRN LWS SG PLIPLSEFRE E++K Y V+ + EVLDL+DTA+RQKE+ +V K
Sbjct  42   PNQSDESRNLLWSTSGSPLIPLSEFREKEVMKHYEVEPDPEVLDLVDTASRQKEVNIVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGDAR+K+C+S+ DLKLD  VMG+RGL ++QR+++GSV+N+V+  ATCP+T+VK
Sbjct  102  IYWGDARDKICESVADLKLDCLVMGSRGLGTIQRVLIGSVSNHVMVNATCPVTIVK  157


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSR  100
           DFSK S+ ALKW IDNL DKGDT Y+IH+ P++
Sbjct  12  DFSKGSKAALKWTIDNLVDKGDTLYLIHVKPNQ  44



>ref|XP_010504187.1| PREDICTED: uncharacterized protein LOC104781260 [Camelina sativa]
Length=164

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P + +E+RN LW +SG PLIPL EFREPE ++KY VK ++  LD+LDT +RQKE+ VV K
Sbjct  42   PISEDEARNSLWFKSGSPLIPLVEFREPETMEKYGVKIDIACLDMLDTGSRQKEVHVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAREKL D+++DLKLDS VMG+RGLS+L+RIIMGSV+++V+  A CP+TVVK  D 
Sbjct  102  LYWGDAREKLVDAVKDLKLDSIVMGSRGLSALRRIIMGSVSSFVIQHAPCPVTVVKDNDS  161

Query  453  HK  458
            +K
Sbjct  162  YK  163


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           DFS+SS+ AL+WA DNLADKGDT Y+IH  P
Sbjct  12  DFSESSKDALQWAFDNLADKGDTIYVIHTLP  42



>ref|XP_003568332.1| PREDICTED: universal stress protein A-like protein [Brachypodium 
distachyon]
Length=167

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H   E+++ LW++SG PLIPLSEFREP +++ Y V+ + EVLD+LDTA RQ E+ VVAKL
Sbjct  51   HGGEEAKHTLWAKSGSPLIPLSEFREPAVMQNYGVRCDAEVLDMLDTAARQLELKVVAKL  110

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGDAREKLC+++++ K+D+ VMG+RGL ++QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  111  YWGDAREKLCEAVDEQKIDTIVMGSRGLGTMQRILLGSVTNYVLSNASCPVTVVK  165



>ref|NP_001235190.1| uncharacterized protein LOC100499728 [Glycine max]
 gb|ACU13396.1| unknown [Glycine max]
 gb|KHN21915.1| Universal stress protein A-like protein [Glycine soja]
Length=164

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +ES N LWS +G PLIPLSEFRE E+++ Y V  + EVLDLLDTA+RQK++ VVAK
Sbjct  42   PSGGSESGNLLWSTTGSPLIPLSEFREKEVMRHYEVDTDAEVLDLLDTASRQKQVNVVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            LYWGDAREK+ +++ DLKLDS VMG+RGL ++QR+++GSVTNYV   A+CPIT+VK
Sbjct  102  LYWGDAREKIVEAVGDLKLDSLVMGSRGLGAIQRVLLGSVTNYVTANASCPITIVK  157


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFSK S+ ALKWAIDNL   GDT YI+H  PS
Sbjct  12  DFSKGSKIALKWAIDNLISNGDTLYIVHTKPS  43



>gb|KHN05122.1| Universal stress protein A-like protein [Glycine soja]
Length=157

 Score =   167 bits (424),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +3

Query  102  SNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW  281
            S++ RN+LW++SG PLIPL+EFRE E++K Y V+ + EVLDLLDTA RQKE+ VV KL+W
Sbjct  44   SSDDRNQLWAKSGSPLIPLTEFREEEIMKHYGVQNDAEVLDLLDTAARQKEVNVVVKLHW  103

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            GD REKL DSIEDLKLDS V+G+RGL ++QR+I+GSV+N+V+T A CP+T+VK
Sbjct  104  GDVREKLLDSIEDLKLDSLVLGSRGLGTIQRMILGSVSNFVMTHAPCPVTIVK  156


 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFS SS+ ALKWAI+NLADK  TFYIIH++P+
Sbjct  12  DFSNSSKIALKWAIENLADKCHTFYIIHVNPN  43



>gb|AFK49059.1| unknown [Lotus japonicus]
Length=164

 Score =   167 bits (424),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +ESRN LWS +G PLIPLSEFRE E+++ Y V  + EVLDLLDTA+RQK++T+VAK
Sbjct  42   PPQDSESRNLLWSTTGSPLIPLSEFREREVMRHYEVDTDAEVLDLLDTASRQKQVTIVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            LYWGDAREK+ D++EDLKLD+ VMG+RGL ++QR+++GSV+ YV + A CP+T+VK
Sbjct  102  LYWGDAREKIVDAVEDLKLDALVMGSRGLGAIQRVLLGSVSTYVTSNANCPVTIVK  157


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSR  100
           DFSK S+ AL WA+DNL   GDT YIIH++P +
Sbjct  12  DFSKGSKTALNWAVDNLLRNGDTLYIIHINPPQ  44



>gb|ABY84681.1| universal stress protein 1 [Gossypium arboreum]
 gb|ACA51838.1| universal stress protein 1 [Gossypium arboreum]
Length=164

 Score =   167 bits (423),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P+ S+ESR  LWS +G PLIPLSEFRE E++K Y V+ + E+LDL+D A+ QK+ T+VAK
Sbjct  42   PNQSDESRKLLWSTTGSPLIPLSEFREKEVMKHYEVEPDPEILDLVDIASGQKQGTLVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            +YWGDAR+K+C+S+EDLKLD  VMG+RGL ++QR+++GSV+NYV+  ATCP+T+VK P  
Sbjct  102  IYWGDARDKICESVEDLKLDCLVMGSRGLGTIQRVLIGSVSNYVMVNATCPVTIVKDPSA  161

Query  453  H  455
            H
Sbjct  162  H  162


 Score = 53.9 bits (128),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSR  100
           DFSK S+ ALKW IDNL DKGDT Y+IH+ P++
Sbjct  12  DFSKGSKAALKWTIDNLVDKGDTLYLIHVKPNQ  44



>emb|CDX73512.1| BnaC08g24910D [Brassica napus]
Length=157

 Score =   164 bits (414),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +3

Query  102  SNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW  281
            S   RN LW +SG PLIPL EFREPE ++KY VK ++ VLD+LDT +RQKEI VV K+YW
Sbjct  44   SEAGRNSLWLKSGSPLIPLVEFREPETMEKYGVKIDIPVLDMLDTGSRQKEIHVVTKIYW  103

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            GDAREKL D+++ LKLDS VMG+RGLS+LQRIIMGSV+++V+  A CP+TVVK
Sbjct  104  GDAREKLVDAVKSLKLDSIVMGSRGLSALQRIIMGSVSSFVIQHAPCPVTVVK  156


 Score = 57.0 bits (136),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFS+SS+ AL+WAIDNLADKGDTFYIIH  P+
Sbjct  12  DFSESSKNALRWAIDNLADKGDTFYIIHALPT  43



>ref|XP_009405844.1| PREDICTED: universal stress protein A-like protein [Musa acuminata 
subsp. malaccensis]
Length=160

 Score =   167 bits (422),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +E+++ LW QSG PLIPL+EFR+P+++K Y +  NMEVLD LDTA+RQK   +VAK
Sbjct  44   PDKGDEAKHPLWIQSGSPLIPLTEFRQPDVMKHYELDVNMEVLDELDTASRQKGAIIVAK  103

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKH  443
            L+WGDAREKLC ++ DL LDS VMG+RG+S ++RI++GSVTNYVLT ATCP+TVVK+
Sbjct  104  LFWGDAREKLCQAVGDLGLDSLVMGSRGVSPIRRILLGSVTNYVLTNATCPVTVVKN  160


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSR  100
           DFSKSS+ AL+WAIDNL  KGDT  ++H+ P +
Sbjct  14  DFSKSSKAALRWAIDNLLRKGDTILLLHIMPDK  46



>ref|XP_009116089.1| PREDICTED: uncharacterized protein LOC103841315 [Brassica rapa]
Length=158

 Score =   164 bits (414),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P +    RN LW +SG PLIPL EFREPE ++KY VK ++ VLDLLDT +RQKEI VV K
Sbjct  42   PTSEAGPRNSLWLKSGSPLIPLVEFREPETMEKYGVKIDIPVLDLLDTGSRQKEIHVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGDAREKL D+++ LKLDS VMG+RGLS+LQRIIMGSV+++V+  A CP+TVVK
Sbjct  102  IYWGDAREKLVDAVKSLKLDSIVMGSRGLSALQRIIMGSVSSFVIQHAPCPVTVVK  157


 Score = 56.6 bits (135),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFS+SS+ AL+WAIDNLADKGDTFYIIH  P+
Sbjct  12  DFSESSKNALRWAIDNLADKGDTFYIIHALPT  43



>ref|XP_006373900.1| ENOD18 family protein [Populus trichocarpa]
 gb|ABK95880.1| unknown [Populus trichocarpa]
 gb|ERP51697.1| ENOD18 family protein [Populus trichocarpa]
Length=161

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 98/114 (86%), Gaps = 1/114 (1%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-  281
            +ESRNKLW++SGCPLIPL EF++PE+LK Y VK + EVLD+LDT +RQK++ VV+KLYW 
Sbjct  46   DESRNKLWAESGCPLIPLDEFKDPEILKNYGVKVDAEVLDMLDTISRQKKVRVVSKLYWG  105

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKH  443
            GDAREKL D+++DLKLDS VMG+RGL ++QRI++GSV+ YV+  A CP+T+VK 
Sbjct  106  GDAREKLLDAVQDLKLDSLVMGSRGLGTVQRILLGSVSAYVMANAPCPVTIVKE  159


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFS SS  ALKWAIDNL D GDT Y+++++ + L
Sbjct  12   DFSPSSRNALKWAIDNLVDDGDTLYLVNVNSNSL  45



>ref|XP_004507155.1| PREDICTED: uncharacterized protein C167.05-like [Cicer arietinum]
Length=164

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  S ESRN LW  +G PLIPLSEFRE E++  Y V  + EVLDLLDTA+RQKE+TVVAK
Sbjct  42   PSQSTESRNLLWLTTGSPLIPLSEFREKEVMHHYEVDPDAEVLDLLDTASRQKELTVVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REK+CD++ DLKLD+ VMG+RGL ++QR+++GSV++YV + A+CP+T+VK
Sbjct  102  IYWGDPREKICDAVGDLKLDALVMGSRGLGAIQRVLLGSVSSYVTSNASCPVTIVK  157


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSR  100
           DFSK S+ ALKWAI+NL    DT YIIH++PS+
Sbjct  12  DFSKGSKIALKWAIENLLRNADTLYIIHINPSQ  44



>gb|AFK43282.1| unknown [Lotus japonicus]
Length=164

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +ESRN LWS +G PLIPLSEFRE E+++ Y V  + EVLDLLDTA+RQK+ T+VAK
Sbjct  42   PPQDSESRNLLWSTTGSPLIPLSEFREREVMRHYEVDTDAEVLDLLDTASRQKQATIVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            LYWGDAREK+ D++EDLKLD+ VMG+RGL ++QR+++GSV+ YV + A CP+T+VK
Sbjct  102  LYWGDAREKIVDAVEDLKLDALVMGSRGLGAIQRVLLGSVSTYVTSNANCPVTIVK  157


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSR  100
           DFSK S+ AL WA+DNL   GDT YIIH++P +
Sbjct  12  DFSKGSKTALNWAVDNLLRNGDTLYIIHINPPQ  44



>emb|CDY13163.1| BnaC04g26720D [Brassica napus]
Length=162

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P +  +S N  W +SG PLIPL EFREPE+++KY VK ++ VLD+LDT +RQKE+ VV K
Sbjct  42   PTSEVDSHNSAWLESGSPLIPLMEFREPEIMEKYGVKIDIPVLDMLDTGSRQKEVHVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDARE L D++EDLKLDS VMG+RGLS+L+RIIMGSV+++V+  A CP+TVVK  D 
Sbjct  102  LYWGDAREALVDAVEDLKLDSIVMGSRGLSALRRIIMGSVSSFVIQHAPCPVTVVKDNDS  161

Query  453  H  455
            H
Sbjct  162  H  162


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFS+SS+ ALKWA +NLADKGDT YIIH  P+
Sbjct  12  DFSESSKNALKWAFENLADKGDTLYIIHTLPT  43



>ref|XP_009139276.1| PREDICTED: universal stress protein A-like protein [Brassica 
rapa]
 emb|CDX76180.1| BnaA04g04440D [Brassica napus]
Length=162

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P +  +S N  W +SG PLIPL EFREPE+++KY VK ++ VLD+LDT +RQKE+ VV K
Sbjct  42   PTSEVDSHNSAWLESGSPLIPLVEFREPEIMEKYGVKIDIPVLDMLDTGSRQKEVHVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDARE L D++EDLKLDS VMG+RGLS+L+RIIMGSV+++V+  A CP+TVVK  D 
Sbjct  102  LYWGDAREALVDAVEDLKLDSIVMGSRGLSALRRIIMGSVSSFVIQHAPCPVTVVKDNDS  161

Query  453  H  455
            H
Sbjct  162  H  162


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFS+SS+ ALKWA +NLADKGDT YIIH  P+
Sbjct  12  DFSESSKNALKWAFENLADKGDTLYIIHTLPT  43



>ref|XP_004137750.1| PREDICTED: uncharacterized protein C167.05-like isoform 1 [Cucumis 
sativus]
Length=176

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 116/175 (66%), Gaps = 34/175 (19%)
 Frame = +3

Query  33   NGPLIT*LIRGTLSISSTSTP-HASN-------------------------------ESR  116
            +GPL T  IR TLS SST TP H+ N                               +SR
Sbjct  4    DGPLTTWPIRVTLSSSSTLTPIHSKNLPIASGLNPVLVSNQSSVSFFFFFFLLYSFCKSR  63

Query  117  NKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDARE  296
            ++        LIPLSEFREPE+LKKY+VK ++E LD+LDT  RQKEITVV+KLYWGDARE
Sbjct  64   SRFGFLPA--LIPLSEFREPEVLKKYDVKIDIEALDILDTGARQKEITVVSKLYWGDARE  121

Query  297  KLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  461
            K+ D+IEDLKLDS VMG+RGLS+++RI++GSV+NYV+T A CP+TVVK  +F  H
Sbjct  122  KIVDAIEDLKLDSLVMGSRGLSTIRRILLGSVSNYVITHAPCPVTVVKDSNFPHH  176



>ref|XP_002309096.1| ENOD18 family protein [Populus trichocarpa]
 gb|ABK94618.1| unknown [Populus trichocarpa]
 gb|EEE92619.1| ENOD18 family protein [Populus trichocarpa]
Length=157

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 102/116 (88%), Gaps = 1/116 (1%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H +  S N+L+++SG PLIPL+EFREPE+LKKY+V+A+++VLD+LDT +RQKE+ VV+KL
Sbjct  39   HINPNSHNQLFAKSGSPLIPLAEFREPEILKKYDVQADIQVLDMLDTISRQKEVKVVSKL  98

Query  276  YW-GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YW GDAREKL D+I+DLKLDS VMG+RGL +++RI++GSV+ YV+T A CP+T+VK
Sbjct  99   YWGGDAREKLLDAIDDLKLDSLVMGSRGLGTIRRILLGSVSTYVMTHAPCPVTIVK  154


 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFS SS+ ALKWAIDNL D GDT Y+IH++P+
Sbjct  12  DFSPSSKNALKWAIDNLVDNGDTLYLIHINPN  43



>ref|NP_001236285.1| uncharacterized protein LOC100527197 [Glycine max]
 gb|ACU16249.1| unknown [Glycine max]
 gb|KHN25838.1| Universal stress protein A-like protein [Glycine soja]
Length=157

 Score =   163 bits (413),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +3

Query  102  SNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW  281
            S++ RN+LW +SG PL+PL+EFR+ E+ K Y V+ + EVLDLLDTA RQKE+ VV KLYW
Sbjct  44   SSDDRNQLWVKSGSPLVPLTEFRDAEVTKHYGVQTDAEVLDLLDTAARQKEVNVVVKLYW  103

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            GD REKL DSIEDLKL+S V+G+RGL ++QR+I+GSV+N+V+T A CP+T+VK
Sbjct  104  GDVREKLLDSIEDLKLNSLVLGSRGLGTIQRMILGSVSNFVMTHAPCPVTIVK  156


 Score = 54.7 bits (130),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFSKSS+ ALKWAI+NLADKG T YIIH++P+
Sbjct  12  DFSKSSKIALKWAIENLADKGQTLYIIHVNPN  43



>ref|XP_011019203.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
Length=157

 Score =   165 bits (417),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 101/116 (87%), Gaps = 1/116 (1%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H +  S N+L+++SG PLIPL+EFREPE+LKKY+V+ ++EVLD+LDT +RQKE+ VV+KL
Sbjct  39   HINPNSHNQLFAKSGSPLIPLAEFREPEILKKYDVEVDIEVLDMLDTISRQKEVKVVSKL  98

Query  276  YW-GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YW GDAREKL D+I+DLKLDS VMG+RGL +++RI++GSV+ YV+T A CP+TVVK
Sbjct  99   YWGGDAREKLLDAIDDLKLDSLVMGSRGLGTIRRILLGSVSTYVMTHAPCPVTVVK  154


 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFS SS+ ALKWAIDNL D GDT Y+IH++P+
Sbjct  12  DFSPSSKNALKWAIDNLVDNGDTLYLIHINPN  43



>ref|XP_006424952.1| hypothetical protein CICLE_v10029414mg [Citrus clementina]
 ref|XP_006488418.1| PREDICTED: universal stress protein A-like protein-like [Citrus 
sinensis]
 gb|ESR38192.1| hypothetical protein CICLE_v10029414mg [Citrus clementina]
Length=166

 Score =   165 bits (417),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 101/127 (80%), Gaps = 1/127 (1%)
 Frame = +3

Query  66   TLSISSTSTPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATR  245
            TL I     P   +ESRN LWS +G PLIPL EFR+ E++K+Y V  + +VLD+LD A++
Sbjct  35   TLYIIHIKLPQ-DDESRNLLWSDTGSPLIPLEEFRDQEVMKQYEVDLDQDVLDMLDAASK  93

Query  246  QKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCP  425
            QK ++VVAKLYWGDAR+KLC+++E +KLDS VMG+RGL ++QR+++GSV+N+VL  A+CP
Sbjct  94   QKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCP  153

Query  426  ITVVKHP  446
            +T+VK P
Sbjct  154  VTIVKDP  160


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSK S+ ALKWAIDNL +KGDT YIIH+
Sbjct  13  DFSKGSKLALKWAIDNLLEKGDTLYIIHI  41



>ref|XP_002323532.2| hypothetical protein POPTR_0016s10110g [Populus trichocarpa]
 gb|EEF05293.2| hypothetical protein POPTR_0016s10110g [Populus trichocarpa]
Length=223

 Score =   166 bits (421),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-  281
            +ESRNKLW++SGCPLIPL EF++PE+LK Y VK + EVLD+LDT +RQK++ VV+KLYW 
Sbjct  108  DESRNKLWAESGCPLIPLDEFKDPEILKNYGVKVDAEVLDMLDTISRQKKVRVVSKLYWG  167

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            GDAREKL D+++DLKLDS VMG+RGL ++QRI++GSV+ YV+  A CP+T+VK
Sbjct  168  GDAREKLLDAVQDLKLDSLVMGSRGLGTVQRILLGSVSAYVMANAPCPVTIVK  220



>gb|KDO66689.1| hypothetical protein CISIN_1g041485mg, partial [Citrus sinensis]
Length=179

 Score =   165 bits (417),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 101/127 (80%), Gaps = 1/127 (1%)
 Frame = +3

Query  66   TLSISSTSTPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATR  245
            TL I     P   +ESRN LWS +G PLIPL EFR+ E++K+Y V  + +VLD+LD A++
Sbjct  48   TLYIIHIKLPQG-DESRNLLWSDTGSPLIPLEEFRDQEVMKQYEVDLDQDVLDMLDAASK  106

Query  246  QKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCP  425
            QK ++VVAKLYWGDAR+KLC+++E +KLDS VMG+RGL ++QR+++GSV+N+VL  A+CP
Sbjct  107  QKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGLGTIQRVLLGSVSNHVLANASCP  166

Query  426  ITVVKHP  446
            +T+VK P
Sbjct  167  VTIVKDP  173


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSK S+ ALKWAIDNL +KGDT YIIH+
Sbjct  26  DFSKGSKLALKWAIDNLLEKGDTLYIIHI  54



>ref|NP_001288953.1| uncharacterized protein C167.05-like [Brassica rapa]
 gb|ABL97944.1| hypothetical protein [Brassica rapa]
 emb|CDX67580.1| BnaA07g16200D [Brassica napus]
Length=159

 Score =   162 bits (410),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P +  ESRN LW +SG PLIPL+EFREP++++ Y VK ++  LD+LDT +R+KE+ VV K
Sbjct  42   PTSEAESRNALWLESGSPLIPLAEFREPKIMENYGVKIDIACLDMLDTGSRKKEVHVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            LYWGDAREKL D++++LKLDS VMG+RGLS+LQRIIMGSV+++V+  A CP+T+VK
Sbjct  102  LYWGDAREKLVDAVKELKLDSIVMGSRGLSALQRIIMGSVSSFVIDHAPCPVTIVK  157


 Score = 54.3 bits (129),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFS+SS+ ALKWAI+NLADKGDT YIIH  P+
Sbjct  12  DFSESSKNALKWAIENLADKGDTLYIIHTLPT  43



>gb|ABK22475.1| unknown [Picea sitchensis]
 gb|ABK23200.1| unknown [Picea sitchensis]
 gb|ACN40676.1| unknown [Picea sitchensis]
Length=164

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  111  SRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDA  290
             +++LW ++G PLIPL+EFRE  L K Y +  + EVLD+LDTA RQKE+ V+AK+YWGDA
Sbjct  49   GQSQLWDKAGSPLIPLAEFREGNLSKHYELNPDAEVLDMLDTAARQKELEVIAKVYWGDA  108

Query  291  REKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            REKLCD++EDLKLDS VMG+RGL  L+R+ +GSV+NYV++ A CP+TVVK P F
Sbjct  109  REKLCDAVEDLKLDSLVMGSRGLGQLKRVFLGSVSNYVISNANCPVTVVKEPGF  162



>ref|XP_007132029.1| hypothetical protein PHAVU_011G060700g [Phaseolus vulgaris]
 gb|ESW04023.1| hypothetical protein PHAVU_011G060700g [Phaseolus vulgaris]
Length=164

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +3

Query  102  SNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW  281
             +ESRN LWS +G PLIPLSEFRE E++  Y V ++ EVLDLLDTA++QK++ VVAKLYW
Sbjct  45   GSESRNLLWSTTGSPLIPLSEFREKEVMHHYEVDSDAEVLDLLDTASKQKQVDVVAKLYW  104

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            GDAREK+C+++ DLKL + VMG+RGL ++QR+++GSVTNYV   A+CP+T+VK
Sbjct  105  GDAREKICEAVGDLKLHTLVMGSRGLGAIQRVLLGSVTNYVTLNASCPVTIVK  157



>ref|XP_004163857.1| PREDICTED: uncharacterized protein C167.05-like isoform 1 [Cucumis 
sativus]
Length=185

 Score =   162 bits (411),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +3

Query  147  LIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLK  326
            LIPLSEFREPE+LKKY+VK ++E LD+LDT  RQKEITVV+KLYWGDAREK+ D+IEDLK
Sbjct  81   LIPLSEFREPEVLKKYDVKIDIEALDILDTGARQKEITVVSKLYWGDAREKIVDAIEDLK  140

Query  327  LDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  461
            LDS VMG+RGLS+++RI++GSV+NYV+T A CP+TVVK  +F  H
Sbjct  141  LDSLVMGSRGLSTIRRILLGSVSNYVITHAPCPVTVVKDSNFPHH  185



>ref|XP_008221790.1| PREDICTED: uncharacterized protein LOC103321737 [Prunus mume]
Length=162

 Score =   162 bits (409),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +ESRN LWS +G PLIPL+EFR+  +++ Y V+ + EVLDLLDTA RQK +TVVAK
Sbjct  43   PSQGDESRNLLWSTTGSPLIPLAEFRQKAVMENYEVEVDPEVLDLLDTAHRQKHVTVVAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            LYWGDAREKLC ++EDLKLD  V+G+RGL ++QR+++GSV++YV+  ATC +T+VK
Sbjct  103  LYWGDAREKLCGAVEDLKLDCLVLGSRGLGTIQRVLLGSVSSYVMANATCAVTIVK  158


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 1/34 (3%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLA-DKGDTFYIIHLHPSR  100
           DFS+ S+ ALKWAI+NLA +KGDT Y IH+ PS+
Sbjct  12  DFSRGSKIALKWAINNLAHEKGDTLYAIHVKPSQ  45



>emb|CDY07565.1| BnaC06g14990D [Brassica napus]
Length=159

 Score =   161 bits (407),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P +  ESRN LW +SG PLIPL EFREP++++ Y VK ++  LD+LDT +R+KE+ VV K
Sbjct  42   PTSEAESRNALWLESGSPLIPLVEFREPKIMENYGVKIDIACLDMLDTGSRKKEVHVVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            LYWGDAREKL D++++LKLDS VMG+RGLS+LQRIIMGSV+++V+  A CP+T+VK
Sbjct  102  LYWGDAREKLVDAVKELKLDSIVMGSRGLSALQRIIMGSVSSFVIDHAPCPVTIVK  157


 Score = 52.4 bits (124),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           D S+SS+ ALKWAI+NLADKGDT YIIH  P+
Sbjct  12  DLSESSKNALKWAIENLADKGDTLYIIHTLPT  43



>ref|XP_008384901.1| PREDICTED: universal stress protein A-like protein [Malus domestica]
Length=162

 Score =   161 bits (408),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +ESR+ LWS +G PLIP +EFRE  +++KY+VK + EVLDLLDT +RQK  TVVAK
Sbjct  43   PSQGDESRSTLWSSTGSPLIPFTEFREKLVMEKYDVKVDAEVLDLLDTVSRQKHATVVAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            LYWGDAREKLC + E+LKLD  V+G+RGL S+QR+++GSV++YV+  A CP+T+VK
Sbjct  103  LYWGDAREKLCGAAEELKLDCLVLGSRGLGSIQRVLLGSVSSYVMANAICPVTIVK  158


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 1/34 (3%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLA-DKGDTFYIIHLHPSR  100
           DFSK  + ALKWA+DNL  +KGDT Y+IH+ PS+
Sbjct  12  DFSKGCKVALKWAMDNLIHEKGDTLYVIHIKPSQ  45



>ref|XP_007206045.1| hypothetical protein PRUPE_ppa012585mg [Prunus persica]
 gb|EMJ07244.1| hypothetical protein PRUPE_ppa012585mg [Prunus persica]
Length=162

 Score =   161 bits (407),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +ESRN LWS +G PLIPL EFR+  +++ Y V+ + EVLDLLDTA RQK +TVVAK
Sbjct  43   PSQGDESRNLLWSTTGSPLIPLEEFRQKAVMENYEVEVDPEVLDLLDTAHRQKHVTVVAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            LYWGDAREKLC ++EDLKLD  V+G+RGL ++QR+++GSV++YV+  ATC +T+VK
Sbjct  103  LYWGDAREKLCGAVEDLKLDCLVLGSRGLGTIQRVLLGSVSSYVMANATCAVTIVK  158


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 1/34 (3%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLA-DKGDTFYIIHLHPSR  100
           DFSK S+ ALKWAI+NLA +KGDT Y IH+ PS+
Sbjct  12  DFSKGSKIALKWAINNLAHEKGDTLYAIHVKPSQ  45



>ref|XP_002520471.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41884.1| conserved hypothetical protein [Ricinus communis]
Length=164

 Score =   161 bits (407),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +ESR  LWS +G PLIPL EFRE E+  KY +K + EVLD+LDT +RQK++T+VAK
Sbjct  42   PQQGDESRLLLWSATGSPLIPLVEFREQEVANKYEIKLDPEVLDMLDTVSRQKQVTIVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            LYWGDAR++ C+++  LKLD  VMG+RGL +++R+++GSVTNYV+ TATCP+TVVK    
Sbjct  102  LYWGDARDRFCEAVGHLKLDCLVMGSRGLGTIKRVLLGSVTNYVMATATCPVTVVKDSSP  161

Query  453  H  455
            H
Sbjct  162  H  162


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSR  100
           DFSK S+ AL WAI NL D GDT YIIH+ P +
Sbjct  12  DFSKGSKLALNWAITNLIDNGDTLYIIHVKPQQ  44



>gb|AFK45410.1| unknown [Medicago truncatula]
 gb|KEH30197.1| adenine nucleotide alpha hydrolase superfamily protein [Medicago 
truncatula]
Length=164

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = +3

Query  66   TLSISSTSTPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATR  245
            TL I   +  H + ESRN LW+ +G PLIPLSEFRE  ++ +Y V  + EVLD+LDTA+R
Sbjct  34   TLYIVHVNHSHPT-ESRNLLWATTGSPLIPLSEFREKNVVHQYEVDPDAEVLDILDTASR  92

Query  246  QKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCP  425
            QK++TVV K+YWGDAREK+ DS+ DLKLD+ VMG+RGL ++QR+++GSV+ YV + A+CP
Sbjct  93   QKQVTVVGKVYWGDAREKIVDSVGDLKLDALVMGSRGLGAIQRVLLGSVSTYVTSNASCP  152

Query  426  ITVVK  440
            +T+VK
Sbjct  153  VTIVK  157


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 3/35 (9%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL---HPS  97
           DFSK S+ ALKWAIDNL   GDT YI+H+   HP+
Sbjct  12  DFSKGSKIALKWAIDNLLRTGDTLYIVHVNHSHPT  46



>ref|XP_009350161.1| PREDICTED: universal stress protein A-like protein [Pyrus x bretschneideri]
Length=162

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +ESR+ LWS +G PLIP +EFRE  +++KY+VK + EVLDLLDT +RQK  TVVAK
Sbjct  43   PSQGDESRSTLWSSTGSPLIPFTEFREKLVMEKYDVKVDAEVLDLLDTVSRQKHATVVAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGDAREKLC + E+LKLD  V+G+RGL S+QR+++GSV++YV+  A CP+T+VK
Sbjct  103  IYWGDAREKLCGAAEELKLDCLVLGSRGLGSIQRVLLGSVSSYVMANAICPVTIVK  158


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 1/34 (3%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLA-DKGDTFYIIHLHPSR  100
           DFSK  + ALKWAIDNL  +KGDT Y+IH+ PS+
Sbjct  12  DFSKGCKLALKWAIDNLIHEKGDTLYVIHVKPSQ  45



>ref|XP_004492382.1| PREDICTED: uncharacterized protein C167.05-like [Cicer arietinum]
Length=163

 Score =   159 bits (403),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            ++S+ESRNKL +++G PLIPL E +E E+L KY V+A++EVLD+L  A  QKE++VVAKL
Sbjct  43   NSSDESRNKLLAKTGSPLIPLEELKEAEVLSKYGVQADVEVLDMLHAAAVQKEVSVVAKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGDAR+KL DSIEDLKLD+ V+G+RGLS+++RI++GSV+N+V+  + CP+T+VK
Sbjct  103  YWGDARQKLMDSIEDLKLDALVLGSRGLSTIKRILLGSVSNFVMVHSPCPVTIVK  157


 Score = 52.4 bits (124),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLH  91
           DFSK+S+ ALKWAI N+ADKGDTFY+IH++
Sbjct  12  DFSKNSKNALKWAIVNMADKGDTFYLIHIN  41



>gb|KDP24530.1| hypothetical protein JCGZ_25094 [Jatropha curcas]
Length=163

 Score =   158 bits (400),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 103/120 (86%), Gaps = 2/120 (2%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++ +ES ++LW++SG PLIPL++FREPE LK Y+VK +++VLD+LDT +RQKE+ V+ K
Sbjct  42   PNSLDES-HQLWAKSGSPLIPLAQFREPETLKSYDVKIDIDVLDMLDTISRQKEVNVITK  100

Query  273  LYW-GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
            LYW GDAR+KL D+I+DLKLDS VMG+RGL +++RI++GSV+ +V+T ATCP+TVVK  D
Sbjct  101  LYWGGDARDKLLDAIDDLKLDSLVMGSRGLGTVKRILLGSVSTFVMTHATCPVTVVKDLD  160


 Score = 52.8 bits (125),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFS SS+ ALKWAIDNLAD+ DT Y+IH++P+ L
Sbjct  12   DFSPSSKKALKWAIDNLADRKDTLYLIHVNPNSL  45



>gb|EEE63940.1| hypothetical protein OsJ_18765 [Oryza sativa Japonica Group]
Length=171

 Score =   160 bits (404),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 100/135 (74%), Gaps = 6/135 (4%)
 Frame = +3

Query  54   LIRGTLSISSTSTPHASNESRNKLWSQSGC------PLIPLSEFREPELLKKYNVKANME  215
            L RG   +      H   E+++ LW +SG        LIPLSEFR+P  +++Y V  + E
Sbjct  35   LRRGDHLVVLHVLHHGGEEAKHALWGKSGSLDSIPPALIPLSEFRDPTAMQQYGVHCDAE  94

Query  216  VLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVT  395
            VLD+LDTA RQ E+TVVAKLYWGDAREKLCD++E+ K+D+ VMG+RGL S+QRI++GSVT
Sbjct  95   VLDMLDTAARQLELTVVAKLYWGDAREKLCDAVEEQKIDTLVMGSRGLGSIQRILLGSVT  154

Query  396  NYVLTTATCPITVVK  440
            NYVL+ A+CP+TVVK
Sbjct  155  NYVLSNASCPVTVVK  169



>ref|XP_008386015.1| PREDICTED: uncharacterized protein LOC103448528 [Malus domestica]
Length=162

 Score =   158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +ESR+ LWS +G PLIP +EFRE  +++KY V+ + EVL+LL+TA+RQK +TVVAK
Sbjct  43   PSQGDESRSILWSSTGSPLIPFTEFREKSVMEKYEVELDAEVLELLETASRQKHVTVVAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            LYWGDAREKLC + E+LKLD  V+G+RGL ++QR+++GSV++YV+  A CP+TVVK
Sbjct  103  LYWGDAREKLCGAAEELKLDCLVIGSRGLGTIQRVLLGSVSSYVMANAECPVTVVK  158


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 1/34 (3%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLA-DKGDTFYIIHLHPSR  100
           DFSK S+ ALKWAIDNL+ +KGDT Y+IH+ PS+
Sbjct  12  DFSKGSKIALKWAIDNLSQEKGDTLYVIHVKPSQ  45



>emb|CAC18558.1| ENOD18 protein [Vicia faba]
Length=164

 Score =   157 bits (396),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            ++S+ESRNKL++++G PLIPL E +E  ++K+Y V+ ++EV+DLL+ A  QKE++VVAKL
Sbjct  42   NSSDESRNKLFAKTGSPLIPLEELKEAGVMKQYGVQTDVEVIDLLEIAATQKEVSVVAKL  101

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGDAR+KL DSIEDLKLD+ V+G+RGLS+++RI++GSV+N+V+  + CP+T+VK
Sbjct  102  YWGDARQKLMDSIEDLKLDALVLGSRGLSTIKRILLGSVSNFVMVHSPCPVTIVK  156


 Score = 52.4 bits (124),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLH  91
           DFSK+S+ ALKWAI N+ADKGDTFY+IH++
Sbjct  11  DFSKNSKNALKWAIVNMADKGDTFYLIHIN  40



>gb|EPS57397.1| hypothetical protein M569_17421 [Genlisea aurea]
Length=185

 Score =   157 bits (398),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
             +S ++L    G PLIPLSEFREPE+++ Y+V  ++E+LD+LDTA+RQKEITVV K+YWG
Sbjct  68   QDSSHELCFHGGSPLIPLSEFREPEVMRNYDVPIDIEILDMLDTASRQKEITVVVKVYWG  127

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            D REK+ +++EDL LDS V+GNRGLS+++RI++GSVTNYV+  A+CP+T+VK
Sbjct  128  DPREKIVEAVEDLNLDSLVIGNRGLSTIKRILLGSVTNYVMEHASCPVTIVK  179


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFS++S+ AL+W+IDNLAD GDTFYI+H+
Sbjct  36  DFSETSKAALQWSIDNLADGGDTFYILHV  64



>emb|CAC18556.1| early nodulin ENOD18 [Vicia faba]
Length=165

 Score =   155 bits (391),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            ++S+ESR+KL++++G PLIPL E +E  ++K+Y V+ ++EV+DLL+ A  QKE++VVAKL
Sbjct  43   NSSDESRSKLFAKTGSPLIPLEELKEAGVMKQYGVQTDVEVIDLLEIAATQKEVSVVAKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGDAR+KL DSIEDLKLD+ V+G+RGLS+++RI++GSV+N+V+  + CP+T+VK
Sbjct  103  YWGDARQKLMDSIEDLKLDALVLGSRGLSTIKRILLGSVSNFVMVHSPCPVTIVK  157


 Score = 52.4 bits (124),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLH  91
           DFSK+S+ ALKWAI N+ADKGDTFY+IH++
Sbjct  12  DFSKNSKNALKWAIVNMADKGDTFYLIHIN  41



>ref|XP_003623213.1| Early nodulin ENOD18 [Medicago truncatula]
 gb|AES79431.1| early nodulin ENOD18 [Medicago truncatula]
Length=169

 Score =   154 bits (389),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            ++S+ESRNK ++++G PLI L E +E E++ KY V+ ++EVLD+LDT   QKE++VVAKL
Sbjct  43   NSSDESRNKQFAKTGSPLISLEELKEVEVMSKYGVQTDVEVLDMLDTLATQKEVSVVAKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGDAR+KL DSIEDLKLD+ V+G+RGLS+++RI++GSV+N+V+  + CP+T+VK
Sbjct  103  YWGDARQKLMDSIEDLKLDALVLGSRGLSTIKRILLGSVSNFVMVHSPCPVTIVK  157


 Score = 52.4 bits (124),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLH  91
           DFSK+S+ ALKWAI N+ADKGDTFY+IH++
Sbjct  12  DFSKNSKNALKWAIVNMADKGDTFYLIHIN  41



>gb|AFK37746.1| unknown [Lotus japonicus]
Length=160

 Score =   150 bits (380),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +3

Query  102  SNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW  281
            S+ SR  +W++SG PLIPLS  R+PE +  Y V+ + EVLD+LD A  QKE+  VAKLYW
Sbjct  42   SDGSRTNIWAKSGSPLIPLSILRQPEAMSNYGVQTDPEVLDMLDAAAGQKEVNFVAKLYW  101

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            G+AR+KL DSIEDLKLDS VMG+RG  S++RI+MGSV+N+++  ATCP+ +V+
Sbjct  102  GEARQKLIDSIEDLKLDSLVMGSRGRGSIKRILMGSVSNFLMIHATCPVAIVR  154


 Score = 55.5 bits (132),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS  ALKWAI+N+ADKGDTFYIIH+
Sbjct  12  DFSKSSNSALKWAIENMADKGDTFYIIHV  40



>ref|XP_004291522.1| PREDICTED: universal stress protein A-like protein [Fragaria 
vesca subsp. vesca]
Length=161

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +ESR+ LWS +G PLIP +EFR+ ++++ Y V+ + EVL+LLDTA +QK +TV+AK
Sbjct  42   PQEGSESRSLLWSTTGSPLIPFAEFRQKDVMENYEVELDQEVLELLDTAIKQKHVTVIAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGDAR+KLC+++EDLKLD  V+G+RGL +LQR+++GSV+++V+  A CP+T+VK
Sbjct  102  IYWGDARDKLCEAVEDLKLDCLVLGSRGLGTLQRVLLGSVSSHVMANANCPVTIVK  157


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPS  97
           DFSK S+ ALKWA+ NL+DK DT Y+IH+ P 
Sbjct  12  DFSKGSKTALKWALHNLSDKSDTLYVIHVKPQ  43



>ref|XP_002281607.1| PREDICTED: uncharacterized protein C167.05 [Vitis vinifera]
 emb|CBI16038.3| unnamed protein product [Vitis vinifera]
Length=164

 Score =   155 bits (391),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +ESRN LWS +G PLIPL EFR+ ++ +KY +  + E L +L TA+ QK+  ++AK
Sbjct  42   PSQGDESRNLLWSATGSPLIPLEEFRDLDVAQKYEINLDPEFLGMLATASSQKKAKIIAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            +YWGDAR+KLCD++ +LKLDS VMG+RGL ++QR  +GSVTNYV+  ATCP+T+VK P  
Sbjct  102  IYWGDARDKLCDAVAELKLDSLVMGSRGLGTIQRTFLGSVTNYVMVHATCPVTIVKDPSS  161

Query  453  H  455
            H
Sbjct  162  H  162


 Score = 50.1 bits (118),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSR  100
           DFS+ S  ALKWAIDNL DKGDT + IH+ PS+
Sbjct  12  DFSQGSNIALKWAIDNLLDKGDTLFFIHVKPSQ  44



>gb|AFK47553.1| unknown [Medicago truncatula]
Length=169

 Score =   151 bits (382),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            ++S+ESRNK ++++G PLI L E +E E++ KY V+ ++EVLD+LDT   QKE++VVAKL
Sbjct  43   NSSDESRNKQFAKTGSPLISLEELKEVEVMSKYGVQTDVEVLDMLDTLATQKEVSVVAKL  102

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGDAR+KL DSIEDLKLD+ V+G+RGLS+++ I++GSV+N+V+  + CP+T+VK
Sbjct  103  YWGDARQKLMDSIEDLKLDALVLGSRGLSTIKGILLGSVSNFVMVHSPCPVTIVK  157


 Score = 52.4 bits (124),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLH  91
           DFSK+S+ ALKWAI N+ADKGDTFY+IH++
Sbjct  12  DFSKNSKNALKWAIVNMADKGDTFYLIHIN  41



>ref|XP_008657063.1| PREDICTED: universal stress protein A-like protein [Zea mays]
 gb|AFW84580.1| hypothetical protein ZEAMMB73_526883 [Zea mays]
Length=158

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H   E +N LWS++G PL+PL E  EP + ++Y+V  + EV D+L+ A RQKE+ VV K+
Sbjct  42   HGREEGKNVLWSRTGSPLVPLEELMEPPVRQRYDVPYDAEVFDMLNAAARQKEMRVVVKM  101

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGD REK+CD++E+L+++S VMG+RGL  +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  102  YWGDPREKVCDAVEELQIESLVMGSRGLGQIQRILLGSVTNYVLSNASCPVTVVK  156



>emb|CAC18557.1| early nodulin ENOD18 [Vicia faba]
Length=164

 Score =   150 bits (380),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 100/115 (87%), Gaps = 1/115 (1%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            ++S+ESR+KL++++G PLIPL E +E  ++K+Y V+ ++EV+DLL+ A  QKE++VVAKL
Sbjct  43   NSSDESRSKLFAKTGSPLIPL-ELKEAGVMKQYGVQTDVEVIDLLEIAATQKEVSVVAKL  101

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGDAR+KL DSIEDLKLD+ V+G+RGLS+++RI++GSV+N+V+  + CP+T+VK
Sbjct  102  YWGDARQKLMDSIEDLKLDALVLGSRGLSTIKRILLGSVSNFVMVHSPCPVTIVK  156


 Score = 52.4 bits (124),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLH  91
           DFSK+S+ ALKWAI N+ADKGDTFY+IH++
Sbjct  12  DFSKNSKNALKWAIVNMADKGDTFYLIHIN  41



>ref|XP_008791855.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Phoenix dactylifera]
Length=164

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +3

Query  102  SNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW  281
            S+ ++ KLW  +G PLIPL EFRE  L K+Y +  + EVLD+LDTA++ K++ VV+K+YW
Sbjct  45   SDHAQKKLWEDTGSPLIPLEEFREMNLSKQYGINPDREVLDILDTASKTKQVKVVSKIYW  104

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            GD REKLCD++EDLKLDS V+G+RGL S +R+++GSV++YV++ ATCP+TVVK
Sbjct  105  GDPREKLCDAVEDLKLDSLVVGSRGLGSFKRLLLGSVSSYVVSNATCPVTVVK  157



>ref|XP_004137752.1| PREDICTED: uncharacterized protein C167.05-like isoform 3 [Cucumis 
sativus]
Length=142

 Score =   148 bits (373),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P++  ES ++LW++SG PLIPLSEFREPE+LKKY+VK ++E LD+LDT  RQKEITVV+K
Sbjct  42   PNSLEESAHRLWAESGSPLIPLSEFREPEVLKKYDVKIDIEALDILDTGARQKEITVVSK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIM  383
            LYWGDAREK+ D+IEDLKLDS VMG+RGLS+++R + 
Sbjct  102  LYWGDAREKIVDAIEDLKLDSLVMGSRGLSTIRRFVF  138


 Score = 53.9 bits (128),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFS SS+ AL+WAIDNLADKGDT +II+++P+ L
Sbjct  12   DFSNSSKNALRWAIDNLADKGDTLFIIYVNPNSL  45



>gb|AID16037.1| putative universal stress protein [Catharanthus roseus]
Length=163

 Score =   152 bits (383),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = +3

Query  60   RGTLSISSTSTPHASNESRN-KLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDT  236
            +G   I  T  P    ES   +LW  +G PLIPLSEF +P ++KKY V  ++E L++++T
Sbjct  33   KGDHLILVTIRPEGHYESGEMQLWETTGSPLIPLSEFSDPHIMKKYGVTPDVETLEIVNT  92

Query  237  ATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTA  416
            A RQKEI V+ K+YWGDAREKLC+S++D+ LD  ++GNRGL +++R IMGSV+NYV+  A
Sbjct  93   AARQKEIVVLMKIYWGDAREKLCESVDDIPLDCIILGNRGLGTIKRAIMGSVSNYVVNNA  152

Query  417  TCPITVVKH  443
            TCP+TVVK 
Sbjct  153  TCPVTVVKQ  161



>ref|XP_010917276.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=164

 Score =   152 bits (383),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  102  SNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW  281
            S+ ++ +LW  SG PLIPL EFRE  L K+Y +  + EVLD+LDTA++ K++ VV+K+YW
Sbjct  45   SDRAQKQLWEDSGSPLIPLDEFREMNLPKQYGINPDREVLDILDTASKTKQVIVVSKIYW  104

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFHK  458
            GD REKLCD++EDLKLDS V+G+RGL S +R+++GSV++YV++ A+CP+TVVK     K
Sbjct  105  GDPREKLCDAVEDLKLDSLVVGSRGLGSFKRLLLGSVSSYVVSNASCPVTVVKGTPMSK  163



>ref|XP_011071386.1| PREDICTED: uncharacterized protein C167.05-like [Sesamum indicum]
Length=161

 Score =   151 bits (381),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW  +G PLIPL EF EP ++KKY V  + E LD++ TA+RQKEITV+ K+YWGD
Sbjct  48   EGEMQLWEATGSPLIPLLEFSEPHIMKKYGVNPDPETLDIVTTASRQKEITVLMKIYWGD  107

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
            AREK+C+SI+++ LD  ++GNRGL  L+R+IMGSV+NYV++ ATCP+TVVK  D
Sbjct  108  AREKICESIDNIPLDCLIIGNRGLGKLKRVIMGSVSNYVVSNATCPVTVVKSHD  161



>ref|XP_010062315.1| PREDICTED: universal stress protein A-like protein [Eucalyptus 
grandis]
Length=164

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  S+ +R +L+  +G PLIPL EFRE    K+Y + ++ EVLD+LDT +R K + V AK
Sbjct  42   PPKSDHTRKQLFEDTGSPLIPLEEFREINFSKQYGLTSDPEVLDVLDTVSRTKGVKVAAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKLC+++EDLKLDS V+G+RGL S++R+++GSV+NYV+T+ATCP+TVVK
Sbjct  102  VYWGDPREKLCEAVEDLKLDSLVVGSRGLGSIKRVLLGSVSNYVVTSATCPVTVVK  157



>gb|KCW69440.1| hypothetical protein EUGRSUZ_F02899 [Eucalyptus grandis]
Length=215

 Score =   151 bits (381),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  S+ +R +L+  +G PLIPL EFRE    K+Y + ++ EVLD+LDT +R K + V AK
Sbjct  93   PPKSDHTRKQLFEDTGSPLIPLEEFREINFSKQYGLTSDPEVLDVLDTVSRTKGVKVAAK  152

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKLC+++EDLKLDS V+G+RGL S++R+++GSV+NYV+T+ATCP+TVVK
Sbjct  153  VYWGDPREKLCEAVEDLKLDSLVVGSRGLGSIKRVLLGSVSNYVVTSATCPVTVVK  208



>ref|XP_010259285.1| PREDICTED: uncharacterized protein C167.05 [Nelumbo nucifera]
Length=164

 Score =   149 bits (377),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW  +G PLIPLSEF +P ++KKY +  + E LD+L  A+RQKEI V+ K+YWGD
Sbjct  48   EGEMQLWEATGSPLIPLSEFSDPVIMKKYGITPDPETLDILQCASRQKEIVVIMKIYWGD  107

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
             REK+C++I+D+ L S V+GNRGL  L+R+IMGSV+NYV+   TCP+TVVKH D
Sbjct  108  PREKICEAIDDIPLSSIVIGNRGLGKLKRVIMGSVSNYVVNNGTCPVTVVKHVD  161



>ref|XP_003567271.1| PREDICTED: universal stress protein A-like protein [Brachypodium 
distachyon]
Length=164

 Score =   149 bits (376),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            +E+++ LWSQSG PLIPL E R+  + ++Y++  + EV D+LDT  R+KE+ VV KLYWG
Sbjct  45   DEAKHVLWSQSGSPLIPLEELRDTAVRQRYDIPEDAEVFDMLDTVEREKELAVVLKLYWG  104

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            D REK+C+++ +L+LDS VMG+RGL  +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  105  DPREKVCEAVGELQLDSLVMGSRGLGQIQRILLGSVTNYVLSNASCPVTVVK  156



>ref|XP_002458767.1| hypothetical protein SORBIDRAFT_03g039910 [Sorghum bicolor]
 gb|EES03887.1| hypothetical protein SORBIDRAFT_03g039910 [Sorghum bicolor]
Length=158

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H  +E++N LWS++G PLIPL E  +P + ++Y++  + EV D L    RQKE+ VV K+
Sbjct  42   HRKDEAKNTLWSRTGSPLIPLEELMDPPVRQRYDMPEDPEVFDTLSAVARQKELCVVIKM  101

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGD REK+CD++E+L L+S VMG+RGL S+QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  102  YWGDPREKVCDAVEELHLESLVMGSRGLGSVQRILLGSVTNYVLSNASCPVTVVK  156



>dbj|BAK06554.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=171

 Score =   147 bits (371),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H  +E+++ LWS SG PLIPL E ++  + ++Y++  + EVLD+LD  +R+KE++VV KL
Sbjct  55   HGRDEAKHVLWSHSGSPLIPLEELKDTAIRQRYDIPDDAEVLDMLDAVSREKELSVVLKL  114

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGD REK+C+++ +L L+S VMG+RGL  +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  115  YWGDPREKVCEAVGELNLESLVMGSRGLGQIQRILLGSVTNYVLSNASCPVTVVK  169



>gb|KJB17335.1| hypothetical protein B456_003G127300 [Gossypium raimondii]
Length=145

 Score =   146 bits (368),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 87/121 (72%), Gaps = 19/121 (16%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            PH S+ESRN LWS SG PLIPLSEFRE E++K Y                   E T+VAK
Sbjct  42   PHQSDESRNLLWSTSGSPLIPLSEFREKEVMKHY-------------------EGTLVAK  82

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
            +YWGDAR+K+C+S+EDLKLD  VMG+RGL ++QR+++GSV+NYV+  ATCP+T+VK P  
Sbjct  83   IYWGDARDKICESVEDLKLDCLVMGSRGLGTIQRVLIGSVSNYVMVNATCPVTIVKDPSA  142

Query  453  H  455
            H
Sbjct  143  H  143


 Score = 48.5 bits (114),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           D+SK S+ ALKW+IDNL ++GDT Y+IH+ P
Sbjct  12  DYSKGSKAALKWSIDNLLNQGDTLYLIHVKP  42



>ref|XP_007147360.1| hypothetical protein PHAVU_006G117600g [Phaseolus vulgaris]
 gb|ESW19354.1| hypothetical protein PHAVU_006G117600g [Phaseolus vulgaris]
Length=159

 Score =   146 bits (369),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P        +LW  +G PLIPLSEF EP ++KKY+ K   EV+D++ TA RQK I V+ K
Sbjct  43   PAHYEHGEMQLWETTGSPLIPLSEFSEPAVMKKYDFKPEPEVIDIVQTAARQKSIMVIMK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            ++WGDAREKLCD++  + LDS  MGNRGL  LQR+IMGSV+N+V+  A+C +TVVK
Sbjct  103  IFWGDAREKLCDAVTQVPLDSLTMGNRGLGPLQRVIMGSVSNFVVNNASCTVTVVK  158



>gb|AGT02387.1| UspA-like protein [Calotropis procera]
Length=162

 Score =   146 bits (369),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW  +G PLIPL+E  EP ++KKY    + E LD+++TA RQKEI V+ K+YWGD
Sbjct  50   EGEMQLWETTGSPLIPLAELSEPNVMKKYGFVPDAETLDIVNTAARQKEIFVLMKIYWGD  109

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKH  443
            AREKLC++++D+ LD  V+GNRGL  ++R IMGSV+NYV+  A+CP+TVVKH
Sbjct  110  AREKLCEAVDDIPLDCIVLGNRGLGKIKRAIMGSVSNYVVNNASCPVTVVKH  161



>ref|XP_006432876.1| hypothetical protein CICLE_v10002725mg [Citrus clementina]
 ref|XP_006471631.1| PREDICTED: universal stress protein A-like protein-like [Citrus 
sinensis]
 gb|ESR46116.1| hypothetical protein CICLE_v10002725mg [Citrus clementina]
 gb|KDO40421.1| hypothetical protein CISIN_1g031202mg [Citrus sinensis]
Length=164

 Score =   146 bits (369),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +3

Query  63   GTLSISSTSTPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTAT  242
            G L I     P  ++ +R +L+  +G PL+PL EFRE    K+Y + +N EVLD+LDT +
Sbjct  32   GDLIILIHVQPPNADHTRKQLFEDTGSPLVPLEEFREINFSKQYGLTSNPEVLDILDTLS  91

Query  243  RQKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATC  422
            R K   VVAK+YWGD REKLCD++EDLKLD+ V+G+RGL +L+R+++GSV+N+V+T ++C
Sbjct  92   RTKGAKVVAKVYWGDPREKLCDAVEDLKLDTLVVGSRGLGALKRVLLGSVSNHVVTNSSC  151

Query  423  PITVVK  440
            P+TVVK
Sbjct  152  PVTVVK  157



>ref|XP_003547361.1| PREDICTED: universal stress protein A-like protein-like [Glycine 
max]
 gb|KHN14685.1| Universal stress protein A-like protein [Glycine soja]
Length=164

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H       +LW  +G PLIPL+EF +P L+K+Y +K   EV+D++ TA +QK I V+ K+
Sbjct  44   HGYEHGEMQLWETTGSPLIPLAEFSDPVLMKRYELKPAPEVIDIVSTAAKQKNIVVLMKI  103

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGDARE+LC++I+ + LD   +GNRGL +LQR+IMGSV+NYV+  ATCP+TVVK
Sbjct  104  YWGDARERLCEAIDHVPLDYLTLGNRGLGTLQRVIMGSVSNYVVNNATCPVTVVK  158



>ref|XP_010262906.1| PREDICTED: uncharacterized protein C167.05-like [Nelumbo nucifera]
Length=229

 Score =   147 bits (370),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 96/117 (82%), Gaps = 3/117 (3%)
 Frame = +3

Query  102  SNESRNKLWSQSGCP--LIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
             +E+R+ LW+ +G P  LIPLSE  +PEL+KKY+++   +VLDLL+TA   KE TVV KL
Sbjct  45   GDEARHVLWANTGSPTALIPLSELLDPELMKKYDIQMAPDVLDLLETA-YTKEATVVGKL  103

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            Y GDAR+KLC ++EDLKLDS VMG+RGLS+++RI++GSVTN+V+T A+CPIT+VK P
Sbjct  104  YLGDARDKLCSAVEDLKLDSLVMGSRGLSTIRRILLGSVTNHVITHASCPITIVKEP  160


 Score = 45.8 bits (107),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFS SS  AL W I+NL DKGDT Y+IH+
Sbjct  12  DFSNSSRSALNWTIENLLDKGDTLYVIHV  40



>ref|XP_006645015.1| PREDICTED: uncharacterized protein C167.05-like [Oryza brachyantha]
Length=161

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H  NE++N LWS +G PLIPL E  E  + ++Y++ ++ EV D+L+  +R+K ++VV K+
Sbjct  45   HGRNEAKNALWSHTGSPLIPLEELMETAVRQRYDIPSDGEVFDMLNAVSREKGLSVVLKM  104

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGD REK+C+++ +L L+S VMG+RGL  +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  105  YWGDPREKVCEAVGELNLESLVMGSRGLGQIQRILLGSVTNYVLSNASCPVTVVK  159



>ref|XP_007026864.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Theobroma cacao]
 gb|EOY07366.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Theobroma cacao]
Length=434

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 93/104 (89%), Gaps = 2/104 (2%)
 Frame = +3

Query  147  LIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG-DAREKLCDSIEDL  323
            LIPL+EFREPE++KKY+VK ++EVLD+LDTA+RQKEI +V KL+WG DAREK+ D+IEDL
Sbjct  16   LIPLTEFREPEIMKKYDVKPDIEVLDMLDTASRQKEIHIVTKLFWGEDAREKILDAIEDL  75

Query  324  KLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            KLDS VMG+RGL ++QRII+GSV+NYV+T A CP+T+V + +FH
Sbjct  76   KLDSLVMGSRGLGTVQRIILGSVSNYVMTHAPCPVTIV-NSNFH  118



>ref|XP_004487759.1| PREDICTED: universal stress protein A-like protein-like [Cicer 
arietinum]
Length=160

 Score =   145 bits (365),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P        +LW+ +G PL PL+EF +P L KKY +++N EV+++  +A  QK++ V+ K
Sbjct  42   PEQYEHGEMQLWAVTGSPLTPLAEFSDPTLFKKYGLESNSEVINIATSAANQKKVVVLVK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
            +YWGDAREKLC++IE + LDS +MGNRGL +++R+IMGSV+NY++  A+CP+TVVK  D
Sbjct  102  IYWGDAREKLCEAIEHIPLDSLIMGNRGLGTIKRVIMGSVSNYIVNNASCPVTVVKSSD  160



>ref|XP_006384122.1| hypothetical protein POPTR_0004s07380g [Populus trichocarpa]
 gb|ERP61919.1| hypothetical protein POPTR_0004s07380g [Populus trichocarpa]
Length=161

 Score =   145 bits (365),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ +R +L+  +G PL+PL+EFRE    K+Y +  + EVLD+LDT +R K   VVAK
Sbjct  42   PPNADHTRKQLFGGTGSPLVPLAEFREINFSKQYGLTYDPEVLDILDTVSRTKGAEVVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKL D++EDLKLDS VMG+RGL +++R+++GSV+NYV+T A CP+TVVK
Sbjct  102  VYWGDPREKLIDAVEDLKLDSLVMGSRGLGAIKRVLLGSVSNYVVTNAPCPVTVVK  157



>ref|XP_008811359.1| PREDICTED: uncharacterized protein C167.05-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008811360.1| PREDICTED: uncharacterized protein C167.05-like isoform X2 [Phoenix 
dactylifera]
Length=157

 Score =   144 bits (364),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P    ES++ LW++SG PLIPL+EFR+PE++K Y+++ +++VLD+LDTA+RQKE T+VAK
Sbjct  42   PPQKEESKHGLWAKSGSPLIPLTEFRQPEVMKHYDLEVDIQVLDMLDTASRQKEATIVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITV  434
            LYWGDAREKLC+++EDLKLDS VMG+RGLS +Q     S   Y+L   +CP+ V
Sbjct  102  LYWGDAREKLCEAVEDLKLDSLVMGSRGLSQIQSPRY-SCLRYLLRLRSCPVPV  154



>ref|XP_006841013.1| hypothetical protein AMTR_s00085p00099740 [Amborella trichopoda]
 gb|ERN02688.1| hypothetical protein AMTR_s00085p00099740 [Amborella trichopoda]
Length=168

 Score =   145 bits (365),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +3

Query  120  KLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKE-ITVVAKLYWGDARE  296
            +LW  +G P IPLSEF +P ++KKY V+ ++E LDLL+   RQK+ ITVV+K+YWGDARE
Sbjct  51   QLWETTGSPFIPLSEFSDPNIMKKYGVQPDIETLDLLNCIARQKKGITVVSKIYWGDARE  110

Query  297  KLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKH  443
            K+C+++ED+ L S V+GNRGL  L+R ++GSV+NYV+  A+CP+TVVKH
Sbjct  111  KICEAVEDIPLHSLVIGNRGLGKLKRALLGSVSNYVVNNASCPVTVVKH  159



>ref|XP_010685657.1| PREDICTED: universal stress protein A-like protein [Beta vulgaris 
subsp. vulgaris]
Length=164

 Score =   144 bits (363),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 94/116 (81%), Gaps = 1/116 (1%)
 Frame = +3

Query  96   HASN-ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            HA   ESRN +WS SG PL+PL+EF +PE++  Y V+   +VL+LL+  ++Q E+TV+ K
Sbjct  43   HAQGLESRNLIWSTSGTPLVPLAEFCDPEVMHGYGVQPEPDVLELLELISKQLEVTVLWK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGDAREK+C++I  L+LD+ +MG+RGLS+++R+++GSVT+YVL  ATCP+TVVK
Sbjct  103  IYWGDAREKVCEAIGSLELDAMIMGSRGLSAIRRVLLGSVTSYVLEHATCPVTVVK  158



>ref|XP_008797443.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Phoenix dactylifera]
Length=211

 Score =   145 bits (367),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW  +G PLIPL+EF +P + KKY VK + E LD+L+T  RQKEI V+ K+YWGD
Sbjct  95   EGEMQLWEATGSPLIPLAEFSDPGVAKKYGVKPDAETLDILNTVARQKEIVVIMKIYWGD  154

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
            AREK+C++IE + L   V+G RGLS+++RI++GSV+NYV+   TCP+TVVK P+
Sbjct  155  AREKICEAIESIPLSCLVIGKRGLSTVKRILIGSVSNYVVNNGTCPVTVVKSPE  208



>gb|KHG02876.1| hypothetical protein F383_26328 [Gossypium arboreum]
Length=164

 Score =   144 bits (362),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 88/119 (74%), Gaps = 4/119 (3%)
 Frame = +3

Query  108  ESRNKLWSQSG-CPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            E   +LW+ SG  PLIPLSEF +P  +KKY VK + E LD+ +TA +QKE+ VV K+YWG
Sbjct  48   EGEMQLWAISGGSPLIPLSEFSDPATMKKYGVKPDPETLDIANTAAKQKEVMVVMKIYWG  107

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  461
            D REKLC++I+++ L   V+GNRGL +L+R IMGSV+NYV+   +CP+TVVKH   H H
Sbjct  108  DPREKLCEAIDNIPLSCMVVGNRGLGTLKRAIMGSVSNYVVNNGSCPVTVVKH---HGH  163



>ref|NP_001044810.1| Os01g0849600 [Oryza sativa Japonica Group]
 dbj|BAB89509.1| putative early nodulin ENOD18 [Oryza sativa Japonica Group]
 dbj|BAF06724.1| Os01g0849600 [Oryza sativa Japonica Group]
 gb|EAZ14154.1| hypothetical protein OsJ_04084 [Oryza sativa Japonica Group]
 dbj|BAG98303.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71807.1| hypothetical protein OsI_04441 [Oryza sativa Indica Group]
Length=162

 Score =   143 bits (360),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H  +E++N LWS +G PLIPL E  E  + ++Y++ ++ EV D+L+  +R+KE++VV K+
Sbjct  46   HGRDEAKNVLWSHTGSPLIPLEELMETAVRQRYDIPSDEEVFDMLNAVSREKELSVVLKM  105

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWG+ REK+C+++ +L L+S VMG+RGL  +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  106  YWGEPREKVCEAVGELNLESLVMGSRGLGQIQRILLGSVTNYVLSNASCPVTVVK  160



>ref|XP_004970581.1| PREDICTED: uncharacterized protein C167.05-like [Setaria italica]
Length=158

 Score =   143 bits (360),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H   E++N LWS +G PLIP  E  EP + ++Y++  + EV D+L+    QKE+ VV K+
Sbjct  42   HGREEAKNVLWSHTGSPLIPFEELMEPPVRQRYDMPEDPEVFDMLNALALQKELCVVVKM  101

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            YWGD REK+CD++ +L L S VMG+RGL  +QRI++GSVTNYVL+ A+CP+TVVK
Sbjct  102  YWGDPREKVCDAVGELNLQSLVMGSRGLGQIQRILLGSVTNYVLSNASCPVTVVK  156



>gb|KJB34724.1| hypothetical protein B456_006G080000 [Gossypium raimondii]
Length=164

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 87/119 (73%), Gaps = 4/119 (3%)
 Frame = +3

Query  108  ESRNKLWSQSG-CPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            E   +LW+ SG  PLIPLSEF +P  +KKY VK + E LD+ +TA +QKE+ VV K+YWG
Sbjct  48   EGEMQLWAISGGSPLIPLSEFSDPATMKKYGVKPDPETLDIANTAAKQKEVMVVMKIYWG  107

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFHKH  461
            D REKLC++I+ + L   V+GNRGL +L+R IMGSV+NYV+   +CP+TVVKH   H H
Sbjct  108  DPREKLCEAIDSIPLSCMVVGNRGLGTLKRAIMGSVSNYVVNNGSCPVTVVKH---HGH  163



>ref|XP_011005923.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Populus euphratica]
Length=161

 Score =   142 bits (359),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ +R +L+  +G PL+PL+EFRE    K+Y +  + EVLD+LD  +R K   VVAK
Sbjct  42   PPKADHTRKQLFEGTGSPLVPLAEFREINFSKQYGLTYDPEVLDILDIVSRTKGAEVVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKL D++EDLKLDS VMG+RGL +++R+++GSV+NYV+T A CP+TVVK
Sbjct  102  VYWGDPREKLIDAVEDLKLDSLVMGSRGLGAIKRVLLGSVSNYVVTNAPCPVTVVK  157



>ref|XP_008227919.1| PREDICTED: universal stress protein A-like protein [Prunus mume]
Length=164

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 92/116 (79%), Gaps = 1/116 (1%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P A+N +R +L+  +G PLIPL EF E  + K+Y + ++ EVLD+LDT +R K   VVAK
Sbjct  43   PKATN-TRKQLFEDTGSPLIPLEEFVETNVSKQYGLTSDPEVLDILDTVSRTKRAKVVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKLCD+++DLKLDS V+G+RGL  ++R+++GSV+NYV+T A+CP+TVVK
Sbjct  102  VYWGDPREKLCDAVQDLKLDSLVVGSRGLGLIKRVLLGSVSNYVVTNASCPVTVVK  157



>gb|KJB19522.1| hypothetical protein B456_003G127400 [Gossypium raimondii]
Length=135

 Score =   136 bits (342),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P+ S+ESRN LWS SG PLIPLSEFRE E++K Y V+ + EVLDL+DTA+RQKE+ +V K
Sbjct  42   PNQSDESRNLLWSTSGSPLIPLSEFREKEVMKHYEVEPDPEVLDLVDTASRQKEVNIVTK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQR  374
            +YWGDAR+K+C+S+ DLKLD  VMG+RGL ++QR
Sbjct  102  IYWGDARDKICESVADLKLDCLVMGSRGLGTIQR  135


 Score = 52.0 bits (123),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSR  100
           DFSK S+ ALKW+ DNL DKGDT Y+IH+ P++
Sbjct  12  DFSKGSKAALKWSTDNLVDKGDTLYLIHVKPNQ  44



>ref|XP_009780200.1| PREDICTED: uncharacterized protein C167.05 [Nicotiana sylvestris]
Length=162

 Score =   142 bits (357),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = +3

Query  54   LIRGTLSISSTSTPHAS-NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLL  230
            L +G   I  T  P     E   +LW  +G PLIPLSEF +   +KKY V  + E LD++
Sbjct  29   LRKGDHLILVTVRPEGHYEEGEMQLWEATGSPLIPLSEFCDAHTMKKYGVNPDPETLDMV  88

Query  231  DTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLT  410
              A RQKEI VV K+YWGDAREKLC++I+   L   V+GNRGL  L+R IMGSV+NYV+ 
Sbjct  89   TLAARQKEIMVVLKIYWGDAREKLCEAIDKTPLSCLVIGNRGLGKLKRAIMGSVSNYVVN  148

Query  411  TATCPITVVKHPD  449
             ATCP+TVVKH D
Sbjct  149  NATCPVTVVKHAD  161



>ref|XP_008811357.1| PREDICTED: uncharacterized protein LOC103722544 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811358.1| PREDICTED: uncharacterized protein LOC103722544 isoform X1 [Phoenix 
dactylifera]
Length=158

 Score =   141 bits (356),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P    ES++ LW++SG PLIPL+EFR+PE++K Y+++ +++VLD+LDTA+RQKE T+VAK
Sbjct  42   PPQKEESKHGLWAKSGSPLIPLTEFRQPEVMKHYDLEVDIQVLDMLDTASRQKEATIVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQR  374
            LYWGDAREKLC+++EDLKLDS VMG+RGLS +QR
Sbjct  102  LYWGDAREKLCEAVEDLKLDSLVMGSRGLSQIQR  135



>ref|XP_010558670.1| PREDICTED: universal stress protein A-like protein [Tarenaya 
hassleriana]
Length=159

 Score =   141 bits (356),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  +  +R  L+  +G PL+PL EFRE    K+Y +  + +VLD+LDT +R K + VVAK
Sbjct  42   PPNAGHTRKILFEDTGSPLVPLEEFREINFSKQYGLAYDPQVLDVLDTLSRAKTVKVVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKLCD+++DL LD  V+G+RGL  ++RI+MGSV+NYV+T ATCP+TVVK
Sbjct  102  VYWGDPREKLCDAVDDLNLDCIVLGSRGLGPIKRILMGSVSNYVVTNATCPVTVVK  157



>ref|XP_002305257.2| hypothetical protein POPTR_0004s07380g [Populus trichocarpa]
 gb|EEE85768.2| hypothetical protein POPTR_0004s07380g [Populus trichocarpa]
Length=162

 Score =   141 bits (356),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 91/117 (78%), Gaps = 1/117 (1%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQK-EITVVA  269
            P  ++ +R +L+  +G PL+PL+EFRE    K+Y +  + EVLD+LDT +R K +  VVA
Sbjct  42   PPNADHTRKQLFGGTGSPLVPLAEFREINFSKQYGLTYDPEVLDILDTVSRTKGQAEVVA  101

Query  270  KLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            K+YWGD REKL D++EDLKLDS VMG+RGL +++R+++GSV+NYV+T A CP+TVVK
Sbjct  102  KVYWGDPREKLIDAVEDLKLDSLVMGSRGLGAIKRVLLGSVSNYVVTNAPCPVTVVK  158



>ref|XP_002528512.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33881.1| conserved hypothetical protein [Ricinus communis]
Length=164

 Score =   141 bits (356),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ +R +L+  +G PL+PL EFRE    K+Y +  + EVLD LDT +R K   VVAK
Sbjct  42   PPKADHTRKQLFEATGSPLVPLEEFREINYSKQYGLSRDPEVLDFLDTVSRTKGAKVVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKLCD+++DLKLDS V+G+RGL  ++R ++GSV+NYV+T A+CP+TVVK
Sbjct  102  VYWGDPREKLCDAVDDLKLDSLVIGSRGLGPIKRELLGSVSNYVVTNASCPVTVVK  157



>ref|XP_006298705.1| hypothetical protein CARUB_v10014810mg [Capsella rubella]
 gb|EOA31603.1| hypothetical protein CARUB_v10014810mg [Capsella rubella]
Length=157

 Score =   140 bits (354),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 91/116 (78%), Gaps = 2/116 (2%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ +R  L+  +G PL+PL EFRE    K+Y +  + EVLD+LDT +R K+  VVAK
Sbjct  42   PQNADHTRKILFEDTGSPLVPLEEFREVNFSKQYGLAYDPEVLDVLDTLSRAKK--VVAK  99

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKLCD++E+LKLDS V+G+RGL SL+R+++GSV+N+V+T ATCP+TVVK
Sbjct  100  VYWGDPREKLCDAVENLKLDSIVLGSRGLGSLKRMLLGSVSNHVVTNATCPVTVVK  155



>gb|KJB17333.1| hypothetical protein B456_003G127300 [Gossypium raimondii]
 gb|KJB17334.1| hypothetical protein B456_003G127300 [Gossypium raimondii]
Length=135

 Score =   138 bits (347),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            PH S+ESRN LWS SG PLIPLSEFRE E++K Y V+ + E+LDL+D A+RQK+ T+VAK
Sbjct  42   PHQSDESRNLLWSTSGSPLIPLSEFREKEVMKHYEVEPDPEILDLVDIASRQKQGTLVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQR  374
            +YWGDAR+K+C+S+EDLKLD  VMG+RGL ++QR
Sbjct  102  IYWGDARDKICESVEDLKLDCLVMGSRGLGTIQR  135


 Score = 48.5 bits (114),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHP  94
           D+SK S+ ALKW+IDNL ++GDT Y+IH+ P
Sbjct  12  DYSKGSKAALKWSIDNLLNQGDTLYLIHVKP  42



>emb|CDX75899.1| BnaC03g39820D [Brassica napus]
Length=163

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW   G PLIPLSEF E  ++KKY VK + E LD+ +TA R+K ITVV K+YWGD
Sbjct  50   EGEMQLWETVGSPLIPLSEFSEAAVMKKYAVKPDAETLDIANTAARKKSITVVMKIYWGD  109

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
             REK+C+++E + L S V+GNRGL  L+R+IMGSV+N+V+    CP+TVVK
Sbjct  110  PREKICEAVEHIPLSSLVIGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK  160



>ref|XP_010931741.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=165

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW  +G PLIPL E  +P + KKY VK + E LD+L+T  RQKEI VV K+YWGD
Sbjct  49   EGEMQLWEATGSPLIPLVELSDPGIAKKYGVKPDAETLDILNTVARQKEIVVVMKIYWGD  108

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            AREK+C++IE++ L   ++GNRGLS ++R+++GSV+NYV+   TCP+TVVK
Sbjct  109  AREKICEAIENIPLCCLIIGNRGLSKIKRVLLGSVSNYVVNNGTCPVTVVK  159



>ref|XP_007035783.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Theobroma cacao]
 gb|EOY06709.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Theobroma cacao]
Length=161

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW  +G P IPLSEF +P ++KKY +K + E LD+++TA RQKE+ V+ K++WGD
Sbjct  48   EGEMQLWEVTGSPFIPLSEFSDPVVMKKYGMKPDPETLDIVNTAARQKEVEVLMKIFWGD  107

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
             REKLC++I+ + L   ++GNRGL  L+R IMGSV+NYV+   +CP+TVVKH D
Sbjct  108  PREKLCEAIDTIPLSCIIVGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVKHHD  161



>gb|EPS64036.1| hypothetical protein M569_10742 [Genlisea aurea]
Length=161

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 90/125 (72%), Gaps = 1/125 (1%)
 Frame = +3

Query  75   ISSTSTPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKE  254
            ++ TS  +  +  R +LW  +G PLIPLSE  +P ++KKY V  + E LDL+ T  RQKE
Sbjct  38   VNVTSDGYYESGER-QLWEATGSPLIPLSELTDPHVMKKYEVNPDPETLDLVSTVARQKE  96

Query  255  ITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITV  434
            ITVV K++WGD REKLC++++ + LD  V+GNRGL  ++R IMGSV+NYV+  ATCP+TV
Sbjct  97   ITVVLKIFWGDPREKLCEAVDAIPLDCLVVGNRGLGKIKRAIMGSVSNYVVNNATCPVTV  156

Query  435  VKHPD  449
            VK  D
Sbjct  157  VKAHD  161



>ref|XP_009630214.1| PREDICTED: uncharacterized protein C167.05 isoform X1 [Nicotiana 
tomentosiformis]
Length=162

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW  +G PLIPLSE  +   +KKY V  + E LD++  A RQKEI VV K+YWGD
Sbjct  48   EGETQLWEATGSPLIPLSELCDAHTMKKYGVNPDPETLDMVTLAARQKEIMVVLKIYWGD  107

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
            AREKLC++I+   L   V+GNRGL  L+R IMGSV+NYV+  ATCP+TVVKH D
Sbjct  108  AREKLCEAIDKTPLSCLVIGNRGLGKLKRAIMGSVSNYVVNNATCPVTVVKHAD  161



>emb|CDO98772.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  120  KLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREK  299
            +LW  +G PLIPL EF +P ++KKY V  + E L+++  A R+KEI V+ K+YWGDAREK
Sbjct  2    QLWETTGSPLIPLVEFSDPHVMKKYGVHPDAETLEIVTCAAREKEIVVLLKIYWGDAREK  61

Query  300  LCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKH  443
            LC+SI+ + LD  V+GNRGL  L+R IMGSV+NYV+  A+CP+TVVK+
Sbjct  62   LCESIDKIPLDCIVIGNRGLGKLKRAIMGSVSNYVVNNASCPVTVVKN  109



>gb|KJB34720.1| hypothetical protein B456_006G079900 [Gossypium raimondii]
 gb|KJB34722.1| hypothetical protein B456_006G079900 [Gossypium raimondii]
 gb|KJB34723.1| hypothetical protein B456_006G079900 [Gossypium raimondii]
Length=162

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H     + +LW  +G PLIPLSEF +P ++K+Y VK + E LD++ TA RQ +I V+ K+
Sbjct  45   HYDEGDQIQLWEATGSPLIPLSEFCDPIIMKRYGVKPDPETLDIVTTAARQTQIEVLMKI  104

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKH  443
            YWGD REKLC++I+ + L   ++GNRGL +L+R IMGSV+NYV+  A+CP+TVVKH
Sbjct  105  YWGDPREKLCEAIDTIPLSCIIVGNRGLGTLKRAIMGSVSNYVVNNASCPVTVVKH  160



>emb|CDY52729.1| BnaC01g44140D [Brassica napus]
Length=163

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +3

Query  120  KLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREK  299
            +LW   G PLIPLSEF E  ++KKY VK + E LD+ +TA RQK ITVV K+YWGD REK
Sbjct  54   QLWETVGSPLIPLSEFSEAAVMKKYGVKPDAETLDIANTAARQKSITVVMKIYWGDPREK  113

Query  300  LCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +C++ E + L S V+GNRGL  L+R+IMGSV+N+V+    CP+TVVK
Sbjct  114  ICEAAEHIPLSSLVIGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK  160



>ref|NP_001288846.1| universal stress protein A-like protein [Brassica rapa]
 gb|ABL97971.1| unknown [Brassica rapa]
 emb|CDY34988.1| BnaA01g27460D [Brassica napus]
Length=163

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +3

Query  120  KLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREK  299
            +LW   G PLIPLSEF E  ++KKY VK + E LD+ +TA RQK ITVV K+YWGD REK
Sbjct  54   QLWETVGSPLIPLSEFSEAAVMKKYGVKPDAETLDIANTAARQKSITVVMKIYWGDPREK  113

Query  300  LCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +C++ E + L S V+GNRGL  L+R+IMGSV+N+V+    CP+TVVK
Sbjct  114  ICEAAEHIPLSSLVIGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK  160



>gb|KDP35746.1| hypothetical protein JCGZ_10518 [Jatropha curcas]
Length=166

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ +R  L+  +G PL+PL EFRE    K+Y +  + EVLD+LDT ++ K   VVAK
Sbjct  43   PPNADHTRKHLFGDTGSPLVPLEEFREINYSKQYGLSRDPEVLDILDTVSKTKGAKVVAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKLCD+++ LKLDS V+G+RGL S++RI++GSV+N+V+  A+CP+TVVK
Sbjct  103  VYWGDPREKLCDAVDHLKLDSLVIGSRGLGSIKRILLGSVSNHVVANASCPVTVVK  158



>ref|XP_008797442.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Phoenix dactylifera]
Length=212

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKE-ITVVAKLYWG  284
            E   +LW  +G PLIPL+EF +P + KKY VK + E LD+L+T  RQKE I V+ K+YWG
Sbjct  95   EGEMQLWEATGSPLIPLAEFSDPGVAKKYGVKPDAETLDILNTVARQKEQIVVIMKIYWG  154

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
            DAREK+C++IE + L   V+G RGLS+++RI++GSV+NYV+   TCP+TVVK P+
Sbjct  155  DAREKICEAIESIPLSCLVIGKRGLSTVKRILIGSVSNYVVNNGTCPVTVVKSPE  209



>ref|XP_009381389.1| PREDICTED: universal stress protein A-like protein [Musa acuminata 
subsp. malaccensis]
Length=162

 Score =   139 bits (351),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +3

Query  99   ASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLY  278
            + + +  +LW + G PLIPL EF +  L  +Y +  + EVLD+L TA+  K + VV+K+Y
Sbjct  46   SDHHTEKQLWEEHGSPLIPLGEFEDMNLTVRYGISPDGEVLDILHTASETKGVKVVSKIY  105

Query  279  WGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            WGD REK+CD++E+LKLDS V+G+RGL +++R+++GSV+NYV+  ATCP+TVVK
Sbjct  106  WGDPREKICDAVEELKLDSLVVGSRGLGAIKRVLLGSVSNYVVVHATCPVTVVK  159



>ref|XP_006419393.1| hypothetical protein CICLE_v10006081mg [Citrus clementina]
 ref|XP_006488847.1| PREDICTED: universal stress protein A-like protein-like [Citrus 
sinensis]
 gb|ESR32633.1| hypothetical protein CICLE_v10006081mg [Citrus clementina]
Length=164

 Score =   139 bits (351),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            +   +LW  SG PLIPL+EF EP ++KKY  K + E LD+++T  RQK+I VV K++WGD
Sbjct  48   KGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDAETLDIVNTVARQKQIVVVMKIFWGD  107

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKH  443
             REK+C++I+ + L   V+GNRGL  L+R IMGSV+NYV+   +CP+TVVK 
Sbjct  108  PREKICEAIDKIPLSCLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVKQ  159



>ref|XP_010548996.1| PREDICTED: universal stress protein A-like protein [Tarenaya 
hassleriana]
Length=163

 Score =   139 bits (351),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = +3

Query  120  KLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREK  299
            +LW  +G P IPL EF +  ++KKY VK + E LD+ +TA RQK ITV+ K+YWGDAREK
Sbjct  54   QLWEATGTPFIPLEEFSDGAVMKKYEVKPDPETLDIANTAARQKPITVIMKIYWGDAREK  113

Query  300  LCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            +C++++ + L   V+GNRGL  L+R+IMGSV+NYV+  A+CP+TVVK P
Sbjct  114  ICEAVDHIPLSCLVIGNRGLGGLKRVIMGSVSNYVVNNASCPVTVVKVP  162



>ref|XP_011005922.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Populus euphratica]
Length=162

 Score =   139 bits (351),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQK-EITVVA  269
            P  ++ +R +L+  +G PL+PL+EFRE    K+Y +  + EVLD+LD  +R K +  VVA
Sbjct  42   PPKADHTRKQLFEGTGSPLVPLAEFREINFSKQYGLTYDPEVLDILDIVSRTKGQAEVVA  101

Query  270  KLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            K+YWGD REKL D++EDLKLDS VMG+RGL +++R+++GSV+NYV+T A CP+TVVK
Sbjct  102  KVYWGDPREKLIDAVEDLKLDSLVMGSRGLGAIKRVLLGSVSNYVVTNAPCPVTVVK  158



>emb|CDX82383.1| BnaA03g34380D [Brassica napus]
Length=163

 Score =   139 bits (351),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW   G PLIPLSEF E  ++KKY VK + E LD+ +TA R K ITVV K+YWGD
Sbjct  50   EGEMQLWETVGSPLIPLSEFSEAAVMKKYAVKPDAETLDIANTAARTKSITVVMKIYWGD  109

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
             REK+C+++E + L S V+GNRGL  L+R+IMGSV+N+V+    CP+TVVK
Sbjct  110  PREKICEAVEHIPLSSLVIGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK  160



>ref|XP_010276270.1| PREDICTED: universal stress protein A-like protein [Nelumbo nucifera]
Length=164

 Score =   139 bits (351),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +3

Query  102  SNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW  281
            S+ ++ KLW ++G PLIPL EF+E  L K+Y +  + +VLDLLD+A+  +  TV+ K+YW
Sbjct  45   SDPAQKKLWEETGSPLIPLGEFKEMNLSKQYGLTRDPDVLDLLDSASAAEGATVLCKVYW  104

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            GD REKL D++E LKLDS V+G+RGL +++R+++GSV+NYV+T ATCP+TVVK
Sbjct  105  GDPREKLLDAVEGLKLDSLVVGSRGLGAIKRVLLGSVSNYVVTNATCPVTVVK  157



>ref|XP_009146047.1| PREDICTED: universal stress protein A-like protein [Brassica 
rapa]
 emb|CDX92110.1| BnaA05g22970D [Brassica napus]
Length=163

 Score =   139 bits (350),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW   G PLIPLSE  E  ++KKY VK + E LD+ +TA RQK ITVV K+YWGD
Sbjct  50   EGEMQLWETVGSPLIPLSEVSEASVMKKYGVKPDAETLDIANTAARQKSITVVMKIYWGD  109

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
             REK+C+++E + L S V+GNRGL  L+R+IMGSV+N+V+    CP+TVVK
Sbjct  110  PREKICEAVEHIPLSSLVIGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK  160



>gb|KDO71923.1| hypothetical protein CISIN_1g031168mg [Citrus sinensis]
Length=164

 Score =   139 bits (350),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 84/121 (69%), Gaps = 1/121 (1%)
 Frame = +3

Query  84   TSTPHASNE-SRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEIT  260
            T  P    E    +LW  SG PLIPL+EF EP ++KKY  K + E LD+++T  RQK+I 
Sbjct  39   TVVPEGGLEKGEQQLWEDSGSPLIPLAEFSEPTIMKKYGAKPDPETLDIVNTVARQKQIV  98

Query  261  VVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            VV K++WGD REK+C++I+ + L   V+GNRGL  L+R IMGSV+NYV+   +CP+TVVK
Sbjct  99   VVMKIFWGDPREKICEAIDKIPLSCLVIGNRGLGKLKRAIMGSVSNYVVNNGSCPVTVVK  158

Query  441  H  443
             
Sbjct  159  Q  159



>ref|XP_009135511.1| PREDICTED: universal stress protein A-like protein [Brassica 
rapa]
Length=163

 Score =   139 bits (350),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW   G PLIPLSEF E  ++KKY VK + E LD+ +TA R K ITVV K+YWGD
Sbjct  50   EGEMQLWETVGSPLIPLSEFSEAAVMKKYAVKPDAETLDIANTAARTKSITVVMKIYWGD  109

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
             REK+C+++E + L S V+GNRGL  L+R+IMGSV+N+V+    CP+TVVK
Sbjct  110  PREKICEAVEHIPLASLVIGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK  160



>gb|EYU29653.1| hypothetical protein MIMGU_mgv1a015303mg [Erythranthe guttata]
Length=161

 Score =   139 bits (349),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  84   TSTPHASNESRN-KLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEIT  260
            T  P    ES   +LW  +G PLIPLS+     ++KKY +  + E LD++ TA  QKEIT
Sbjct  39   TVRPEGYYESGEMQLWEATGSPLIPLSDLTNAHIMKKYGLTPDPETLDMVSTAASQKEIT  98

Query  261  VVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            V+ K+YWGDAREKLC+SI+++ LDS V+GNRGL  ++R IMGSV+N+V+  ATCP+TVVK
Sbjct  99   VLMKIYWGDAREKLCESIDNVPLDSLVIGNRGLGKIKRAIMGSVSNFVVNNATCPVTVVK  158

Query  441  HPD  449
              D
Sbjct  159  SHD  161



>ref|XP_002271154.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 emb|CBI27357.3| unnamed protein product [Vitis vinifera]
Length=164

 Score =   139 bits (349),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +3

Query  102  SNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW  281
            S   + +L+  +G PL+PL EFR+  L K+Y +  + EVLD+LDT  R K   VVAK+YW
Sbjct  45   SEHPKKQLFEDTGSPLVPLEEFRDINLSKQYGLNPDPEVLDILDTVARSKGAKVVAKVYW  104

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            GD REKLCD+++DLKLD  V+G+RGL  L+RI++GSV+NYV+  A+CP+TVVK
Sbjct  105  GDPREKLCDAVDDLKLDCLVLGSRGLGVLRRILLGSVSNYVMVHASCPVTVVK  157



>gb|KHG02877.1| hypothetical protein F383_26329 [Gossypium arboreum]
Length=162

 Score =   138 bits (348),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +3

Query  96   HASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKL  275
            H     + +LW  +G PLIPLSEF +P ++K+Y VK + E LD++ TA RQ +I V+ K+
Sbjct  45   HYDEGDQIQLWEATGSPLIPLSEFCDPIIMKRYGVKPDPETLDIVTTAARQTQIEVLMKI  104

Query  276  YWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKH  443
            YWGD REKLC++I+ + L   ++GNRGL +L+R IMGSV+NYV+   +CP+TVVKH
Sbjct  105  YWGDPREKLCEAIDTIPLSCIIVGNRGLGTLKRAIMGSVSNYVVNNGSCPVTVVKH  160



>ref|XP_011085896.1| PREDICTED: universal stress protein A-like protein [Sesamum indicum]
Length=165

 Score =   138 bits (348),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +3

Query  102  SNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW  281
            ++ +  +L++ +G PLIPL EFRE  + K Y +  + EVLD+LDT ++ + + VVAK+YW
Sbjct  45   ADPTNKQLFADTGSPLIPLEEFREINVSKHYGLNPDPEVLDMLDTVSKTRRVKVVAKVYW  104

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            GD REKLCD+ E LKLDS V+G+RGL +++R+++GSV+NYV+  ATCP+TVVK
Sbjct  105  GDPREKLCDAAEQLKLDSLVVGSRGLGTIKRVLLGSVSNYVVQNATCPVTVVK  157



>ref|XP_006373899.1| hypothetical protein POPTR_0016s10110g [Populus trichocarpa]
 gb|ERP51696.1| hypothetical protein POPTR_0016s10110g [Populus trichocarpa]
Length=208

 Score =   137 bits (344),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYW-  281
            +ESRNKLW++SGCPLIPL EF++PE+LK Y VK + EVLD+LDT +RQK++ VV+KLYW 
Sbjct  108  DESRNKLWAESGCPLIPLDEFKDPEILKNYGVKVDAEVLDMLDTISRQKKVRVVSKLYWG  167

Query  282  GDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTN  398
            GDAREKL D+++DLKLDS VMG+RGL ++QR      TN
Sbjct  168  GDAREKLLDAVQDLKLDSLVMGSRGLGTVQRYPYNFKTN  206


 Score = 46.6 bits (109),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSRL  103
            DFS SS  ALKWAIDNL D GDT Y+++++ + L
Sbjct  74   DFSPSSRNALKWAIDNLVDDGDTLYLVNVNSNSL  107



>ref|XP_010064666.1| PREDICTED: uncharacterized protein C167.05 [Eucalyptus grandis]
 gb|KCW87966.1| hypothetical protein EUGRSUZ_A00373 [Eucalyptus grandis]
Length=164

 Score =   138 bits (348),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW  +G PLIPLSEF +P ++KKY VK + E +D++ T  RQKE+ VV K+YWGD
Sbjct  48   EGEMQLWEATGSPLIPLSEFSDPVIMKKYGVKVDPETIDIVSTIARQKEVVVVMKIYWGD  107

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            AREK+C++I+   L   ++GNRGL  L+R I+GSV+NYV+   +CP+TVVK
Sbjct  108  AREKICEAIDKFPLSCLIIGNRGLGKLKRAILGSVSNYVVNNGSCPVTVVK  158



>ref|XP_008797478.1| PREDICTED: uncharacterized protein LOC103712673 [Phoenix dactylifera]
Length=554

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW  +G PLIPL+EF +P + KKY VK + E LD+L+T  RQKEI V+ K+YWGD
Sbjct  277  EGEMQLWEATGSPLIPLAEFSDPGVAKKYGVKPDAETLDILNTVARQKEIVVIMKIYWGD  336

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
            AREK+C++IE + L   V+G RGLS+++RI++GSV+NYV+   TCP+TVVK P+
Sbjct  337  AREKICEAIESIPLSCLVIGKRGLSTVKRILIGSVSNYVVNNGTCPVTVVKSPE  390



>ref|XP_006298702.1| hypothetical protein CARUB_v10014797mg [Capsella rubella]
 gb|EOA31600.1| hypothetical protein CARUB_v10014797mg [Capsella rubella]
Length=164

 Score =   138 bits (347),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW   G P IPLSEF +  ++KKY VK + E LD+ +TA R+K ITVV K+YWGD
Sbjct  50   EGEMQLWETVGSPFIPLSEFSDAAVMKKYAVKPDAETLDIANTAARKKSITVVMKIYWGD  109

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
             REK+C + E + L S VMGNRGL  L+R+IMGSV+N+V+ +  CP+TVVK
Sbjct  110  PREKICSAAEQIPLSSLVMGNRGLGGLKRMIMGSVSNHVVNSVACPVTVVK  160



>ref|XP_010101064.1| Universal stress protein A-like protein [Morus notabilis]
 gb|EXB86774.1| Universal stress protein A-like protein [Morus notabilis]
Length=166

 Score =   138 bits (347),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ +R +L+  +G PLIPL EFRE    K+Y +    EV+D+LDT +R K   VVAK
Sbjct  42   PPEADHTRKELFQDTGSPLIPLEEFREINFSKQYGLSNEPEVIDILDTVSRTKGAKVVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKL D+++ LKLDS V+G+RGL  ++R+++GSV+NYV+T A+CP+TVVK
Sbjct  102  VYWGDPREKLLDAVKQLKLDSLVLGSRGLGPIKRVLLGSVSNYVVTHASCPVTVVK  157



>ref|XP_010504913.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=163

 Score =   138 bits (347),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW   G P IPLSEF +  ++KKY VK + E LD+L+TA+R K ITVV K+YWGD
Sbjct  50   EGEMQLWETVGSPYIPLSEFSDAAVMKKYAVKPDAETLDILNTASRSKSITVVMKIYWGD  109

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
             REK+C + E + L S VMGNRGL  L+R+IMGSV+N+V+    CP+TVVK
Sbjct  110  PREKICAAAEQIPLSSLVMGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK  160



>ref|XP_011038407.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
 ref|XP_011038408.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
Length=161

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ +R +L+ ++G PL+PL EFRE    K+Y +  + EVLD+LDT ++ K   VVAK
Sbjct  42   PPKADHTRKQLFEENGSPLVPLEEFREINYSKQYGLTHDPEVLDILDTVSKTKGAKVVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKL D+++DLKLDS V+G+RGL +++R+++GSV+ YV+T A+CP+TVVK
Sbjct  102  VYWGDPREKLLDAVDDLKLDSLVIGSRGLGAIKRVLLGSVSYYVVTNASCPVTVVK  157



>emb|CDP01682.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = +3

Query  108  ESRNK-LWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            E+ NK L+  +G PLIPL+EFRE  + K Y +  + EVLDLLD   + K + VVAK+YWG
Sbjct  46   ETTNKQLFEDTGSPLIPLAEFREINVSKHYGLNPDPEVLDLLDMVAKTKGVKVVAKVYWG  105

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            DAREKLC++++ LKLDS V+G+RGL +++R+++GSV+NYV+  A CP+TVVK P
Sbjct  106  DAREKLCEAVDHLKLDSLVVGSRGLGAIKRVLLGSVSNYVVQNALCPVTVVKGP  159



>gb|ACR38280.1| unknown [Zea mays]
Length=165

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ S  +LW  +G PLIPLSEF E  L  +Y +  + E L++L   ++ K++ V+AK
Sbjct  43   PKGADASHKELWKSTGSPLIPLSEFMEMNLQARYGLNPDKETLEILRAVSKSKQVEVLAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            +YWGDAREKLC++++DLK+DS V+G RGL  L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  103  VYWGDAREKLCEAVDDLKVDSFVLGCRGLGPLKRALLGSVSNYVVNNATCPVTVVRGP  160



>ref|NP_850506.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
 gb|AAF26101.1|AC012328_4 unknown protein [Arabidopsis thaliana]
 gb|AEE73920.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
Length=159

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ +R  L+ ++G PLIPL EFRE  L K+Y +  + EVLD+LDT +R K++ VVAK
Sbjct  42   PQNADHTRKILFEETGSPLIPLEEFREVNLSKQYGLAYDPEVLDVLDTLSRAKKVKVVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKLCD++E+LKLDS V+G+RGL SL+RI++GSV+N+V+T ATCP+TVVK
Sbjct  102  VYWGDPREKLCDAVENLKLDSIVLGSRGLGSLKRILLGSVSNHVVTNATCPVTVVK  157



>ref|XP_009761731.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=167

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = +3

Query  108  ESRNK-LWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            E  NK L+  +G PLIPL EFRE  + K Y +  + EVLD+LDT ++ K++ VVAK+YWG
Sbjct  46   EPTNKQLFEDTGSPLIPLDEFREINVSKYYGLNPDREVLDMLDTVSKLKKVIVVAKVYWG  105

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            DAREKLCD+ E LKLDS V+G+RGL  L+R+++GSV+N+V+  ATCP+TVVK
Sbjct  106  DAREKLCDAAEHLKLDSLVLGSRGLGVLKRMLLGSVSNHVVQNATCPVTVVK  157



>ref|XP_010465732.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
 ref|XP_010487572.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=163

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW   G P IPLSEF +  ++KKY VK + + LD+L+TA+R+K ITVV K+YWGD
Sbjct  50   EGEMQLWETVGSPYIPLSEFSDAAVMKKYAVKPDAQTLDILNTASREKSITVVMKIYWGD  109

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
             REK+C + E + L S VMGNRGL  L+R+IMGSV+N+V+    CP+TVVK
Sbjct  110  PREKICAAAEQIPLSSLVMGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK  160



>emb|CBI22890.3| unnamed protein product [Vitis vinifera]
Length=115

 Score =   135 bits (340),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +3

Query  120  KLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREK  299
            +LW  +G PLIPLSEF +P + KKY VK + E LD+++   RQK+I VV K+YWGDAREK
Sbjct  2    QLWETTGSPLIPLSEFSDPIISKKYGVKPDAETLDIVNCVARQKDIVVVMKVYWGDAREK  61

Query  300  LCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
            +C++I+++ L   V+GNRGL  ++R I+GSV+NYV+   +CP+TVVK+ +
Sbjct  62   ICEAIDNIPLSCLVIGNRGLGKIKRAILGSVSNYVVNNGSCPVTVVKNAE  111



>ref|XP_002519217.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43081.1| conserved hypothetical protein [Ricinus communis]
Length=164

 Score =   137 bits (344),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW  +G PLIPL EF +P ++KKY VK + E LD+++T   QK+I VV K+YWGD
Sbjct  48   EGEMQLWEVTGSPLIPLHEFSDPAVMKKYGVKPDPETLDIVNTVANQKQIVVVMKIYWGD  107

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDF  452
             REK+C++I+ + L   ++GNRGL  ++R IMGSV+NYV+   TCP+TVVK  D 
Sbjct  108  PREKICEAIDKIPLSCLIIGNRGLGKIKRAIMGSVSNYVVNNGTCPVTVVKQHDH  162



>ref|XP_002316036.1| universal stress family protein [Populus trichocarpa]
 gb|ABK96115.1| unknown [Populus trichocarpa]
 gb|EEF02207.1| universal stress family protein [Populus trichocarpa]
Length=164

 Score =   137 bits (344),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +3

Query  120  KLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREK  299
            +LW  +G P+IPLSEF +P  +KKY +K + E LDLL+T   QKEI VV K+YWGD REK
Sbjct  52   QLWEVTGSPMIPLSEFSDPVTMKKYGLKPDPETLDLLNTVAHQKEIVVVLKIYWGDPREK  111

Query  300  LCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFHK  458
            +C++I+ + L   V+GNRGL  ++R IMGSV+NYV+   +CPITVVK  D  +
Sbjct  112  ICEAIDKIPLSCLVIGNRGLGKVKRAIMGSVSNYVVNNGSCPITVVKQSDHEQ  164



>ref|XP_009602053.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
Length=165

 Score =   137 bits (344),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +3

Query  105  NESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWG  284
            + +  +L+  +G PLIPL EFRE  + K Y +  + EVLD+LDT ++ K++ V+AK+YWG
Sbjct  49   DTTNKQLFEDTGSPLIPLDEFREINVSKYYGLNPDREVLDMLDTVSKLKKVIVMAKVYWG  108

Query  285  DAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            DAREKLCD+ E LKLDS V+G+RGL  L+R+++GSV+N+V+  ATCP+TVVK
Sbjct  109  DAREKLCDAAEHLKLDSLVVGSRGLGVLKRVLLGSVSNHVVQNATCPVTVVK  160



>ref|XP_003570541.1| PREDICTED: uncharacterized protein C167.05-like [Brachypodium 
distachyon]
Length=166

 Score =   137 bits (344),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ S   LW  +G PLIPL EF E  +  +Y V  + EVL++L   ++ K++ V+AK
Sbjct  43   PKGTDASHKGLWKSTGSPLIPLLEFMEMNVQARYGVNPDKEVLEILQAESKSKQVEVLAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            +YWGDAREKLC++++DLK+DS V+G RGL  L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  103  IYWGDAREKLCEAVDDLKVDSVVLGCRGLGPLKRALLGSVSNYVVNNATCPVTVVRGP  160



>ref|XP_006357579.1| PREDICTED: uncharacterized protein LOC102602636 [Solanum tuberosum]
Length=132

 Score =   130 bits (326),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = +3

Query  96   HASN-ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            H  N +SR++LW+QSG PLIPL EFRE E+L  Y+V+ ++E+LD LDTAT QK+I VV K
Sbjct  39   HVKNYDSRHQLWAQSGSPLIPLVEFREAEVLHYYDVETDIELLDTLDTATTQKQINVVIK  98

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQR  374
            LYWGDAREKLC  I DL+L+S VMG+RGLS LQR
Sbjct  99   LYWGDAREKLCQGIHDLQLNSIVMGSRGLSRLQR  132


 Score = 51.2 bits (121),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHL  88
           DFSKSS+ ALKW I+NLADKGDTF IIH+
Sbjct  12  DFSKSSKAALKWTINNLADKGDTFCIIHV  40



>gb|EMT31927.1| hypothetical protein F775_31141 [Aegilops tauschii]
Length=165

 Score =   136 bits (343),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ S   LW  +G PLIPL EF E  +  +Y V  + EVL++L   ++ K++ ++AK
Sbjct  43   PKGADASHKGLWKSTGSPLIPLLEFMEMNVQARYGVNPDKEVLEILQAESKSKQVEILAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
            +YWGDAREKLC++++DLK+DS V+G RGL  L+R ++GSV+NYV+  ATCP+TVV+ P+
Sbjct  103  IYWGDAREKLCEAVDDLKVDSVVLGCRGLGPLKRALLGSVSNYVVNNATCPVTVVRGPN  161



>ref|XP_002452902.1| hypothetical protein SORBIDRAFT_04g034630 [Sorghum bicolor]
 gb|EES05878.1| hypothetical protein SORBIDRAFT_04g034630 [Sorghum bicolor]
Length=165

 Score =   136 bits (343),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ S  +LW  +G PLIPL EF E  +  +Y +  + E+L++L  A++ K++ V+AK
Sbjct  43   PKGADASHKELWKSTGSPLIPLPEFMEMNVQARYGLNPDKEILEILQAASKSKQVEVLAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            +YWGDAREKLC++++DLK++S V+G RGL  L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  103  IYWGDAREKLCEAVDDLKVNSFVLGCRGLGPLKRALLGSVSNYVVNNATCPVTVVRGP  160



>ref|XP_002885183.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61442.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=163

 Score =   136 bits (343),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW   G P IPLSEF +  ++KKY VK + E LD+++TA R+K +TVV K+YWGD
Sbjct  50   EGEMQLWETVGSPFIPLSEFSDAAVMKKYAVKPDAETLDIVNTAARKKTVTVVMKIYWGD  109

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
             REK+C + E + L S VMGNRGL  L+R+IMGSV+N+V+    CP+TVVK
Sbjct  110  PREKICAAAEQIPLSSLVMGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK  160



>ref|XP_002277653.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
Length=165

 Score =   136 bits (343),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW  +G PLIPLSEF +P + KKY VK + E LD+++   RQK+I VV K+YWGD
Sbjct  48   EGEMQLWETTGSPLIPLSEFSDPIISKKYGVKPDAETLDIVNCVARQKDIVVVMKVYWGD  107

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
            AREK+C++I+++ L   V+GNRGL  ++R I+GSV+NYV+   +CP+TVVK+ +
Sbjct  108  AREKICEAIDNIPLSCLVIGNRGLGKIKRAILGSVSNYVVNNGSCPVTVVKNAE  161



>ref|XP_002323966.2| hypothetical protein POPTR_0017s01470g [Populus trichocarpa]
 gb|EEF04099.2| hypothetical protein POPTR_0017s01470g [Populus trichocarpa]
Length=161

 Score =   136 bits (342),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +3

Query  87   STPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVV  266
            + P  ++ +R +L+ ++G PL+PL EFRE    K+Y +  + EVLD+LDT ++ K   VV
Sbjct  40   AQPPKADHTRKQLFEENGSPLVPLEEFREINYSKQYGLTHDPEVLDILDTVSKTKGAKVV  99

Query  267  AKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            AK+YWGD REKL D+++DLKLDS V+G+RGL +++R+++GSV+ +V+T A+CP+TVVK
Sbjct  100  AKVYWGDPREKLIDAVDDLKLDSLVIGSRGLGAIKRVLLGSVSYHVVTNASCPVTVVK  157



>gb|AFK43932.1| unknown [Lotus japonicus]
Length=172

 Score =   136 bits (342),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  60   RGTLSISSTSTPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTA  239
            RG   I     P  ++ +R +L++++G PL+P+ E RE    K+Y +  + EV+D+LDTA
Sbjct  21   RGDQIIIINVEPPNADHTRKELFAENGSPLVPMEELREINFTKQYGIARDPEVIDILDTA  80

Query  240  TRQKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTAT  419
            +R K    +AK+YWGD REKLC ++EDL LDS V+G+RGL  ++R++MGSV+ +V+T A+
Sbjct  81   SRTKGAKAMAKVYWGDPREKLCSAVEDLHLDSLVVGSRGLGPIKRVLMGSVSKHVVTNAS  140

Query  420  CPITVVK  440
            CP+TVVK
Sbjct  141  CPVTVVK  147



>ref|XP_003568882.1| PREDICTED: universal stress protein A-like protein [Brachypodium 
distachyon]
Length=171

 Score =   136 bits (342),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  123  LWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKL  302
            LW  +G PLIPLSEF EP + KKY VK + E LD+L+T  +QKEITVV+K+ WGD REKL
Sbjct  59   LWEATGSPLIPLSEFSEPAIAKKYGVKPDAETLDMLNTIAKQKEITVVSKVLWGDPREKL  118

Query  303  CDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            C +I D+ +   V+G+RGL  L+R+++GSV+++V+  A CP+TVVK
Sbjct  119  CQAIHDIPMSCLVIGSRGLGKLKRVLLGSVSDFVVNNAACPVTVVK  164



>ref|NP_001132238.1| hypothetical protein [Zea mays]
 gb|ACF81008.1| unknown [Zea mays]
 gb|AFW73684.1| hypothetical protein ZEAMMB73_655044 [Zea mays]
Length=165

 Score =   136 bits (342),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   + S  +LW  +G PLIPLSEF E  L  +Y +  + E L++L   ++ K++ V+AK
Sbjct  43   PKGVDSSHKELWKTTGSPLIPLSEFMEMNLQARYGLNPDKETLEILRAVSKSKQVEVLAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            +YWGDAREKLC++++DLK+DS V+G RGL  L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  103  VYWGDAREKLCEAVDDLKVDSFVLGCRGLGPLKRALLGSVSNYVVNNATCPVTVVRGP  160



>ref|XP_002884367.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60626.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=159

 Score =   135 bits (341),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ +R  L+  +G PL+PL EFRE  L K+Y +  + EVLD+LDT +R K++ VVAK
Sbjct  42   PQNADHTRKILFEDTGSPLVPLEEFREINLSKQYGLAYDPEVLDVLDTLSRAKKVKVVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKLCD++E+LKLDS V+G+RGL SL+RI++GSV+N+V+T ATCP+TVVK
Sbjct  102  VYWGDPREKLCDAVENLKLDSIVLGSRGLGSLKRILLGSVSNHVVTNATCPVTVVK  157



>ref|XP_004954077.1| PREDICTED: uncharacterized protein C167.05-like isoform X1 [Setaria 
italica]
Length=165

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ S  +LW  +G PLIPL EF E  +  +Y +  + E+L++L  A++ K++ V+AK
Sbjct  43   PKGADASHKELWKSTGSPLIPLPEFMEMNVQARYGLVPDKEILEILQAASKAKQVEVLAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            +YWGDAREKLC++++DLK++S V+G RGL  L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  103  IYWGDAREKLCEAVDDLKVNSFVLGCRGLGPLKRALLGSVSNYVVNNATCPVTVVRGP  160



>ref|XP_008438946.1| PREDICTED: uncharacterized protein C167.05 [Cucumis melo]
Length=164

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  KLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREK  299
            +LW  +G PLIPL EF +P  ++KY +K + E LD++ TA  QKEITV+ K+YWGDAREK
Sbjct  52   QLWQTTGSPLIPLIEFSDPNTMRKYGIKPDAETLDIVTTAAAQKEITVLLKIYWGDAREK  111

Query  300  LCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            +C++I+++ +   ++GNRGL  L+R I+GSV+NYV+   +CP+TVVK  D  
Sbjct  112  ICEAIDNIPITCLIIGNRGLGKLKRAILGSVSNYVVNNGSCPVTVVKKADHE  163



>ref|XP_004954078.1| PREDICTED: uncharacterized protein C167.05-like isoform X2 [Setaria 
italica]
Length=164

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ S  +LW  +G PLIPL EF E  +  +Y +  + E+L++L  A++ K++ V+AK
Sbjct  42   PKGADASHKELWKSTGSPLIPLPEFMEMNVQARYGLVPDKEILEILQAASKAKQVEVLAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            +YWGDAREKLC++++DLK++S V+G RGL  L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  102  IYWGDAREKLCEAVDDLKVNSFVLGCRGLGPLKRALLGSVSNYVVNNATCPVTVVRGP  159



>ref|XP_007141947.1| hypothetical protein PHAVU_008G239500g [Phaseolus vulgaris]
 gb|ESW13941.1| hypothetical protein PHAVU_008G239500g [Phaseolus vulgaris]
Length=163

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 88/116 (76%), Gaps = 1/116 (1%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            PHA + +R +L+  +G PL+PL E RE    K+Y +  + EV+D+LDTA++ K    VAK
Sbjct  43   PHA-HHTRKELFEVTGSPLVPLEELRELNFAKQYGIPRDPEVIDILDTASKTKGAKAVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKLC+++EDL LDS V+G+RGL  ++R+++GSV+ +V+T A+CP+TVVK
Sbjct  102  VYWGDPREKLCNAVEDLHLDSLVIGSRGLGPIKRVLLGSVSKHVMTNASCPVTVVK  157



>dbj|BAJ86638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = +3

Query  54   LIRGTLSISSTSTPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLD  233
            L RG   +      H   E+++ +W++SG PLIPLSEFREPE++K Y V  + EVLD+LD
Sbjct  35   LRRGDTVVVLHVLRHGGEEAKHAVWAKSGSPLIPLSEFREPEVMKNYGVTCDAEVLDMLD  94

Query  234  TATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTT  413
            TA RQ E+ VVAKLYWGDAREKLCD++E+ K+D+ VMG+RGL  +QR    + T  V+T 
Sbjct  95   TAARQLELKVVAKLYWGDAREKLCDAVEEQKIDTIVMGSRGLGLIQRY---NTTTAVVTM  151

Query  414  --ATCPI  428
               TC I
Sbjct  152  LLRTCAI  158



>ref|XP_006406778.1| hypothetical protein EUTSA_v10021673mg [Eutrema salsugineum]
 gb|ESQ48231.1| hypothetical protein EUTSA_v10021673mg [Eutrema salsugineum]
Length=163

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW   G PLIPLSEF +  ++KKY VK + E LD+ +TA+R K ITVV K+YWGD
Sbjct  50   EGEMQLWETVGSPLIPLSEFSDAAVMKKYGVKPDAETLDIANTASRMKSITVVMKIYWGD  109

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
             REK+ +++E + L S V+GNRGL  L+R+IMGSV+N+V+    CP+TVVK
Sbjct  110  PREKISEAVEQIPLSSLVIGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK  160



>ref|NP_566564.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Arabidopsis thaliana]
 gb|AAK55691.1|AF378888_1 AT3g17020/K14A17_14 [Arabidopsis thaliana]
 dbj|BAA94980.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK91493.1| AT3g17020/K14A17_14 [Arabidopsis thaliana]
 gb|AEE75895.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Arabidopsis thaliana]
Length=163

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW   G P IP+SEF +  ++KKY +K + E LD+++TA R+K ITVV K+YWGD
Sbjct  50   EGEMQLWETVGSPFIPMSEFSDAAVMKKYALKPDAETLDIVNTAARKKTITVVMKIYWGD  109

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
             REK+C + E + L S VMGNRGL  L+R+IMGSV+N+V+    CP+TVVK
Sbjct  110  PREKICAAAEQIPLSSLVMGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK  160



>dbj|BAJ92234.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=165

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ S   LW  +G PLIPL EF E  +  +Y V  + +VL++L   ++ K++ ++AK
Sbjct  43   PKGADASHKGLWKSTGSPLIPLLEFMEMNVQARYGVNPDKDVLEILQAESKSKQVEILAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
            +YWGDAREKLC++++DLK+DS V+G RGL  L+R ++GSV+NYV+  ATCP+TVV+ P+
Sbjct  103  IYWGDAREKLCEAVDDLKVDSVVLGCRGLGPLKRALLGSVSNYVVNNATCPVTVVRGPN  161



>gb|ADB54804.1| universal stress protein 7364 [Hordeum vulgare subsp. vulgare]
Length=162

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ S   LW  +G PLIPL EF E  +  +Y V  + +VL++L   ++ K++ ++AK
Sbjct  40   PKGADASHKGLWKSTGSPLIPLLEFMEMNVQARYGVNPDKDVLEILQAESKSKQVEILAK  99

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
            +YWGDAREKLC++++DLK+DS V+G RGL  L+R ++GSV+NYV+  ATCP+TVV+ P+
Sbjct  100  IYWGDAREKLCEAVDDLKVDSVVLGCRGLGPLKRALLGSVSNYVVNNATCPVTVVRGPN  158



>gb|AAQ02914.1|AF396464_1 C2.6 protein [Pisum sativum]
Length=164

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +3

Query  168  REPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMG  347
            + PE++ KY V+ ++EVLDLLDT +RQKE+ VV K+YWGDAREKL D++EDLKLDS VMG
Sbjct  66   QRPEIMNKYGVQIDIEVLDLLDTFSRQKEVNVVTKVYWGDAREKLLDAVEDLKLDSLVMG  125

Query  348  NRGLSSLQRIIMGSVTNYVLTTATCPITVVKH  443
            +RGLS++QRI++GSV+N+V+  A CP+T+VK 
Sbjct  126  SRGLSTIQRILLGSVSNFVMANAPCPVTIVKD  157



>ref|XP_011010266.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
 ref|XP_011010273.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
 ref|XP_011010280.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
 ref|XP_011010289.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
Length=164

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +3

Query  120  KLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREK  299
            +LW  +G P+IPLSEF +P  +KKY +K + E LDLL+T   QKEI VV K+YWGD REK
Sbjct  52   QLWEVTGSPMIPLSEFSDPVTMKKYGLKPDPETLDLLNTVAHQKEIVVVLKIYWGDPREK  111

Query  300  LCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKH  443
            +C++I+ + L   V+GNRGL  ++R IMGSV+NYV+   +CP+TVVK 
Sbjct  112  ICEAIDKIPLSCLVIGNRGLGKVKRAIMGSVSNYVVNNGSCPVTVVKQ  159



>ref|XP_006408321.1| hypothetical protein EUTSA_v10021680mg [Eutrema salsugineum]
 gb|ESQ49774.1| hypothetical protein EUTSA_v10021680mg [Eutrema salsugineum]
Length=159

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ +R  L+ ++G PL+PL EFRE    K+Y +  + EVLD+LDT +R K++ VVAK
Sbjct  42   PQNADHTRKILFEETGSPLVPLEEFREVNFSKQYGLAYDPEVLDVLDTLSRAKKVKVVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKLCD++++LKLDS V+G+RGL SL+RI++GSV+N+V+T ATCP+TVVK
Sbjct  102  VYWGDPREKLCDAVQNLKLDSIVLGSRGLGSLKRILLGSVSNHVVTNATCPVTVVK  157



>ref|NP_001237890.1| uncharacterized protein LOC100500682 [Glycine max]
 gb|ACU15825.1| unknown [Glycine max]
Length=166

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +3

Query  60   RGTLSISSTSTPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTA  239
            +G   I  T  P  ++ +R +L+  +G PL+PL E RE    K+Y +  + EV+ +LDTA
Sbjct  31   KGDQIILITVQPPQAHHTRKELFEDTGSPLVPLEELRELNFTKQYGIARDPEVIGILDTA  90

Query  240  TRQKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTAT  419
            ++ K    VAK+YWGD REKLC+++EDL LDS V+G+RGL  ++R+++GSV+ +V+T A+
Sbjct  91   SKTKGAKAVAKVYWGDPREKLCNAVEDLHLDSLVVGSRGLGPIKRVLLGSVSKHVMTNAS  150

Query  420  CPITVVK  440
            CP+TVVK
Sbjct  151  CPVTVVK  157



>gb|KDP42177.1| hypothetical protein JCGZ_02907 [Jatropha curcas]
Length=193

 Score =   128 bits (321),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P   +ESRN LW  SG PLIPL EFR+ ++ +KY +  + EVLDLLDTA+RQK++ V+AK
Sbjct  42   PSQGDESRNLLWYNSGAPLIPLEEFRDEQVAQKYEINLDPEVLDLLDTASRQKQVIVLAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQR  374
            LYWGDAR++LC +++DLKLD  VMG+RGL ++QR
Sbjct  102  LYWGDARDRLCQAVDDLKLDCLVMGSRGLGTIQR  135


 Score = 50.1 bits (118),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  2   DFSKSSEGALKWAIDNLADKGDTFYIIHLHPSR  100
           DFSK S+ ALKWAI NL D+GDT ++IH+ PS+
Sbjct  12  DFSKGSKLALKWAISNLIDEGDTLFVIHVKPSQ  44



>emb|CDX95890.1| BnaC05g36410D [Brassica napus]
Length=195

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW   G PLIPLSE  E  ++KKY VK + E LD+ +TA  QK ITVV K+YWGD
Sbjct  82   EGEMQLWETVGSPLIPLSEVSEASVMKKYGVKPDAETLDIANTAATQKSITVVMKIYWGD  141

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
             REKLC++ E + L S V+GNRGL  L+R+IMGSV+N+V+    CP+TVVK
Sbjct  142  PREKLCEAAEHIPLSSIVIGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK  192



>gb|EYU41387.1| hypothetical protein MIMGU_mgv1a015186mg [Erythranthe guttata]
Length=165

 Score =   134 bits (337),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +3

Query  87   STPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVV  266
            ++P A + +  +L++ +G PLIPL EFRE  + K+Y +  +  VLD+L T ++ K + VV
Sbjct  41   ASPKA-DPTNKQLFADTGSPLIPLEEFREMNVSKQYGLTPDSNVLDMLTTLSKTKRVKVV  99

Query  267  AKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            AK+YWGD REKLC ++E LKLDS V+G+RGL +++R+++GSV+NYV+  ATCP+TVVK
Sbjct  100  AKVYWGDPREKLCGAVEQLKLDSLVLGSRGLGAIKRVLLGSVSNYVVQHATCPVTVVK  157



>gb|KHN39491.1| Universal stress protein A-like protein [Glycine soja]
Length=166

 Score =   134 bits (337),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +3

Query  60   RGTLSISSTSTPHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTA  239
            +G   I  T  P  ++ +R +L+  +G PL+PL E RE    K+Y +  + EV+ +LDTA
Sbjct  31   KGDQIILITVQPPQAHHTRKELFEDTGSPLVPLEELRELNFTKQYGIARDPEVIGILDTA  90

Query  240  TRQKEITVVAKLYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTAT  419
            ++ K    VAK+YWGD REKLC+++EDL LDS V+G+RGL  ++R+++GSV+ +V+T A+
Sbjct  91   SKTKGAKAVAKVYWGDPREKLCNAVEDLHLDSLVVGSRGLGPIKRVLLGSVSKHVMTNAS  150

Query  420  CPITVVK  440
            CP+TVVK
Sbjct  151  CPVTVVK  157



>dbj|BAJ86930.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=165

 Score =   134 bits (337),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ S   LW  +G PLIPL EF E  +  +Y V  + +VL++L    + K++ ++AK
Sbjct  43   PKGADASHKGLWKSTGSPLIPLLEFMEMNVQARYGVNPDKDVLEILQAEPKSKQVEILAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
            +YWGDAREKLC++++DLK+DS V+G RGL  L+R ++GSV+NYV+  ATCP+TVV+ P+
Sbjct  103  IYWGDAREKLCEAVDDLKVDSVVLGCRGLGPLKRALLGSVSNYVVNNATCPVTVVRGPN  161



>gb|EMT05701.1| Universal stress protein A-like protein [Aegilops tauschii]
Length=166

 Score =   134 bits (336),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +3

Query  123  LWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREKL  302
            LW  SG PLIPLSEF  P + KKY VK + E LD+L+T  +QKE+ VV+K+ +GD REKL
Sbjct  55   LWEASGSPLIPLSEFSHPSIAKKYGVKPDAETLDMLNTIAKQKEVAVVSKVLFGDPREKL  114

Query  303  CDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            C +I D+ + S V+G+RGL  L+R+++GSV++YV+  A CP+TVVK    H
Sbjct  115  CQAIHDMPISSLVIGSRGLGKLKRVLLGSVSDYVVNNAACPVTVVKPASNH  165



>ref|NP_001148736.1| LOC100282352 [Zea mays]
 gb|ACF83510.1| unknown [Zea mays]
 gb|ACG32696.1| USP family protein [Zea mays]
Length=167

 Score =   134 bits (336),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            +S   LW  +G PLIPLSEF +P + KKY  K +ME LDLL+T   QKEI VV K+ WGD
Sbjct  51   QSEAILWESTGSPLIPLSEFSDPIIAKKYGAKPDMETLDLLNTTATQKEIMVVVKVLWGD  110

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
             REKLC  I D  L   V+G+RGL  L+R+++GSV++YV+  ATCP+TVVK
Sbjct  111  PREKLCQVIHDTPLSCLVIGSRGLGKLKRVLLGSVSDYVVNNATCPVTVVK  161



>ref|XP_009383705.1| PREDICTED: uncharacterized protein C167.05 [Musa acuminata subsp. 
malaccensis]
Length=162

 Score =   134 bits (336),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = +3

Query  108  ESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGD  287
            E   +LW  +G P IPL EF +P + KKY VK + E LD+L+T  RQKEI V+ K+YWGD
Sbjct  48   EGEMQLWETTGSPFIPLIEFSDPGIAKKYGVKPDAETLDILNTVARQKEIVVLMKIYWGD  107

Query  288  AREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPD  449
            AREK+C++I+ + L   ++GNRG   ++R+++GSV+N+V+   TCP+TVVK  D
Sbjct  108  AREKICEAIDTIPLSCLIIGNRGHGGIKRLLLGSVSNHVVNNGTCPVTVVKGVD  161



>ref|XP_006298706.1| hypothetical protein CARUB_v10014810mg [Capsella rubella]
 gb|EOA31604.1| hypothetical protein CARUB_v10014810mg [Capsella rubella]
Length=159

 Score =   134 bits (336),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ +R  L+  +G PL+PL EFRE    K+Y +  + EVLD+LDT +R K++ VVAK
Sbjct  42   PQNADHTRKILFEDTGSPLVPLEEFREVNFSKQYGLAYDPEVLDVLDTLSRAKKVKVVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKLCD++E+LKLDS V+G+RGL SL+R+++GSV+N+V+T ATCP+TVVK
Sbjct  102  VYWGDPREKLCDAVENLKLDSIVLGSRGLGSLKRMLLGSVSNHVVTNATCPVTVVK  157



>gb|AFK33464.1| unknown [Lotus japonicus]
 gb|AFK45024.1| unknown [Lotus japonicus]
Length=166

 Score =   134 bits (336),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  120  KLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREK  299
            +LW  +G PLIPLS+F +  +LK+Y +K   EV+D+  TA+++K I V+ K+YWGDAREK
Sbjct  54   QLWETTGSPLIPLSDFSDTAVLKRYGLKPEPEVIDIATTASKEKNIEVLLKIYWGDAREK  113

Query  300  LCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            L ++IE + LDS +MGNRGL +L+R IMGSV+N+V+  A+CP+TVVK
Sbjct  114  LLEAIEHIPLDSIIMGNRGLGTLRRAIMGSVSNHVVNNASCPVTVVK  160



>ref|XP_010508189.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=158

 Score =   133 bits (335),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ +R  L+  +G PL+PL EFRE    K+Y +  + EVLD+LDT +R K++ VVAK
Sbjct  42   PQNADHTRKILFEDTGSPLVPLEEFREVNFSKQYGLAYDPEVLDVLDTLSRAKKVKVVAK  101

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            +YWGD REKLCD++E+LKLDS V+G+RGL SL+R+++GSV+N+V+T ATCP+TVVK
Sbjct  102  VYWGDPREKLCDAVENLKLDSIVLGSRGLGSLKRMLLGSVSNHVVTNATCPVTVVK  157



>ref|XP_004295087.1| PREDICTED: universal stress protein A-like protein [Fragaria 
vesca subsp. vesca]
Length=161

 Score =   133 bits (335),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +3

Query  120  KLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREK  299
            +LW  +G PLIPL EF +  ++ KY VK + E +D++ TA  QKEITV+ K+YWGDAREK
Sbjct  52   QLWGVTGSPLIPLPEFSDAHIMNKYEVKPDAETVDIVTTAASQKEITVLVKIYWGDAREK  111

Query  300  LCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVK  440
            + ++I+ + L   VMGNRGL +L+R+IMGSV+N+V+  A CP+TVVK
Sbjct  112  IIEAIDKIPLSFLVMGNRGLGTLKRVIMGSVSNFVVNNARCPVTVVK  158



>gb|EEC74090.1| hypothetical protein OsI_09119 [Oryza sativa Indica Group]
Length=165

 Score =   134 bits (336),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ S  +LW  +G PLIPL EF E  +  +Y +  + EVL++L   ++ K++ V+AK
Sbjct  43   PKGADASHKELWKSTGSPLIPLLEFMEMNVQARYGINPDKEVLEILQAESKSKQVEVLAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            +YWGDAREKLC++++DLK+++ V+G RGL  L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  103  VYWGDAREKLCEAVDDLKVNTFVLGCRGLGPLKRALLGSVSNYVVNNATCPVTVVRAP  160



>ref|NP_001048266.1| Os02g0773200 [Oryza sativa Japonica Group]
 dbj|BAD16874.1| universal stress protein / early nodulin ENOD18-like [Oryza sativa 
Japonica Group]
 dbj|BAF10180.1| Os02g0773200 [Oryza sativa Japonica Group]
 gb|EAZ24778.1| hypothetical protein OsJ_08554 [Oryza sativa Japonica Group]
 dbj|BAG98422.1| unnamed protein product [Oryza sativa Japonica Group]
Length=165

 Score =   133 bits (335),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +3

Query  93   PHASNESRNKLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAK  272
            P  ++ S  +LW  +G PLIPL EF E  +  +Y +  + EVL++L   ++ K++ V+AK
Sbjct  43   PKGADASHKELWKSTGSPLIPLLEFMEMNVQARYGINPDKEVLEILQAESKSKQVEVLAK  102

Query  273  LYWGDAREKLCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHP  446
            +YWGDAREKLC++++DLK+++ V+G RGL  L+R ++GSV+NYV+  ATCP+TVV+ P
Sbjct  103  VYWGDAREKLCEAVDDLKVNTFVLGCRGLGPLKRALLGSVSNYVVNNATCPVTVVRAP  160



>ref|XP_004134244.1| PREDICTED: uncharacterized protein C167.05-like [Cucumis sativus]
 ref|XP_004162211.1| PREDICTED: uncharacterized protein C167.05-like [Cucumis sativus]
 gb|KGN57163.1| Universal stress protein [Cucumis sativus]
Length=164

 Score =   133 bits (335),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  KLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREK  299
            +LW  +G PLIPL EF +P  ++KY +K + E LD++ TA  QKEI V+ K+YWGDAREK
Sbjct  52   QLWQTTGSPLIPLVEFSDPNTMRKYGIKPDAETLDIVSTAAAQKEINVLLKIYWGDAREK  111

Query  300  LCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKHPDFH  455
            +C++I+ + +   ++GNRGL  L+R I+GSV+NYV+   +CP+TVVK  D  
Sbjct  112  ICEAIDHIPITCLIIGNRGLGKLKRAILGSVSNYVVNNGSCPVTVVKKADHE  163



>ref|XP_008223352.1| PREDICTED: universal stress protein A-like protein [Prunus mume]
Length=164

 Score =   133 bits (335),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  120  KLWSQSGCPLIPLSEFREPELLKKYNVKANMEVLDLLDTATRQKEITVVAKLYWGDAREK  299
            +LW  +G PLIP+ EF +  ++KKY V  + E LD+ +TA +QKEITVV K+YWGDAREK
Sbjct  51   QLWGVTGSPLIPVVEFSDANVMKKYKVNPDPETLDIANTAAKQKEITVVMKIYWGDAREK  110

Query  300  LCDSIEDLKLDSRVMGNRGLSSLQRIIMGSVTNYVLTTATCPITVVKH  443
            + ++I+ + L   V+GNRGL  L+R+IMGSV+N+V+  A+CP+TVVK+
Sbjct  111  IIEAIDKVPLSLLVIGNRGLGKLKRVIMGSVSNFVVNNASCPVTVVKN  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115