BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP002E03 514 bp,

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011075483.1|  PREDICTED: 40S ribosomal protein S9-2              332   2e-113   Sesamum indicum [beniseed]
ref|XP_004135180.1|  PREDICTED: 40S ribosomal protein S9-2-like         329   3e-112   Cucumis sativus [cucumbers]
ref|XP_011085760.1|  PREDICTED: 40S ribosomal protein S9-2-like         328   8e-112   Sesamum indicum [beniseed]
ref|XP_002517490.1|  40S ribosomal protein S9, putative                 328   9e-112   Ricinus communis
ref|XP_010037164.1|  PREDICTED: 40S ribosomal protein S9-2-like         328   1e-111   Eucalyptus grandis [rose gum]
ref|XP_011098613.1|  PREDICTED: 40S ribosomal protein S9-2              328   1e-111   Sesamum indicum [beniseed]
ref|NP_001275235.1|  uncharacterized protein LOC102577830               328   1e-111   Solanum tuberosum [potatoes]
ref|XP_010029297.1|  PREDICTED: 40S ribosomal protein S9-2              328   1e-111   Eucalyptus grandis [rose gum]
gb|EYU34659.1|  hypothetical protein MIMGU_mgv1a014209mg                327   2e-111   Erythranthe guttata [common monkey flower]
ref|XP_010091216.1|  40S ribosomal protein S9-2                         327   2e-111   Morus notabilis
emb|CDP02222.1|  unnamed protein product                                327   3e-111   Coffea canephora [robusta coffee]
gb|KDP31233.1|  hypothetical protein JCGZ_11609                         327   4e-111   Jatropha curcas
gb|KDP41175.1|  hypothetical protein JCGZ_15582                         326   5e-111   Jatropha curcas
ref|XP_004238784.1|  PREDICTED: 40S ribosomal protein S9-2              326   7e-111   Solanum lycopersicum
ref|XP_004228395.1|  PREDICTED: 40S ribosomal protein S9-2              326   7e-111   Solanum lycopersicum
gb|EYU22431.1|  hypothetical protein MIMGU_mgv1a014214mg                326   7e-111   Erythranthe guttata [common monkey flower]
gb|KCW56189.1|  hypothetical protein EUGRSUZ_I01938                     325   1e-110   Eucalyptus grandis [rose gum]
ref|XP_010256989.1|  PREDICTED: 40S ribosomal protein S9-2-like         325   1e-110   Nelumbo nucifera [Indian lotus]
ref|XP_009604777.1|  PREDICTED: 40S ribosomal protein S9-2-like         325   1e-110   Nicotiana tomentosiformis
ref|XP_009627396.1|  PREDICTED: 40S ribosomal protein S9-2              325   2e-110   Nicotiana tomentosiformis
ref|XP_002511557.1|  40S ribosomal protein S9, putative                 325   3e-110   Ricinus communis
ref|XP_009598709.1|  PREDICTED: 40S ribosomal protein S9-2-like         324   3e-110   Nicotiana tomentosiformis
gb|EYU28732.1|  hypothetical protein MIMGU_mgv1a014218mg                324   4e-110   Erythranthe guttata [common monkey flower]
ref|XP_009798560.1|  PREDICTED: 40S ribosomal protein S9-2-like         324   4e-110   Nicotiana sylvestris
ref|XP_010029477.1|  PREDICTED: 40S ribosomal protein S9-2              324   5e-110   Eucalyptus grandis [rose gum]
ref|NP_001274868.1|  40S ribosomal protein S9-2-like                    323   6e-110   Solanum tuberosum [potatoes]
ref|XP_002522398.1|  40S ribosomal protein S9, putative                 323   7e-110   Ricinus communis
ref|XP_009778292.1|  PREDICTED: 40S ribosomal protein S9-2              323   7e-110   Nicotiana sylvestris
ref|XP_002283256.1|  PREDICTED: 40S ribosomal protein S9-2              323   1e-109   Vitis vinifera
ref|XP_011004198.1|  PREDICTED: 40S ribosomal protein S9-2 isofor...    323   1e-109   Populus euphratica
ref|XP_009779308.1|  PREDICTED: 40S ribosomal protein S9-2-like         323   1e-109   Nicotiana sylvestris
emb|CDP00311.1|  unnamed protein product                                322   2e-109   Coffea canephora [robusta coffee]
ref|XP_009600364.1|  PREDICTED: 40S ribosomal protein S9-2-like         322   2e-109   Nicotiana tomentosiformis
ref|XP_010242426.1|  PREDICTED: 40S ribosomal protein S9-2              322   2e-109   Nelumbo nucifera [Indian lotus]
gb|ABQ32300.1|  putative 40S ribosomal protein S9                       322   2e-109   Artemisia annua [sweet Annie]
ref|XP_006367430.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    322   3e-109   Solanum tuberosum [potatoes]
ref|XP_002323418.1|  hypothetical protein POPTR_0016s07730g             321   6e-109   Populus trichocarpa [western balsam poplar]
gb|EPS73776.1|  hypothetical protein M569_00980                         321   6e-109   Genlisea aurea
ref|XP_007037295.1|  Ribosomal protein S4                               320   1e-108   Theobroma cacao [chocolate]
ref|XP_006367431.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    320   1e-108   Solanum tuberosum [potatoes]
ref|XP_011004201.1|  PREDICTED: 40S ribosomal protein S9-2-like i...    320   2e-108   Populus euphratica
ref|XP_011004703.1|  PREDICTED: 40S ribosomal protein S9-2-like         320   2e-108   Populus euphratica
gb|KJB74899.1|  hypothetical protein B456_012G055000                    320   2e-108   Gossypium raimondii
gb|KJB70960.1|  hypothetical protein B456_011G097500                    320   2e-108   Gossypium raimondii
gb|KJB33600.1|  hypothetical protein B456_006G020700                    320   2e-108   Gossypium raimondii
gb|KHG16530.1|  40S ribosomal S9-2 -like protein                        320   2e-108   Gossypium arboreum [tree cotton]
gb|KJB11057.1|  hypothetical protein B456_001G238700                    320   2e-108   Gossypium raimondii
ref|XP_002324730.1|  hypothetical protein POPTR_0018s07520g             319   3e-108   Populus trichocarpa [western balsam poplar]
ref|XP_007032505.1|  Ribosomal protein S4                               319   4e-108   Theobroma cacao [chocolate]
emb|CAG47084.1|  40S ribosomal protein S9                               319   4e-108   Catharanthus roseus [chatas]
gb|AFK46709.1|  unknown                                                 319   4e-108   Lotus japonicus
ref|XP_004499428.1|  PREDICTED: 40S ribosomal protein S9-2-like         318   5e-108   Cicer arietinum [garbanzo]
ref|XP_007138197.1|  hypothetical protein PHAVU_009G188600g             318   6e-108   Phaseolus vulgaris [French bean]
gb|ABK21901.1|  unknown                                                 318   8e-108   Picea sitchensis
ref|XP_007155321.1|  hypothetical protein PHAVU_003G191200g             318   1e-107   Phaseolus vulgaris [French bean]
ref|XP_003549666.1|  PREDICTED: 40S ribosomal protein S9-2-like         318   1e-107   Glycine max [soybeans]
ref|XP_004508755.1|  PREDICTED: 40S ribosomal protein S9-2-like         318   1e-107   Cicer arietinum [garbanzo]
ref|XP_003577383.1|  PREDICTED: 40S ribosomal protein S9-2-like         317   1e-107   Brachypodium distachyon [annual false brome]
ref|XP_010917021.1|  PREDICTED: 40S ribosomal protein S9-2              317   2e-107   Elaeis guineensis
ref|XP_003598026.1|  40S ribosomal protein S9                           317   2e-107   Medicago truncatula
gb|AFK40975.1|  unknown                                                 317   2e-107   Medicago truncatula
ref|XP_002276284.1|  PREDICTED: 40S ribosomal protein S9-2              317   2e-107   Vitis vinifera
ref|NP_001276185.1|  40S ribosomal protein S9-2-like                    317   3e-107   Glycine max [soybeans]
ref|XP_008780681.1|  PREDICTED: 40S ribosomal protein S9-2              317   3e-107   Phoenix dactylifera
ref|XP_007215987.1|  hypothetical protein PRUPE_ppa011733mg             316   5e-107   Prunus persica
ref|XP_009389620.1|  PREDICTED: 40S ribosomal protein S9-2-like         316   6e-107   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU15321.1|  unknown                                                 317   6e-107   Glycine max [soybeans]
ref|XP_009414866.1|  PREDICTED: 40S ribosomal protein S9-2              316   7e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403622.1|  PREDICTED: 40S ribosomal protein S9-2-like         316   7e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007209623.1|  hypothetical protein PRUPE_ppa011764mg             316   7e-107   Prunus persica
ref|XP_006380606.1|  hypothetical protein POPTR_0007s09750g             316   7e-107   Populus trichocarpa [western balsam poplar]
ref|XP_002317362.1|  hypothetical protein POPTR_0011s09670g             316   8e-107   Populus trichocarpa [western balsam poplar]
ref|NP_001278530.1|  40S ribosomal protein S9                           315   8e-107   Zea mays [maize]
ref|XP_006282728.1|  hypothetical protein CARUB_v10005777mg             315   9e-107   Capsella rubella
ref|XP_010435836.1|  PREDICTED: 40S ribosomal protein S9-2              315   9e-107   Camelina sativa [gold-of-pleasure]
ref|XP_006663032.1|  PREDICTED: 40S ribosomal protein S9-2-like         315   9e-107   Oryza brachyantha
ref|XP_003576178.1|  PREDICTED: 40S ribosomal protein S9-2-like         315   1e-106   Brachypodium distachyon [annual false brome]
ref|XP_010554004.1|  PREDICTED: 40S ribosomal protein S9-2              315   1e-106   Tarenaya hassleriana [spider flower]
ref|NP_001049004.1|  Os03g0154700                                       315   2e-106   
ref|NP_001238740.1|  uncharacterized protein LOC100305663               315   2e-106   Glycine max [soybeans]
gb|ABR17162.1|  unknown                                                 314   4e-106   Picea sitchensis
gb|ACG33443.1|  40S ribosomal protein S9                                313   5e-106   Zea mays [maize]
ref|XP_002870751.1|  40S ribosomal protein S9                           313   5e-106   Arabidopsis lyrata subsp. lyrata
ref|XP_009383889.1|  PREDICTED: 40S ribosomal protein S9-2-like         313   6e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004299381.1|  PREDICTED: 40S ribosomal protein S9-2-like         313   7e-106   Fragaria vesca subsp. vesca
ref|XP_002442158.1|  hypothetical protein SORBIDRAFT_08g015270          313   7e-106   Sorghum bicolor [broomcorn]
ref|XP_004962962.1|  PREDICTED: 40S ribosomal protein S9-2-like         313   8e-106   Setaria italica
gb|KFK33188.1|  hypothetical protein AALP_AA6G341500                    313   1e-105   Arabis alpina [alpine rockcress]
ref|XP_006405589.1|  hypothetical protein EUTSA_v10027944mg             313   1e-105   Eutrema salsugineum
ref|NP_198801.1|  40S ribosomal protein S9-2                            313   1e-105   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001131442.1|  uncharacterized protein LOC100192774               312   1e-105   Zea mays [maize]
gb|EMS50632.1|  40S ribosomal protein S9-2                              312   1e-105   Triticum urartu
ref|XP_003623232.1|  40S ribosomal protein S9                           312   2e-105   Medicago truncatula
ref|XP_006664031.1|  PREDICTED: 40S ribosomal protein S9-2-like         311   3e-105   Oryza brachyantha
ref|XP_010551858.1|  PREDICTED: 40S ribosomal protein S9-2-like         311   4e-105   Tarenaya hassleriana [spider flower]
ref|XP_006438663.1|  hypothetical protein CICLE_v10032800mg             311   4e-105   Citrus clementina
ref|XP_010550058.1|  PREDICTED: 40S ribosomal protein S9-2-like         311   5e-105   Tarenaya hassleriana [spider flower]
ref|XP_010545191.1|  PREDICTED: 40S ribosomal protein S9-2-like         311   5e-105   Tarenaya hassleriana [spider flower]
ref|NP_001149705.1|  40S ribosomal protein S9                           311   5e-105   Zea mays [maize]
ref|XP_010937076.1|  PREDICTED: 40S ribosomal protein S9-2-like         311   6e-105   Elaeis guineensis
ref|XP_003637511.1|  40S ribosomal protein S9                           312   6e-105   
ref|XP_004304310.1|  PREDICTED: 40S ribosomal protein S9-2              310   9e-105   Fragaria vesca subsp. vesca
ref|XP_003557815.1|  PREDICTED: 40S ribosomal protein S9-2              310   9e-105   Brachypodium distachyon [annual false brome]
ref|XP_004984207.1|  PREDICTED: 40S ribosomal protein S9-2-like         310   2e-104   Setaria italica
ref|XP_010524330.1|  PREDICTED: 40S ribosomal protein S9-2-like         310   2e-104   Tarenaya hassleriana [spider flower]
ref|XP_008341561.1|  PREDICTED: 40S ribosomal protein S9-2              310   2e-104   Malus domestica [apple tree]
ref|XP_002463229.1|  hypothetical protein SORBIDRAFT_02g040120          309   2e-104   Sorghum bicolor [broomcorn]
ref|XP_002463225.1|  hypothetical protein SORBIDRAFT_02g040080          309   2e-104   Sorghum bicolor [broomcorn]
ref|XP_004958404.1|  PREDICTED: 40S ribosomal protein S9-2-like         309   2e-104   Setaria italica
ref|XP_010939529.1|  PREDICTED: 40S ribosomal protein S9-2-like         309   3e-104   Elaeis guineensis
ref|XP_008379343.1|  PREDICTED: 40S ribosomal protein S9-2              309   3e-104   Malus domestica [apple tree]
ref|XP_006650139.1|  PREDICTED: 40S ribosomal protein S9-2-like         309   3e-104   Oryza brachyantha
ref|XP_010683223.1|  PREDICTED: 40S ribosomal protein S9-2              308   5e-104   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010695717.1|  PREDICTED: 40S ribosomal protein S9-2-like         308   7e-104   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003562635.1|  PREDICTED: 40S ribosomal protein S9-2-like         308   9e-104   Brachypodium distachyon [annual false brome]
ref|XP_010092050.1|  40S ribosomal protein S9-2                         310   1e-103   Morus notabilis
ref|XP_006657990.1|  PREDICTED: 40S ribosomal protein S9-2-like         307   1e-103   Oryza brachyantha
ref|XP_009124855.1|  PREDICTED: 40S ribosomal protein S9-2              306   3e-103   Brassica rapa
emb|CDX74423.1|  BnaA04g09660D                                          306   3e-103   Brassica napus [oilseed rape]
ref|XP_001754369.1|  predicted protein                                  305   1e-102   Physcomitrella patens
ref|XP_001767226.1|  predicted protein                                  305   1e-102   Physcomitrella patens
dbj|BAJ90873.1|  predicted protein                                      305   1e-102   Hordeum vulgare subsp. vulgare [barley]
gb|AAT08735.1|  40S ribosomal protein S9                                305   2e-102   Hyacinthus orientalis [common hyacinth]
ref|XP_002985335.1|  hypothetical protein SELMODRAFT_157263             305   2e-102   Selaginella moellendorffii
ref|XP_001777561.1|  predicted protein                                  304   2e-102   Physcomitrella patens
ref|XP_010420178.1|  PREDICTED: 40S ribosomal protein S9-1              304   3e-102   Camelina sativa [gold-of-pleasure]
ref|XP_006400037.1|  hypothetical protein EUTSA_v10014722mg             304   3e-102   Eutrema salsugineum
ref|XP_006288701.1|  hypothetical protein CARUB_v10002009mg             304   3e-102   Capsella rubella
ref|XP_001754496.1|  predicted protein                                  304   4e-102   Physcomitrella patens
gb|ABA94602.1|  40S ribosomal protein S9, putative, expressed           303   4e-102   Oryza sativa Japonica Group [Japonica rice]
ref|NP_197024.1|  40S ribosomal protein S9-1                            303   5e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873713.1|  40S ribosomal protein S9                           303   1e-101   Arabidopsis lyrata subsp. lyrata
ref|XP_002960852.1|  hypothetical protein SELMODRAFT_74302              301   3e-101   Selaginella moellendorffii
gb|EMS59613.1|  40S ribosomal protein S9-2                              301   6e-101   Triticum urartu
gb|EAY83173.1|  hypothetical protein OsI_38384                          300   6e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_009131450.1|  PREDICTED: 40S ribosomal protein S9-1              300   8e-101   Brassica rapa
ref|XP_001762390.1|  predicted protein                                  300   1e-100   Physcomitrella patens
gb|KHG14244.1|  40S ribosomal S9-2 -like protein                        299   2e-100   Gossypium arboreum [tree cotton]
ref|XP_006827176.1|  hypothetical protein AMTR_s00010p00256040          300   2e-100   
gb|KFK25765.1|  hypothetical protein AALP_AA8G156800                    299   2e-100   Arabis alpina [alpine rockcress]
gb|KHG14681.1|  40S ribosomal S9-2 -like protein                        299   2e-100   Gossypium arboreum [tree cotton]
gb|EEC74543.1|  hypothetical protein OsI_10067                          299   9e-99    Oryza sativa Indica Group [Indian rice]
ref|XP_001702303.1|  ribosomal protein S9, component of cytosolic...    293   4e-98    Chlamydomonas reinhardtii
gb|ADB77797.1|  40S ribosomal protein S9                                293   4e-98    Chlamydomonas reinhardtii
ref|XP_006431128.1|  hypothetical protein CICLE_v10013599mg             293   4e-98    Citrus clementina
gb|KHG06711.1|  40S ribosomal S9-2 -like protein                        295   6e-98    Gossypium arboreum [tree cotton]
gb|KDP41176.1|  hypothetical protein JCGZ_15583                         293   6e-98    Jatropha curcas
ref|XP_009126038.1|  PREDICTED: 40S ribosomal protein S9-1-like         292   1e-97    Brassica rapa
ref|XP_002958222.1|  component of cytosolic 80S ribosome and 40S ...    291   2e-97    Volvox carteri f. nagariensis
gb|KHN30826.1|  40S ribosomal protein S9-2                              291   4e-97    Glycine soja [wild soybean]
pdb|3J60|J  Chain J, Localization Of The Small Subunit Ribosomal ...    291   5e-97    Triticum aestivum [Canadian hard winter wheat]
emb|CDY30273.1|  BnaC04g31840D                                          308   3e-95    Brassica napus [oilseed rape]
gb|KIZ06357.1|  40S ribosomal protein S9-2                              279   1e-92    Monoraphidium neglectum
ref|XP_005648482.1|  ribosomal protein S9 component of cytosolic ...    278   3e-92    Coccomyxa subellipsoidea C-169
emb|CEF99084.1|  Ribosomal protein S4/S9, eukaryotic/archaeal           278   4e-92    Ostreococcus tauri
ref|XP_005849917.1|  hypothetical protein CHLNCDRAFT_56085              277   8e-92    Chlorella variabilis
ref|XP_001419792.1|  Ribosomal protein S9, component of cytosolic...    276   4e-91    Ostreococcus lucimarinus CCE9901
ref|XP_002500609.1|  predicted protein                                  275   5e-91    Micromonas commoda
gb|KCW87774.1|  hypothetical protein EUGRSUZ_A00153                     273   9e-91    Eucalyptus grandis [rose gum]
ref|XP_002467783.1|  hypothetical protein SORBIDRAFT_01g033980          273   2e-90    Sorghum bicolor [broomcorn]
ref|XP_003056784.1|  predicted protein                                  272   1e-89    Micromonas pusilla CCMP1545
gb|KCW56192.1|  hypothetical protein EUGRSUZ_I01938                     269   5e-89    Eucalyptus grandis [rose gum]
ref|XP_008367548.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    269   2e-88    
gb|EAY83171.1|  hypothetical protein OsI_38381                          268   4e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_010274527.1|  PREDICTED: 40S ribosomal protein S9-2-like         267   2e-87    Nelumbo nucifera [Indian lotus]
ref|XP_006381973.1|  hypothetical protein POPTR_0006s22640g             263   3e-86    Populus trichocarpa [western balsam poplar]
tpg|DAA41535.1|  TPA: hypothetical protein ZEAMMB73_424707              264   6e-86    Zea mays [maize]
tpg|DAA55417.1|  TPA: hypothetical protein ZEAMMB73_005048              261   9e-86    Zea mays [maize]
gb|ABF94049.1|  40S ribosomal protein S9, putative, expressed           260   2e-85    Oryza sativa Japonica Group [Japonica rice]
gb|ABA94598.1|  40S ribosomal protein S9, putative, expressed           259   3e-85    Oryza sativa Japonica Group [Japonica rice]
dbj|BAA78592.1|  40S ribosomal protein S9                               260   4e-85    Chlamydomonas sp. HS-5
ref|XP_003609048.1|  40S ribosomal protein S9                           260   8e-85    
ref|XP_006438664.1|  hypothetical protein CICLE_v10033755mg             258   2e-84    Citrus clementina
ref|XP_011399104.1|  40S ribosomal protein S9-1                         258   3e-84    Auxenochlorella protothecoides
gb|KIZ02547.1|  40S ribosomal protein S9-2                              259   3e-84    Monoraphidium neglectum
gb|ADB77798.1|  40S ribosomal protein S9                                256   1e-83    Cladophora coelothrix
emb|CBN76630.1|  conserved unknown protein                              255   5e-83    Ectocarpus siliculosus
ref|XP_005708491.1|  40S ribosomal protein S9e                          253   3e-82    Galdieria sulphuraria
ref|XP_007922661.1|  hypothetical protein MYCFIDRAFT_60241              253   4e-82    Cercospora fijiensis CIRAD86
gb|KCW56188.1|  hypothetical protein EUGRSUZ_I01938                     251   5e-82    Eucalyptus grandis [rose gum]
gb|EPE04605.1|  40s ribosomal protein s9                                252   6e-82    Ophiostoma piceae UAMH 11346
ref|NP_001119227.1|  40S ribosomal protein S9-1                         250   1e-81    Arabidopsis thaliana [mouse-ear cress]
gb|KIN07697.1|  hypothetical protein OIDMADRAFT_16275                   252   1e-81    Oidiodendron maius Zn
gb|EME38681.1|  ribosomal protein S9-like protein                       251   1e-81    Dothistroma septosporum NZE10
ref|XP_002139923.1|  40S ribosomal protein S9                           251   1e-81    Cryptosporidium muris RN66
ref|XP_001546443.1|  40S ribosomal protein S9                           251   2e-81    Botrytis cinerea B05.10
gb|KIW50177.1|  40S ribosomal protein S9                                251   2e-81    Exophiala xenobiotica
ref|XP_006691696.1|  40S ribosomal protein s9-like protein              251   2e-81    Chaetomium thermophilum var. thermophilum DSM 1495
gb|KIW44874.1|  40S ribosomal protein S9                                251   2e-81    Exophiala oligosperma
gb|KDD75683.1|  hypothetical protein H632_c551p0                        251   2e-81    Helicosporidium sp. ATCC 50920
gb|KIV80024.1|  40S ribosomal protein S9                                251   2e-81    Exophiala sideris
gb|KEF58004.1|  40S ribosomal protein S9                                251   2e-81    Exophiala aquamarina CBS 119918
gb|KIW15420.1|  40S ribosomal protein S9                                251   3e-81    Exophiala spinifera
gb|EKG11582.1|  Ribosomal protein S4/S9                                 250   3e-81    Macrophomina phaseolina MS6
ref|XP_007782986.1|  40S ribosomal protein S9                           250   3e-81    Coniosporium apollinis CBS 100218
gb|KIW73335.1|  40S ribosomal protein S9                                250   3e-81    Capronia semi-immersa
ref|XP_008722253.1|  40S ribosomal protein S9                           250   3e-81    Cladophialophora carrionii CBS 160.54
ref|XP_007724904.1|  40S ribosomal protein S9                           250   4e-81    Capronia coronata CBS 617.96
ref|XP_009155008.1|  40S ribosomal protein S9                           250   4e-81    Exophiala dermatitidis NIH/UT8656
ref|XP_007674573.1|  hypothetical protein BAUCODRAFT_66115              250   5e-81    Baudoinia panamericana UAMH 10762
ref|XP_007698387.1|  hypothetical protein COCSADRAFT_35730              250   6e-81    Bipolaris sorokiniana ND90Pr
ref|XP_003838270.1|  similar to 40S ribosomal protein S9                250   6e-81    Leptosphaeria maculans JN3
gb|KIW07901.1|  40S ribosomal protein S9                                249   6e-81    Verruconis gallopava
ref|XP_007731850.1|  40S ribosomal protein S9                           250   6e-81    Capronia epimyces CBS 606.96
ref|XP_001937443.1|  40S ribosomal protein S9                           249   6e-81    Pyrenophora tritici-repentis Pt-1C-BFP
gb|ESZ90022.1|  40S ribosomal protein S9                                249   7e-81    Sclerotinia borealis F-4157
dbj|GAM43906.1|  40S ribosomal protein                                  249   7e-81    Talaromyces cellulolyticus
ref|XP_008808061.1|  PREDICTED: 40S ribosomal protein S9-2-like         248   8e-81    Phoenix dactylifera
ref|XP_007587858.1|  putative 40s ribosomal protein s9 protein          249   8e-81    Neofusicoccum parvum UCRNP2
ref|XP_007913411.1|  putative 40s ribosomal protein s9 protein          249   8e-81    Phaeoacremonium minimum UCRPA7
ref|XP_007750565.1|  40S ribosomal protein S9                           249   8e-81    Cladophialophora psammophila CBS 110553
gb|KIW24305.1|  40S ribosomal protein S9                                249   9e-81    Cladophialophora immunda
ref|XP_001246606.1|  40S ribosomal protein S9                           249   9e-81    Coccidioides immitis RS
gb|EMF08137.1|  40S ribosomal protein S9                                249   9e-81    Sphaerulina musiva SO2202
ref|XP_002152417.1|  40S ribosomal protein S9                           249   1e-80    Talaromyces marneffei ATCC 18224
gb|EPS26866.1|  hypothetical protein PDE_01806                          249   1e-80    Penicillium oxalicum 114-2
ref|XP_009038600.1|  hypothetical protein AURANDRAFT_28757              249   1e-80    Aureococcus anophagefferens
gb|KDN65245.1|  putative ribosomal protein S4                           249   1e-80    Colletotrichum sublineola
ref|XP_007829664.1|  40S ribosomal protein S9                           249   1e-80    Pestalotiopsis fici W106-1
ref|XP_007687378.1|  hypothetical protein COCMIDRAFT_93683              249   1e-80    Bipolaris oryzae ATCC 44560
ref|XP_003303583.1|  40S ribosomal protein S9                           251   1e-80    Pyrenophora teres f. teres 0-1
ref|XP_001791646.1|  hypothetical protein SNOG_00985                    249   1e-80    Parastagonospora nodorum SN15
gb|KIV89206.1|  40S ribosomal protein S9                                249   2e-80    Exophiala mesophila
ref|XP_011115175.1|  hypothetical protein H072_9617                     249   2e-80    Dactylellina haptotyla CBS 200.50
emb|CDR95115.1|  40S ribosomal subunit protein S9, putative             248   2e-80    Babesia bigemina
ref|XP_001594205.1|  40S ribosomal protein S9                           249   2e-80    Sclerotinia sclerotiorum 1980 UF-70
gb|KEQ66339.1|  40S ribosomal protein S9                                248   2e-80    Aureobasidium melanogenum CBS 110374
gb|AFK45767.1|  unknown                                                 248   2e-80    Medicago truncatula
ref|XP_007288535.1|  40S ribosomal protein S9                           248   2e-80    Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|KIX06477.1|  40S ribosomal protein S9                                248   2e-80    Rhinocladiella mackenziei CBS 650.93
gb|KEQ72499.1|  40S ribosomal protein S9                                248   2e-80    Aureobasidium namibiae CBS 147.97
gb|KHJ32708.1|  putative 40s ribosomal protein s9                       248   2e-80    Erysiphe necator
ref|XP_007273485.1|  40s ribosomal protein                              248   3e-80    Colletotrichum gloeosporioides Nara gc5
emb|CCF33735.1|  40S ribosomal protein S9                               248   3e-80    Colletotrichum higginsianum
gb|EFQ29502.1|  ribosomal protein S4                                    248   3e-80    Colletotrichum graminicola M1.001
ref|XP_007788827.1|  putative 40s ribosomal protein s9 protein          248   3e-80    Eutypa lata UCREL1
gb|EFX05063.1|  40S ribosomal protein s9                                248   3e-80    Grosmannia clavigera kw1407
ref|XP_002486003.1|  40S ribosomal protein S9                           248   3e-80    Talaromyces stipitatus ATCC 10500
ref|XP_005767233.1|  hypothetical protein EMIHUDRAFT_61745              248   3e-80    Emiliania huxleyi CCMP1516
ref|XP_004336000.1|  ribosomal protein S4, putative                     248   4e-80    Acanthamoeba castellanii str. Neff
ref|XP_002794235.1|  40S ribosomal protein S9                           248   4e-80    
gb|KIX95793.1|  40S ribosomal protein S9                                248   4e-80    Fonsecaea multimorphosa CBS 102226
ref|XP_008711137.1|  40S ribosomal protein S9                           248   5e-80    Cyphellophora europaea CBS 101466
dbj|GAM87141.1|  hypothetical protein ANO11243_051620                   247   5e-80    fungal sp. No.11243
gb|ERS98231.1|  40S ribosomal protein S9                                247   5e-80    Sporothrix schenckii ATCC 58251
ref|XP_007593688.1|  40S ribosomal protein S9                           247   6e-80    Colletotrichum fioriniae PJ7
ref|XP_003660223.1|  hypothetical protein MYCTH_2298252                 247   7e-80    Myceliophthora thermophila ATCC 42464
gb|EPQ66464.1|  Protein component of the small (40S) ribosomal su...    247   8e-80    Blumeria graminis f. sp. tritici 96224
ref|XP_002367195.1|  40S ribosomal protein S9, putative                 247   8e-80    Toxoplasma gondii ME49
gb|EXX79184.1|  ribosomal 40S subunit protein S9A                       247   8e-80    Rhizophagus irregularis DAOM 197198w
gb|ESA03224.1|  hypothetical protein GLOINDRAFT_243564                  246   8e-80    Rhizophagus irregularis DAOM 181602
gb|EGD95527.1|  ribosomal protein S9                                    247   8e-80    Trichophyton tonsurans CBS 112818
ref|XP_003847713.1|  40S ribosomal protein S9                           247   9e-80    Zymoseptoria tritici IPO323
ref|XP_003237660.1|  40S ribosomal protein S9                           247   9e-80    Trichophyton rubrum CBS 118892
sp|P52810.1|RS9_PODAS  RecName: Full=40S ribosomal protein S9; Al...    246   1e-79    Podospora anserina
ref|XP_662407.1|  RS9_PODAN 40S ribosomal protein S9 (S7)               246   1e-79    Aspergillus nidulans FGSC A4
ref|XP_003720755.1|  40S ribosomal protein S9                           246   1e-79    Magnaporthe oryzae 70-15
ref|XP_003886044.1|  hypothetical protein NCLIV_064440                  246   1e-79    Neospora caninum Liverpool
ref|XP_005534862.1|  40S ribosomal protein S9                           246   1e-79    Cyanidioschyzon merolae strain 10D
gb|KIW78598.1|  40S ribosomal protein S9                                246   2e-79    Fonsecaea pedrosoi CBS 271.37
ref|XP_005852611.1|  small subunit ribosomal protein S9e                246   2e-79    Nannochloropsis gaditana CCMP526
gb|AGV54486.1|  40S ribosomal protein S9-2-like protein                 246   2e-79    Phaseolus vulgaris [French bean]
gb|EEH07566.1|  40S ribosomal protein S9                                246   2e-79    Histoplasma capsulatum G186AR
ref|XP_002629546.1|  40S ribosomal protein S9                           246   2e-79    Blastomyces gilchristii SLH14081
gb|ELR03231.1|  40S ribosomal protein S9                                246   2e-79    Pseudogymnoascus destructans 20631-21
ref|XP_003172904.1|  40S ribosomal protein S9                           246   2e-79    Microsporum gypseum CBS 118893
ref|XP_002842953.1|  40S ribosomal protein S9                           246   2e-79    Arthroderma otae CBS 113480
gb|KEZ42817.1|  hypothetical protein SAPIO_CDS5234                      246   2e-79    Scedosporium apiospermum
ref|XP_001537827.1|  40S ribosomal protein S9                           245   2e-79    Histoplasma capsulatum NAm1
ref|XP_001222689.1|  40S ribosomal protein S9                           246   2e-79    Chaetomium globosum CBS 148.51
gb|EXX62810.1|  ribosomal 40S subunit protein S9A                       246   2e-79    Rhizophagus irregularis DAOM 197198w
ref|XP_011122298.1|  hypothetical protein AOL_s00079g121                246   3e-79    Arthrobotrys oligospora ATCC 24927
gb|EJK71823.1|  hypothetical protein THAOC_06697                        245   3e-79    Thalassiosira oceanica
ref|XP_001824638.1|  40S ribosomal protein S9                           245   3e-79    Aspergillus oryzae RIB40
ref|XP_964233.1|  40S ribosomal protein S9                              245   4e-79    Neurospora crassa OR74A
ref|XP_003007794.1|  40S ribosomal protein S9                           245   4e-79    Verticillium alfalfae VaMs.102
ref|XP_002289706.1|  RS9, ribosomal protein 9                           245   5e-79    Thalassiosira pseudonana CCMP1335
ref|XP_001903023.1|  hypothetical protein                               246   6e-79    Podospora anserina S mat+
ref|XP_002110068.1|  S9 ribosomal protein                               244   7e-79    Trichoplax adhaerens
ref|XP_009220754.1|  40S ribosomal protein S9                           244   8e-79    
emb|CDH55798.1|  40s ribosomal protein s9                               244   9e-79    
emb|CDJ32982.1|  40S ribosomal protein S9, putative                     244   1e-78    
emb|CDI78299.1|  40S ribosomal protein S9, putative                     244   1e-78    
ref|XP_003347095.1|  40S ribosomal protein S9                           244   1e-78    
ref|XP_003651341.1|  40S ribosomal protein S9                           245   1e-78    
ref|XP_001400515.1|  40S ribosomal protein S9                           244   1e-78    
ref|XP_001263755.1|  40S ribosomal protein S9                           244   1e-78    
ref|XP_001217311.1|  40S ribosomal protein S9                           244   1e-78    
ref|XP_008623589.1|  40S ribosomal protein                              244   1e-78    
gb|ETB62408.1|  40S ribosomal protein S9                                244   1e-78    
ref|XP_002175454.1|  40S ribosomal protein S9                           244   1e-78    
ref|XP_002171823.1|  40S ribosomal protein S9                           243   1e-78    
ref|XP_009531030.1|  hypothetical protein PHYSODRAFT_354997             244   1e-78    
ref|XP_006964217.1|  ribosomal protein S9, S4 family                    244   1e-78    
emb|CCF75909.1|  unnamed protein product                                243   2e-78    
gb|EWM23131.1|  40s ribosomal protein s9                                246   2e-78    
emb|CDS04034.1|  Putative 40S ribosomal protein S9                      243   2e-78    
gb|EER45719.1|  40S ribosomal protein S9                                243   2e-78    
gb|AET50489.1|  hypothetical protein                                    243   2e-78    
ref|XP_009022737.1|  hypothetical protein HELRODRAFT_155894             243   2e-78    
emb|CDS49582.1|  40S ribosomal protein S9, putative                     243   2e-78    
gb|AGH70193.1|  40S ribosomal protein S9                                243   2e-78    
dbj|BAJ85708.1|  predicted protein                                      243   2e-78    
gb|EHK22520.1|  hypothetical protein TRIVIDRAFT_216043                  243   2e-78    
ref|XP_001270715.1|  40S ribosomal protein S9                           243   2e-78    
ref|XP_001613757.1|  40S ribosomal protein S9                           243   3e-78    
gb|KDQ62955.1|  hypothetical protein JAAARDRAFT_28926                   243   3e-78    
ref|XP_007874274.1|  30S ribosomal protein S4                           243   3e-78    
gb|KFH47053.1|  40S ribosomal protein S9-like protein                   243   3e-78    
ref|XP_003026421.1|  40S ribosomal protein S9                           243   3e-78    
ref|XP_002841454.1|  40S ribosomal protein S9                           243   3e-78    
ref|XP_003052792.1|  40S ribosomal protein S9                           243   4e-78    
emb|CDM31877.1|  40S ribosomal protein S9                               243   4e-78    
ref|XP_001609790.1|  40S ribosomal subunit protein S9                   242   4e-78    
gb|EHK42959.1|  hypothetical protein TRIATDRAFT_258286                  243   4e-78    
gb|ACO15505.1|  40S ribosomal protein S9                                242   4e-78    
ref|XP_009259609.1|  hypothetical protein FPSE_08216                    242   4e-78    
ref|XP_004222815.1|  40S ribosomal protein S9                           242   4e-78    
ref|XP_008815169.1|  40S ribosomal protein                              242   5e-78    
gb|ACO10247.1|  40S ribosomal protein S9                                242   5e-78    
ref|XP_006671722.1|  40S ribosomal protein S9 (S7)                      242   5e-78    
emb|CDO63078.1|  40S ribosomal protein S9, putative                     242   5e-78    
ref|XP_001351758.1|  40S ribosomal protein S9, putative                 242   5e-78    
ref|XP_007860645.1|  ribosomal protein S4                               242   5e-78    
gb|KGO75304.1|  Ribosomal protein S4/S9                                 242   5e-78    
dbj|BAN20249.1|  ribosomal protein S9                                   242   6e-78    
ref|XP_002903192.1|  40S ribosomal protein S9-1                         242   6e-78    
ref|XP_730059.1|  ribosomal protein S4                                  243   6e-78    
emb|CDJ50108.1|  40S ribosomal protein S9, putative                     242   7e-78    
gb|EGU79448.1|  hypothetical protein FOXB_10033                         242   8e-78    
ref|XP_002259613.1|  40S ribosomal subunit protein S9                   241   8e-78    
ref|XP_009540632.1|  hypothetical protein HETIRDRAFT_456594             241   9e-78    
gb|EQL04090.1|  Ribosomal protein S4/S9                                 241   1e-77    
gb|ABW90415.1|  putative ribosomal protein S9                           241   1e-77    
ref|XP_001873539.1|  40S ribosomal protein S9                           241   1e-77    
ref|XP_001829481.1|  40S ribosomal protein S9                           241   1e-77    
ref|XP_008601048.1|  40S ribosomal protein S9                           241   1e-77    
gb|KIL71469.1|  hypothetical protein M378DRAFT_155038                   241   1e-77    
ref|XP_001873538.1|  40S ribosomal protein S9                           241   1e-77    
gb|KIM47402.1|  hypothetical protein M413DRAFT_199385                   241   1e-77    
gb|KIM82299.1|  hypothetical protein PILCRDRAFT_475098                  241   1e-77    
gb|ACO12686.1|  40S ribosomal protein S9                                241   1e-77    
ref|WP_039781875.1|  hypothetical protein                               239   1e-77    
gb|EKV18981.1|  40S ribosomal protein S9                                241   2e-77    
tpe|CAL69096.1|  TPA: putative 40S ribosomal protein S9                 241   2e-77    
ref|XP_008544905.1|  PREDICTED: 40S ribosomal protein S9                241   2e-77    
gb|KDQ15631.1|  hypothetical protein BOTBODRAFT_31523                   241   2e-77    
emb|CAH04322.1|  S9e ribosomal protein                                  241   2e-77    
ref|XP_011180539.1|  PREDICTED: 40S ribosomal protein S9                241   2e-77    
ref|XP_001894478.1|  40S ribosomal protein S9                           241   2e-77    
gb|ABG01900.1|  S9 ribosomal protein                                    240   2e-77    
ref|XP_007510860.1|  40S ribosomal protein S9                           243   2e-77    
ref|XP_003147914.1|  40S ribosomal protein S9                           241   2e-77    
ref|XP_004518997.1|  PREDICTED: 40S ribosomal protein S9-like           241   2e-77    
gb|KIJ95270.1|  hypothetical protein K443DRAFT_332076                   241   2e-77    
emb|CCQ18585.1|  40S ribosomal protein S9                               240   3e-77    
ref|XP_008080957.1|  Alpha-L RNA-binding motif                          241   3e-77    
ref|XP_007391198.1|  hypothetical protein PHACADRAFT_248675             240   3e-77    
ref|XP_007307288.1|  40S ribosomal protein S9                           240   3e-77    
ref|XP_011497696.1|  PREDICTED: 40S ribosomal protein S9                240   3e-77    
ref|XP_007811695.1|  40S ribosomal protein S9                           240   4e-77    
ref|XP_008032443.1|  40S ribosomal protein S9                           240   4e-77    
ref|XP_002562828.1|  Pc20g02740                                         240   4e-77    
gb|KJA19242.1|  hypothetical protein HYPSUDRAFT_204799                  240   4e-77    
gb|KFG83429.1|  40S ribosomal protein S9 (S7)                           240   4e-77    
dbj|BAD26701.1|  ribosomal protein S9                                   240   4e-77    
gb|KIM31691.1|  hypothetical protein M408DRAFT_236801                   240   5e-77    
gb|KFH63847.1|  40S ribosomal protein S9                                239   5e-77    
gb|KII94201.1|  hypothetical protein PLICRDRAFT_695235                  239   5e-77    
gb|AAR09821.1|  similar to Drosophila melanogaster RpS9                 239   6e-77    
ref|XP_008486802.1|  PREDICTED: 40S ribosomal protein S9                239   6e-77    
emb|CCG81315.1|  40S ribosomal protein S9                               239   6e-77    
ref|XP_002047289.1|  GJ13353                                            239   6e-77    
ref|NP_524004.2|  ribosomal protein S9, isoform A                       239   6e-77    
gb|EIE83578.1|  40S ribosomal protein S9                                239   6e-77    
ref|XP_001956309.1|  GF24655                                            239   6e-77    
ref|XP_003325266.1|  40S ribosomal protein S9                           239   6e-77    
gb|ADO95157.1|  ribosomal protein S9                                    239   7e-77    
ref|XP_008876439.1|  ribosomal protein S4                               239   7e-77    
gb|ADT80642.1|  ribosomal protein S9                                    239   7e-77    
ref|NP_001037265.1|  ribosomal protein S9                               239   7e-77    
emb|CDO74409.1|  hypothetical protein BN946_scf184867.g7                239   7e-77    
gb|AAX62465.1|  ribosomal protein S9                                    239   8e-77    
ref|XP_001984182.1|  GH15146                                            239   8e-77    
gb|KIP02503.1|  hypothetical protein PHLGIDRAFT_20458                   239   8e-77    
gb|KIK68304.1|  hypothetical protein GYMLUDRAFT_35690                   239   8e-77    
gb|ACO11706.1|  40S ribosomal protein S9                                239   8e-77    
gb|EIE83453.1|  40S ribosomal protein S9                                239   9e-77    
ref|XP_001352621.1|  GA28351                                            239   9e-77    
dbj|BAM17690.1|  ribosomal protein S9                                   239   9e-77    
emb|CEG69035.1|  Putative 40S ribosomal protein S9                      239   9e-77    
ref|XP_007853601.1|  40s ribosomal protein s9                           239   1e-76    
gb|EHJ71338.1|  ribosomal protein S9                                    239   1e-76    
gb|KDQ31494.1|  hypothetical protein PLEOSDRAFT_1054562                 239   1e-76    
gb|ABG01896.1|  S9 ribosomal protein                                    239   1e-76    
gb|KIO25495.1|  hypothetical protein M407DRAFT_91820                    239   1e-76    
ref|XP_007265130.1|  40S ribosomal protein S9                           239   1e-76    
dbj|BAM19012.1|  ribosomal protein S9                                   239   1e-76    
gb|KIY51995.1|  ribosomal protein S4                                    239   1e-76    
emb|CCA67900.1|  probable 40S ribosomal protein S9                      239   1e-76    
emb|CCI48676.1|  unnamed protein product                                239   1e-76    
gb|ACY71248.1|  ribosomal protein S9                                    239   1e-76    
gb|ABX26127.1|  ribosomal protein S9                                    238   1e-76    
ref|XP_003400837.1|  PREDICTED: 40S ribosomal protein S9-like           238   2e-76    
gb|EKC97706.1|  40S ribosomal protein S9-A                              238   2e-76    
gb|EMD42348.1|  40S ribosomal protein S9                                238   2e-76    
emb|CEJ91392.1|  Putative 40S ribosomal protein S9 (S7)                 238   2e-76    
emb|CEI90627.1|  Putative 40S ribosomal protein S9                      238   2e-76    
ref|XP_002471051.1|  ribosomal protein S9                               238   2e-76    
gb|AAT76788.1|  40S ribosomal protein S9                                238   2e-76    
gb|KIJ53746.1|  hypothetical protein M422DRAFT_58531                    238   2e-76    
ref|XP_001945527.1|  PREDICTED: 40S ribosomal protein S9                238   2e-76    
ref|XP_004363804.1|  30S ribosomal protein S4                           238   2e-76    
ref|XP_004341959.2|  40S ribosomal protein S9                           238   2e-76    
ref|XP_004830832.1|  40S ribosomal protein S9, putative                 238   2e-76    
gb|ACY95323.1|  ribosomal protein S9                                    238   2e-76    
ref|XP_007379209.1|  40S ribosomal protein S9                           238   3e-76    
gb|AAX48885.1|  S9                                                      238   3e-76    
ref|XP_002007973.1|  GI12083                                            238   3e-76    
ref|XP_005181976.1|  PREDICTED: 40S ribosomal protein S9                238   3e-76    
emb|CAJ17220.1|  ribosomal protein S9e                                  238   3e-76    
gb|KDE04206.1|  40S ribosomal protein S9-A                              238   3e-76    
ref|XP_009846369.1|  ribosomal protein S4                               238   4e-76    
gb|EUC58677.1|  40S ribosomal protein S9                                238   4e-76    
emb|CCO33607.1|  40S ribosomal protein S9-A                             238   4e-76    
ref|XP_002179777.1|  predicted protein                                  236   4e-76    
gb|ACF17617.1|  S-9                                                     236   5e-76    
ref|XP_967635.1|  PREDICTED: 40S ribosomal protein S9                   237   5e-76    
dbj|GAD92307.1|  40S ribosomal protein S9                               238   5e-76    
gb|KDR16262.1|  40S ribosomal protein S9                                237   5e-76    
ref|XP_007360763.1|  40S ribosomal protein S9                           237   5e-76    
gb|ABE68882.1|  40S ribosomal protein S9                                238   5e-76    
gb|ABM55670.1|  putative ribosomal protein S9                           237   5e-76    
ref|XP_007256932.1|  PREDICTED: 40S ribosomal protein S9-like           237   5e-76    
gb|KJE98318.1|  40S ribosomal protein S9                                238   5e-76    
emb|CEP13692.1|  hypothetical protein                                   237   6e-76    
dbj|GAN01898.1|  40S ribosomal protein S9                               237   6e-76    
dbj|GAN07351.1|  40S ribosomal protein S9                               237   6e-76    
gb|EPB81471.1|  40S ribosomal protein S9                                237   6e-76    
gb|EPS99409.1|  hypothetical protein FOMPIDRAFT_1024265                 237   6e-76    
gb|KEY65850.1|  hypothetical protein S7711_05856                        237   6e-76    
gb|AAY66962.1|  40S ribosomal protein S9                                237   7e-76    
ref|XP_007763855.1|  40S ribosomal protein S9                           237   7e-76    
ref|XP_001608270.1|  PREDICTED: 40S ribosomal protein S9                237   7e-76    
gb|ADK11698.1|  ribosomal protein S9                                    236   8e-76    
gb|ACD65142.1|  putative 40S ribosomal protein RPS9                     237   8e-76    
gb|ABE68880.1|  40S ribosomal protein S9                                236   8e-76    
emb|CCA22601.1|  40S ribosomal protein S91 putative                     237   8e-76    
ref|XP_007877369.1|  hypothetical protein PFL1_01668                    238   8e-76    
gb|ADB77802.1|  40S ribosomal protein S9                                236   9e-76    
gb|KFH67080.1|  small subunit ribosomal protein S9e                     240   9e-76    
ref|XP_009265857.1|  40S ribosomal protein S9-B                         236   9e-76    
ref|NP_595840.1|  40S ribosomal protein S9                              236   1e-75    
ref|XP_011066131.1|  PREDICTED: 40S ribosomal protein S9                236   1e-75    
gb|ADO28208.1|  40S ribosomal protein s9                                236   1e-75    
ref|NP_001187074.1|  40S ribosomal protein S9                           236   1e-75    
gb|KDN39854.1|  40S ribosomal protein S9                                236   1e-75    
ref|XP_008618158.1|  30S ribosomal protein S4                           236   1e-75    
dbj|BAA82319.1|  ribosomal protein S9 homolog                           236   1e-75    
ref|XP_006015023.1|  PREDICTED: 40S ribosomal protein S9-like           236   1e-75    
ref|XP_635999.1|  ribosomal protein 1024                                236   1e-75    
gb|EJU02852.1|  40S ribosomal protein S9                                236   1e-75    
ref|XP_009098805.1|  PREDICTED: 40S ribosomal protein S9                235   1e-75    
ref|XP_002603611.1|  hypothetical protein BRAFLDRAFT_126921             236   1e-75    
ref|XP_005367975.1|  PREDICTED: 40S ribosomal protein S9-like           236   1e-75    
ref|XP_011144040.1|  PREDICTED: 40S ribosomal protein S9                236   1e-75    
ref|XP_005090825.1|  PREDICTED: 40S ribosomal protein S9-like iso...    236   1e-75    
ref|XP_006897356.1|  PREDICTED: 40S ribosomal protein S9                236   1e-75    
gb|AHB33642.1|  40S ribosomal protein S9                                236   1e-75    
gb|ABZ04261.1|  ribosomal protein rps9                                  236   2e-75    
ref|XP_005534243.1|  PREDICTED: 40S ribosomal protein S9-like           236   2e-75    
ref|XP_005433872.1|  PREDICTED: 40S ribosomal protein S9-like           236   2e-75    
gb|KDR85862.1|  hypothetical protein GALMADRAFT_132501                  236   2e-75    
ref|XP_007324335.1|  hypothetical protein SERLADRAFT_480346             236   2e-75    
emb|CCM02260.1|  predicted protein                                      236   2e-75    
gb|EPY49628.1|  40S ribosomal protein S9                                236   2e-75    
gb|KIO07111.1|  hypothetical protein M404DRAFT_998525                   236   2e-75    
gb|KFA66102.1|  hypothetical protein S40285_04299                       236   2e-75    
ref|XP_002416200.1|  40S ribosomal protein S9, putative                 235   2e-75    
ref|NP_001232711.1|  putative 40S ribosomal protein S9                  236   2e-75    
ref|XP_007538773.1|  PREDICTED: 40S ribosomal protein S9                236   2e-75    
ref|NP_001004.2|  40S ribosomal protein S9                              235   2e-75    
ref|XP_002119507.1|  PREDICTED: 40S ribosomal protein S9                235   2e-75    
ref|NP_592945.1|  40S ribosomal protein S9                              235   2e-75    
emb|CDQ94630.1|  unnamed protein product                                235   3e-75    
gb|AAX29348.1|  ribosomal protein S9                                    235   3e-75    
ref|XP_003387673.1|  PREDICTED: 40S ribosomal protein S9-like           235   3e-75    
ref|XP_003977663.1|  PREDICTED: 40S ribosomal protein S9-like           235   3e-75    
gb|AFK33393.1|  unknown                                                 235   3e-75    
ref|XP_002430661.1|  40S ribosomal protein S9, putative                 235   3e-75    
gb|AGM32374.1|  putative S9e ribosomal protein                          235   3e-75    
gb|AEA39492.1|  ribosomal protein S9                                    235   4e-75    
emb|CAA47013.1|  ribosomal protein S9                                   235   4e-75    
gb|KIY62147.1|  ribosomal protein S4                                    235   4e-75    
gb|ACH85276.1|  ribosomal protein S9                                    235   4e-75    
gb|EMP40612.1|  40S ribosomal protein S9                                236   4e-75    
ref|XP_001747599.1|  hypothetical protein                               235   4e-75    
dbj|GAA97183.1|  hypothetical protein E5Q_03859                         235   4e-75    
gb|KIM62296.1|  hypothetical protein SCLCIDRAFT_1215157                 235   5e-75    
ref|XP_011445733.1|  PREDICTED: 40S ribosomal protein S9                234   5e-75    



>ref|XP_011075483.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
 ref|XP_011075484.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
Length=197

 Score =   332 bits (852),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 166/166 (100%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_004135180.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004141548.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004172155.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_004173021.1| PREDICTED: 40S ribosomal protein S9-2-like [Cucumis sativus]
 ref|XP_008446334.1| PREDICTED: 40S ribosomal protein S9-2 [Cucumis melo]
 ref|XP_008459594.1| PREDICTED: 40S ribosomal protein S9-2 [Cucumis melo]
 gb|KGN51904.1| hypothetical protein Csa_5G604980 [Cucumis sativus]
 gb|KGN52667.1| hypothetical protein Csa_5G649850 [Cucumis sativus]
Length=197

 Score =   329 bits (844),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 166/166 (100%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQKHIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_011085760.1| PREDICTED: 40S ribosomal protein S9-2-like [Sesamum indicum]
Length=196

 Score =   328 bits (842),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_002517490.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF45032.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=196

 Score =   328 bits (841),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_010037164.1| PREDICTED: 40S ribosomal protein S9-2-like [Eucalyptus grandis]
 gb|KCW48831.1| hypothetical protein EUGRSUZ_K02467 [Eucalyptus grandis]
Length=197

 Score =   328 bits (841),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_011098613.1| PREDICTED: 40S ribosomal protein S9-2 [Sesamum indicum]
Length=196

 Score =   328 bits (841),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIR+GRQVVNVPSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRIGRQVVNVPSFMVRVDSQKHIDFSLTSPF  166



>ref|NP_001275235.1| uncharacterized protein LOC102577830 [Solanum tuberosum]
 ref|XP_006367429.1| PREDICTED: 40S ribosomal protein S9-2-like [Solanum tuberosum]
 gb|ABA46767.1| unknown [Solanum tuberosum]
Length=197

 Score =   328 bits (840),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPF  166



>ref|XP_010029297.1| PREDICTED: 40S ribosomal protein S9-2 [Eucalyptus grandis]
 gb|KCW56190.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=197

 Score =   328 bits (840),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>gb|EYU34659.1| hypothetical protein MIMGU_mgv1a014209mg [Erythranthe guttata]
Length=197

 Score =   327 bits (839),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVCFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDP+RIFEG+ALLRRMN+Y LLDESQNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKDPKRIFEGEALLRRMNKYALLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_010091216.1| 40S ribosomal protein S9-2 [Morus notabilis]
 gb|EXB43471.1| 40S ribosomal protein S9-2 [Morus notabilis]
Length=199

 Score =   327 bits (839),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 166/166 (100%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRHGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQKHIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>emb|CDP02222.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   327 bits (838),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNVPSFLVRVDSQKHIDFS++SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFLVRVDSQKHIDFSITSPF  166



>gb|KDP31233.1| hypothetical protein JCGZ_11609 [Jatropha curcas]
Length=197

 Score =   327 bits (837),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>gb|KDP41175.1| hypothetical protein JCGZ_15582 [Jatropha curcas]
Length=197

 Score =   326 bits (836),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_004238784.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
Length=197

 Score =   326 bits (835),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPF  166



>ref|XP_004228395.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
 ref|XP_004228398.1| PREDICTED: 40S ribosomal protein S9-2-like [Solanum lycopersicum]
 ref|XP_010319448.1| PREDICTED: 40S ribosomal protein S9-2 [Solanum lycopersicum]
 gb|AAU93594.1| 40S ribosomal protein S9 , putative [Solanum demissum]
Length=197

 Score =   326 bits (835),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPF  166



>gb|EYU22431.1| hypothetical protein MIMGU_mgv1a014214mg [Erythranthe guttata]
Length=197

 Score =   326 bits (835),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVCVYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDP+RIFEG+ALLRRMNRYGLLDESQ+KLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKDPKRIFEGEALLRRMNRYGLLDESQSKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQKHIRVGRQVVNVPSF+VR+DSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNVPSFMVRMDSQKHIDFSLTSPF  166



>gb|KCW56189.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=176

 Score =   325 bits (832),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_010256989.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
 ref|XP_010269850.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
Length=197

 Score =   325 bits (834),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPL  166



>ref|XP_009604777.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
Length=197

 Score =   325 bits (833),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_009627396.1| PREDICTED: 40S ribosomal protein S9-2 [Nicotiana tomentosiformis]
Length=197

 Score =   325 bits (832),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+AL+RRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKDPRRIFEGEALMRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLTSPF  166



>ref|XP_002511557.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF52159.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=197

 Score =   325 bits (832),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VR+DSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRIDSQKHIDFSLTSPF  166



>ref|XP_009598709.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
Length=197

 Score =   324 bits (831),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPF  166



>gb|EYU28732.1| hypothetical protein MIMGU_mgv1a014218mg [Erythranthe guttata]
Length=197

 Score =   324 bits (831),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVCFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+AL+RRMN+Y LLDESQNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKDPRRIFEGEALMRRMNKYALLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_009798560.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   324 bits (831),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_010029477.1| PREDICTED: 40S ribosomal protein S9-2 [Eucalyptus grandis]
 gb|KCW83573.1| hypothetical protein EUGRSUZ_B00467 [Eucalyptus grandis]
Length=197

 Score =   324 bits (830),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+ SF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIASFMVRVDSQKHIDFSLTSPF  166



>ref|NP_001274868.1| 40S ribosomal protein S9-2-like [Solanum tuberosum]
 gb|AFW90596.1| putative 40S ribosomal protein S9 [Solanum tuberosum]
Length=197

 Score =   323 bits (829),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKD RRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKDSRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPF  166



>ref|XP_002522398.1| 40S ribosomal protein S9, putative [Ricinus communis]
 gb|EEF39890.1| 40S ribosomal protein S9, putative [Ricinus communis]
Length=196

 Score =   323 bits (829),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNQRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_009778292.1| PREDICTED: 40S ribosomal protein S9-2 [Nicotiana sylvestris]
Length=197

 Score =   323 bits (829),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+AL+RRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKDPRRIFEGEALMRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLTSPF  166



>ref|XP_002283256.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 ref|XP_002275166.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 emb|CBI22191.3| unnamed protein product [Vitis vinifera]
 emb|CBI15244.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   323 bits (828),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSFLVR+DSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFLVRMDSQKHIDFSLTSPL  166



>ref|XP_011004198.1| PREDICTED: 40S ribosomal protein S9-2 isoform X1 [Populus euphratica]
 ref|XP_011004199.1| PREDICTED: 40S ribosomal protein S9-2 isoform X1 [Populus euphratica]
 ref|XP_011004200.1| PREDICTED: 40S ribosomal protein S9-2 isoform X2 [Populus euphratica]
Length=197

 Score =   323 bits (827),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_009779308.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   323 bits (827),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLTSPF  166



>emb|CDP00311.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   322 bits (826),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARN  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRR+FEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKDPRRVFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_009600364.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana tomentosiformis]
 ref|XP_009782105.1| PREDICTED: 40S ribosomal protein S9-2-like [Nicotiana sylvestris]
Length=197

 Score =   322 bits (826),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDESQNKLDYVL+LTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLSLTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VR+DSQKHIDFSL SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRLDSQKHIDFSLISPF  166



>ref|XP_010242426.1| PREDICTED: 40S ribosomal protein S9-2 [Nelumbo nucifera]
Length=197

 Score =   322 bits (826),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQKHIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPL  166



>gb|ABQ32300.1| putative 40S ribosomal protein S9 [Artemisia annua]
Length=197

 Score =   322 bits (825),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVPFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTL+EKDPRRIFEG+AL+RRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLEEKDPRRIFEGEALMRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_006367430.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X1 [Solanum 
tuberosum]
Length=197

 Score =   322 bits (825),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK PR IFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKAPRPIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPF  166



>ref|XP_002323418.1| hypothetical protein POPTR_0016s07730g [Populus trichocarpa]
 ref|XP_002322813.2| 40S ribosomal protein S9 [Populus trichocarpa]
 gb|ABK93151.1| unknown [Populus trichocarpa]
 gb|ABK96412.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF05179.1| hypothetical protein POPTR_0016s07730g [Populus trichocarpa]
 gb|EEF04574.2| 40S ribosomal protein S9 [Populus trichocarpa]
Length=197

 Score =   321 bits (823),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKNSRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+QKHIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIKQKHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>gb|EPS73776.1| hypothetical protein M569_00980 [Genlisea aurea]
Length=197

 Score =   321 bits (822),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNART  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+H+RVGRQVVNVPSF+VR+DSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHVRVGRQVVNVPSFMVRLDSQKHIDFSLTSPL  166



>ref|XP_007037295.1| Ribosomal protein S4 [Theobroma cacao]
 gb|EOY21796.1| Ribosomal protein S4 [Theobroma cacao]
Length=197

 Score =   320 bits (821),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+H+RVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHVRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_006367431.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X2 [Solanum 
tuberosum]
Length=197

 Score =   320 bits (820),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK PR IFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKAPRPIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNV SF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFSLTSPF  166



>ref|XP_011004201.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X1 [Populus 
euphratica]
 ref|XP_011004202.1| PREDICTED: 40S ribosomal protein S9-2-like isoform X2 [Populus 
euphratica]
Length=197

 Score =   320 bits (819),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKNSRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_011004703.1| PREDICTED: 40S ribosomal protein S9-2-like [Populus euphratica]
Length=197

 Score =   320 bits (819),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKNSRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>gb|KJB74899.1| hypothetical protein B456_012G055000 [Gossypium raimondii]
Length=197

 Score =   320 bits (819),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>gb|KJB70960.1| hypothetical protein B456_011G097500 [Gossypium raimondii]
Length=197

 Score =   320 bits (819),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>gb|KJB33600.1| hypothetical protein B456_006G020700 [Gossypium raimondii]
Length=197

 Score =   320 bits (819),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>gb|KHG16530.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
 gb|KJB39897.1| hypothetical protein B456_007G036500 [Gossypium raimondii]
Length=197

 Score =   320 bits (819),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>gb|KJB11057.1| hypothetical protein B456_001G238700 [Gossypium raimondii]
 gb|KJB11058.1| hypothetical protein B456_001G238700 [Gossypium raimondii]
Length=197

 Score =   320 bits (819),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_002324730.1| hypothetical protein POPTR_0018s07520g [Populus trichocarpa]
 ref|XP_006381972.1| hypothetical protein POPTR_0006s22630g [Populus trichocarpa]
 gb|ABK93418.1| unknown [Populus trichocarpa]
 gb|ABK95800.1| unknown [Populus trichocarpa]
 gb|ABK96647.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF03295.1| hypothetical protein POPTR_0018s07520g [Populus trichocarpa]
 gb|ERP59769.1| hypothetical protein POPTR_0006s22630g [Populus trichocarpa]
Length=197

 Score =   319 bits (818),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+ RRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKNQRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_007032505.1| Ribosomal protein S4 [Theobroma cacao]
 gb|EOY03431.1| Ribosomal protein S4 [Theobroma cacao]
Length=197

 Score =   319 bits (817),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRHGLLDESQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>emb|CAG47084.1| 40S ribosomal protein S9 [Catharanthus roseus]
Length=197

 Score =   319 bits (817),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARN  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG+ALLRRMNRYGLLDE QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKDPRRIFEGEALLRRMNRYGLLDEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQKHIDFS++SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFSITSPF  166



>gb|AFK46709.1| unknown [Lotus japonicus]
Length=197

 Score =   319 bits (817),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPL  166



>ref|XP_004499428.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
Length=197

 Score =   318 bits (816),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPL  166



>ref|XP_007138197.1| hypothetical protein PHAVU_009G188600g [Phaseolus vulgaris]
 gb|ESW10191.1| hypothetical protein PHAVU_009G188600g [Phaseolus vulgaris]
Length=197

 Score =   318 bits (816),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVGRQVVN+PSFLVRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFLVRVDSQKHIDFSLTSPL  166



>gb|ABK21901.1| unknown [Picea sitchensis]
 gb|ACN40156.1| unknown [Picea sitchensis]
Length=197

 Score =   318 bits (815),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYTLSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQ+KLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPL  166



>ref|XP_007155321.1| hypothetical protein PHAVU_003G191200g [Phaseolus vulgaris]
 gb|ESW27315.1| hypothetical protein PHAVU_003G191200g [Phaseolus vulgaris]
Length=197

 Score =   318 bits (814),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPL  166



>ref|XP_003549666.1| PREDICTED: 40S ribosomal protein S9-2-like [Glycine max]
 gb|KHN18541.1| 40S ribosomal protein S9-2 [Glycine soja]
 gb|KHN48678.1| 40S ribosomal protein S9-2 [Glycine soja]
Length=197

 Score =   318 bits (814),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPL  166



>ref|XP_004508755.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
 ref|XP_004508756.1| PREDICTED: 40S ribosomal protein S9-2-like [Cicer arietinum]
Length=197

 Score =   318 bits (814),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPL  166



>ref|XP_003577383.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   317 bits (813),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDS+KHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNIPSFMVRVDSEKHIDFSLTSPF  166



>ref|XP_010917021.1| PREDICTED: 40S ribosomal protein S9-2 [Elaeis guineensis]
Length=197

 Score =   317 bits (813),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYSLSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDENQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSFLVRVDS KHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFLVRVDSAKHIDFSLTSPF  166



>ref|XP_003598026.1| 40S ribosomal protein S9 [Medicago truncatula]
 ref|XP_003598028.1| 40S ribosomal protein S9 [Medicago truncatula]
 ref|XP_003604908.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|ACJ85917.1| unknown [Medicago truncatula]
 gb|AES68277.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AES68279.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AES87105.1| 40S ribosomal S9-like protein [Medicago truncatula]
 gb|AFK39708.1| unknown [Medicago truncatula]
 gb|AFK43821.1| unknown [Medicago truncatula]
Length=197

 Score =   317 bits (813),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>gb|AFK40975.1| unknown [Medicago truncatula]
Length=197

 Score =   317 bits (812),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_002276284.1| PREDICTED: 40S ribosomal protein S9-2 [Vitis vinifera]
 emb|CBI31983.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   317 bits (812),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMN+YGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNKYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRV+SQKHIDF+ +SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVESQKHIDFANTSPL  166



>ref|NP_001276185.1| 40S ribosomal protein S9-2-like [Glycine max]
 ref|XP_003523030.1| PREDICTED: 40S ribosomal protein S9-2-like [Glycine max]
 ref|XP_007137996.1| hypothetical protein PHAVU_009G172300g [Phaseolus vulgaris]
 gb|ACU20562.1| unknown [Glycine max]
 gb|ESW09990.1| hypothetical protein PHAVU_009G172300g [Phaseolus vulgaris]
Length=197

 Score =   317 bits (812),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVGRQVVN+PSFLVRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFLVRVDSQKHIDFSLTSPL  166



>ref|XP_008780681.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
 ref|XP_008780688.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
 ref|XP_008780693.1| PREDICTED: 40S ribosomal protein S9-2 [Phoenix dactylifera]
Length=197

 Score =   317 bits (811),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQ+ALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQFALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDEMQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS KHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPF  166



>ref|XP_007215987.1| hypothetical protein PRUPE_ppa011733mg [Prunus persica]
 ref|XP_008230756.1| PREDICTED: 40S ribosomal protein S9-2 [Prunus mume]
 gb|EMJ17186.1| hypothetical protein PRUPE_ppa011733mg [Prunus persica]
Length=198

 Score =   316 bits (810),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK PRRIFEG+ALLRRMNRYGLL+E+QNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLEETQNKLDYVLALTVENFLERRLQTLVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFS++SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSITSPL  166



>ref|XP_009389620.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009411686.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   316 bits (810),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS KHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPF  166



>gb|ACU15321.1| unknown [Glycine max]
Length=222

 Score =   317 bits (812),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKT KKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTLKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPL  166



>ref|XP_009414866.1| PREDICTED: 40S ribosomal protein S9-2 [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   316 bits (809),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS KHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPF  166



>ref|XP_009403622.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   316 bits (809),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS KHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFSLTSPF  166



>ref|XP_007209623.1| hypothetical protein PRUPE_ppa011764mg [Prunus persica]
 ref|XP_008239810.1| PREDICTED: 40S ribosomal protein S9-2-like [Prunus mume]
 gb|EMJ10822.1| hypothetical protein PRUPE_ppa011764mg [Prunus persica]
Length=197

 Score =   316 bits (809),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQT+VF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTIVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+ SFLVR DS+KHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNISSFLVRCDSEKHIDFSLTSPL  166



>ref|XP_006380606.1| hypothetical protein POPTR_0007s09750g [Populus trichocarpa]
 gb|ERP58403.1| hypothetical protein POPTR_0007s09750g [Populus trichocarpa]
Length=197

 Score =   316 bits (809),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E+QNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEENQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+H RVGRQVVN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIKQRHTRVGRQVVNIPSFMVRVDSQKHIDFSLTSPL  166



>ref|XP_002317362.1| hypothetical protein POPTR_0011s09670g [Populus trichocarpa]
 gb|ABK93285.1| unknown [Populus trichocarpa]
 gb|EEE97974.1| hypothetical protein POPTR_0011s09670g [Populus trichocarpa]
Length=197

 Score =   316 bits (809),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN ARM
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E+QNKLDYVLALTVE+FLERRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEENQNKLDYVLALTVESFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVGRQ VN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIKQRHIRVGRQAVNIPSFMVRVDSQKHIDFSLTSPL  166



>ref|NP_001278530.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACG32995.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACG34689.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACL52933.1| unknown [Zea mays]
 tpg|DAA55418.1| TPA: 40S ribosomal protein S9 isoform 1 [Zea mays]
 tpg|DAA55419.1| TPA: 40S ribosomal protein S9 isoform 2 [Zea mays]
Length=194

 Score =   315 bits (808),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVGRQ+VNVPSF+VRV+S+KHIDFSLSSPF
Sbjct  121  AKSIHHARVLIKQRHIRVGRQIVNVPSFMVRVESEKHIDFSLSSPF  166



>ref|XP_006282728.1| hypothetical protein CARUB_v10005777mg [Capsella rubella]
 gb|EOA15626.1| hypothetical protein CARUB_v10005777mg [Capsella rubella]
Length=198

 Score =   315 bits (808),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIR+GRQ+VN+PSF+VRV+SQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRIGRQLVNIPSFMVRVESQKHIDFSLTSPF  166



>ref|XP_010435836.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
 ref|XP_010441098.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
 ref|XP_010450759.1| PREDICTED: 40S ribosomal protein S9-2 [Camelina sativa]
Length=197

 Score =   315 bits (808),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQKH+DFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHVDFSLTSPF  166



>ref|XP_006663032.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   315 bits (808),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPF  166



>ref|XP_003576178.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   315 bits (808),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VNVPSF+VRV+S+KHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNVPSFMVRVESEKHIDFSLTSPF  166



>ref|XP_010554004.1| PREDICTED: 40S ribosomal protein S9-2 [Tarenaya hassleriana]
Length=197

 Score =   315 bits (808),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV+V+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMN+YGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNKYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+VDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVDSQKHIDFSLTSPF  166



>ref|NP_001049004.1| Os03g0154700 [Oryza sativa Japonica Group]
 ref|NP_001068233.1| Os11g0602600 [Oryza sativa Japonica Group]
 gb|ABA94599.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA94601.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF94048.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG22548.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10918.1| Os03g0154700 [Oryza sativa Japonica Group]
 dbj|BAF28596.1| Os11g0602600 [Oryza sativa Japonica Group]
 gb|EAY81477.1| hypothetical protein OsI_36650 [Oryza sativa Indica Group]
 gb|EAZ18880.1| hypothetical protein OsJ_34422 [Oryza sativa Japonica Group]
 gb|ABR25448.1| 40S ribosomal protein S9 [Oryza sativa Indica Group]
 dbj|BAG96424.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87870.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93092.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96556.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96871.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96935.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68442.1| hypothetical protein OsI_36651 [Oryza sativa Indica Group]
 gb|EEE52362.1| hypothetical protein OsJ_34424 [Oryza sativa Japonica Group]
 gb|EEE58343.1| hypothetical protein OsJ_09456 [Oryza sativa Japonica Group]
Length=195

 Score =   315 bits (806),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPF  166



>ref|NP_001238740.1| uncharacterized protein LOC100305663 [Glycine max]
 gb|ACU13464.1| unknown [Glycine max]
Length=197

 Score =   315 bits (806),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNY KTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYEKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPL  166



>gb|ABR17162.1| unknown [Picea sitchensis]
 gb|ACN39805.1| unknown [Picea sitchensis]
 gb|ACN39957.1| unknown [Picea sitchensis]
 gb|ACN40724.1| unknown [Picea sitchensis]
 gb|ADE77363.1| unknown [Picea sitchensis]
Length=197

 Score =   314 bits (804),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN ARM
Sbjct  1    MVHVVFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYTLSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDETQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPL  166



>gb|ACG33443.1| 40S ribosomal protein S9 [Zea mays]
Length=194

 Score =   313 bits (803),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+P RIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPHRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVGRQ+VNVPSF+VRV+S+KHIDFSLSSPF
Sbjct  121  AKSIHHARVLIKQRHIRVGRQIVNVPSFMVRVESEKHIDFSLSSPF  166



>ref|XP_002870751.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47010.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
Length=197

 Score =   313 bits (803),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQKH+DFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHVDFSLTSPF  166



>ref|XP_009383889.1| PREDICTED: 40S ribosomal protein S9-2-like [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   313 bits (803),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+ SF+VRVDS KHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIASFMVRVDSAKHIDFSLTSPF  166



>ref|XP_004299381.1| PREDICTED: 40S ribosomal protein S9-2-like [Fragaria vesca subsp. 
vesca]
Length=198

 Score =   313 bits (802),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM
Sbjct  1    MVHVVFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+E QNKLDYVLALTVENFLERRLQT+VF+ G+
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEEGQNKLDYVLALTVENFLERRLQTVVFKKGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VR DS+KHIDF+++SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRCDSEKHIDFAITSPL  166



>ref|XP_002442158.1| hypothetical protein SORBIDRAFT_08g015270 [Sorghum bicolor]
 gb|EES15996.1| hypothetical protein SORBIDRAFT_08g015270 [Sorghum bicolor]
Length=195

 Score =   313 bits (802),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVGRQ+VNVPSF+VRV+S+KHIDFSLSSPF
Sbjct  121  AKSIHHARVLIKQRHIRVGRQIVNVPSFMVRVESEKHIDFSLSSPF  166



>ref|XP_004962962.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=195

 Score =   313 bits (802),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVGRQ+VNVPSF+VRV+S+KHIDFSLSSPF
Sbjct  121  AKSIHHARVLIKQRHIRVGRQIVNVPSFMVRVESEKHIDFSLSSPF  166



>gb|KFK33188.1| hypothetical protein AALP_AA6G341500 [Arabis alpina]
Length=197

 Score =   313 bits (802),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALT+ENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTIENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHIDFSLTSPF  166



>ref|XP_006405589.1| hypothetical protein EUTSA_v10027944mg [Eutrema salsugineum]
 gb|ESQ47042.1| hypothetical protein EUTSA_v10027944mg [Eutrema salsugineum]
Length=198

 Score =   313 bits (801),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNR GLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRSGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+VDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVDSQKHIDFSLTSPF  166



>ref|NP_198801.1| 40S ribosomal protein S9-2 [Arabidopsis thaliana]
 sp|Q9FLF0.1|RS92_ARATH RecName: Full=40S ribosomal protein S9-2 [Arabidopsis thaliana]
 dbj|BAB10209.1| 40S ribosomal protein S9 [Arabidopsis thaliana]
 gb|AAM65655.1| 40S ribosomal protein S9-like [Arabidopsis thaliana]
 gb|ABD94071.1| At5g39850 [Arabidopsis thaliana]
 gb|AED94483.1| 40S ribosomal protein S9-2 [Arabidopsis thaliana]
Length=197

 Score =   313 bits (801),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV+V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDETQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+SQKH+DFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESQKHVDFSLTSPF  166



>ref|NP_001131442.1| uncharacterized protein LOC100192774 [Zea mays]
 gb|ACG30355.1| 40S ribosomal protein S9 [Zea mays]
 gb|AFW87984.1| 40S ribosomal protein S9 [Zea mays]
Length=193

 Score =   312 bits (800),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS+KHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSEKHIDFSLTSPL  166



>gb|EMS50632.1| 40S ribosomal protein S9-2 [Triticum urartu]
 gb|EMT06699.1| 40S ribosomal protein S9-2 [Aegilops tauschii]
Length=195

 Score =   312 bits (800),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG ALLRRMNRYGLL E Q+KLDYVLALT ENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGAALLRRMNRYGLLAEGQDKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VNVPSF+VRV+S+KHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNVPSFMVRVESEKHIDFSLTSPF  166



>ref|XP_003623232.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|AES79450.1| 40S ribosomal S9-like protein [Medicago truncatula]
Length=197

 Score =   312 bits (800),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLV EYGLRCKRELWRVQYALSRIRNN+R 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVREYGLRCKRELWRVQYALSRIRNNSRT  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_006664031.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   311 bits (798),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VNVPSF+VR++S+KHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQIVNVPSFMVRLESEKHIDFSLTSPF  166



>ref|XP_010551858.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   311 bits (798),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV+VN+YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVNYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+P+RIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRFGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQKHIDF+L+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDSQKHIDFALTSPF  166



>ref|XP_006438663.1| hypothetical protein CICLE_v10032800mg [Citrus clementina]
 ref|XP_006483187.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 ref|XP_006483188.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 gb|ESR51903.1| hypothetical protein CICLE_v10032800mg [Citrus clementina]
Length=197

 Score =   311 bits (798),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM+RYG L+ESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMHRYGFLEESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDSQKHI+FSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFVVRVDSQKHIEFSLTSPF  166



>ref|XP_010550058.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   311 bits (797),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV+V++YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQKHIDF+L+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDSQKHIDFALTSPF  166



>ref|XP_010545191.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   311 bits (797),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV+V++YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQKHIDF+L+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDSQKHIDFALTSPF  166



>ref|NP_001149705.1| 40S ribosomal protein S9 [Zea mays]
 gb|ACG36447.1| 40S ribosomal protein S9 [Zea mays]
 gb|AFR11274.1| ribosomal protein S9 [Zea mays]
 tpg|DAA41536.1| TPA: 40S ribosomal protein S9 [Zea mays]
Length=193

 Score =   311 bits (796),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESEKHIDFSLTSPL  166



>ref|XP_010937076.1| PREDICTED: 40S ribosomal protein S9-2-like [Elaeis guineensis]
Length=197

 Score =   311 bits (796),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDE+QNKLDYVLALTVENFLERRLQT VF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDENQNKLDYVLALTVENFLERRLQTQVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDS KHIDF+L+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSAKHIDFALNSPF  166



>ref|XP_003637511.1| 40S ribosomal protein S9 [Medicago truncatula]
 gb|KEH42383.1| 40S ribosomal S9-like protein [Medicago truncatula]
Length=224

 Score =   312 bits (799),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  28   MVKVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARN  87

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLERRLQTL F++GM
Sbjct  88   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLERRLQTLAFKSGM  147

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  148  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  193



>ref|XP_004304310.1| PREDICTED: 40S ribosomal protein S9-2 [Fragaria vesca subsp. 
vesca]
Length=197

 Score =   310 bits (795),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVVFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL+ESQNKLDYVLALTVENFLERRLQT VF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLEESQNKLDYVLALTVENFLERRLQTQVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VR+DS+KHIDF+++SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRIDSEKHIDFAITSPL  166



>ref|XP_003557815.1| PREDICTED: 40S ribosomal protein S9-2 [Brachypodium distachyon]
Length=195

 Score =   310 bits (795),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VF+ GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLAEDQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVD++KHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDTEKHIDFSLTSPL  166



>ref|XP_004984207.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=194

 Score =   310 bits (793),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS+KH+DFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSEKHVDFSLTSPL  166



>ref|XP_010524330.1| PREDICTED: 40S ribosomal protein S9-2-like [Tarenaya hassleriana]
Length=197

 Score =   310 bits (793),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV+V++YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVNVSYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+P+RIFEG+ALLRRMNR+GLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRFGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQKHIDF+L+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDSQKHIDFALTSPF  166



>ref|XP_008341561.1| PREDICTED: 40S ribosomal protein S9-2 [Malus domestica]
Length=197

 Score =   310 bits (793),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVVHYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYSLSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKXGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPL  166



>ref|XP_002463229.1| hypothetical protein SORBIDRAFT_02g040120 [Sorghum bicolor]
 gb|EER99750.1| hypothetical protein SORBIDRAFT_02g040120 [Sorghum bicolor]
Length=194

 Score =   309 bits (792),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESEKHIDFSLTSPL  166



>ref|XP_002463225.1| hypothetical protein SORBIDRAFT_02g040080 [Sorghum bicolor]
 gb|EER99746.1| hypothetical protein SORBIDRAFT_02g040080 [Sorghum bicolor]
Length=194

 Score =   309 bits (792),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESEKHIDFSLTSPL  166



>ref|XP_004958404.1| PREDICTED: 40S ribosomal protein S9-2-like [Setaria italica]
Length=194

 Score =   309 bits (792),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVESEKHIDFSLTSPL  166



>ref|XP_010939529.1| PREDICTED: 40S ribosomal protein S9-2-like [Elaeis guineensis]
Length=197

 Score =   309 bits (792),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNR+GLLDE+QNKLDYVLALTVENFLERRLQT VF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRFGLLDENQNKLDYVLALTVENFLERRLQTQVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS KHIDF+L+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSAKHIDFALNSPF  166



>ref|XP_008379343.1| PREDICTED: 40S ribosomal protein S9-2 [Malus domestica]
Length=197

 Score =   309 bits (792),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV  YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVVHYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYSLSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSQKHIDFSLTSPL  166



>ref|XP_006650139.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=195

 Score =   309 bits (792),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VR+DS+KHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRLDSEKHIDFSLTSPL  166



>ref|XP_010683223.1| PREDICTED: 40S ribosomal protein S9-2 [Beta vulgaris subsp. vulgaris]
Length=197

 Score =   308 bits (790),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV +YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNAARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMN++GLLDE QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNKHGLLDEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNVPSF+VRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFMVRVDSQKHIDFSLTSPF  166



>ref|XP_010695717.1| PREDICTED: 40S ribosomal protein S9-2-like [Beta vulgaris subsp. 
vulgaris]
Length=197

 Score =   308 bits (789),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR 
Sbjct  1    MVHVCFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNAARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM+R+GLLDE QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMHRHGLLDEGQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSLSSPF
Sbjct  121  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLSSPF  166



>ref|XP_003562635.1| PREDICTED: 40S ribosomal protein S9-2-like [Brachypodium distachyon]
Length=195

 Score =   308 bits (788),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VF+ GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLAEDQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRV ++KHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVATEKHIDFSLTSPL  166



>ref|XP_010092050.1| 40S ribosomal protein S9-2 [Morus notabilis]
 gb|EXB49964.1| 40S ribosomal protein S9-2 [Morus notabilis]
Length=271

 Score =   310 bits (795),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/156 (95%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = +3

Query  45   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  224
            GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK+PR
Sbjct  85   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKNPR  144

Query  225  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHARVL  404
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GMAKSIHHARVL
Sbjct  145  RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGMAKSIHHARVL  204

Query  405  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            IRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  205  IRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  240



>ref|XP_006657990.1| PREDICTED: 40S ribosomal protein S9-2-like [Oryza brachyantha]
Length=194

 Score =   307 bits (787),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHAR+LIRQ+HIRVGRQ+VN+PSF+VR++S+KHIDFSL+SP 
Sbjct  121  AKSIHHARILIRQRHIRVGRQLVNIPSFMVRLESEKHIDFSLTSPL  166



>ref|XP_009124855.1| PREDICTED: 40S ribosomal protein S9-2 [Brassica rapa]
Length=197

 Score =   306 bits (785),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIF+G+ALLRRMN+ GLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKNPRRIFQGEALLRRMNKNGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+V+SQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVESQKHIDFSLTSPF  166



>emb|CDX74423.1| BnaA04g09660D [Brassica napus]
Length=198

 Score =   306 bits (785),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  1    MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIF+G+ALLRRMN+ GLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKNPRRIFQGEALLRRMNKNGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+V+SQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVESQKHIDFSLTSPF  166



>ref|XP_001754369.1| predicted protein [Physcomitrella patens]
 ref|XP_001761244.1| predicted protein [Physcomitrella patens]
 gb|EDQ73966.1| predicted protein [Physcomitrella patens]
 gb|EDQ80819.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   305 bits (781),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDENQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VRVDSQKH+DF+LSSP 
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRVDSQKHVDFALSSPL  166



>ref|XP_001767226.1| predicted protein [Physcomitrella patens]
 gb|EDQ67907.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   305 bits (781),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDENQSKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VRVDSQKH+DF+LSSP 
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRVDSQKHVDFALSSPL  166



>dbj|BAJ90873.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99877.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=195

 Score =   305 bits (781),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK PRRIFEG ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VF+ GM
Sbjct  61   LLTLDEKSPRRIFEGAALLRRMNRYGLLSEDQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVD++KH+DFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDTEKHVDFSLTSPL  166



>gb|AAT08735.1| 40S ribosomal protein S9 [Hyacinthus orientalis]
Length=197

 Score =   305 bits (780),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQY LSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELWRVQYVLSRIRNAARQ  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDE+DPRR+FEG+ALLRRM++YGLLDE QNKLDYVLALTVENFLERRLQT VF+ GM
Sbjct  61   LLTLDERDPRRVFEGEALLRRMHKYGLLDEEQNKLDYVLALTVENFLERRLQTQVFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVNVPSFLV+++S KHIDF+LSSPF
Sbjct  121  AKSIHHARVLIRQRHIRVGRQVVNVPSFLVKLESGKHIDFALSSPF  166



>ref|XP_002985335.1| hypothetical protein SELMODRAFT_157263 [Selaginella moellendorffii]
 ref|XP_002987182.1| hypothetical protein SELMODRAFT_235178 [Selaginella moellendorffii]
 gb|EFJ11758.1| hypothetical protein SELMODRAFT_235178 [Selaginella moellendorffii]
 gb|EFJ13465.1| hypothetical protein SELMODRAFT_157263 [Selaginella moellendorffii]
Length=198

 Score =   305 bits (780),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV+V+FYRNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWR+QY LSRIRN AR 
Sbjct  1    MVNVSFYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRLQYVLSRIRNAARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEGDALLRRM+RYGLL+E QNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGDALLRRMHRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVL+RQ+HIRVG+Q+VNVPSFLVRV+SQKHIDF+L+SPF
Sbjct  121  AKSIHHARVLVRQRHIRVGKQMVNVPSFLVRVESQKHIDFALTSPF  166



>ref|XP_001777561.1| predicted protein [Physcomitrella patens]
 gb|EDQ57604.1| predicted protein [Physcomitrella patens]
Length=197

 Score =   304 bits (779),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDE+Q+KLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDENQSKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VRVDSQKH+DF+LSSP 
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRVDSQKHVDFALSSPL  166



>ref|XP_010420178.1| PREDICTED: 40S ribosomal protein S9-1 [Camelina sativa]
Length=198

 Score =   304 bits (779),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPF
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPF  166



>ref|XP_006400037.1| hypothetical protein EUTSA_v10014722mg [Eutrema salsugineum]
 gb|ESQ41490.1| hypothetical protein EUTSA_v10014722mg [Eutrema salsugineum]
Length=198

 Score =   304 bits (779),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPF
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPF  166



>ref|XP_006288701.1| hypothetical protein CARUB_v10002009mg [Capsella rubella]
 ref|XP_010453649.1| PREDICTED: 40S ribosomal protein S9-1-like [Camelina sativa]
 ref|XP_010492346.1| PREDICTED: 40S ribosomal protein S9-1-like [Camelina sativa]
 gb|EOA21599.1| hypothetical protein CARUB_v10002009mg [Capsella rubella]
Length=197

 Score =   304 bits (778),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQYALSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPF
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPF  166



>ref|XP_001754496.1| predicted protein [Physcomitrella patens]
 gb|EDQ80466.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   304 bits (778),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQYALSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYALSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDESQ KLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDESQCKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VR+DSQKH+DF+LSSP 
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRLDSQKHVDFALSSPL  166



>gb|ABA94602.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
Length=192

 Score =   303 bits (777),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 159/166 (96%), Gaps = 3/166 (2%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HI   RQ+VN+PSF+VRV+S+KHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHI---RQIVNIPSFMVRVESEKHIDFSLTSPF  163



>ref|NP_197024.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
 sp|Q9LXG1.1|RS91_ARATH RecName: Full=40S ribosomal protein S9-1 [Arabidopsis thaliana]
 emb|CAB89330.1| 40S ribosomal protein-like [Arabidopsis thaliana]
 gb|AAR24214.1| At5g15200 [Arabidopsis thaliana]
 gb|AAR92351.1| At5g15200 [Arabidopsis thaliana]
 dbj|BAF00367.1| 40S ribosomal protein - like [Arabidopsis thaliana]
 gb|AED92128.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
Length=198

 Score =   303 bits (777),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPF
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPF  166



>ref|XP_002873713.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49972.1| 40S ribosomal protein S9 [Arabidopsis lyrata subsp. lyrata]
Length=198

 Score =   303 bits (775),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKSPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPF
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPF  166



>ref|XP_002960852.1| hypothetical protein SELMODRAFT_74302 [Selaginella moellendorffii]
 ref|XP_002967162.1| hypothetical protein SELMODRAFT_144850 [Selaginella moellendorffii]
 gb|EFJ31761.1| hypothetical protein SELMODRAFT_144850 [Selaginella moellendorffii]
 gb|EFJ38391.1| hypothetical protein SELMODRAFT_74302 [Selaginella moellendorffii]
Length=198

 Score =   301 bits (772),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV  YRNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQY LSRIRN +R 
Sbjct  1    MVHVCVYRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNASRH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM+RYGLL+E QNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMHRYGLLEEGQNKLDYVLALTVENFLERRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVL+RQ+HIRVG+Q+VNVPSFLVRV+SQKHIDF+L+SPF
Sbjct  121  AKSIHHARVLVRQRHIRVGKQMVNVPSFLVRVESQKHIDFALTSPF  166



>gb|EMS59613.1| 40S ribosomal protein S9-2 [Triticum urartu]
 gb|EMT26225.1| 40S ribosomal protein S9-2 [Aegilops tauschii]
Length=195

 Score =   301 bits (770),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KREL+RVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRAKRELYRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG ALLRRMNRYGLL E QNKLDYVLALTV+NFL+RRLQT+VF+ GM
Sbjct  61   LLTLDEKNPRRIFEGAALLRRMNRYGLLTEEQNKLDYVLALTVDNFLQRRLQTIVFKNGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVD++KH+DFSL+SP 
Sbjct  121  AKSIHHARVLIRQRHIRVGKQLVNIPSFMVRVDTEKHVDFSLTSPL  166



>gb|EAY83173.1| hypothetical protein OsI_38384 [Oryza sativa Indica Group]
Length=173

 Score =   300 bits (767),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M+HV+FYRNYGKTFKK RRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MMHVSFYRNYGKTFKKQRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+P RIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPCRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHA  LIRQ+HIRVGRQ+VNVPSF+VR++S+KHIDFSL+SPF
Sbjct  121  AKSIHHACFLIRQRHIRVGRQIVNVPSFMVRLESEKHIDFSLTSPF  166



>ref|XP_009131450.1| PREDICTED: 40S ribosomal protein S9-1 [Brassica rapa]
 ref|XP_009121599.1| PREDICTED: 40S ribosomal protein S9-1 [Brassica rapa]
 emb|CDX91003.1| BnaC02g05940D [Brassica napus]
 emb|CDX85559.1| BnaA02g02540D [Brassica napus]
 emb|CDX85058.1| BnaC05g19970D [Brassica napus]
 emb|CDX78618.1| BnaA03g05300D [Brassica napus]
 emb|CDX70599.1| BnaC03g06830D [Brassica napus]
 emb|CDX69542.1| BnaA10g18910D [Brassica napus]
Length=197

 Score =   300 bits (769),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV +YRNYGKTFK PRRP+EKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPFEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+P+RIFEG+ALLR+MNRYGLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRKMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SPF
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIDFALTSPF  166



>ref|XP_001762390.1| predicted protein [Physcomitrella patens]
 gb|EDQ72857.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   300 bits (768),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV  +RNYGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQY LSRIRNNARM
Sbjct  1    MVHVASFRNYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQYVLSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+ RRIFEG+ALLRRMNRYGLLDESQ KLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNTRRIFEGEALLRRMNRYGLLDESQCKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVG+Q+V+VPSF+VR++SQKH+DF+LSSP 
Sbjct  121  AKSIHHARVLIKQRHIRVGKQIVDVPSFMVRLESQKHVDFALSSPL  166



>gb|KHG14244.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=191

 Score =   299 bits (766),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +3

Query  45   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  224
            GKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PR
Sbjct  5    GKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARDLLTLDEKNPR  64

Query  225  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHARVL  404
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GMAKSIHHARVL
Sbjct  65   RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVL  124

Query  405  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            IRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  125  IRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  160



>ref|XP_006827176.1| hypothetical protein AMTR_s00010p00256040 [Amborella trichopoda]
 gb|ERM94413.1| hypothetical protein AMTR_s00010p00256040 [Amborella trichopoda]
Length=227

 Score =   300 bits (769),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = +3

Query  30   FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLD  209
            F   +GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR LLTLD
Sbjct  36   FIEVHGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARELLTLD  95

Query  210  EKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIH  389
            EK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GMAKSIH
Sbjct  96   EKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGMAKSIH  155

Query  390  HARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            HARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SP 
Sbjct  156  HARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPL  196



>gb|KFK25765.1| hypothetical protein AALP_AA8G156800 [Arabis alpina]
Length=197

 Score =   299 bits (766),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+P+RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHH+RVLIRQ+HIRVG+Q+VN+PSF+VR++SQKHIDF+L+SP 
Sbjct  121  AKSIHHSRVLIRQRHIRVGKQLVNIPSFMVRLESQKHIDFALTSPL  166



>gb|KHG14681.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=189

 Score =   299 bits (765),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +3

Query  45   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  224
            GKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PR
Sbjct  3    GKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARDLLTLDEKNPR  62

Query  225  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHARVL  404
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GMAKSIHHARVL
Sbjct  63   RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVL  122

Query  405  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            IRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  123  IRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  158



>gb|EEC74543.1| hypothetical protein OsI_10067 [Oryza sativa Indica Group]
Length=292

 Score =   299 bits (765),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +3

Query  42   YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDP  221
            YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR LLTLDEK+P
Sbjct  107  YGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARHLLTLDEKNP  166

Query  222  RRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHARV  401
            RRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVF+AGMAKSIHHARV
Sbjct  167  RRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGMAKSIHHARV  226

Query  402  LIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            LIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SPF
Sbjct  227  LIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPF  263



>ref|XP_001702303.1| ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDO97033.1| ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
Length=190

 Score =   293 bits (751),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M  + FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR+
Sbjct  1    MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARV  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDP+RIFEG+AL+RRMNRYGLL+ESQ+KLDYVLALT ++FLERRLQTLVF+ G+
Sbjct  61   LLTLDEKDPKRIFEGNALMRRMNRYGLLNESQDKLDYVLALTPQDFLERRLQTLVFKQGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQKHIDF+L+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFALTSPF  166



>gb|ADB77797.1| 40S ribosomal protein S9 [Chlamydomonas reinhardtii]
Length=178

 Score =   293 bits (750),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M  + FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR+
Sbjct  1    MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARV  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDP+RIFEG+AL+RRMNRYGLL+ESQ+KLDYVLALT ++FLERRLQTLVF+ G+
Sbjct  61   LLTLDEKDPKRIFEGNALMRRMNRYGLLNESQDKLDYVLALTPQDFLERRLQTLVFKQGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQKHIDF+L+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFALTSPF  166



>ref|XP_006431128.1| hypothetical protein CICLE_v10013599mg [Citrus clementina]
 ref|XP_006482573.1| PREDICTED: 40S ribosomal protein S9-2-like [Citrus sinensis]
 gb|ESR44368.1| hypothetical protein CICLE_v10013599mg [Citrus clementina]
 gb|KDO72548.1| hypothetical protein CISIN_1g046291mg [Citrus sinensis]
Length=197

 Score =   293 bits (751),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVG +GLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGSFGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDPRRIFEG ALLRRM RYGLL+ +QNKLDYVLALTVE+FLERRLQT+VF+AG+
Sbjct  61   LLTLDEKDPRRIFEGQALLRRMFRYGLLEATQNKLDYVLALTVESFLERRLQTVVFKAGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+QKHIRVGRQ+VN+PSFLVRVD+Q H+  SL+S  
Sbjct  121  AKSIHHARVLIKQKHIRVGRQIVNIPSFLVRVDAQNHVGVSLTSSL  166



>gb|KHG06711.1| 40S ribosomal S9-2 -like protein [Gossypium arboreum]
Length=250

 Score =   295 bits (755),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +3

Query  45   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  224
              TFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PR
Sbjct  64   ATTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARDLLTLDEKNPR  123

Query  225  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHARVL  404
            RIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF+ GMAKSIHHARVL
Sbjct  124  RIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVL  183

Query  405  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            IRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  184  IRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  219



>gb|KDP41176.1| hypothetical protein JCGZ_15583 [Jatropha curcas]
Length=201

 Score =   293 bits (750),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 154/164 (94%), Gaps = 2/164 (1%)
 Frame = +3

Query  21   HVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLL  200
            H++F  +    F   RRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN ARMLL
Sbjct  9    HIDF--SLTSPFGGGRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARMLL  66

Query  201  TLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAK  380
            TLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GMAK
Sbjct  67   TLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGMAK  126

Query  381  SIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            SIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  127  SIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  170



>ref|XP_009126038.1| PREDICTED: 40S ribosomal protein S9-1-like [Brassica rapa]
Length=197

 Score =   292 bits (748),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV +YRNYGKTFK PRRP+EKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPFEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+P+RIFEG+ALLR+MNRYGLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKNPKRIFEGEALLRKMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIH +RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHI F+L SPF
Sbjct  121  AKSIHPSRVLIRQRHIRVGKQLVNIPSFMVRLDSQKHIGFALISPF  166



>ref|XP_002958222.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ40676.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=190

 Score =   291 bits (746),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M  + FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLR KRELWRVQ  LS+IRN AR+
Sbjct  1    MPKIGFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRNAARV  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTL+EKDP+RIFEG+AL+RRMNRYGLL ESQ+KLDYVLALT ++FLERRLQTLVF+ G+
Sbjct  61   LLTLEEKDPKRIFEGNALMRRMNRYGLLSESQDKLDYVLALTPQDFLERRLQTLVFKQGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVG+QVVNVPSF+VRVDSQKHIDF+L+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNVPSFMVRVDSQKHIDFALTSPF  166



>gb|KHN30826.1| 40S ribosomal protein S9-2 [Glycine soja]
Length=188

 Score =   291 bits (744),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 154/166 (93%), Gaps = 9/166 (5%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGE         WRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGE---------WRVQYALSRIRNNARN  51

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM RYGLLDE+QNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  52   LLTLDEKNPRRIFEGEALLRRMFRYGLLDETQNKLDYVLALTVENFLERRLQTLVFKSGM  111

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVGRQVVN+PSFLVRVDSQKHIDFSL+SP 
Sbjct  112  AKSIHHARVLIKQRHIRVGRQVVNIPSFLVRVDSQKHIDFSLTSPL  157



>pdb|3J60|J Chain J, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=195

 Score =   291 bits (744),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 153/161 (95%), Gaps = 2/161 (1%)
 Frame = +3

Query  36   RNYGKTF--KKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLD  209
            R Y KT+  KKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR LLTLD
Sbjct  6    RTYSKTYSTKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARHLLTLD  65

Query  210  EKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIH  389
            EK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVF+AGMAKSIH
Sbjct  66   EKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGMAKSIH  125

Query  390  HARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            HARVLIRQ+HIRVGRQ+VN+PSF+VRV+S+KHIDFSL+SPF
Sbjct  126  HARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPF  166



>emb|CDY30273.1| BnaC04g31840D [Brassica napus]
Length=965

 Score =   308 bits (788),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MV V FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN AR 
Sbjct  769  MVQVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE  828

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIF+G+ALLRRMN+ GLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  829  LLTLDEKNPRRIFQGEALLRRMNKNGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  888

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+V+V+SQKHIDFSL+SPF
Sbjct  889  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVKVESQKHIDFSLTSPF  934



>gb|KIZ06357.1| 40S ribosomal protein S9-2 [Monoraphidium neglectum]
Length=191

 Score =   279 bits (714),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M  + FYR+YGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQ  LS+IR  AR+
Sbjct  1    MPKIGFYRSYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRKAARV  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTL++KDP+RIFEG+AL+RRM +YGLL+E+Q+KLDYVLAL+ ++FLERRLQTLVF+ G+
Sbjct  61   LLTLEDKDPKRIFEGNALMRRMYKYGLLNETQDKLDYVLALSPQDFLERRLQTLVFKQGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVG+QVVN+PSFLVRVDSQKHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQVVNIPSFLVRVDSQKHIDFSLTSPF  166



>ref|XP_005648482.1| ribosomal protein S9 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE23938.1| ribosomal protein S9 component of cytosolic 80S ribosome and 
40S small subunit [Coccomyxa subellipsoidea C-169]
Length=180

 Score =   278 bits (711),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M H+++YRNYGKTFKKPRRP+EKERLD+ELKLVGE+GLR KRELWRVQ ALS+IR  AR 
Sbjct  1    MPHISYYRNYGKTFKKPRRPFEKERLDSELKLVGEFGLRNKRELWRVQMALSKIRQAART  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLD+K+ +R+FEG+ALLRRM +YGLL+E+QNKLDYVLALT ++FLERRLQTLVF+ G+
Sbjct  61   LLTLDDKETKRLFEGEALLRRMYKYGLLEEAQNKLDYVLALTPQDFLERRLQTLVFKLGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSF+VRVDSQKHIDF+L+SPF
Sbjct  121  AKSMHHARVLIRQRHIRVGKQIVNVPSFMVRVDSQKHIDFALNSPF  166



>emb|CEF99084.1| Ribosomal protein S4/S9, eukaryotic/archaeal [Ostreococcus tauri]
Length=192

 Score =   278 bits (711),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M    FYRNYGKTFKKPRRP+EK+RLDAELK+VGE+GLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSSTFYRNYGKTFKKPRRPFEKDRLDAELKIVGEFGLRNKRELWRVQFALNKLRNAARV  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDP+RIFEG+A++RRM  YGLLDE+Q+KLDYVLALT E FLERRLQTLVF+ G+
Sbjct  61   LLTLDEKDPKRIFEGEAIIRRMRAYGLLDETQDKLDYVLALTPETFLERRLQTLVFKLGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSFLVR DSQKHIDF+L+SP 
Sbjct  121  AKSVHHARVLIRQRHIRVGKQIVNVPSFLVRTDSQKHIDFALNSPL  166



>ref|XP_005849917.1| hypothetical protein CHLNCDRAFT_56085 [Chlorella variabilis]
 gb|EFN57815.1| hypothetical protein CHLNCDRAFT_56085 [Chlorella variabilis]
Length=192

 Score =   277 bits (709),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M  + FYRNYGKTFKKPRRP+EKERLDAELK+VGE+GLR KRELWRVQ  LS++R  AR 
Sbjct  1    MPSIGFYRNYGKTFKKPRRPFEKERLDAELKVVGEFGLRNKRELWRVQMVLSKLRARARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDP+R+FEG+ALLRRM RYG LDESQNKLDYVLALT  + LERRLQTLVF+ G+
Sbjct  61   LLTLDEKDPKRLFEGEALLRRMYRYGFLDESQNKLDYVLALTPADVLERRLQTLVFKLGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VRVDSQKHIDF+L+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNIPSFMVRVDSQKHIDFALNSPF  166



>ref|XP_001419792.1| Ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO98085.1| Ribosomal protein S9, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=194

 Score =   276 bits (705),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M    +YRNYGKTFKKPRRP+EKERLDAELK+VGE+GLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSSTYYRNYGKTFKKPRRPFEKERLDAELKIVGEFGLRNKRELWRVQFALNKLRNAARV  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDP+RIFEG+A++RRM  YGLLDE+Q+KLDYVLAL  E FLERRLQTLVF+ G+
Sbjct  61   LLTLDEKDPKRIFEGEAIMRRMRNYGLLDETQDKLDYVLALGPEQFLERRLQTLVFKLGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSFLVR DSQKHIDF+L+SP 
Sbjct  121  AKSVHHARVLIRQRHIRVGKQIVNVPSFLVRTDSQKHIDFALNSPL  166



>ref|XP_002500609.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61867.1| predicted protein [Micromonas sp. RCC299]
Length=194

 Score =   275 bits (704),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M    FYR+Y KTFKKPRRP+EKERLD+ELK+VGEYGLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSTTFYRSYSKTFKKPRRPFEKERLDSELKIVGEYGLRNKRELWRVQFALNKLRNAARV  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDP+RIFEG+A++RRM RYGLLDESQ+KLDYVLALT E FLERRLQT+VF+ G+
Sbjct  61   LLTLDEKDPKRIFEGEAIMRRMYRYGLLDESQDKLDYVLALTPEIFLERRLQTIVFKLGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKS+HHARVLI+Q+HIRVG+Q+VN+PSFLVR DSQKHID+SL+SP 
Sbjct  121  AKSVHHARVLIKQRHIRVGKQIVNIPSFLVRADSQKHIDYSLNSPL  166



>gb|KCW87774.1| hypothetical protein EUGRSUZ_A00153 [Eucalyptus grandis]
Length=140

 Score =   273 bits (698),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVG  431
            AKSIHHARVLIRQ+HIRVG
Sbjct  121  AKSIHHARVLIRQRHIRVG  139



>ref|XP_002467783.1| hypothetical protein SORBIDRAFT_01g033980 [Sorghum bicolor]
 gb|EER94781.1| hypothetical protein SORBIDRAFT_01g033980 [Sorghum bicolor]
Length=177

 Score =   273 bits (699),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 146/166 (88%), Gaps = 16/166 (10%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+                NKLDYVLALTVENFL+RRLQT+VF+ GM
Sbjct  61   LLTLDEKNPRRIFEGE----------------NKLDYVLALTVENFLQRRLQTIVFKNGM  104

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDS+KHIDFSL+SP 
Sbjct  105  AKSIHHARVLIRQRHIRVGRQLVNIPSFMVRVDSEKHIDFSLTSPL  150



>ref|XP_003056784.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58429.1| predicted protein [Micromonas pusilla CCMP1545]
Length=196

 Score =   272 bits (695),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M    FYR+Y KTFKKPRRP+EKERLD ELK VGE+GLR KRELWRVQ+AL+++RN AR+
Sbjct  1    MPSSTFYRSYSKTFKKPRRPFEKERLDNELKTVGEFGLRNKRELWRVQFALNKLRNAARV  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEKDP+RIFEG+A++RRM RYGLLDE+Q+KLDYVLAL+ + FLERRLQTLVF+ G+
Sbjct  61   LLTLDEKDPKRIFEGEAIMRRMYRYGLLDETQDKLDYVLALSADAFLERRLQTLVFKLGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKS+HHARVLIRQ+HIRVG+Q+VNVPSFLVR DSQKHIDF+L+SP 
Sbjct  121  AKSVHHARVLIRQRHIRVGKQIVNVPSFLVRTDSQKHIDFALNSPL  166



>gb|KCW56192.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=147

 Score =   269 bits (687),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRNNARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNNARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIR  425
            AKSIHHARVLIRQ+HIR
Sbjct  121  AKSIHHARVLIRQRHIR  137



>ref|XP_008367548.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S9-2-like 
[Malus domestica]
Length=197

 Score =   269 bits (687),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M HV+FYRNYGKT KKPRRPYEKERLDAELKLVGE+GLR  RELWRV  + SRIRNNAR 
Sbjct  1    MFHVSFYRNYGKTLKKPRRPYEKERLDAELKLVGEFGLRXPRELWRVSASQSRIRNNARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRI  G+ALLRRMNRY LLDE  NKL YVLAL VENFLERRL T+ F+ GM
Sbjct  61   LLTLDEKNPRRIIXGEALLRRMNRYKLLDEGXNKLXYVLALNVENFLERRLXTIXFKTGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIR +HI VGRQV N+PSFLVR D++KHIDFSL+SP 
Sbjct  121  AKSIHHARVLIRLRHIXVGRQVXNIPSFLVRCDTEKHIDFSLTSPL  166



>gb|EAY83171.1| hypothetical protein OsI_38381 [Oryza sativa Indica Group]
Length=192

 Score =   268 bits (685),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 154/166 (93%), Gaps = 3/166 (2%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKP+RPYEKERLDAELKLVGEYGLRCKRELWRVQYAL+RIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPKRPYEKERLDAELKLVGEYGLRCKRELWRVQYALNRIRNAARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMN Y LL E QNKLD VLALT ENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNHYRLLAEGQNKLDCVLALTAENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HI   R+++NVPSF+VR++S+KHIDFSL+SPF
Sbjct  121  AKSIHHARVLIRQRHI---RRIINVPSFMVRLESEKHIDFSLTSPF  163



>ref|XP_010274527.1| PREDICTED: 40S ribosomal protein S9-2-like [Nelumbo nucifera]
Length=223

 Score =   267 bits (683),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 143/152 (94%), Gaps = 4/152 (3%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQY LSRIRN ARM
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYVLSRIRNAARM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLA+TVENFLERRLQTLVF++GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLDESQNKLDYVLAVTVENFLERRLQTLVFKSGM  120

Query  375  AKSIHHARVLIRQKHIRVGRQVV----NVPSF  458
            AKSIHHARVLIRQ+H+R G+ +V     VP++
Sbjct  121  AKSIHHARVLIRQRHVRRGQVLVVRRSGVPTY  152



>ref|XP_006381973.1| hypothetical protein POPTR_0006s22640g [Populus trichocarpa]
 gb|ERP59770.1| hypothetical protein POPTR_0006s22640g [Populus trichocarpa]
Length=178

 Score =   263 bits (671),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 140/166 (84%), Gaps = 19/166 (11%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGK FKKPRRPYEKE LDAELKLVGEYGLR KRELWRVQYA SRIRN A M
Sbjct  1    MVHVSFYRNYGKNFKKPRRPYEKECLDAELKLVGEYGLRAKRELWRVQYAFSRIRNAATM  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+ R                   +SQNKLDYVLALTVENFLERRLQTLVF+AGM
Sbjct  61   LLTLDEKNQR-------------------QSQNKLDYVLALTVENFLERRLQTLVFKAGM  101

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  102  AKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  147



>tpg|DAA41535.1| TPA: hypothetical protein ZEAMMB73_424707 [Zea mays]
Length=243

 Score =   264 bits (675),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 138/155 (89%), Gaps = 6/155 (4%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALTVENFL+RRLQT+VF+ GM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLGEGQNKLDYVLALTVENFLQRRLQTIVFKNGM  120

Query  375  AKSIHHARVLIRQKHIR------VGRQVVNVPSFL  461
            AKSIHHARVLIRQ+HIR      + R  +NV   L
Sbjct  121  AKSIHHARVLIRQRHIRFVYMLLIPRLCINVSCIL  155



>tpg|DAA55417.1| TPA: hypothetical protein ZEAMMB73_005048 [Zea mays]
Length=169

 Score =   261 bits (667),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNAARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL E QNKLDYVLALT ENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLAEGQNKLDYVLALTAENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHIR  425
            AKSIHHARVLI+Q+HIR
Sbjct  121  AKSIHHARVLIKQRHIR  137



>gb|ABF94049.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
Length=158

 Score =   260 bits (664),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHI  422
            AKSIHHARVLIRQ+HI
Sbjct  121  AKSIHHARVLIRQRHI  136



>gb|ABA94598.1| 40S ribosomal protein S9, putative, expressed [Oryza sativa Japonica 
Group]
Length=158

 Score =   259 bits (663),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARH  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRMNRYGLL + QNKLDYVLALTVENFL RRLQTLVF+AGM
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMNRYGLLADGQNKLDYVLALTVENFLARRLQTLVFKAGM  120

Query  375  AKSIHHARVLIRQKHI  422
            AKSIHHARVLIRQ+HI
Sbjct  121  AKSIHHARVLIRQRHI  136



>dbj|BAA78592.1| 40S ribosomal protein S9 [Chlamydomonas sp. HS-5]
Length=192

 Score =   260 bits (665),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M  +  YRNYGKTFKKPRRP+EKERLD ELKLVGEYGLR KRELWRVQ  LS+IRN AR 
Sbjct  1    MPKIGQYRNYGKTFKKPRRPFEKERLDGELKLVGEYGLRNKRELWRVQMILSKIRNAARN  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LL  DE D +R+FEG AL+RRM +YGLL+E+Q+KLDYVLAL   +FLERRLQT+VF+ G+
Sbjct  61   LLQHDEDDTKRLFEGQALMRRMYKYGLLNETQDKLDYVLALQPNDFLERRLQTVVFKQGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q HIRVG+QVVN+PSF+VRVDSQKH+DF+L+SPF
Sbjct  121  AKSIHHARVLIKQNHIRVGKQVVNIPSFMVRVDSQKHVDFALTSPF  166



>ref|XP_003609048.1| 40S ribosomal protein S9 [Medicago truncatula]
Length=200

 Score =   260 bits (664),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 142/166 (86%), Gaps = 13/166 (8%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNAR 
Sbjct  1    MVHVAFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNART  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK+PRRIFEG+ALLRRM ++GLLDE+QNKLDYVLALTVENFLE RLQTL    G 
Sbjct  61   LLTLDEKNPRRIFEGEALLRRMFKHGLLDETQNKLDYVLALTVENFLECRLQTL---CGS  117

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
              +  H           VGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  118  YLTEAHW----------VGRQVVNIPSFMVRVDSQKHIDFSLTSPF  153



>ref|XP_006438664.1| hypothetical protein CICLE_v10033755mg [Citrus clementina]
 gb|ESR51904.1| hypothetical protein CICLE_v10033755mg [Citrus clementina]
Length=178

 Score =   258 bits (659),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 141/166 (85%), Gaps = 19/166 (11%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAEL+LVGEYGLRCKRELWRVQYALSRIRN AR 
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            L+ L EK  R+                   SQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  61   LVNLGEKKTRK-------------------SQNKLDYVLALTVENFLERRLQTLVFKSGM  101

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQ+VN+PSF+VRVDSQKHI+FSL+SPF
Sbjct  102  AKSIHHARVLIRQRHIRVGRQLVNIPSFVVRVDSQKHIEFSLTSPF  147



>ref|XP_011399104.1| 40S ribosomal protein S9-1 [Auxenochlorella protothecoides]
 gb|KFM26208.1| 40S ribosomal protein S9-1 [Auxenochlorella protothecoides]
Length=192

 Score =   258 bits (659),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M  ++ YRNYGKTFKKPRRP+EKERLDAELK VGE+GLR KRELWRVQ  LS+ R+ AR 
Sbjct  1    MPSISCYRNYGKTFKKPRRPFEKERLDAELKTVGEFGLRNKRELWRVQLVLSKFRSRARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTL+EKDP+R+FEG+AL+RRM RYG L+  ++KLDYVL+LT +  LERRLQT VF+ G+
Sbjct  61   LLTLEEKDPKRLFEGEALMRRMYRYGFLETHEDKLDYVLSLTPDRVLERRLQTQVFKLGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNVPSFIVRIDSQKHIDFALNSPF  166



>gb|KIZ02547.1| 40S ribosomal protein S9-2 [Monoraphidium neglectum]
Length=227

 Score =   259 bits (662),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 154/201 (77%), Gaps = 35/201 (17%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M  + FYR+YGKTFKKPRRP+EKERLDAELKLVGEYGLR KRELWRVQ  LS+IR  AR+
Sbjct  1    MPKIGFYRSYGKTFKKPRRPFEKERLDAELKLVGEYGLRNKRELWRVQMVLSKIRKAARV  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTL++KDP+RIFEG+AL+RRM +YGLL+E+Q+KLDYVLAL+ ++FLERRLQTLVF+ G+
Sbjct  61   LLTLEDKDPKRIFEGNALMRRMYKYGLLNETQDKLDYVLALSPQDFLERRLQTLVFKQGL  120

Query  375  AKSIHHARVLIRQKHIR-----------------------------------VGRQVVNV  449
            AKSIHHARVLIRQ+HI                                    VG+QVVN+
Sbjct  121  AKSIHHARVLIRQRHISSSGSSSSSRPAGMVAGAQQPRVRCNAAGGALSNRWVGKQVVNI  180

Query  450  PSFLVRVDSQKHIDFSLSSPF  512
            PSF+VRVDSQKHIDFSL+SPF
Sbjct  181  PSFMVRVDSQKHIDFSLTSPF  201



>gb|ADB77798.1| 40S ribosomal protein S9 [Cladophora coelothrix]
Length=179

 Score =   256 bits (655),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M  + +YR+YGKTF+ PRRP+EKER D+ELKLVGE+GLR KRELWRVQ ALS++R  AR 
Sbjct  1    MPKIAYYRSYGKTFRGPRRPFEKERPDSELKLVGEFGLRNKRELWRVQLALSKLRGAARE  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLD-ESQNKLDYVLALTVENFLERRLQTLVFRAG  371
            LLTLDE DP+RIF+G++LLRRM RYGLLD E QNKLDY+LALT  +FLERRLQT VF+ G
Sbjct  61   LLTLDEDDPKRIFQGNSLLRRMYRYGLLDQEKQNKLDYILALTPADFLERRLQTQVFKLG  120

Query  372  MAKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            +AKSIHHARV+IRQ+HIRVG+Q+VNVPSF+VR++SQ HIDF+L+SPF
Sbjct  121  LAKSIHHARVIIRQRHIRVGKQIVNVPSFMVRMESQGHIDFALTSPF  167



>emb|CBN76630.1| conserved unknown protein [Ectocarpus siliculosus]
Length=194

 Score =   255 bits (651),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M  V  +RNY KTFK PRRPYEKERLD+ELKL GEYGLRCKRE+WRVQ+AL++IR  AR 
Sbjct  1    MPKVGIHRNYRKTFKTPRRPYEKERLDSELKLCGEYGLRCKREIWRVQFALAKIRKAARQ  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLD KDP+R+FEG ALLRRM+R+GLL E + +LD+VL LT E  LERRLQT VF+ G+
Sbjct  61   LLTLDTKDPKRLFEGPALLRRMSRFGLLGEDEKELDFVLQLTTEKMLERRLQTKVFKQGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+ +HIRVG+Q+VNVP F+VR+DS+KHIDFS++SP+
Sbjct  121  AKSIHHARVLIKHRHIRVGKQLVNVPQFMVRMDSEKHIDFSITSPY  166



>ref|XP_005708491.1| 40S ribosomal protein S9e [Galdieria sulphuraria]
 gb|EME31971.1| 40S ribosomal protein S9e [Galdieria sulphuraria]
Length=193

 Score =   253 bits (646),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  33   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  212
            YR   KT++ PRRP+EKERLDAELKLVGEYGLR KRELWRV++ALS+IR  AR LLTL+E
Sbjct  5    YRTCSKTYRTPRRPFEKERLDAELKLVGEYGLRNKRELWRVEFALSKIRAAARDLLTLEE  64

Query  213  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHH  392
            KDPRRIFEG+ALLRR+ R+GLLDE++  LD+VL+L V++ LERRLQT V + G+AKSIHH
Sbjct  65   KDPRRIFEGNALLRRLTRFGLLDETRQSLDHVLSLKVQDLLERRLQTQVLKLGLAKSIHH  124

Query  393  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            ARVLIRQ+HIRVG+Q+VNVPSF+VRVDSQKHIDFSL SPF
Sbjct  125  ARVLIRQRHIRVGKQLVNVPSFMVRVDSQKHIDFSLDSPF  164



>ref|XP_007922661.1| hypothetical protein MYCFIDRAFT_60241 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME85361.1| hypothetical protein MYCFIDRAFT_60241 [Pseudocercospora fijiensis 
CIRAD86]
Length=193

 Score =   253 bits (645),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFEAARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+LSSPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALSSPF  162



>gb|KCW56188.1| hypothetical protein EUGRSUZ_I01938 [Eucalyptus grandis]
Length=164

 Score =   251 bits (642),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 133/166 (80%), Gaps = 33/166 (20%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV+FYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQ            
Sbjct  1    MVHVSFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQ------------  48

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
                                 MNRYGLLDESQNKLDYVLALTVENFLERRLQTLVF++GM
Sbjct  49   ---------------------MNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKSGM  87

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRVDSQKHIDFSL+SPF
Sbjct  88   AKSIHHARVLIRQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPF  133



>gb|EPE04605.1| 40s ribosomal protein s9 [Ophiostoma piceae UAMH 11346]
Length=190

 Score =   252 bits (644),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  39   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  218
            +Y KT K PRRP+E  RLD+ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEKD
Sbjct  5    SYSKTAKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEKD  64

Query  219  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHAR  398
            P+R+FEG+AL+RR+ R G+LD+S+ KLDYVLAL VE+FLERRLQTLV++ G+AKSIHHAR
Sbjct  65   PKRLFEGNALIRRLVRVGVLDDSRMKLDYVLALKVEDFLERRLQTLVYKLGLAKSIHHAR  124

Query  399  VLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            VLIRQ+HIRVG+QVVNVPSF+VR+DSQKHIDFSLSSPF
Sbjct  125  VLIRQRHIRVGKQVVNVPSFIVRLDSQKHIDFSLSSPF  162



>ref|NP_001119227.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
 gb|AED92129.1| 40S ribosomal protein S9-1 [Arabidopsis thaliana]
Length=156

 Score =   250 bits (639),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            MVHV +YRNYGKTFK PRRPYEKERLD+ELKLVGEYGLR KRELWRVQY+LSRIRN AR 
Sbjct  1    MVHVCYYRNYGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARD  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLDEK PRRIFEG+ALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQT+VF++GM
Sbjct  61   LLTLDEKSPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGM  120

Query  375  AKSIHHARVLIRQKHIR  425
            AKSIHH+RVLIRQ+HIR
Sbjct  121  AKSIHHSRVLIRQRHIR  137



>gb|KIN07697.1| hypothetical protein OIDMADRAFT_16275 [Oidiodendron maius Zn]
Length=192

 Score =   252 bits (643),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+LSSPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALSSPF  162



>gb|EME38681.1| ribosomal protein S9-like protein [Dothistroma septosporum NZE10]
Length=193

 Score =   251 bits (642),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDFSL+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFSLTSPF  162



>ref|XP_002139923.1| 40S ribosomal protein S9 [Cryptosporidium muris RN66]
 gb|EEA05574.1| 40S ribosomal protein S9, putative [Cryptosporidium muris RN66]
Length=189

 Score =   251 bits (641),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +3

Query  24   VNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLT  203
            V  Y N+ KT ++P+RP+EKERLDAE+KL+GEYGL+ KRE+WRVQY L++IR  AR LLT
Sbjct  2    VKSYTNHSKTSRQPKRPFEKERLDAEMKLIGEYGLKNKREVWRVQYTLAKIRAAARHLLT  61

Query  204  LDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKS  383
            LD+KDP R+F+G+ALLRRM R GLL E++ KLDYVL LTV  FLERRLQT VF+ G+AKS
Sbjct  62   LDDKDPIRVFQGEALLRRMERLGLLSENERKLDYVLGLTVNKFLERRLQTRVFKLGLAKS  121

Query  384  IHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            IHHARVLIRQ HIRVGRQ+VNVPSF+VR+DS+KHIDFSLSSPF
Sbjct  122  IHHARVLIRQHHIRVGRQIVNVPSFMVRLDSEKHIDFSLSSPF  164



>ref|XP_001546443.1| 40S ribosomal protein S9 [Botrytis cinerea B05.10]
 emb|CCD54749.1| similar to 40S ribosomal protein S9 [Botrytis cinerea T4]
 gb|EMR81651.1| putative 40s ribosomal protein s9 protein [Botrytis cinerea BcDW1]
Length=191

 Score =   251 bits (641),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+F+ERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFMERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+LSSPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALSSPF  162



>gb|KIW50177.1| 40S ribosomal protein S9 [Exophiala xenobiotica]
Length=193

 Score =   251 bits (641),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>ref|XP_006691696.1| 40S ribosomal protein s9-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
 gb|EGS22704.1| 40S ribosomal protein s9-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
Length=190

 Score =   251 bits (641),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R Y KT+K PRRPYE  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR+LLTLDEK
Sbjct  4    RKYSKTYKVPRRPYEAARLDSELKLVGEYGLRNKREVWRVLLTLSKIRRAARILLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL  E+FLERRLQTLV++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALKAEDFLERRLQTLVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFMVRLDSQKHIDFALTSPF  162



>gb|KIW44874.1| 40S ribosomal protein S9 [Exophiala oligosperma]
Length=193

 Score =   251 bits (640),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>gb|KDD75683.1| hypothetical protein H632_c551p0 [Helicosporidium sp. ATCC 50920]
Length=203

 Score =   251 bits (641),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +3

Query  45   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  224
            GK FK PRRP+EKERLDAELK VGEYGLRCKRELWRVQ  LS+ R+ AR LLTL E D R
Sbjct  22   GKVFKVPRRPFEKERLDAELKTVGEYGLRCKRELWRVQLVLSKFRSRARELLTLPENDAR  81

Query  225  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHARVL  404
            R+FEG+AL+RRM RYG LD SQ+KLDYVL+LT  + LERRLQTLVF+ G+AKSIHHARVL
Sbjct  82   RVFEGEALMRRMYRYGFLDASQDKLDYVLSLTPADVLERRLQTLVFKLGLAKSIHHARVL  141

Query  405  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            IRQ+HIRVG+Q+VNVPSFLVRVDSQKHIDF+L+SPF
Sbjct  142  IRQRHIRVGKQLVNVPSFLVRVDSQKHIDFALNSPF  177



>gb|KIV80024.1| 40S ribosomal protein S9 [Exophiala sideris]
Length=193

 Score =   251 bits (640),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>gb|KEF58004.1| 40S ribosomal protein S9 [Exophiala aquamarina CBS 119918]
Length=193

 Score =   251 bits (640),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALNVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>gb|KIW15420.1| 40S ribosomal protein S9 [Exophiala spinifera]
Length=193

 Score =   251 bits (640),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>gb|EKG11582.1| Ribosomal protein S4/S9 [Macrophomina phaseolina MS6]
Length=191

 Score =   250 bits (639),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF  162



>ref|XP_007782986.1| 40S ribosomal protein S9 [Coniosporium apollinis CBS 100218]
 gb|EON67669.1| 40S ribosomal protein S9 [Coniosporium apollinis CBS 100218]
Length=191

 Score =   250 bits (639),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF  162



>gb|KIW73335.1| 40S ribosomal protein S9 [Capronia semiimmersa]
Length=193

 Score =   250 bits (639),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF  162



>ref|XP_008722253.1| 40S ribosomal protein S9 [Cladophialophora carrionii CBS 160.54]
 gb|ETI28179.1| 40S ribosomal protein S9 [Cladophialophora carrionii CBS 160.54]
Length=193

 Score =   250 bits (639),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF  162



>ref|XP_007724904.1| 40S ribosomal protein S9 [Capronia coronata CBS 617.96]
 gb|EXJ85466.1| 40S ribosomal protein S9 [Capronia coronata CBS 617.96]
Length=193

 Score =   250 bits (638),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF  162



>ref|XP_009155008.1| 40S ribosomal protein S9 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY54547.1| 40S ribosomal protein S9 [Exophiala dermatitidis NIH/UT8656]
Length=193

 Score =   250 bits (638),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF  162



>ref|XP_007674573.1| hypothetical protein BAUCODRAFT_66115, partial [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC98135.1| hypothetical protein BAUCODRAFT_66115, partial [Baudoinia compniacensis 
UAMH 10762]
Length=194

 Score =   250 bits (638),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R Y KT+K PRRP+E  RLD+ELK+VGEYGL+ KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RKYSKTYKVPRRPFESARLDSELKIVGEYGLKNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVGRQ+VNVPSFLVR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGRQIVNVPSFLVRLDSQKHIDFALTSPF  162



>ref|XP_007698387.1| hypothetical protein COCSADRAFT_35730 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_008031057.1| hypothetical protein SETTUDRAFT_98745 [Setosphaeria turcica Et28A]
 gb|EMD65693.1| hypothetical protein COCSADRAFT_35730 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD89741.1| hypothetical protein COCHEDRAFT_1225361 [Bipolaris maydis C5]
 gb|ENI10046.1| hypothetical protein COCC4DRAFT_185738 [Bipolaris maydis ATCC 
48331]
 gb|EOA81657.1| hypothetical protein SETTUDRAFT_98745 [Setosphaeria turcica Et28A]
Length=192

 Score =   250 bits (638),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+  PRRP+E  RLD ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYSVPRRPFESARLDTELKLVGEYGLRNKREVWRVQLTLSKIRRAARSLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFMVRLDSQKHIDFALTSPF  162



>ref|XP_003838270.1| similar to 40S ribosomal protein S9 [Leptosphaeria maculans JN3]
 emb|CBX94791.1| similar to 40S ribosomal protein S9 [Leptosphaeria maculans JN3]
Length=192

 Score =   250 bits (638),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+  PRRP+E  RLD ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYSVPRRPFESARLDTELKLVGEYGLRNKREVWRVQLTLSKIRRAARSLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFMVRLDSQKHIDFALTSPF  162



>gb|KIW07901.1| 40S ribosomal protein S9 [Verruconis gallopava]
Length=191

 Score =   249 bits (637),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>ref|XP_007731850.1| 40S ribosomal protein S9 [Capronia epimyces CBS 606.96]
 gb|EXJ86571.1| 40S ribosomal protein S9 [Capronia epimyces CBS 606.96]
Length=193

 Score =   250 bits (638),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK++GEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIIGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALNVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF  162



>ref|XP_001937443.1| 40S ribosomal protein S9 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU50030.1| 40S ribosomal protein S9 [Pyrenophora tritici-repentis Pt-1C-BFP]
Length=193

 Score =   249 bits (637),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+  PRRP+E  RLD ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  5    RSYSKTYSVPRRPFESARLDTELKLVGEYGLRNKREVWRVQLTLSKIRRAARSLLTLDEK  64

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  65   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  124

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  125  RVLIRQRHIRVGKQIVNVPSFMVRLDSQKHIDFALTSPF  163



>gb|ESZ90022.1| 40S ribosomal protein S9 [Sclerotinia borealis F-4157]
Length=191

 Score =   249 bits (637),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  39   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  218
            +Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEKD
Sbjct  5    SYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEKD  64

Query  219  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHAR  398
            P+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+F+ERRLQT V++ G+AKSIHHAR
Sbjct  65   PKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFMERRLQTCVYKLGLAKSIHHAR  124

Query  399  VLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            VLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+LSSPF
Sbjct  125  VLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALSSPF  162



>dbj|GAM43906.1| 40S ribosomal protein [Talaromyces cellulolyticus]
Length=192

 Score =   249 bits (637),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRPYE  RLD+ELK VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RSYSKTYKVPRRPYESARLDSELKTVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  125

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPS++VR+DSQKHIDF+L+SPF
Sbjct  126  RVLIRQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPF  164



>ref|XP_008808061.1| PREDICTED: 40S ribosomal protein S9-2-like, partial [Phoenix 
dactylifera]
Length=165

 Score =   248 bits (634),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  111  VGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPRRIFEGDALLRRMNRYGLLDESQ  290
            VGEYGLRCKRELWRVQYALSRIRN AR LLTLDEK+PRRIFEG+ALLRRMNR+GLLDE+Q
Sbjct  1    VGEYGLRCKRELWRVQYALSRIRNAARELLTLDEKNPRRIFEGEALLRRMNRFGLLDENQ  60

Query  291  NKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHARVLIRQKHIRVGRQVVNVPSFLVRV  470
            NKLDYVLALTVENFLERRLQT VF++GMAKSIHHARVLIRQ+HIRVGRQVVN+PSF+VRV
Sbjct  61   NKLDYVLALTVENFLERRLQTQVFKSGMAKSIHHARVLIRQRHIRVGRQVVNIPSFMVRV  120

Query  471  DSQKHIDFSLSSPF  512
            DS KHIDF+L+SPF
Sbjct  121  DSAKHIDFALNSPF  134



>ref|XP_007587858.1| putative 40s ribosomal protein s9 protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD44674.1| putative 40s ribosomal protein s9 protein [Neofusicoccum parvum 
UCRNP2]
Length=191

 Score =   249 bits (637),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF  162



>ref|XP_007913411.1| putative 40s ribosomal protein s9 protein [Togninia minima UCRPA7]
 gb|EOO01840.1| putative 40s ribosomal protein s9 protein [Togninia minima UCRPA7]
Length=191

 Score =   249 bits (636),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  39   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  218
            +Y KT K PRRP+E  RLD+ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEKD
Sbjct  5    SYSKTAKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEKD  64

Query  219  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHAR  398
            P+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHAR
Sbjct  65   PKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHAR  124

Query  399  VLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            VLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  125  VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>ref|XP_007750565.1| 40S ribosomal protein S9 [Cladophialophora psammophila CBS 110553]
 gb|EXJ61489.1| 40S ribosomal protein S9 [Cladophialophora psammophila CBS 110553]
 gb|KIW95815.1| 40S ribosomal protein S9 [Cladophialophora bantiana CBS 173.52]
Length=192

 Score =   249 bits (637),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF  162



>gb|KIW24305.1| 40S ribosomal protein S9 [Cladophialophora immunda]
Length=193

 Score =   249 bits (637),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF  162



>ref|XP_001246606.1| 40S ribosomal protein S9 [Coccidioides immitis RS]
 ref|XP_003066604.1| 40S ribosomal protein S9 [Coccidioides posadasii C735 delta SOWgp]
 gb|EER24459.1| 40S ribosomal protein S9, putative [Coccidioides posadasii C735 
delta SOWgp]
 gb|EFW18442.1| 40S ribosomal protein S9 [Coccidioides posadasii str. Silveira]
 gb|EAS35023.3| 40S ribosomal protein S9 [Coccidioides immitis RS]
Length=190

 Score =   249 bits (636),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRPYE  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTL+EK
Sbjct  4    RSYSKTYKVPRRPYESARLDSELKMVGEYGLRNKREVWRVQLTLSKIRRAARELLTLEEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V+R G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTQVYRLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SP 
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPL  162



>gb|EMF08137.1| 40S ribosomal protein S9 [Sphaerulina musiva SO2202]
Length=193

 Score =   249 bits (636),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  39   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  218
            +Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLT+DEKD
Sbjct  5    SYSKTYKVPRRPFEAARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTMDEKD  64

Query  219  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHAR  398
            P+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHAR
Sbjct  65   PKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHAR  124

Query  399  VLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            VLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  125  VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>ref|XP_002152417.1| 40S ribosomal protein S9 [Talaromyces marneffei ATCC 18224]
 gb|EEA19480.1| 40S ribosomal protein S9 [Talaromyces marneffei ATCC 18224]
 gb|KFX49628.1| 40S ribosomal protein S9 [Talaromyces marneffei PM1]
Length=191

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRPYE  RLD+ELK VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RSYSKTYKVPRRPYESARLDSELKTVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  125

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPS++VR+DSQKHIDF+L+SPF
Sbjct  126  RVLIRQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPF  164



>gb|EPS26866.1| hypothetical protein PDE_01806 [Penicillium oxalicum 114-2]
Length=193

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  125

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDFSL+SPF
Sbjct  126  RVLIKQRHIRVGKQIVNVPSFMVRLDSQKHIDFSLTSPF  164



>ref|XP_009038600.1| hypothetical protein AURANDRAFT_28757 [Aureococcus anophagefferens]
 gb|EGB06855.1| hypothetical protein AURANDRAFT_28757 [Aureococcus anophagefferens]
Length=196

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M   +F RNY KT K PRRP+EKER+D ELKLVGEYGLRCKRELWR Q AL+++R  AR 
Sbjct  1    MPKTSFLRNYRKTSKTPRRPFEKERIDGELKLVGEYGLRCKRELWRTQLALAKLRKAART  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTLD KDP R+FE  ALLRR+ RYGLLDE++ +LD VL +T +  LERRLQT VF+ G+
Sbjct  61   LLTLDTKDPARMFEAPALLRRLQRYGLLDETELELDAVLQMTTQRLLERRLQTKVFKQGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLI+Q+HIRVG+QVVNVPSFLVR+DS+KHIDF+++SP+
Sbjct  121  AKSIHHARVLIKQRHIRVGKQVVNVPSFLVRLDSEKHIDFAITSPY  166



>gb|KDN65245.1| putative ribosomal protein S4 [Colletotrichum sublineola]
Length=191

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  39   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  218
             Y KT K PRRP+E  RLD+ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEKD
Sbjct  5    TYSKTSKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEKD  64

Query  219  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHAR  398
            P+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHAR
Sbjct  65   PKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHAR  124

Query  399  VLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            VLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  125  VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>ref|XP_007829664.1| 40S ribosomal protein S9 [Pestalotiopsis fici W106-1]
 gb|ETS84867.1| 40S ribosomal protein S9 [Pestalotiopsis fici W106-1]
Length=190

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  39   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  218
            +Y KT K PRRP+E  RLD+ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEKD
Sbjct  5    SYSKTAKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEKD  64

Query  219  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHAR  398
            P+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHAR
Sbjct  65   PKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHAR  124

Query  399  VLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            VLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  125  VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>ref|XP_007687378.1| hypothetical protein COCMIDRAFT_93683 [Bipolaris oryzae ATCC 
44560]
 ref|XP_007710963.1| hypothetical protein COCCADRAFT_35663 [Bipolaris zeicola 26-R-13]
 gb|EUC34734.1| hypothetical protein COCCADRAFT_35663 [Bipolaris zeicola 26-R-13]
 gb|EUC46152.1| hypothetical protein COCMIDRAFT_93683 [Bipolaris oryzae ATCC 
44560]
 gb|EUN22073.1| hypothetical protein COCVIDRAFT_42086 [Bipolaris victoriae FI3]
Length=192

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+  PRRP+E  RLD ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYSVPRRPFESARLDTELKLVGEYGLRNKREVWRVQLTLSKIRRAARSLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFMVRLDSQKHIDFALTSPF  162



>ref|XP_003303583.1| 40S ribosomal protein S9 [Pyrenophora teres f. teres 0-1]
 gb|EFQ88321.1| hypothetical protein PTT_15843 [Pyrenophora teres f. teres 0-1]
Length=270

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+  PRRP+E  RLD ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  82   RSYSKTYSVPRRPFESARLDTELKLVGEYGLRNKREVWRVQLTLSKIRRAARSLLTLDEK  141

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  142  DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  201

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  202  RVLIRQRHIRVGKQIVNVPSFMVRLDSQKHIDFALTSPF  240



>ref|XP_001791646.1| hypothetical protein SNOG_00985 [Phaeosphaeria nodorum SN15]
 gb|EAT92480.1| hypothetical protein SNOG_00985 [Phaeosphaeria nodorum SN15]
Length=192

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+  PRRP+E  RLD ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYSVPRRPFESARLDTELKLVGEYGLRNKREVWRVQLTLSKIRRAARSLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ +LDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMRLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFMVRLDSQKHIDFALTSPF  162



>gb|KIV89206.1| 40S ribosomal protein S9 [Exophiala mesophila]
Length=193

 Score =   249 bits (635),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+  PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYSVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>ref|XP_011115175.1| hypothetical protein H072_9617 [Dactylellina haptotyla CBS 200.50]
 gb|EPS36858.1| hypothetical protein H072_9617 [Dactylellina haptotyla CBS 200.50]
Length=192

 Score =   249 bits (635),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R Y KT+K PRRP+E  RLDAELK VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RTYSKTYKVPRRPFESARLDAELKTVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  65

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LD+S+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRAGILDDSRMKLDYVLALKIEDFLERRLQTQVYKLGLAKSIHHA  125

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  126  RVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  164



>emb|CDR95115.1| 40S ribosomal subunit protein S9, putative [Babesia bigemina]
Length=184

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +3

Query  24   VNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLT  203
            V  YRNY KTF+ P+RP+EKERLD ELKL+GEYGL+ KRE+WRVQY LS+IR+ AR LLT
Sbjct  2    VGSYRNYSKTFRNPKRPFEKERLDQELKLIGEYGLKNKREVWRVQYVLSKIRSAARYLLT  61

Query  204  LDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKS  383
            LDEKD +R F+GDALLRRM RYGL+ E++ KLD+VL LT+   +ERRLQT VF+ G+AKS
Sbjct  62   LDEKDTKRQFQGDALLRRMVRYGLMGENEQKLDFVLGLTLNKMMERRLQTKVFKLGLAKS  121

Query  384  IHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            IHHAR +IRQ+HIRVG+Q+V++PSF+VRVDS+KHIDF+L+SPF
Sbjct  122  IHHARCMIRQRHIRVGKQIVDIPSFMVRVDSEKHIDFALTSPF  164



>ref|XP_001594205.1| 40S ribosomal protein S9 [Sclerotinia sclerotiorum 1980 UF-70]
 gb|EDO01537.1| 40S ribosomal protein S9 [Sclerotinia sclerotiorum 1980 UF-70]
Length=191

 Score =   249 bits (635),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTAKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDE++ KLDYVLAL +E+F+ERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDEARMKLDYVLALKIEDFMERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+LSSPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALSSPF  162



>gb|KEQ66339.1| 40S ribosomal protein S9 [Aureobasidium melanogenum CBS 110374]
Length=191

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK VGEYGLR KRE+WRVQ  LS+IR  AR LLT+DEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKSVGEYGLRNKREIWRVQLTLSKIRRAARQLLTMDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+D+QKHIDF+L+SPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFVVRLDAQKHIDFALTSPF  162



>gb|AFK45767.1| unknown [Medicago truncatula]
Length=191

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD ELK VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDVELKTVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LD+S+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDDSRMKLDYVLALRVEDFLERRLQTQVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+LSSPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALSSPF  162



>ref|XP_007288535.1| 40S ribosomal protein S9 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD21533.1| 40S ribosomal protein S9 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=193

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  39   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  218
            +Y KT+K PRRP+E  RLD+ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTL+EKD
Sbjct  5    SYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLEEKD  64

Query  219  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHAR  398
            P+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHAR
Sbjct  65   PKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHAR  124

Query  399  VLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            VLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+LSSPF
Sbjct  125  VLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALSSPF  162



>gb|KIX06477.1| 40S ribosomal protein S9 [Rhinocladiella mackenziei CBS 650.93]
Length=193

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLILSKIRRAARELLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF  162



>gb|KEQ72499.1| 40S ribosomal protein S9 [Aureobasidium pullulans var. namibiae 
CBS 147.97]
 gb|KEQ89117.1| 40S ribosomal protein S9 [Aureobasidium pullulans EXF-150]
Length=192

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK VGEYGLR KRE+WRVQ  LS+IR  AR LLT+DEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKSVGEYGLRNKREIWRVQLTLSKIRRAARQLLTMDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+D+QKHIDF+L+SPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFVVRLDAQKHIDFALTSPF  162



>gb|KHJ32708.1| putative 40s ribosomal protein s9 [Erysiphe necator]
Length=192

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT + PRRP+E  RLD+ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTSRVPRRPFESARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQKHIRVG+Q+VNVPSF+VR+DSQKHIDF+L SPF
Sbjct  124  RVLIRQKHIRVGKQIVNVPSFIVRLDSQKHIDFALKSPF  162



>ref|XP_007273485.1| 40s ribosomal protein [Colletotrichum gloeosporioides Nara gc5]
 gb|ELA37447.1| 40s ribosomal protein [Colletotrichum gloeosporioides Nara gc5]
 gb|EQB55027.1| hypothetical protein CGLO_05076 [Colletotrichum gloeosporioides 
Cg-14]
Length=191

 Score =   248 bits (633),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  39   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  218
             Y KT K PRRP+E  RLD+ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEKD
Sbjct  5    TYSKTSKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEKD  64

Query  219  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHAR  398
            P+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHAR
Sbjct  65   PKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHAR  124

Query  399  VLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            VLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  125  VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>emb|CCF33735.1| 40S ribosomal protein S9 [Colletotrichum higginsianum]
Length=191

 Score =   248 bits (633),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  39   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  218
             Y KT K PRRP+E  RLD+ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEKD
Sbjct  5    TYSKTSKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEKD  64

Query  219  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHAR  398
            P+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHAR
Sbjct  65   PKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHAR  124

Query  399  VLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            VLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  125  VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>gb|EFQ29502.1| ribosomal protein S4 [Colletotrichum graminicola M1.001]
 gb|ENH77682.1| 40s ribosomal protein [Colletotrichum orbiculare MAFF 240422]
Length=191

 Score =   248 bits (633),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  39   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  218
             Y KT K PRRP+E  RLD+ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEKD
Sbjct  5    TYSKTSKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEKD  64

Query  219  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHAR  398
            P+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHAR
Sbjct  65   PKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHAR  124

Query  399  VLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            VLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  125  VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>ref|XP_007788827.1| putative 40s ribosomal protein s9 protein [Eutypa lata UCREL1]
 gb|EMR72089.1| putative 40s ribosomal protein s9 protein [Eutypa lata UCREL1]
Length=191

 Score =   248 bits (633),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  39   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  218
            +Y KT K PRRP+E  RLD+ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEKD
Sbjct  5    SYSKTAKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEKD  64

Query  219  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHAR  398
            P+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHAR
Sbjct  65   PKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHAR  124

Query  399  VLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            VLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  125  VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>gb|EFX05063.1| 40S ribosomal protein s9 [Grosmannia clavigera kw1407]
Length=191

 Score =   248 bits (633),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  39   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  218
            +Y KT K PRRP+E  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEKD
Sbjct  5    SYSKTAKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVMLTLSKIRRAARQLLTLDEKD  64

Query  219  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHAR  398
            P+R+FEG+AL+RR+ R G+LD+S+ KLDYVLAL VE+FLERRLQTLV++ G+AKSIHHAR
Sbjct  65   PKRLFEGNALIRRLVRVGVLDDSRMKLDYVLALKVEDFLERRLQTLVYKLGLAKSIHHAR  124

Query  399  VLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            VLIRQ+HIRVG+QVVNVPSF+VR+DSQKHIDFSL+SPF
Sbjct  125  VLIRQRHIRVGKQVVNVPSFIVRLDSQKHIDFSLNSPF  162



>ref|XP_002486003.1| 40S ribosomal protein S9 [Talaromyces stipitatus ATCC 10500]
 gb|EED13765.1| 40S ribosomal protein S9 [Talaromyces stipitatus ATCC 10500]
Length=192

 Score =   248 bits (633),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRPYE  RLD+ELK VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  6    RSYSKTYKVPRRPYESARLDSELKTVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  65

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL +E+FLERRLQT V++ G+AKSIHHA
Sbjct  66   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKIEDFLERRLQTCVYKLGLAKSIHHA  125

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPS++VR+DSQKHIDF+L+SP 
Sbjct  126  RVLIRQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSPL  164



>ref|XP_005767233.1| hypothetical protein EMIHUDRAFT_61745 [Emiliania huxleyi CCMP1516]
 gb|EOD14804.1| hypothetical protein EMIHUDRAFT_61745 [Emiliania huxleyi CCMP1516]
Length=194

 Score =   248 bits (633),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  15   MVHVNFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARM  194
            M H +F RN+GKT + PRRP+EK+RLD E+KL+GE+GL+ KRE+WR Q  L+RIR  AR+
Sbjct  1    MPHASFLRNHGKTARTPRRPFEKQRLDIEMKLIGEFGLKNKREVWRTQLTLARIRKAARV  60

Query  195  LLTLDEKDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGM  374
            LLTL++KDP+R+FEG+ALLRR+ R G+LDES+ +LDYVLAL   +F+ERRLQT VF+ G+
Sbjct  61   LLTLEDKDPKRLFEGNALLRRLVRLGVLDESKAQLDYVLALKPADFMERRLQTQVFKLGL  120

Query  375  AKSIHHARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            AKSIHHARVLIRQ+HIRVG+Q+VN+PSF+VR +SQKHIDFS++SPF
Sbjct  121  AKSIHHARVLIRQRHIRVGKQIVNIPSFMVRTESQKHIDFSITSPF  166



>ref|XP_004336000.1| ribosomal protein S4, putative, partial [Acanthamoeba castellanii 
str. Neff]
 gb|ELR13987.1| ribosomal protein S4, putative, partial [Acanthamoeba castellanii 
str. Neff]
Length=188

 Score =   248 bits (632),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +3

Query  45   GKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKDPR  224
            GKT K PRRP+EKERLD ELKL+GE+GL+ KRE+WRV YALS++R NAR LLTL EK P+
Sbjct  1    GKTVKTPRRPFEKERLDHELKLIGEFGLKNKREVWRVHYALSKVRKNARKLLTLPEKHPK  60

Query  225  RIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHARVL  404
            RIFEG A+LRR++R G+++ES+NKLDYVLAL + +FLERRLQT VF+ G+AKSIHHARVL
Sbjct  61   RIFEGSAMLRRLHRMGVMEESKNKLDYVLALKINDFLERRLQTQVFKIGLAKSIHHARVL  120

Query  405  IRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            IRQ+HIRVG+Q+VNVPSF+VR DSQKH+DF+++SPF
Sbjct  121  IRQRHIRVGKQIVNVPSFIVRTDSQKHVDFAINSPF  156



>ref|XP_002794235.1| 40S ribosomal protein S9 [Paracoccidioides sp. 'lutzii' Pb01]
 ref|XP_010758823.1| 40S ribosomal protein S9 [Paracoccidioides brasiliensis Pb18]
 gb|EEH18301.1| 40S ribosomal protein S9 [Paracoccidioides brasiliensis Pb03]
 gb|EEH47228.1| 40S ribosomal protein S9 [Paracoccidioides brasiliensis Pb18]
Length=191

 Score =   248 bits (632),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRPY   RLD+ELK+VG YGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPYGSARLDSELKIVGTYGLRNKREVWRVQLTLSKIRRAARELLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLALTVE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALTVEDFLERRLQTQVYQLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF  162



>gb|KIX95793.1| 40S ribosomal protein S9 [Fonsecaea multimorphosa CBS 102226]
Length=193

 Score =   248 bits (632),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELK+VGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVMLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>ref|XP_008711137.1| 40S ribosomal protein S9 [Cyphellophora europaea CBS 101466]
 gb|ETN46425.1| 40S ribosomal protein S9 [Cyphellophora europaea CBS 101466]
Length=195

 Score =   248 bits (632),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT+K PRRP+E  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVLLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>dbj|GAM87141.1| hypothetical protein ANO11243_051620 [fungal sp. No.11243]
Length=192

 Score =   247 bits (631),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            ++Y KT+K PRRP+   RLDAELK VGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    QSYSKTYKVPRRPFGAARLDAELKTVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLI+Q+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIKQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>gb|ERS98231.1| 40S ribosomal protein S9 [Sporothrix schenckii ATCC 58251]
 gb|KIH87408.1| small subunit ribosomal protein S9e [Sporothrix brasiliensis 
5110]
Length=190

 Score =   247 bits (631),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  39   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  218
            +Y KT K PRRP+E  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEKD
Sbjct  5    SYSKTAKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVLLTLSKIRRAARQLLTLDEKD  64

Query  219  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHAR  398
            P+R+FEG+AL+RR+ R G+LD+S+ KLDYVLAL VE+FLERRLQTLV++ G+AKSIHHAR
Sbjct  65   PKRLFEGNALIRRLVRVGVLDDSRMKLDYVLALKVEDFLERRLQTLVYKLGLAKSIHHAR  124

Query  399  VLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            VLIRQ+HIRVG+QVVNVPSF+VR+DSQKHIDFSL SPF
Sbjct  125  VLIRQRHIRVGKQVVNVPSFIVRLDSQKHIDFSLKSPF  162



>ref|XP_007593688.1| 40S ribosomal protein S9 [Colletotrichum fioriniae PJ7]
 gb|EXF82658.1| 40S ribosomal protein S9 [Colletotrichum fioriniae PJ7]
Length=192

 Score =   247 bits (631),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +3

Query  39   NYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEKD  218
             Y KT K P RP+E  RLD+ELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEKD
Sbjct  5    TYSKTSKVPNRPFEAARLDSELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEKD  64

Query  219  PRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHAR  398
            P+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL VE+FLERRLQT V++ G+AKSIHHAR
Sbjct  65   PKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTCVYKLGLAKSIHHAR  124

Query  399  VLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            VLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  125  VLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTSPF  162



>ref|XP_003660223.1| hypothetical protein MYCTH_2298252 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO54978.1| hypothetical protein MYCTH_2298252 [Myceliophthora thermophila 
ATCC 42464]
Length=191

 Score =   247 bits (630),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R+Y KT K PRRP+E  RLD+ELKLVGEYGLR KRE+WRV   LS+IR  AR LLTLDEK
Sbjct  4    RSYSKTAKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVLLTLSKIRRAARELLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL  E+FLERRLQTLV++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKAEDFLERRLQTLVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+L+SPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALNSPF  162



>gb|EPQ66464.1| Protein component of the small (40S) ribosomal subunit [Blumeria 
graminis f. sp. tritici 96224]
 emb|CCU82039.1| 40S ribosomal protein S9 [Blumeria graminis f. sp. hordei DH14]
Length=192

 Score =   247 bits (630),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            R Y KT + PRRP+E  RLDAELKLVGEYGLR KRE+WRVQ  LS+IR  AR LLTLDEK
Sbjct  4    RCYSKTSRVPRRPFESARLDAELKLVGEYGLRNKREVWRVQLTLSKIRRAARQLLTLDEK  63

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DP+R+FEG+AL+RR+ R G+LDES+ KLDYVLAL  E+F+ERRLQT V++ G+AKSIHHA
Sbjct  64   DPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKTEDFMERRLQTCVYKLGLAKSIHHA  123

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VNVPSF+VR+DSQKHIDF+LSSPF
Sbjct  124  RVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDFALSSPF  162



>ref|XP_002367195.1| 40S ribosomal protein S9, putative [Toxoplasma gondii ME49]
 ref|XP_008883863.1| ribosomal protein RPS9 [Hammondia hammondi]
 gb|EPR63525.1| ribosomal protein RPS9 [Toxoplasma gondii GT1]
 gb|EPT25014.1| ribosomal protein RPS9 [Toxoplasma gondii ME49]
 gb|ESS34279.1| ribosomal protein RPS9 [Toxoplasma gondii VEG]
 gb|KEP65652.1| ribosomal protein RPS9 [Hammondia hammondi]
 gb|KFG46575.1| ribosomal protein RPS9 [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG48357.1| ribosomal protein RPS9 [Toxoplasma gondii p89]
 gb|KFG54080.1| ribosomal protein RPS9 [Toxoplasma gondii FOU]
 gb|KFG64413.1| ribosomal protein RPS9 [Toxoplasma gondii RUB]
 gb|KFH12211.1| ribosomal protein RPS9 [Toxoplasma gondii VAND]
 gb|KFH16022.1| ribosomal protein RPS9 [Toxoplasma gondii MAS]
Length=188

 Score =   247 bits (630),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  33   YRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDE  212
            YR Y KT + P+RP+EKERLD E+KL+GEYGL+ KRE+WRVQYAL++IR+ AR LLTL+E
Sbjct  5    YRTYSKTARSPKRPFEKERLDQEMKLLGEYGLKNKREVWRVQYALAKIRSAARELLTLEE  64

Query  213  KDPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHH  392
            KDPRR+F+G ALLRRM R GLL ES+ KLDYVL LTV  FLERRLQT VF+ G+AKSIHH
Sbjct  65   KDPRRVFQGTALLRRMVRLGLLGESEQKLDYVLGLTVAKFLERRLQTKVFKLGLAKSIHH  124

Query  393  ARVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            ARVLIRQ+HIRVG+ +V++PSF+VRVDS+KH+D++++SPF
Sbjct  125  ARVLIRQRHIRVGKHIVDIPSFMVRVDSEKHVDYAITSPF  164



>gb|EXX79184.1| ribosomal 40S subunit protein S9A [Rhizophagus irregularis DAOM 
197198w]
Length=190

 Score =   247 bits (630),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  36   RNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYALSRIRNNARMLLTLDEK  215
            RN  KT+K PRRP+EKER+D EL+L+GEYGLR KRE+WRV Y LS IR  AR LLTLD+K
Sbjct  6    RNCSKTYKVPRRPFEKERIDQELRLIGEYGLRNKREIWRVAYTLSNIRRAARELLTLDDK  65

Query  216  DPRRIFEGDALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFRAGMAKSIHHA  395
            DPRR+FEG+AL+RR+ R G+LDE++ KLDYVLAL +E+FLERRLQT VF+ G+AKSIHHA
Sbjct  66   DPRRLFEGNALIRRLVRIGVLDETKMKLDYVLALKIEDFLERRLQTQVFKLGLAKSIHHA  125

Query  396  RVLIRQKHIRVGRQVVNVPSFLVRVDSQKHIDFSLSSPF  512
            RVLIRQ+HIRVG+Q+VN+PSF+VR+DSQKHIDF+L+SP+
Sbjct  126  RVLIRQRHIRVGKQIVNIPSFIVRLDSQKHIDFALTSPY  164



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720