BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP002E01 561 bp,

Length=561
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004244325.1|  PREDICTED: uncharacterized protein LOC101257787    140   6e-35   Solanum lycopersicum
emb|CDP16819.1|  unnamed protein product                                135   7e-35   Coffea canephora [robusta coffee]
ref|XP_006346057.1|  PREDICTED: uncharacterized protein LOC102586...    138   4e-34   Solanum tuberosum [potatoes]
ref|XP_009630057.1|  PREDICTED: uncharacterized protein LOC104120...    137   4e-34   Nicotiana tomentosiformis
ref|XP_006346056.1|  PREDICTED: uncharacterized protein LOC102586...    138   5e-34   Solanum tuberosum [potatoes]
ref|XP_010097528.1|  hypothetical protein L484_024739                   135   8e-34   Morus notabilis
ref|XP_008222536.1|  PREDICTED: uncharacterized protein LOC103322400    136   9e-34   Prunus mume [ume]
ref|XP_009630056.1|  PREDICTED: uncharacterized protein LOC104120...    136   1e-33   Nicotiana tomentosiformis
ref|XP_009630055.1|  PREDICTED: uncharacterized protein LOC104120...    136   1e-33   Nicotiana tomentosiformis
ref|XP_007226823.1|  hypothetical protein PRUPE_ppa017697mg             136   2e-33   Prunus persica
ref|XP_008369134.1|  PREDICTED: uncharacterized protein LOC103432718    135   3e-33   Malus domestica [apple tree]
ref|XP_009774550.1|  PREDICTED: uncharacterized protein LOC104224...    134   4e-33   Nicotiana sylvestris
ref|XP_009774549.1|  PREDICTED: uncharacterized protein LOC104224...    134   4e-33   Nicotiana sylvestris
ref|XP_009419490.1|  PREDICTED: uncharacterized protein LOC103999462    133   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004309844.1|  PREDICTED: uncharacterized protein LOC101295...    134   2e-32   Fragaria vesca subsp. vesca
ref|XP_009774548.1|  PREDICTED: uncharacterized protein LOC104224...    133   2e-32   Nicotiana sylvestris
ref|XP_010069307.1|  PREDICTED: uncharacterized protein LOC104456...    125   1e-31   Eucalyptus grandis [rose gum]
ref|XP_011093604.1|  PREDICTED: uncharacterized protein LOC105173...    131   1e-31   Sesamum indicum [beniseed]
ref|XP_011093577.1|  PREDICTED: uncharacterized protein LOC105173...    131   1e-31   Sesamum indicum [beniseed]
ref|XP_010069306.1|  PREDICTED: uncharacterized protein LOC104456...    125   1e-31   Eucalyptus grandis [rose gum]
gb|KEH30315.1|  hypothetical protein MTR_4g067090                       130   2e-31   Medicago truncatula
gb|KCW62651.1|  hypothetical protein EUGRSUZ_G001841                    124   2e-31   Eucalyptus grandis [rose gum]
ref|XP_009363707.1|  PREDICTED: uncharacterized protein LOC103953661    129   7e-31   Pyrus x bretschneideri [bai li]
ref|XP_010268281.1|  PREDICTED: uncharacterized protein LOC104605...    128   9e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006443053.1|  hypothetical protein CICLE_v10020610mg             124   2e-30   Citrus clementina
gb|KDP42802.1|  hypothetical protein JCGZ_23744                         127   3e-30   Jatropha curcas
gb|KCW62640.1|  hypothetical protein EUGRSUZ_G00171                     121   3e-30   Eucalyptus grandis [rose gum]
gb|KCW62649.1|  hypothetical protein EUGRSUZ_G00183                     123   4e-30   Eucalyptus grandis [rose gum]
gb|EYU32223.1|  hypothetical protein MIMGU_mgv1a021037mg                123   5e-30   Erythranthe guttata [common monkey flower]
ref|XP_007034081.1|  Uncharacterized protein isoform 3                  124   5e-30   Theobroma cacao [chocolate]
gb|KCW57608.1|  hypothetical protein EUGRSUZ_H00375                     124   6e-30   Eucalyptus grandis [rose gum]
ref|XP_006443052.1|  hypothetical protein CICLE_v10020801mg             123   6e-30   Citrus clementina
ref|XP_003597511.1|  hypothetical protein MTR_2g098830                  127   6e-30   
gb|AES67762.2|  aleurone layer morphogenesis protein                    127   7e-30   Medicago truncatula
ref|XP_006478769.1|  PREDICTED: uncharacterized protein LOC102615607    125   7e-30   
ref|XP_007034080.1|  Uncharacterized protein isoform 2                  124   9e-30   Theobroma cacao [chocolate]
gb|KEH39474.1|  aleurone layer morphogenesis protein                    127   9e-30   Medicago truncatula
ref|XP_002533047.1|  hypothetical protein RCOM_0068670                  125   1e-29   
ref|XP_004507329.1|  PREDICTED: uncharacterized protein LOC101495369    125   1e-29   Cicer arietinum [garbanzo]
gb|KCW57607.1|  hypothetical protein EUGRSUZ_H00375                     125   1e-29   Eucalyptus grandis [rose gum]
gb|KCW62653.1|  hypothetical protein EUGRSUZ_G001881                    120   2e-29   Eucalyptus grandis [rose gum]
ref|XP_009616030.1|  PREDICTED: uncharacterized protein LOC104108...    123   2e-29   Nicotiana tomentosiformis
ref|XP_009616031.1|  PREDICTED: uncharacterized protein LOC104108...    123   2e-29   Nicotiana tomentosiformis
ref|XP_010650543.1|  PREDICTED: uncharacterized protein LOC104879...    124   2e-29   Vitis vinifera
ref|XP_007034079.1|  Uncharacterized protein isoform 1                  124   2e-29   Theobroma cacao [chocolate]
ref|XP_010650542.1|  PREDICTED: uncharacterized protein LOC104879...    124   3e-29   Vitis vinifera
ref|XP_010650537.1|  PREDICTED: uncharacterized protein LOC104879...    124   3e-29   Vitis vinifera
ref|XP_009616029.1|  PREDICTED: uncharacterized protein LOC104108...    123   3e-29   Nicotiana tomentosiformis
gb|KGN45995.1|  hypothetical protein Csa_6G042290                       120   3e-29   Cucumis sativus [cucumbers]
ref|XP_009616028.1|  PREDICTED: uncharacterized protein LOC104108...    123   3e-29   Nicotiana tomentosiformis
ref|XP_009616027.1|  PREDICTED: uncharacterized protein LOC104108...    122   4e-29   Nicotiana tomentosiformis
ref|XP_010672149.1|  PREDICTED: uncharacterized protein LOC104888...    124   4e-29   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010672147.1|  PREDICTED: uncharacterized protein LOC104888...    124   5e-29   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KCW62646.1|  hypothetical protein EUGRSUZ_G00179                     120   6e-29   Eucalyptus grandis [rose gum]
ref|XP_008445722.1|  PREDICTED: uncharacterized protein LOC103488...    122   7e-29   
gb|KHN33313.1|  hypothetical protein glysoja_005355                     122   1e-28   Glycine soja [wild soybean]
ref|XP_008445720.1|  PREDICTED: uncharacterized protein LOC103488...    121   1e-28   Cucumis melo [Oriental melon]
ref|XP_006597233.1|  PREDICTED: uncharacterized protein LOC102670...    122   2e-28   Glycine max [soybeans]
ref|XP_006597236.1|  PREDICTED: uncharacterized protein LOC102670...    122   2e-28   Glycine max [soybeans]
ref|XP_008445719.1|  PREDICTED: uncharacterized protein LOC103488...    121   2e-28   Cucumis melo [Oriental melon]
ref|XP_004486922.1|  PREDICTED: uncharacterized protein LOC101510...    121   3e-28   
gb|KDO36965.1|  hypothetical protein CISIN_1g046099mg                   114   3e-28   Citrus sinensis [Valencia orange]
ref|XP_008445716.1|  PREDICTED: uncharacterized protein LOC103488...    121   3e-28   Cucumis melo [Oriental melon]
ref|XP_008445718.1|  PREDICTED: uncharacterized protein LOC103488...    121   3e-28   
ref|XP_006443055.1|  hypothetical protein CICLE_v100233381mg            115   4e-28   Citrus clementina
ref|XP_010067983.1|  PREDICTED: uncharacterized protein LOC104454786    120   5e-28   Eucalyptus grandis [rose gum]
ref|XP_004140981.1|  PREDICTED: uncharacterized protein LOC101206764    120   5e-28   
ref|XP_009795178.1|  PREDICTED: uncharacterized protein LOC104241...    119   5e-28   Nicotiana sylvestris
ref|XP_006590945.1|  PREDICTED: uncharacterized protein LOC102659394    120   5e-28   
gb|KHN06212.1|  hypothetical protein glysoja_031654                     120   5e-28   Glycine soja [wild soybean]
ref|XP_009795177.1|  PREDICTED: uncharacterized protein LOC104241...    119   9e-28   Nicotiana sylvestris
ref|XP_009795176.1|  PREDICTED: uncharacterized protein LOC104241...    119   9e-28   Nicotiana sylvestris
ref|XP_010907677.1|  PREDICTED: uncharacterized protein LOC105034290    118   3e-27   Elaeis guineensis
ref|XP_010268285.1|  PREDICTED: uncharacterized protein LOC104605...    116   8e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010268283.1|  PREDICTED: uncharacterized protein LOC104605...    116   8e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010268282.1|  PREDICTED: uncharacterized protein LOC104605...    117   9e-27   Nelumbo nucifera [Indian lotus]
ref|XP_007131958.1|  hypothetical protein PHAVU_011G055000g             117   9e-27   Phaseolus vulgaris [French bean]
gb|KHN25284.1|  hypothetical protein glysoja_010201                     116   1e-26   Glycine soja [wild soybean]
ref|XP_010268280.1|  PREDICTED: uncharacterized protein LOC104605...    116   1e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010268284.1|  PREDICTED: uncharacterized protein LOC104605...    114   4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_006342961.1|  PREDICTED: uncharacterized protein LOC102581370    113   8e-26   Solanum tuberosum [potatoes]
ref|XP_008810770.1|  PREDICTED: uncharacterized protein LOC103722...    112   1e-25   
ref|XP_008790624.1|  PREDICTED: uncharacterized protein LOC103707...    113   3e-25   Phoenix dactylifera
ref|XP_008790625.1|  PREDICTED: uncharacterized protein LOC103707...    112   3e-25   Phoenix dactylifera
ref|XP_008810768.1|  PREDICTED: uncharacterized protein LOC103722...    112   3e-25   Phoenix dactylifera
ref|XP_008810769.1|  PREDICTED: uncharacterized protein LOC103722...    112   3e-25   Phoenix dactylifera
ref|XP_010912110.1|  PREDICTED: uncharacterized protein LOC105038115    111   1e-24   Elaeis guineensis
ref|XP_011026403.1|  PREDICTED: uncharacterized protein LOC105127...    110   2e-24   Populus euphratica
ref|XP_011026398.1|  PREDICTED: uncharacterized protein LOC105127...    110   2e-24   Populus euphratica
ref|XP_003597503.1|  hypothetical protein MTR_2g098720                  104   3e-23   Medicago truncatula
gb|KJB37932.1|  hypothetical protein B456_006G227200                    106   4e-23   Gossypium raimondii
ref|XP_004235580.1|  PREDICTED: uncharacterized protein LOC101261598    104   2e-22   Solanum lycopersicum
ref|XP_003597502.1|  hypothetical protein MTR_2g098710                  101   5e-22   Medicago truncatula
ref|XP_006417970.1|  hypothetical protein EUTSA_v10007042mg             103   6e-22   Eutrema salsugineum
gb|AES67755.2|  hypothetical protein MTR_2g098730                       100   1e-21   Medicago truncatula
ref|XP_006380294.1|  hypothetical protein POPTR_0007s02040g             102   2e-21   Populus trichocarpa [western balsam poplar]
ref|XP_003597504.1|  hypothetical protein MTR_2g098730                  100   2e-21   
gb|EPS72437.1|  hypothetical protein M569_02323                       97.8    4e-21   Genlisea aurea
ref|XP_008790626.1|  PREDICTED: uncharacterized protein LOC103707...  99.0    2e-20   Phoenix dactylifera
ref|XP_003636931.1|  hypothetical protein MTR_065s0006                93.6    1e-19   
ref|XP_004959595.1|  PREDICTED: uncharacterized protein LOC101755092  97.1    1e-19   
ref|XP_004957337.1|  PREDICTED: uncharacterized protein LOC101755893  94.7    6e-19   Setaria italica
ref|XP_006845219.1|  hypothetical protein AMTR_s00005p00253820        95.1    6e-19   Amborella trichopoda
ref|XP_010557073.1|  PREDICTED: uncharacterized protein LOC104826...  93.6    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_010557074.1|  PREDICTED: uncharacterized protein LOC104826...  93.6    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_010557072.1|  PREDICTED: uncharacterized protein LOC104826...  93.2    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_010557065.1|  PREDICTED: uncharacterized protein LOC104826...  93.2    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_009118568.1|  PREDICTED: uncharacterized protein LOC103843582  93.6    2e-18   Brassica rapa
emb|CDY06187.1|  BnaA09g50160D                                        91.7    1e-17   Brassica napus [oilseed rape]
emb|CDY10002.1|  BnaC08g44490D                                        91.3    1e-17   Brassica napus [oilseed rape]
gb|KEH17747.1|  hypothetical protein MTR_0002s1280                    86.3    6e-17   Medicago truncatula
tpg|DAA62272.1|  TPA: hypothetical protein ZEAMMB73_229235            88.2    8e-17   Zea mays [maize]
ref|XP_003597507.1|  hypothetical protein MTR_2g098770                86.3    1e-16   Medicago truncatula
ref|XP_008652928.1|  PREDICTED: uncharacterized protein LOC103633013  87.8    1e-16   Zea mays [maize]
ref|XP_006661428.1|  PREDICTED: uncharacterized protein LOC102721864  87.4    2e-16   Oryza brachyantha
ref|XP_002892313.1|  predicted protein                                88.2    2e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_002460519.1|  hypothetical protein SORBIDRAFT_02g029790        87.4    2e-16   Sorghum bicolor [broomcorn]
ref|NP_001063660.1|  Os09g0514500                                     85.9    3e-16   
gb|EAZ45354.1|  hypothetical protein OsJ_29999                        86.3    4e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ09742.1|  hypothetical protein OsI_32030                        85.9    5e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_002442290.1|  hypothetical protein SORBIDRAFT_08g017520        85.9    5e-16   Sorghum bicolor [broomcorn]
ref|XP_002458095.1|  hypothetical protein SORBIDRAFT_03g026860        85.5    6e-16   Sorghum bicolor [broomcorn]
ref|XP_010485541.1|  PREDICTED: uncharacterized protein LOC104763...  85.1    9e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010485533.1|  PREDICTED: uncharacterized protein LOC104763...  85.1    9e-16   Camelina sativa [gold-of-pleasure]
ref|NP_172086.2|  uncharacterized protein                             84.3    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAF80120.1|AC024174_2  Contains similarity to an unknown prote...  85.1    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475317.1|  PREDICTED: uncharacterized protein LOC104754750  84.0    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002460278.1|  hypothetical protein SORBIDRAFT_02g025890        82.4    7e-15   Sorghum bicolor [broomcorn]
gb|KHN30102.1|  hypothetical protein glysoja_010480                   77.8    4e-14   Glycine soja [wild soybean]
ref|XP_006307018.1|  hypothetical protein CARUB_v10008604mg           80.1    4e-14   Capsella rubella
ref|XP_006307017.1|  hypothetical protein CARUB_v10008604mg           80.1    5e-14   Capsella rubella
ref|XP_010557069.1|  PREDICTED: uncharacterized protein LOC104826...  80.1    5e-14   Tarenaya hassleriana [spider flower]
ref|XP_002442289.1|  hypothetical protein SORBIDRAFT_08g017510        77.0    6e-14   Sorghum bicolor [broomcorn]
gb|EMS45395.1|  hypothetical protein TRIUR3_14576                     74.7    4e-12   Triticum urartu
ref|XP_010233334.1|  PREDICTED: uncharacterized protein LOC104583229  72.8    1e-11   
gb|EMS66244.1|  hypothetical protein TRIUR3_09292                     72.4    2e-11   Triticum urartu
gb|EMT22038.1|  hypothetical protein F775_01210                       71.2    4e-11   Aegilops tauschii
ref|XP_006443057.1|  hypothetical protein CICLE_v10024150mg           67.4    9e-11   Citrus clementina
gb|KDO40438.1|  hypothetical protein CISIN_1g046679mg                 67.4    9e-11   Citrus sinensis [Valencia orange]
gb|EMT06544.1|  hypothetical protein F775_30073                       69.7    1e-10   Aegilops tauschii
ref|XP_010231706.1|  PREDICTED: uncharacterized protein LOC104582750  69.3    2e-10   Brachypodium distachyon [annual false brome]
ref|XP_011457280.1|  PREDICTED: uncharacterized protein LOC101295...  67.0    1e-09   Fragaria vesca subsp. vesca
ref|XP_009344381.1|  PREDICTED: uncharacterized protein LOC103936263  63.5    2e-08   Pyrus x bretschneideri [bai li]
gb|EMT07234.1|  hypothetical protein F775_03282                       62.0    4e-08   Aegilops tauschii
ref|XP_002442274.1|  hypothetical protein SORBIDRAFT_08g017370        50.1    4e-05   Sorghum bicolor [broomcorn]
gb|EYU38904.1|  hypothetical protein MIMGU_mgv1a022859mg              50.4    1e-04   Erythranthe guttata [common monkey flower]



>ref|XP_004244325.1| PREDICTED: uncharacterized protein LOC101257787 [Solanum lycopersicum]
 ref|XP_010324220.1| PREDICTED: uncharacterized protein LOC101257787 [Solanum lycopersicum]
Length=803

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQ  390
            P + +Q+SVAKQLH +V+LYNYY RK+ PQA+YLDF+SFC+L +TLKP L  +M    +Q
Sbjct  35   PTLSQQQSVAKQLHAVVILYNYYQRKEDPQAQYLDFESFCKLAMTLKPALMSYMKF-MNQ  93

Query  391  SDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            SD     D  N  S+TEKAIQ ACN+S  LDASK  P +  W ISKVSVLLLDSKKE
Sbjct  94   SDLTSSKDMNNDLSVTEKAIQDACNISCALDASKDVPAINKWLISKVSVLLLDSKKE  150



>emb|CDP16819.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 91/129 (71%), Gaps = 2/129 (2%)
 Frame = +1

Query  178  PHLPVCIPSGTPP-IDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP  +    PP +D Q+SVA+Q+H + LLYNYY+RKQ P+  +L+F  FC+L +TLKP
Sbjct  21   PLLPSKLYGKDPPSLDNQQSVARQMHAVGLLYNYYYRKQDPELCFLEFVPFCKLALTLKP  80

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L  HM     Q+D V LND ENQ S+TEKA+  ACN+S  LDA K  P +EGW ISKVS
Sbjct  81   TLMPHMKFTL-QTDPVGLNDLENQLSVTEKAVMDACNISLSLDALKDIPSIEGWPISKVS  139

Query  535  VLLLDSKKE  561
            VLL+DS+KE
Sbjct  140  VLLVDSEKE  148



>ref|XP_006346057.1| PREDICTED: uncharacterized protein LOC102586583 isoform X2 [Solanum 
tuberosum]
 ref|XP_006346058.1| PREDICTED: uncharacterized protein LOC102586583 isoform X3 [Solanum 
tuberosum]
Length=805

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQ  390
            P + +Q+SVAKQLH +VLLYNYY RK+  QA+YLDF+SFC+L +TLKP L  +M    +Q
Sbjct  35   PTLSQQQSVAKQLHAVVLLYNYYQRKEDSQAQYLDFESFCKLAMTLKPALMSYMKF-MNQ  93

Query  391  SDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            SD     D  N  S+TEKAIQ ACN+S  LDASK  P +  W ISKVSVLLLDSKKE
Sbjct  94   SDLTSSKDMNNDLSVTEKAIQDACNISCALDASKDVPAINKWLISKVSVLLLDSKKE  150



>ref|XP_009630057.1| PREDICTED: uncharacterized protein LOC104120076 isoform X3 [Nicotiana 
tomentosiformis]
Length=629

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 89/130 (68%), Gaps = 3/130 (2%)
 Frame = +1

Query  178  PHLPVCIPS--GTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLK  351
            PHLP+   +    P + +Q SVAKQLH +VLLYNYY RKQ PQA+ LDF+SFC+L V LK
Sbjct  20   PHLPLKSSAIKEPPSLSQQLSVAKQLHAVVLLYNYYQRKQNPQAQNLDFESFCKLAVALK  79

Query  352  PVLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKV  531
            P L  +M    +QSD     D++N  S+ EKAIQ ACN+S  LDASK  P +  W I+K 
Sbjct  80   PALVSYMKF-MNQSDPTGSKDTDNDLSVAEKAIQDACNISCALDASKNVPSINKWLIAKA  138

Query  532  SVLLLDSKKE  561
            SVLLLDSKKE
Sbjct  139  SVLLLDSKKE  148



>ref|XP_006346056.1| PREDICTED: uncharacterized protein LOC102586583 isoform X1 [Solanum 
tuberosum]
Length=832

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQ  390
            P + +Q+SVAKQLH +VLLYNYY RK+  QA+YLDF+SFC+L +TLKP L  +M    +Q
Sbjct  62   PTLSQQQSVAKQLHAVVLLYNYYQRKEDSQAQYLDFESFCKLAMTLKPALMSYMKF-MNQ  120

Query  391  SDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            SD     D  N  S+TEKAIQ ACN+S  LDASK  P +  W ISKVSVLLLDSKKE
Sbjct  121  SDLTSSKDMNNDLSVTEKAIQDACNISCALDASKDVPAINKWLISKVSVLLLDSKKE  177



>ref|XP_010097528.1| hypothetical protein L484_024739 [Morus notabilis]
 gb|EXB68719.1| hypothetical protein L484_024739 [Morus notabilis]
Length=494

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 89/131 (68%), Gaps = 6/131 (5%)
 Frame = +1

Query  178  PHLPVCIPSGTPPIDKQ---RSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTL  348
            P LP    S  P I  Q   ++VAKQ+H ++LLYNYYHRKQ P  EYL F SFC+L V L
Sbjct  23   PMLPT--KSSVPGIASQSQLQAVAKQVHAVLLLYNYYHRKQNPALEYLGFNSFCKLAVIL  80

Query  349  KPVLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISK  528
            KP L  H+   +  +D  EL+D ENQ S+ EK I  AC++S +LDAS+ NP +EGW I+K
Sbjct  81   KPALLGHLKFMQISNDK-ELDDPENQLSVMEKTIMHACDISKVLDASRENPNVEGWPITK  139

Query  529  VSVLLLDSKKE  561
            V+V L+DSKKE
Sbjct  140  VAVFLVDSKKE  150



>ref|XP_008222536.1| PREDICTED: uncharacterized protein LOC103322400 [Prunus mume]
Length=694

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            TP + +Q SVAKQ+H +VLLYNYYHRKQ P  E L+F SFC+LV+ LKP L  HM   + 
Sbjct  34   TPSLSQQESVAKQVHAVVLLYNYYHRKQCPDLEVLNFDSFCKLVLVLKPALLPHMKFMQK  93

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             SD+ EL D E Q S+TEK I  ACN+S  LDASK  P  EGW ISKV+V L+D KKE
Sbjct  94   PSDT-ELEDLEKQLSVTEKTIMDACNMSLRLDASKDVPNTEGWPISKVTVFLVDPKKE  150



>ref|XP_009630056.1| PREDICTED: uncharacterized protein LOC104120076 isoform X2 [Nicotiana 
tomentosiformis]
Length=716

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 89/130 (68%), Gaps = 3/130 (2%)
 Frame = +1

Query  178  PHLPVCIPS--GTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLK  351
            PHLP+   +    P + +Q SVAKQLH +VLLYNYY RKQ PQA+ LDF+SFC+L V LK
Sbjct  20   PHLPLKSSAIKEPPSLSQQLSVAKQLHAVVLLYNYYQRKQNPQAQNLDFESFCKLAVALK  79

Query  352  PVLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKV  531
            P L  +M    +QSD     D++N  S+ EKAIQ ACN+S  LDASK  P +  W I+K 
Sbjct  80   PALVSYMKF-MNQSDPTGSKDTDNDLSVAEKAIQDACNISCALDASKNVPSINKWLIAKA  138

Query  532  SVLLLDSKKE  561
            SVLLLDSKKE
Sbjct  139  SVLLLDSKKE  148



>ref|XP_009630055.1| PREDICTED: uncharacterized protein LOC104120076 isoform X1 [Nicotiana 
tomentosiformis]
Length=760

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 89/130 (68%), Gaps = 3/130 (2%)
 Frame = +1

Query  178  PHLPVCIPS--GTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLK  351
            PHLP+   +    P + +Q SVAKQLH +VLLYNYY RKQ PQA+ LDF+SFC+L V LK
Sbjct  20   PHLPLKSSAIKEPPSLSQQLSVAKQLHAVVLLYNYYQRKQNPQAQNLDFESFCKLAVALK  79

Query  352  PVLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKV  531
            P L  +M    +QSD     D++N  S+ EKAIQ ACN+S  LDASK  P +  W I+K 
Sbjct  80   PALVSYMKF-MNQSDPTGSKDTDNDLSVAEKAIQDACNISCALDASKNVPSINKWLIAKA  138

Query  532  SVLLLDSKKE  561
            SVLLLDSKKE
Sbjct  139  SVLLLDSKKE  148



>ref|XP_007226823.1| hypothetical protein PRUPE_ppa017697mg, partial [Prunus persica]
 gb|EMJ28022.1| hypothetical protein PRUPE_ppa017697mg, partial [Prunus persica]
Length=719

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQ  390
            P + +Q SVAKQ+H +VLLYNYYHRKQ P  E L+F SFC+LV+ LKP L  HM   +  
Sbjct  35   PSLSQQESVAKQVHAVVLLYNYYHRKQCPDLEVLNFDSFCKLVLVLKPALLPHMKFMQKP  94

Query  391  SDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            SD+ EL+D E Q S+TEK I  ACN+S  LDASK  P +EGW ISKV+V L+D KKE
Sbjct  95   SDT-ELDDLEKQLSVTEKTIMDACNMSLRLDASKDVPNIEGWPISKVTVFLVDPKKE  150



>ref|XP_008369134.1| PREDICTED: uncharacterized protein LOC103432718 [Malus domestica]
Length=742

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            TP + +Q SVAKQ+H +VLLYNYYHRKQ P+ E L+F SFC+LV+ LKP L  HM   +S
Sbjct  34   TPSLSQQESVAKQVHAVVLLYNYYHRKQCPKLEDLNFDSFCKLVLFLKPALMVHMKFMQS  93

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             +D+ +L+D E Q S+TEKAI  AC++S  LDA K  P  EGW ISKV+VLL+DSKKE
Sbjct  94   PNDT-KLDDLEKQLSVTEKAIVDACSISVSLDALKDVPNTEGWPISKVTVLLVDSKKE  150



>ref|XP_009774550.1| PREDICTED: uncharacterized protein LOC104224570 isoform X3 [Nicotiana 
sylvestris]
Length=609

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 88/130 (68%), Gaps = 3/130 (2%)
 Frame = +1

Query  178  PHLPVCIPS--GTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLK  351
            P LP+   +    P + +Q SVAKQLH +VLLYNYY RKQ PQA+ LDF+SFC+L VTLK
Sbjct  20   PRLPLTSSAIKEPPSLSQQHSVAKQLHAVVLLYNYYQRKQNPQAQNLDFESFCKLAVTLK  79

Query  352  PVLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKV  531
            P L  +M    +QSD     D  +  S+ EKAIQ ACN+S  LDASK  P +  W I+KV
Sbjct  80   PALVSYMKF-MNQSDLTGSKDMGDDLSVAEKAIQDACNISCALDASKNVPSINKWLIAKV  138

Query  532  SVLLLDSKKE  561
            SVLLLDSKKE
Sbjct  139  SVLLLDSKKE  148



>ref|XP_009774549.1| PREDICTED: uncharacterized protein LOC104224570 isoform X2 [Nicotiana 
sylvestris]
Length=627

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 88/130 (68%), Gaps = 3/130 (2%)
 Frame = +1

Query  178  PHLPVCIPS--GTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLK  351
            P LP+   +    P + +Q SVAKQLH +VLLYNYY RKQ PQA+ LDF+SFC+L VTLK
Sbjct  20   PRLPLTSSAIKEPPSLSQQHSVAKQLHAVVLLYNYYQRKQNPQAQNLDFESFCKLAVTLK  79

Query  352  PVLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKV  531
            P L  +M    +QSD     D  +  S+ EKAIQ ACN+S  LDASK  P +  W I+KV
Sbjct  80   PALVSYMKF-MNQSDLTGSKDMGDDLSVAEKAIQDACNISCALDASKNVPSINKWLIAKV  138

Query  532  SVLLLDSKKE  561
            SVLLLDSKKE
Sbjct  139  SVLLLDSKKE  148



>ref|XP_009419490.1| PREDICTED: uncharacterized protein LOC103999462 [Musa acuminata 
subsp. malaccensis]
Length=644

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = +1

Query  178  PHLPVCIPSGTPP-IDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP  + S  PP ID+Q SVAKQ+H +VLLYNYYHRKQ+P+ E+L F++FC++    KP
Sbjct  15   PLLPARVSSAEPPTIDQQNSVAKQMHSVVLLYNYYHRKQFPRLEFLCFEAFCKVATIAKP  74

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
            +L  +MN     ++  EL D + Q S+ EK I  ACN+S  LDA K  P M+GW +S+V+
Sbjct  75   ILLTYMNVMHKNAE--ELQDLDQQLSVMEKKIMDACNISKTLDALKNAPNMDGWLVSRVA  132

Query  535  VLLLDSKKE  561
            V L+D+ KE
Sbjct  133  VFLVDASKE  141



>ref|XP_004309844.1| PREDICTED: uncharacterized protein LOC101295192 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457278.1| PREDICTED: uncharacterized protein LOC101295192 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457279.1| PREDICTED: uncharacterized protein LOC101295192 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=767

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 84/118 (71%), Gaps = 2/118 (2%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            TP +  Q SVAKQ+H +VLLYNY HRKQYP+ E L F SFC+LVV LKP L  HM   + 
Sbjct  34   TPSLSLQESVAKQVHAVVLLYNY-HRKQYPKLEVLRFSSFCKLVVDLKPALLAHMTFMQM  92

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             SD+ EL+D E Q S+TE+ I  AC +S+ LDAS   P  EGW ISKV+VLL+DSKKE
Sbjct  93   PSDT-ELDDLEKQLSVTERTIMDACEISTSLDASMGTPNTEGWPISKVTVLLVDSKKE  149



>ref|XP_009774548.1| PREDICTED: uncharacterized protein LOC104224570 isoform X1 [Nicotiana 
sylvestris]
Length=758

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 88/130 (68%), Gaps = 3/130 (2%)
 Frame = +1

Query  178  PHLPVCIPS--GTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLK  351
            P LP+   +    P + +Q SVAKQLH +VLLYNYY RKQ PQA+ LDF+SFC+L VTLK
Sbjct  20   PRLPLTSSAIKEPPSLSQQHSVAKQLHAVVLLYNYYQRKQNPQAQNLDFESFCKLAVTLK  79

Query  352  PVLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKV  531
            P L  +M    +QSD     D  +  S+ EKAIQ ACN+S  LDASK  P +  W I+KV
Sbjct  80   PALVSYMKF-MNQSDLTGSKDMGDDLSVAEKAIQDACNISCALDASKNVPSINKWLIAKV  138

Query  532  SVLLLDSKKE  561
            SVLLLDSKKE
Sbjct  139  SVLLLDSKKE  148



>ref|XP_010069307.1| PREDICTED: uncharacterized protein LOC104456248 isoform X2 [Eucalyptus 
grandis]
Length=231

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            +P   +Q+SVAKQ+H +V+LYNYYHR+Q+ Q E+L F+SFC+L+  LKP L  +M C + 
Sbjct  34   SPSPSQQQSVAKQVHGVVILYNYYHRRQHRQLEFLGFESFCKLIAVLKPPLLAYMKCLQ-  92

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            ++D  EL D E Q S+ EK I  AC+L   L+ASK  P +EGW IS+V+V L+DS+KE
Sbjct  93   RNDDAELVDPEKQLSLMEKTIMNACDLCMGLNASKDIPDIEGWSISEVAVFLVDSRKE  150



>ref|XP_011093604.1| PREDICTED: uncharacterized protein LOC105173510 isoform X2 [Sesamum 
indicum]
Length=836

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 90/129 (70%), Gaps = 2/129 (2%)
 Frame = +1

Query  178  PHLPVCIPSGTPPI-DKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP+ +    PP  D Q SVA+Q+H +VLLYNYYHRKQ P  E+LDF SFC+L + L+P
Sbjct  35   PRLPLTVSVNDPPTEDAQNSVARQMHAVVLLYNYYHRKQKPDLEFLDFVSFCKLALLLRP  94

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L   M    ++S+ VEL  +E+Q S+TEKA++ AC+++  LDASK  P  EG  ISKV+
Sbjct  95   SLIPFMKM-MNESELVELTGAEDQLSVTEKAVKDACDIAVALDASKDIPATEGCPISKVA  153

Query  535  VLLLDSKKE  561
            VLL+DS+ E
Sbjct  154  VLLIDSEGE  162



>ref|XP_011093577.1| PREDICTED: uncharacterized protein LOC105173510 isoform X1 [Sesamum 
indicum]
 ref|XP_011093587.1| PREDICTED: uncharacterized protein LOC105173510 isoform X1 [Sesamum 
indicum]
 ref|XP_011093595.1| PREDICTED: uncharacterized protein LOC105173510 isoform X1 [Sesamum 
indicum]
Length=845

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 90/129 (70%), Gaps = 2/129 (2%)
 Frame = +1

Query  178  PHLPVCIPSGTPPI-DKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP+ +    PP  D Q SVA+Q+H +VLLYNYYHRKQ P  E+LDF SFC+L + L+P
Sbjct  35   PRLPLTVSVNDPPTEDAQNSVARQMHAVVLLYNYYHRKQKPDLEFLDFVSFCKLALLLRP  94

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L   M    ++S+ VEL  +E+Q S+TEKA++ AC+++  LDASK  P  EG  ISKV+
Sbjct  95   SLIPFMKM-MNESELVELTGAEDQLSVTEKAVKDACDIAVALDASKDIPATEGCPISKVA  153

Query  535  VLLLDSKKE  561
            VLL+DS+ E
Sbjct  154  VLLIDSEGE  162



>ref|XP_010069306.1| PREDICTED: uncharacterized protein LOC104456248 isoform X1 [Eucalyptus 
grandis]
Length=245

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            +P   +Q+SVAKQ+H +V+LYNYYHR+Q+ Q E+L F+SFC+L+  LKP L  +M C + 
Sbjct  34   SPSPSQQQSVAKQVHGVVILYNYYHRRQHRQLEFLGFESFCKLIAVLKPPLLAYMKCLQ-  92

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            ++D  EL D E Q S+ EK I  AC+L   L+ASK  P +EGW IS+V+V L+DS+KE
Sbjct  93   RNDDAELVDPEKQLSLMEKTIMNACDLCMGLNASKDIPDIEGWSISEVAVFLVDSRKE  150



>gb|KEH30315.1| hypothetical protein MTR_4g067090 [Medicago truncatula]
Length=646

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
             P   +Q+ +AKQ+H +VLLYNYYHRKQ+P+ EYL F  FC+L+V L+P L  +M   + 
Sbjct  35   NPTTSQQQVIAKQVHSVVLLYNYYHRKQHPELEYLPFNEFCKLIVVLRPPLLAYMKFMQ-  93

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            + + VEL D E Q S+TEK I  AC++ + LDASK  P +EGW ISKVSVLL+DSKKE
Sbjct  94   KINEVELIDVEKQLSLTEKGIMDACDICNCLDASKNVPNIEGWPISKVSVLLIDSKKE  151



>gb|KCW62651.1| hypothetical protein EUGRSUZ_G001841, partial [Eucalyptus grandis]
Length=228

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 84/119 (71%), Gaps = 1/119 (1%)
 Frame = +1

Query  205  GTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKK  384
             +P   +Q+ VAKQ+H +V+LYNYYHRKQ+ Q E+LD +SFC+L+  LKP L  +M C +
Sbjct  33   DSPSPSQQQWVAKQVHGVVILYNYYHRKQHRQLEFLDVESFCKLIAVLKPPLLAYMKCLQ  92

Query  385  SQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             ++D  EL D E Q S+TEK I  AC+L   L ASK  P +EGW IS+V+V L+DS+KE
Sbjct  93   -RNDDAELVDPEKQLSLTEKTIMNACDLCMRLSASKDIPDIEGWSISEVAVFLVDSRKE  150



>ref|XP_009363707.1| PREDICTED: uncharacterized protein LOC103953661 [Pyrus x bretschneideri]
Length=743

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            TP + +Q SVAKQ+H +VLLYNYYHRKQ P+ E L+F SFC+LV+ LKP L  +M   +S
Sbjct  34   TPSLSQQESVAKQVHAVVLLYNYYHRKQCPKLEDLNFDSFCKLVLFLKPALMVYMKFMQS  93

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             +D+ +L+D E Q S+TEK I  AC +S  LDA K  P  EGW ISKV+VLL+DSKKE
Sbjct  94   PNDT-KLDDLEKQLSVTEKEIVDACCISLSLDALKDVPNTEGWPISKVTVLLVDSKKE  150



>ref|XP_010268281.1| PREDICTED: uncharacterized protein LOC104605278 isoform X2 [Nelumbo 
nucifera]
Length=648

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 85/129 (66%), Gaps = 3/129 (2%)
 Frame = +1

Query  178  PHLPVCIPSGTPP-IDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LPV      PP I  Q  VAKQ+H +VLLYNYYHRKQ+PQ E+LDF SFC++ V  KP
Sbjct  23   PVLPVKSSGRHPPSIALQEQVAKQMHAVVLLYNYYHRKQFPQLEFLDFASFCKVAVNAKP  82

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L  HM  K  Q  + +  + +   SITEKAI  ACN+   LDASK  P +EGW I++VS
Sbjct  83   NLLAHM--KFMQGGNADTANLDEHLSITEKAIMDACNICLWLDASKDVPSIEGWPITEVS  140

Query  535  VLLLDSKKE  561
            VLL+DS K+
Sbjct  141  VLLIDSAKK  149



>ref|XP_006443053.1| hypothetical protein CICLE_v10020610mg [Citrus clementina]
 gb|ESR56293.1| hypothetical protein CICLE_v10020610mg [Citrus clementina]
Length=380

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            TP    Q+SVAKQ+H +VLL+NYYH KQ+ Q ++  F+SF +L V LKP L  HM   + 
Sbjct  34   TPSESLQQSVAKQVHAVVLLHNYYHIKQHRQLKFEGFESFSKLAVVLKPTLLAHMKLMQR  93

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             +DS EL+D + Q S+TEK I  AC++S+ LDASK  P  EGW ISKV+VLL+DS+KE
Sbjct  94   SNDS-ELDDPDKQLSVTEKKIMDACDISNSLDASKDIPSTEGWPISKVAVLLIDSRKE  150



>gb|KDP42802.1| hypothetical protein JCGZ_23744 [Jatropha curcas]
Length=679

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 88/133 (66%), Gaps = 10/133 (8%)
 Frame = +1

Query  178  PHLPV-----CIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVV  342
            P LP      CIPS +     Q  VAKQ+H +VLLYNYYHRKQ+   E+L F+ FC+L V
Sbjct  27   PKLPSKSSARCIPSQS----DQELVAKQVHAVVLLYNYYHRKQHIHLEFLGFEDFCKLAV  82

Query  343  TLKPVLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEI  522
             L+P L  H+   +  +D+ EL+D E Q S+TEK I  AC++S+ LDASK+ P  EGW I
Sbjct  83   ILRPTLFPHLKLMQLSNDT-ELDDLEKQLSLTEKTIMDACDISTSLDASKSVPSSEGWTI  141

Query  523  SKVSVLLLDSKKE  561
            SKVSV L+DS +E
Sbjct  142  SKVSVFLIDSLRE  154



>gb|KCW62640.1| hypothetical protein EUGRSUZ_G00171 [Eucalyptus grandis]
Length=222

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 86/128 (67%), Gaps = 1/128 (1%)
 Frame = +1

Query  178  PHLPVCIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPV  357
            P +P      +P   +Q+ VAKQ+H +V+LY+YYHRKQ+ Q E+L F+SFC+L+  LKP 
Sbjct  23   PVIPATSVRDSPSPSQQQWVAKQVHGVVILYDYYHRKQHRQLEFLGFESFCKLIAVLKPP  82

Query  358  LAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSV  537
            L  +M   + ++D  EL D E Q S+TEK I  AC+L   L ASK  P +EGW IS+V+V
Sbjct  83   LLAYMKYLQ-RNDDAELVDPEKQLSLTEKTIMNACDLCMRLSASKDIPDIEGWSISEVAV  141

Query  538  LLLDSKKE  561
             L+DS+KE
Sbjct  142  FLVDSRKE  149



>gb|KCW62649.1| hypothetical protein EUGRSUZ_G00183 [Eucalyptus grandis]
Length=322

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 86/128 (67%), Gaps = 1/128 (1%)
 Frame = +1

Query  178  PHLPVCIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPV  357
            P +P      +P   +Q+ VAKQ+H +V+LYNYYHRKQ+ Q E+L F+SFC+L+  LKP 
Sbjct  23   PVIPATSVRDSPSPSQQQWVAKQVHGVVILYNYYHRKQHRQLEFLGFESFCKLIAVLKPP  82

Query  358  LAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSV  537
            L  +M   + ++D  EL D E Q S+TEK I  AC+L   L ASK  P +EGW IS+V+V
Sbjct  83   LLAYMKYLQ-RNDDAELVDPEKQLSLTEKTIMNACDLCMRLSASKDIPDIEGWSISEVAV  141

Query  538  LLLDSKKE  561
             L+DS+KE
Sbjct  142  FLVDSRKE  149



>gb|EYU32223.1| hypothetical protein MIMGU_mgv1a021037mg, partial [Erythranthe 
guttata]
Length=346

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 90/129 (70%), Gaps = 2/129 (2%)
 Frame = +1

Query  178  PHLPVCIPSGTPPI-DKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP+ +    PP  D  RSVA+Q+H +V+LYNYYHRKQ P+ E+LDF  F +L ++L+P
Sbjct  33   PRLPLSVSIDDPPDEDAHRSVARQMHAVVVLYNYYHRKQKPELEFLDFVPFSKLALSLRP  92

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L   M    ++S+S+E + +EN  S TEK+I+ AC++S  LDA+K  P +E   +SKV+
Sbjct  93   NLIPFMKF-TNESESIEFDGNENGLSETEKSIKNACDISKALDANKDFPTIENCPVSKVA  151

Query  535  VLLLDSKKE  561
            VLL+DSK+E
Sbjct  152  VLLIDSKRE  160



>ref|XP_007034081.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 ref|XP_007034082.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY05007.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY05008.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=453

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            TP +DKQ++VAKQ+  +VLLYNYYHRK++   EYL F+ FC+L +  KP L  +MN   S
Sbjct  34   TPTLDKQQAVAKQVRAVVLLYNYYHRKRHLHLEYLGFEPFCKLALVAKPNLKSYMNLMLS  93

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             SD  EL+D   Q S+TEKAI+ AC++S+ LDAS+  P  +GW +SKV++ L+D +KE
Sbjct  94   -SDDTELSDLGKQISLTEKAIKDACDISTSLDASREVPSTKGWPVSKVAIFLIDLRKE  150



>gb|KCW57608.1| hypothetical protein EUGRSUZ_H00375 [Eucalyptus grandis]
Length=515

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            +P   +Q+SVAKQ+H +V+LYNYYHR+Q+ Q E+L F+SFC+L+  LKP L  +M C + 
Sbjct  34   SPSPSQQQSVAKQVHGVVILYNYYHRRQHRQLEFLGFESFCKLIAVLKPPLLAYMKCLQ-  92

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            ++D  EL D E Q S+ EK I  AC+L   L+ASK  P +EGW IS+V+V L+DS+KE
Sbjct  93   RNDDAELVDPEKQLSLMEKTIMNACDLCMGLNASKDIPDIEGWSISEVAVFLVDSRKE  150



>ref|XP_006443052.1| hypothetical protein CICLE_v10020801mg [Citrus clementina]
 gb|ESR56292.1| hypothetical protein CICLE_v10020801mg [Citrus clementina]
Length=359

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = +1

Query  226  QRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVE  405
            Q+SVAKQ+H +VLL+NYYH KQ+ Q ++  F+SF +L V LKP L  HM   +  +DS E
Sbjct  41   QQSVAKQVHAVVLLHNYYHIKQHRQLKFEGFESFSKLAVVLKPTLLAHMKLLQRSNDS-E  99

Query  406  LNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            L+D + Q S+TEK I  AC++S+ LDASK  P  EGW ISKV+VLL+DS+KE
Sbjct  100  LDDPDKQLSVTEKKIMDACDISNSLDASKDIPSTEGWPISKVAVLLIDSRKE  151



>ref|XP_003597511.1| hypothetical protein MTR_2g098830 [Medicago truncatula]
Length=1588

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 87/117 (74%), Gaps = 3/117 (3%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQ  390
            PP+ +Q+ VAKQ+H +VLLYNYYHRKQ P+ E++ F +FC+L+V L+P L  +M   K  
Sbjct  34   PPLSQQQKVAKQVHAVVLLYNYYHRKQNPELEFVAFSAFCKLIVDLRPALLPYM---KFT  90

Query  391  SDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
               V+L D E Q S+TEKAI  + ++ ++LDASK+ P +EGW ISKV+VLL+DSKKE
Sbjct  91   QKPVDLVDVEQQLSLTEKAIVSSYDICTLLDASKSVPNIEGWPISKVAVLLVDSKKE  147


 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  211   PPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQ  390
             P I +Q+ VAKQ+H +VLLYNYYHRK++P+ E++ FK FC+L+V L+P L  +M   + +
Sbjct  965   PSISQQQKVAKQVHSVVLLYNYYHRKRHPELEFVAFKDFCKLIVGLRPALLIYMKFTQ-K  1023

Query  391   SDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
              D  +L D E Q S+TEKAI  +C++ + LDASK  P +EGW +SKV++LL+DSK E
Sbjct  1024  PDQTDLVDVEQQLSLTEKAIASSCDICTCLDASKNVPNIEGWPVSKVAILLVDSKME  1080



>gb|AES67762.2| aleurone layer morphogenesis protein [Medicago truncatula]
Length=1566

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 87/117 (74%), Gaps = 3/117 (3%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQ  390
            PP+ +Q+ VAKQ+H +VLLYNYYHRKQ P+ E++ F +FC+L+V L+P L  +M   K  
Sbjct  34   PPLSQQQKVAKQVHAVVLLYNYYHRKQNPELEFVAFSAFCKLIVDLRPALLPYM---KFT  90

Query  391  SDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
               V+L D E Q S+TEKAI  + ++ ++LDASK+ P +EGW ISKV+VLL+DSKKE
Sbjct  91   QKPVDLVDVEQQLSLTEKAIVSSYDICTLLDASKSVPNIEGWPISKVAVLLVDSKKE  147


 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  211   PPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQ  390
             P I +Q+ VAKQ+H +VLLYNYYHRK++P+ E++ FK FC+L+V L+P L  +M   + +
Sbjct  945   PSISQQQKVAKQVHSVVLLYNYYHRKRHPELEFVAFKDFCKLIVGLRPALLIYMKFTQ-K  1003

Query  391   SDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
              D  +L D E Q S+TEKAI  +C++ + LDASK  P +EGW +SKV++LL+DSK E
Sbjct  1004  PDQTDLVDVEQQLSLTEKAIASSCDICTCLDASKNVPNIEGWPVSKVAILLVDSKME  1060



>ref|XP_006478769.1| PREDICTED: uncharacterized protein LOC102615607 [Citrus sinensis]
Length=649

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            TP    Q+SVAKQ+H +VLL+NYYH KQ+ Q ++  F+SF +L V LKP L  HM   + 
Sbjct  35   TPSESLQQSVAKQVHAVVLLHNYYHIKQHRQLKFEGFESFSKLAVVLKPTLLAHMKLLQR  94

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             +DS EL+D + Q S+TEK I  AC++S+ LDASK  P  EGW ISKV+VLL+DS+KE
Sbjct  95   SNDS-ELDDPDKQLSVTEKKIMDACDISNSLDASKDIPSTEGWPISKVAVLLIDSRKE  151



>ref|XP_007034080.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY05006.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=550

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            TP +DKQ++VAKQ+  +VLLYNYYHRK++   EYL F+ FC+L +  KP L  +MN   S
Sbjct  34   TPTLDKQQAVAKQVRAVVLLYNYYHRKRHLHLEYLGFEPFCKLALVAKPNLKSYMNLMLS  93

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             SD  EL+D   Q S+TEKAI+ AC++S+ LDAS+  P  +GW +SKV++ L+D +KE
Sbjct  94   -SDDTELSDLGKQISLTEKAIKDACDISTSLDASREVPSTKGWPVSKVAIFLIDLRKE  150



>gb|KEH39474.1| aleurone layer morphogenesis protein [Medicago truncatula]
Length=1299

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQ  390
            P I +Q+ VAKQ+H +VLLYNYYHRK++P+ E++ FK FC+L+V L+P L  +M   + +
Sbjct  678  PSISQQQKVAKQVHSVVLLYNYYHRKRHPELEFVAFKDFCKLIVGLRPALLIYMKFTQ-K  736

Query  391  SDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             D  +L D E Q S+TEKAI  +C++ + LDASK  P +EGW +SKV++LL+DSK E
Sbjct  737  PDQTDLVDVEQQLSLTEKAIASSCDICTCLDASKNVPNIEGWPVSKVAILLVDSKME  793



>ref|XP_002533047.1| hypothetical protein RCOM_0068670 [Ricinus communis]
 gb|EEF29337.1| hypothetical protein RCOM_0068670 [Ricinus communis]
Length=624

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            TP    Q  V KQ+H +VLLYNYY+RKQ+P  EYL F++FC+L V L+P L  H+   + 
Sbjct  39   TPTQFDQELVGKQVHAVVLLYNYYYRKQHPHLEYLGFENFCKLAVILRPTLLAHLKLMQL  98

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             +D+ EL++ E + S+TEK I  AC++S+ LDAS+  P +EGW ISKV+V L+D KKE
Sbjct  99   SNDT-ELDNLEEEVSLTEKMIMDACDISTTLDASRQAPTIEGWPISKVAVFLIDLKKE  155



>ref|XP_004507329.1| PREDICTED: uncharacterized protein LOC101495369 [Cicer arietinum]
Length=654

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQ  390
            P + +Q+ +AKQ+H +VLLYNYYHRK +P+ EYL F  FC+L V L+P L  +M   + +
Sbjct  36   PTLSQQQLIAKQVHSVVLLYNYYHRKHHPELEYLPFNEFCKLSVVLRPALLAYMQFMQ-K  94

Query  391  SDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             + VEL D E Q S+TEK I  AC++   LDASK  P +EGW +SKV++LL+DSKKE
Sbjct  95   VNEVELIDVEKQLSLTEKVIMDACDVCKRLDASKNVPNIEGWPVSKVAILLIDSKKE  151



>gb|KCW57607.1| hypothetical protein EUGRSUZ_H00375 [Eucalyptus grandis]
Length=633

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            +P   +Q+SVAKQ+H +V+LYNYYHR+Q+ Q E+L F+SFC+L+  LKP L  +M C + 
Sbjct  34   SPSPSQQQSVAKQVHGVVILYNYYHRRQHRQLEFLGFESFCKLIAVLKPPLLAYMKCLQ-  92

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            ++D  EL D E Q S+ EK I  AC+L   L+ASK  P +EGW IS+V+V L+DS+KE
Sbjct  93   RNDDAELVDPEKQLSLMEKTIMNACDLCMGLNASKDIPDIEGWSISEVAVFLVDSRKE  150



>gb|KCW62653.1| hypothetical protein EUGRSUZ_G001881, partial [Eucalyptus grandis]
Length=287

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            +P   +Q+ VAKQ+H +V+LYNYYHRKQ+ Q E+L F+SFC+L+  LKP L  +M   + 
Sbjct  34   SPSPSQQQWVAKQVHGVVILYNYYHRKQHRQLEFLGFESFCKLIAVLKPPLLAYMKYLQ-  92

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            ++D  EL D E Q S+TEK I  AC+L   L ASK  P +EGW IS+V+V L+DS+KE
Sbjct  93   RNDDAELVDPEKQLSLTEKTIMNACDLCMRLSASKDIPDIEGWSISEVAVFLVDSRKE  150



>ref|XP_009616030.1| PREDICTED: uncharacterized protein LOC104108651 isoform X4 [Nicotiana 
tomentosiformis]
Length=541

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYP--QAEYLDFKSFCELVVTLKPVLAWHMNCKK  384
            P +D+QRS+AK +  +VLLYNYY+RKQ+   + E+L+F SFC+L V LKP L  +M   +
Sbjct  38   PTLDQQRSMAKHVEAVVLLYNYYYRKQHQDHKIEFLNFTSFCQLAVVLKPSLVTYMKLMR  97

Query  385  SQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             +SD  +++D E+Q S+TEKAI  AC++SS LDA++ +P+ E W ISKV V L+DS++E
Sbjct  98   -RSDYTDVDDLESQISLTEKAIMRACDISSALDAAQVDPLSEKWPISKVVVFLVDSRRE  155



>ref|XP_009616031.1| PREDICTED: uncharacterized protein LOC104108651 isoform X5 [Nicotiana 
tomentosiformis]
Length=516

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYP--QAEYLDFKSFCELVVTLKPVLAWHMNCKK  384
            P +D+QRS+AK +  +VLLYNYY+RKQ+   + E+L+F SFC+L V LKP L  +M   +
Sbjct  38   PTLDQQRSMAKHVEAVVLLYNYYYRKQHQDHKIEFLNFTSFCQLAVVLKPSLVTYMKLMR  97

Query  385  SQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             +SD  +++D E+Q S+TEKAI  AC++SS LDA++ +P+ E W ISKV V L+DS++E
Sbjct  98   -RSDYTDVDDLESQISLTEKAIMRACDISSALDAAQVDPLSEKWPISKVVVFLVDSRRE  155



>ref|XP_010650543.1| PREDICTED: uncharacterized protein LOC104879453 isoform X3 [Vitis 
vinifera]
Length=624

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = +1

Query  223  KQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSV  402
            +Q+SVAKQ+H +VLLYNYYHRKQ+ Q E+L F+ FC+L V LKP L  HM   +    + 
Sbjct  39   QQQSVAKQVHAVVLLYNYYHRKQHQQLEFLGFEPFCKLAVVLKPSLLSHMKLMQILK-TG  97

Query  403  ELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            EL+D EN  S TEK +  AC++S+ L+ASK  P  EGW ISKV+V L+DS+KE
Sbjct  98   ELDDLENHLSATEKMVMDACDISTSLNASKDVPNTEGWPISKVTVFLVDSRKE  150



>ref|XP_007034079.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY05005.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=673

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            TP +DKQ++VAKQ+  +VLLYNYYHRK++   EYL F+ FC+L +  KP L  +MN   S
Sbjct  34   TPTLDKQQAVAKQVRAVVLLYNYYHRKRHLHLEYLGFEPFCKLALVAKPNLKSYMNLMLS  93

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             SD  EL+D   Q S+TEKAI+ AC++S+ LDAS+  P  +GW +SKV++ L+D +KE
Sbjct  94   -SDDTELSDLGKQISLTEKAIKDACDISTSLDASREVPSTKGWPVSKVAIFLIDLRKE  150



>ref|XP_010650542.1| PREDICTED: uncharacterized protein LOC104879453 isoform X2 [Vitis 
vinifera]
 emb|CBI36653.3| unnamed protein product [Vitis vinifera]
Length=691

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = +1

Query  223  KQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSV  402
            +Q+SVAKQ+H +VLLYNYYHRKQ+ Q E+L F+ FC+L V LKP L  HM   +    + 
Sbjct  39   QQQSVAKQVHAVVLLYNYYHRKQHQQLEFLGFEPFCKLAVVLKPSLLSHMKLMQILK-TG  97

Query  403  ELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            EL+D EN  S TEK +  AC++S+ L+ASK  P  EGW ISKV+V L+DS+KE
Sbjct  98   ELDDLENHLSATEKMVMDACDISTSLNASKDVPNTEGWPISKVTVFLVDSRKE  150



>ref|XP_010650537.1| PREDICTED: uncharacterized protein LOC104879453 isoform X1 [Vitis 
vinifera]
 ref|XP_010650538.1| PREDICTED: uncharacterized protein LOC104879453 isoform X1 [Vitis 
vinifera]
 ref|XP_010650539.1| PREDICTED: uncharacterized protein LOC104879453 isoform X1 [Vitis 
vinifera]
 ref|XP_010650540.1| PREDICTED: uncharacterized protein LOC104879453 isoform X1 [Vitis 
vinifera]
 ref|XP_010650541.1| PREDICTED: uncharacterized protein LOC104879453 isoform X1 [Vitis 
vinifera]
Length=692

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = +1

Query  223  KQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSV  402
            +Q+SVAKQ+H +VLLYNYYHRKQ+ Q E+L F+ FC+L V LKP L  HM   +    + 
Sbjct  39   QQQSVAKQVHAVVLLYNYYHRKQHQQLEFLGFEPFCKLAVVLKPSLLSHMKLMQILK-TG  97

Query  403  ELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            EL+D EN  S TEK +  AC++S+ L+ASK  P  EGW ISKV+V L+DS+KE
Sbjct  98   ELDDLENHLSATEKMVMDACDISTSLNASKDVPNTEGWPISKVTVFLVDSRKE  150



>ref|XP_009616029.1| PREDICTED: uncharacterized protein LOC104108651 isoform X3 [Nicotiana 
tomentosiformis]
Length=572

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYP--QAEYLDFKSFCELVVTLKPVLAWHMNCKK  384
            P +D+QRS+AK +  +VLLYNYY+RKQ+   + E+L+F SFC+L V LKP L  +M   +
Sbjct  38   PTLDQQRSMAKHVEAVVLLYNYYYRKQHQDHKIEFLNFTSFCQLAVVLKPSLVTYMKLMR  97

Query  385  SQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             +SD  +++D E+Q S+TEKAI  AC++SS LDA++ +P+ E W ISKV V L+DS++E
Sbjct  98   -RSDYTDVDDLESQISLTEKAIMRACDISSALDAAQVDPLSEKWPISKVVVFLVDSRRE  155



>gb|KGN45995.1| hypothetical protein Csa_6G042290 [Cucumis sativus]
Length=316

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 87/129 (67%), Gaps = 3/129 (2%)
 Frame = +1

Query  178  PHLPVCIPS-GTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP    S   PP    +SVAKQ+H +VLLYN+YH+KQ+P  E+L F++FC+L V +KP
Sbjct  23   PMLPAKSSSRENPPEALLQSVAKQMHAVVLLYNFYHQKQHPHLEFLSFETFCKLAVIIKP  82

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L  HM   +S SD +EL + E Q S  EKAI  AC++++ L+AS    V EGW +SKV+
Sbjct  83   ALLSHMKLMQS-SDDIELENPEKQLSPAEKAIMDACDIATCLEASTDENV-EGWPLSKVA  140

Query  535  VLLLDSKKE  561
            V L+DSKKE
Sbjct  141  VFLVDSKKE  149



>ref|XP_009616028.1| PREDICTED: uncharacterized protein LOC104108651 isoform X2 [Nicotiana 
tomentosiformis]
Length=578

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYP--QAEYLDFKSFCELVVTLKPVLAWHMNCKK  384
            P +D+QRS+AK +  +VLLYNYY+RKQ+   + E+L+F SFC+L V LKP L  +M   +
Sbjct  38   PTLDQQRSMAKHVEAVVLLYNYYYRKQHQDHKIEFLNFTSFCQLAVVLKPSLVTYMKLMR  97

Query  385  SQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             +SD  +++D E+Q S+TEKAI  AC++SS LDA++ +P+ E W ISKV V L+DS++E
Sbjct  98   -RSDYTDVDDLESQISLTEKAIMRACDISSALDAAQVDPLSEKWPISKVVVFLVDSRRE  155



>ref|XP_009616027.1| PREDICTED: uncharacterized protein LOC104108651 isoform X1 [Nicotiana 
tomentosiformis]
Length=579

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYP--QAEYLDFKSFCELVVTLKPVLAWHMNCKK  384
            P +D+QRS+AK +  +VLLYNYY+RKQ+   + E+L+F SFC+L V LKP L  +M   +
Sbjct  38   PTLDQQRSMAKHVEAVVLLYNYYYRKQHQDHKIEFLNFTSFCQLAVVLKPSLVTYMKLMR  97

Query  385  SQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             +SD  +++D E+Q S+TEKAI  AC++SS LDA++ +P+ E W ISKV V L+DS++E
Sbjct  98   -RSDYTDVDDLESQISLTEKAIMRACDISSALDAAQVDPLSEKWPISKVVVFLVDSRRE  155



>ref|XP_010672149.1| PREDICTED: uncharacterized protein LOC104888776 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010672150.1| PREDICTED: uncharacterized protein LOC104888776 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=796

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 77/109 (71%), Gaps = 4/109 (4%)
 Frame = +1

Query  235  VAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVELND  414
            VAKQ+H +VLLYNYYHRKQ+P   +L+FKSFC++ V LKP L  H       ++  EL+D
Sbjct  39   VAKQVHAVVLLYNYYHRKQHPGLAFLEFKSFCKMAVALKPNLQLHF----GMTNHTELDD  94

Query  415  SENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             E   S+TEKAI  AC+ S  LDASK N ++E W I+KV+V L+DS+KE
Sbjct  95   VEKHLSLTEKAIMNACDTSKSLDASKDNQIVESWPITKVAVFLVDSRKE  143



>ref|XP_010672147.1| PREDICTED: uncharacterized protein LOC104888776 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010672148.1| PREDICTED: uncharacterized protein LOC104888776 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=797

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 77/109 (71%), Gaps = 4/109 (4%)
 Frame = +1

Query  235  VAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVELND  414
            VAKQ+H +VLLYNYYHRKQ+P   +L+FKSFC++ V LKP L  H       ++  EL+D
Sbjct  39   VAKQVHAVVLLYNYYHRKQHPGLAFLEFKSFCKMAVALKPNLQLHF----GMTNHTELDD  94

Query  415  SENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             E   S+TEKAI  AC+ S  LDASK N ++E W I+KV+V L+DS+KE
Sbjct  95   VEKHLSLTEKAIMNACDTSKSLDASKDNQIVESWPITKVAVFLVDSRKE  143



>gb|KCW62646.1| hypothetical protein EUGRSUZ_G00179 [Eucalyptus grandis]
Length=331

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            +P   +Q+ VAKQ+H +V+LY+YYHRKQ+ Q E+L F+SFC+L+  LKP L  +M   + 
Sbjct  34   SPSPSQQQRVAKQVHGVVILYDYYHRKQHRQLEFLGFESFCKLIAVLKPPLLAYMKYLQ-  92

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            ++D  EL D E Q S+TEK I  AC+L   L ASK  P +EGW IS+V+V L+DS+KE
Sbjct  93   RNDDAELVDPEKQLSLTEKTIMNACDLCMRLSASKDIPDIEGWSISEVAVFLVDSRKE  150



>ref|XP_008445722.1| PREDICTED: uncharacterized protein LOC103488666 isoform X5 [Cucumis 
melo]
Length=561

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = +1

Query  178  PHLPVCIPS-GTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP    S   PP    +SVAKQ+H +VLLYN+YHRKQ+P  E+L F++FC+L V +KP
Sbjct  23   PMLPAKSSSRENPPEALLQSVAKQMHAVVLLYNFYHRKQHPHLEFLSFEAFCKLAVIVKP  82

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L  HM   +S SD +EL + E Q S  EKAI  AC++++ L+AS  +  +EGW +SKV+
Sbjct  83   ALLSHMKLMQS-SDDIELENPEKQLSPAEKAIMDACDIATCLEAS-PDENIEGWPLSKVA  140

Query  535  VLLLDSKKE  561
            V L+DSKKE
Sbjct  141  VFLVDSKKE  149



>gb|KHN33313.1| hypothetical protein glysoja_005355 [Glycine soja]
Length=701

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 84/132 (64%), Gaps = 10/132 (8%)
 Frame = +1

Query  178  PHLPV--CIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLK  351
            P LP     P   P   +Q  VAKQ+H +VLLYNYYHRKQYP+  +L F  FC+L + L+
Sbjct  24   PVLPAKPSTPDNPPSPSQQHLVAKQVHSVVLLYNYYHRKQYPELAFLPFVEFCKLALVLR  83

Query  352  PVLAWHMNC--KKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEIS  525
            P L+ HM    K  +++ VE      Q S+TE  I  ACN+ + LDASK  P +EGW IS
Sbjct  84   PTLSVHMKSMLKPDETELVE------QLSLTEDKILNACNICTCLDASKNVPDVEGWPIS  137

Query  526  KVSVLLLDSKKE  561
            KVSVLL+DSKKE
Sbjct  138  KVSVLLIDSKKE  149



>ref|XP_008445720.1| PREDICTED: uncharacterized protein LOC103488666 isoform X4 [Cucumis 
melo]
Length=580

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = +1

Query  178  PHLPVCIPS-GTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP    S   PP    +SVAKQ+H +VLLYN+YHRKQ+P  E+L F++FC+L V +KP
Sbjct  23   PMLPAKSSSRENPPEALLQSVAKQMHAVVLLYNFYHRKQHPHLEFLSFEAFCKLAVIVKP  82

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L  HM   +S SD +EL + E Q S  EKAI  AC++++ L+AS  +  +EGW +SKV+
Sbjct  83   ALLSHMKLMQS-SDDIELENPEKQLSPAEKAIMDACDIATCLEAS-PDENIEGWPLSKVA  140

Query  535  VLLLDSKKE  561
            V L+DSKKE
Sbjct  141  VFLVDSKKE  149



>ref|XP_006597233.1| PREDICTED: uncharacterized protein LOC102670361 isoform X1 [Glycine 
max]
 ref|XP_006597234.1| PREDICTED: uncharacterized protein LOC102670361 isoform X2 [Glycine 
max]
 ref|XP_006597235.1| PREDICTED: uncharacterized protein LOC102670361 isoform X3 [Glycine 
max]
Length=782

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 84/132 (64%), Gaps = 10/132 (8%)
 Frame = +1

Query  178  PHLPV--CIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLK  351
            P LP     P   P   +Q  VAKQ+H +VLLYNYYHRKQYP+  +L F  FC+L + L+
Sbjct  24   PVLPAKPSTPDNPPSPSQQHLVAKQVHSVVLLYNYYHRKQYPELAFLPFVEFCKLALVLR  83

Query  352  PVLAWHMNC--KKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEIS  525
            P L+ HM    K  +++ VE      Q S+TE  I  ACN+ + LDASK  P +EGW IS
Sbjct  84   PTLSVHMKSMLKPDETELVE------QLSLTEDKILNACNICTCLDASKNVPDVEGWPIS  137

Query  526  KVSVLLLDSKKE  561
            KVSVLL+DSKKE
Sbjct  138  KVSVLLIDSKKE  149



>ref|XP_006597236.1| PREDICTED: uncharacterized protein LOC102670361 isoform X4 [Glycine 
max]
Length=781

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 84/132 (64%), Gaps = 10/132 (8%)
 Frame = +1

Query  178  PHLPV--CIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLK  351
            P LP     P   P   +Q  VAKQ+H +VLLYNYYHRKQYP+  +L F  FC+L + L+
Sbjct  24   PVLPAKPSTPDNPPSPSQQHLVAKQVHSVVLLYNYYHRKQYPELAFLPFVEFCKLALVLR  83

Query  352  PVLAWHMNC--KKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEIS  525
            P L+ HM    K  +++ VE      Q S+TE  I  ACN+ + LDASK  P +EGW IS
Sbjct  84   PTLSVHMKSMLKPDETELVE------QLSLTEDKILNACNICTCLDASKNVPDVEGWPIS  137

Query  526  KVSVLLLDSKKE  561
            KVSVLL+DSKKE
Sbjct  138  KVSVLLIDSKKE  149



>ref|XP_008445719.1| PREDICTED: uncharacterized protein LOC103488666 isoform X3 [Cucumis 
melo]
Length=620

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = +1

Query  178  PHLPVCIPS-GTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP    S   PP    +SVAKQ+H +VLLYN+YHRKQ+P  E+L F++FC+L V +KP
Sbjct  23   PMLPAKSSSRENPPEALLQSVAKQMHAVVLLYNFYHRKQHPHLEFLSFEAFCKLAVIVKP  82

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L  HM   +S SD +EL + E Q S  EKAI  AC++++ L+AS  +  +EGW +SKV+
Sbjct  83   ALLSHMKLMQS-SDDIELENPEKQLSPAEKAIMDACDIATCLEAS-PDENIEGWPLSKVA  140

Query  535  VLLLDSKKE  561
            V L+DSKKE
Sbjct  141  VFLVDSKKE  149



>ref|XP_004486922.1| PREDICTED: uncharacterized protein LOC101510515 isoform X1 [Cicer 
arietinum]
 ref|XP_004486923.1| PREDICTED: uncharacterized protein LOC101510515 isoform X2 [Cicer 
arietinum]
Length=660

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 86/130 (66%), Gaps = 3/130 (2%)
 Frame = +1

Query  178  PHLPV--CIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLK  351
            P LP    I    P + +Q  VAKQ+H  VLLYNYYHRKQ P+ E++ FK FC+L V L+
Sbjct  23   PMLPEKPSIRDEEPALSQQHKVAKQVHSAVLLYNYYHRKQNPELEFVAFKDFCKLFVNLR  82

Query  352  PVLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKV  531
            P L  +M   + + D  +L D + Q S+TEK I  +C++ + LDASK  P +EGW I+KV
Sbjct  83   PALLPYMKFTQ-KPDETDLVDVDQQLSLTEKEIASSCDICTHLDASKNVPNIEGWPITKV  141

Query  532  SVLLLDSKKE  561
            +VLL++SKKE
Sbjct  142  AVLLVNSKKE  151



>gb|KDO36965.1| hypothetical protein CISIN_1g046099mg, partial [Citrus sinensis]
Length=174

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +1

Query  247  LHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVELNDSENQ  426
            +H +VLLYNYYH KQ+ Q ++  F+SF +L V LKP L  HM   +  +DS EL+D + Q
Sbjct  2    VHAVVLLYNYYHIKQHRQLKFEGFESFSKLAVVLKPTLLAHMKLLQRSNDS-ELDDPDKQ  60

Query  427  FSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             S+TEK I  AC++S+ LDASK  P  EGW ISKV+VLL+DS+KE
Sbjct  61   LSVTEKKIMDACDISNSLDASKDIPSTEGWPISKVAVLLIDSRKE  105



>ref|XP_008445716.1| PREDICTED: uncharacterized protein LOC103488666 isoform X1 [Cucumis 
melo]
 ref|XP_008445717.1| PREDICTED: uncharacterized protein LOC103488666 isoform X1 [Cucumis 
melo]
Length=683

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = +1

Query  178  PHLPVCIPS-GTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP    S   PP    +SVAKQ+H +VLLYN+YHRKQ+P  E+L F++FC+L V +KP
Sbjct  23   PMLPAKSSSRENPPEALLQSVAKQMHAVVLLYNFYHRKQHPHLEFLSFEAFCKLAVIVKP  82

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L  HM   +S SD +EL + E Q S  EKAI  AC++++ L+AS  +  +EGW +SKV+
Sbjct  83   ALLSHMKLMQS-SDDIELENPEKQLSPAEKAIMDACDIATCLEAS-PDENIEGWPLSKVA  140

Query  535  VLLLDSKKE  561
            V L+DSKKE
Sbjct  141  VFLVDSKKE  149



>ref|XP_008445718.1| PREDICTED: uncharacterized protein LOC103488666 isoform X2 [Cucumis 
melo]
Length=683

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = +1

Query  178  PHLPVCIPS-GTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP    S   PP    +SVAKQ+H +VLLYN+YHRKQ+P  E+L F++FC+L V +KP
Sbjct  23   PMLPAKSSSRENPPEALLQSVAKQMHAVVLLYNFYHRKQHPHLEFLSFEAFCKLAVIVKP  82

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L  HM   +S SD +EL + E Q S  EKAI  AC++++ L+AS  +  +EGW +SKV+
Sbjct  83   ALLSHMKLMQS-SDDIELENPEKQLSPAEKAIMDACDIATCLEAS-PDENIEGWPLSKVA  140

Query  535  VLLLDSKKE  561
            V L+DSKKE
Sbjct  141  VFLVDSKKE  149



>ref|XP_006443055.1| hypothetical protein CICLE_v100233381mg, partial [Citrus clementina]
 gb|ESR56295.1| hypothetical protein CICLE_v100233381mg, partial [Citrus clementina]
Length=218

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = +1

Query  232  SVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVELN  411
            SV   +H +VLLYNYYH KQ+ Q ++  F+SF +L V LKP L  HM   +  +DS EL+
Sbjct  8    SVIPMVHAVVLLYNYYHIKQHRQLKFEGFESFSKLAVVLKPTLLAHMKLLQRSNDS-ELD  66

Query  412  DSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            D + Q S+TEK I  AC++S+ LDASK  P  EGW ISKV+VLL+DS+KE
Sbjct  67   DPDKQLSVTEKKIMDACDISNSLDASKDIPSTEGWPISKVAVLLIDSRKE  116



>ref|XP_010067983.1| PREDICTED: uncharacterized protein LOC104454786 [Eucalyptus grandis]
Length=607

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            +P   +Q+ VAKQ+H +V+LYNYYHRKQ+ Q E+L F+SFC+L+  LKP L  +M   + 
Sbjct  34   SPSPSQQQWVAKQVHGVVILYNYYHRKQHRQLEFLGFESFCKLIAVLKPPLLAYMKYLQ-  92

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            ++D  EL D E Q S+TEK I  AC+L   L ASK  P +EGW IS+V+V L+DS+KE
Sbjct  93   RNDDAELVDPEKQLSLTEKTIMNACDLCMRLSASKDIPDIEGWSISEVAVFLVDSRKE  150



>ref|XP_004140981.1| PREDICTED: uncharacterized protein LOC101206764 [Cucumis sativus]
Length=632

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 87/129 (67%), Gaps = 3/129 (2%)
 Frame = +1

Query  178  PHLPVCIPS-GTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP    S   PP    +SVAKQ+H +VLLYN+YH+KQ+P  E+L F++FC+L V +KP
Sbjct  23   PMLPAKSSSRENPPEALLQSVAKQMHAVVLLYNFYHQKQHPHLEFLSFETFCKLAVIIKP  82

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L  HM   +S SD +EL + E Q S  EKAI  AC++++ L+AS    V EGW +SKV+
Sbjct  83   ALLSHMKLMQS-SDDIELENPEKQLSPAEKAIMDACDIATCLEASTDENV-EGWPLSKVA  140

Query  535  VLLLDSKKE  561
            V L+DSKKE
Sbjct  141  VFLVDSKKE  149



>ref|XP_009795178.1| PREDICTED: uncharacterized protein LOC104241913 isoform X3 [Nicotiana 
sylvestris]
Length=509

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYP--QAEYLDFKSFCELVVTLKPVLAWHMNCKK  384
            P +D+QRS+AKQ+  +VLLYNYY+RKQ+   + E+L+F SFC+L V LKP L  +M   +
Sbjct  38   PTLDQQRSMAKQVEAVVLLYNYYYRKQHQDHKIEFLNFTSFCQLAVVLKPSLITYMELMR  97

Query  385  SQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             + D  +++D E+Q S+TE+AI  AC++SS LDA++A+P+   W  SKV V L+DS++E
Sbjct  98   -RPDYTDVDDLESQISLTERAIMRACDISSALDAAQADPLSGTWPTSKVVVFLVDSRRE  155



>ref|XP_006590945.1| PREDICTED: uncharacterized protein LOC102659394 [Glycine max]
Length=681

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 82/129 (64%), Gaps = 2/129 (2%)
 Frame = +1

Query  178  PHLPV-CIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP      G P   +Q+ VAKQ+   VLLYNYYHRKQ+P+  YL F  FC+L V L+P
Sbjct  23   PLLPTKATVQGNPTPSQQKLVAKQVRSAVLLYNYYHRKQHPELAYLPFNEFCKLAVVLRP  82

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L  +M   ++  +  EL D E Q S TEK I  AC++   LDASK  P +EGW I+KVS
Sbjct  83   PLLAYMQFMQNLKEE-ELTDVEKQLSFTEKMIMEACDVCKCLDASKDVPNIEGWPITKVS  141

Query  535  VLLLDSKKE  561
            +LL+DSKKE
Sbjct  142  ILLIDSKKE  150



>gb|KHN06212.1| hypothetical protein glysoja_031654 [Glycine soja]
Length=664

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 82/129 (64%), Gaps = 2/129 (2%)
 Frame = +1

Query  178  PHLPV-CIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP      G P   +Q+ VAKQ+   VLLYNYYHRKQ+P+  YL F  FC+L V L+P
Sbjct  23   PLLPTKATVQGNPTPSQQKLVAKQVRSAVLLYNYYHRKQHPELAYLPFNEFCKLAVVLRP  82

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L  +M   ++  +  EL D E Q S TEK I  AC++   LDASK  P +EGW I+KVS
Sbjct  83   PLLAYMQFMQNLKEE-ELTDVEKQLSFTEKMIMEACDVCKCLDASKDVPNIEGWPITKVS  141

Query  535  VLLLDSKKE  561
            +LL+DSKKE
Sbjct  142  ILLIDSKKE  150



>ref|XP_009795177.1| PREDICTED: uncharacterized protein LOC104241913 isoform X2 [Nicotiana 
sylvestris]
Length=571

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYP--QAEYLDFKSFCELVVTLKPVLAWHMNCKK  384
            P +D+QRS+AKQ+  +VLLYNYY+RKQ+   + E+L+F SFC+L V LKP L  +M   +
Sbjct  38   PTLDQQRSMAKQVEAVVLLYNYYYRKQHQDHKIEFLNFTSFCQLAVVLKPSLITYMELMR  97

Query  385  SQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             + D  +++D E+Q S+TE+AI  AC++SS LDA++A+P+   W  SKV V L+DS++E
Sbjct  98   -RPDYTDVDDLESQISLTERAIMRACDISSALDAAQADPLSGTWPTSKVVVFLVDSRRE  155



>ref|XP_009795176.1| PREDICTED: uncharacterized protein LOC104241913 isoform X1 [Nicotiana 
sylvestris]
Length=572

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYP--QAEYLDFKSFCELVVTLKPVLAWHMNCKK  384
            P +D+QRS+AKQ+  +VLLYNYY+RKQ+   + E+L+F SFC+L V LKP L  +M   +
Sbjct  38   PTLDQQRSMAKQVEAVVLLYNYYYRKQHQDHKIEFLNFTSFCQLAVVLKPSLITYMELMR  97

Query  385  SQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             + D  +++D E+Q S+TE+AI  AC++SS LDA++A+P+   W  SKV V L+DS++E
Sbjct  98   -RPDYTDVDDLESQISLTERAIMRACDISSALDAAQADPLSGTWPTSKVVVFLVDSRRE  155



>ref|XP_010907677.1| PREDICTED: uncharacterized protein LOC105034290 [Elaeis guineensis]
Length=751

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 79/129 (61%), Gaps = 3/129 (2%)
 Frame = +1

Query  178  PHLPVCIP-SGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP+ +     P  D+Q +VA+Q+H + LLYNYYHRKQ+PQ E+L F+SFC+     KP
Sbjct  35   PLLPLRVSLQEIPTDDQQEAVARQIHAVALLYNYYHRKQFPQLEFLAFESFCKAASIAKP  94

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L  ++       D     D + Q SITEK I  ACN+S  LDAS   P MEGW ISKV+
Sbjct  95   TLMAYLKYMHKYEDGS--GDLDKQLSITEKKIMDACNISEALDASNNTPNMEGWPISKVA  152

Query  535  VLLLDSKKE  561
            V L++  KE
Sbjct  153  VFLINHTKE  161



>ref|XP_010268285.1| PREDICTED: uncharacterized protein LOC104605278 isoform X6 [Nelumbo 
nucifera]
Length=599

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = +1

Query  244  QLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVELNDSEN  423
            Q+H +VLLYNYYHRKQ+PQ E+LDF SFC++ V  KP L  HM  K  Q  + +  + + 
Sbjct  67   QMHAVVLLYNYYHRKQFPQLEFLDFASFCKVAVNAKPNLLAHM--KFMQGGNADTANLDE  124

Query  424  QFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
              SITEKAI  ACN+   LDASK  P +EGW I++VSVLL+DS K+
Sbjct  125  HLSITEKAIMDACNICLWLDASKDVPSIEGWPITEVSVLLIDSAKK  170



>ref|XP_010268283.1| PREDICTED: uncharacterized protein LOC104605278 isoform X4 [Nelumbo 
nucifera]
Length=604

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = +1

Query  244  QLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVELNDSEN  423
            Q+H +VLLYNYYHRKQ+PQ E+LDF SFC++ V  KP L  HM  K  Q  + +  + + 
Sbjct  67   QMHAVVLLYNYYHRKQFPQLEFLDFASFCKVAVNAKPNLLAHM--KFMQGGNADTANLDE  124

Query  424  QFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
              SITEKAI  ACN+   LDASK  P +EGW I++VSVLL+DS K+
Sbjct  125  HLSITEKAIMDACNICLWLDASKDVPSIEGWPITEVSVLLIDSAKK  170



>ref|XP_010268282.1| PREDICTED: uncharacterized protein LOC104605278 isoform X3 [Nelumbo 
nucifera]
Length=632

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = +1

Query  244  QLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVELNDSEN  423
            Q+H +VLLYNYYHRKQ+PQ E+LDF SFC++ V  KP L  HM  K  Q  + +  + + 
Sbjct  67   QMHAVVLLYNYYHRKQFPQLEFLDFASFCKVAVNAKPNLLAHM--KFMQGGNADTANLDE  124

Query  424  QFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
              SITEKAI  ACN+   LDASK  P +EGW I++VSVLL+DS K+
Sbjct  125  HLSITEKAIMDACNICLWLDASKDVPSIEGWPITEVSVLLIDSAKK  170



>ref|XP_007131958.1| hypothetical protein PHAVU_011G055000g [Phaseolus vulgaris]
 gb|ESW03952.1| hypothetical protein PHAVU_011G055000g [Phaseolus vulgaris]
Length=683

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQ  390
            P   +Q+ VA+Q+   VLLYNY+HRKQ+P+ EYL    FC+L+V L+P L   M   ++ 
Sbjct  35   PSPSQQKLVARQVRSAVLLYNYHHRKQHPELEYLPLNEFCKLIVVLRPALLAFMQFMQN-  93

Query  391  SDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            S+  EL D E Q S+TEK I  AC++   LDASK  P +EGW I+KV++LL+DSKKE
Sbjct  94   SNEEELTDVEKQLSLTEKKIMEACDVCKCLDASKNVPNIEGWPITKVAILLIDSKKE  150



>gb|KHN25284.1| hypothetical protein glysoja_010201 [Glycine soja]
Length=608

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = +1

Query  211  PPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQ  390
            P   +Q+ VA Q+   VLLYNYYHRKQ+P+  YL F  FC+L V L+P L  +M   ++ 
Sbjct  35   PTPSQQKLVANQVRSTVLLYNYYHRKQHPELAYLPFNEFCKLAVVLRPPLLAYMQFMQNL  94

Query  391  SDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            ++  EL D E Q S+TEK I  AC++   LDASK  P +EGW I+KVS+LL+DSKKE
Sbjct  95   NEE-ELTDVEKQLSLTEKMIMEACDVCKCLDASKDAPNIEGWPITKVSMLLIDSKKE  150



>ref|XP_010268280.1| PREDICTED: uncharacterized protein LOC104605278 isoform X1 [Nelumbo 
nucifera]
Length=669

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 74/106 (70%), Gaps = 2/106 (2%)
 Frame = +1

Query  244  QLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVELNDSEN  423
            Q+H +VLLYNYYHRKQ+PQ E+LDF SFC++ V  KP L  HM  K  Q  + +  + + 
Sbjct  67   QMHAVVLLYNYYHRKQFPQLEFLDFASFCKVAVNAKPNLLAHM--KFMQGGNADTANLDE  124

Query  424  QFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
              SITEKAI  ACN+   LDASK  P +EGW I++VSVLL+DS K+
Sbjct  125  HLSITEKAIMDACNICLWLDASKDVPSIEGWPITEVSVLLIDSAKK  170



>ref|XP_010268284.1| PREDICTED: uncharacterized protein LOC104605278 isoform X5 [Nelumbo 
nucifera]
Length=602

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 73/105 (70%), Gaps = 2/105 (2%)
 Frame = +1

Query  247  LHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVELNDSENQ  426
            +H +VLLYNYYHRKQ+PQ E+LDF SFC++ V  KP L  HM  K  Q  + +  + +  
Sbjct  1    MHAVVLLYNYYHRKQFPQLEFLDFASFCKVAVNAKPNLLAHM--KFMQGGNADTANLDEH  58

Query  427  FSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             SITEKAI  ACN+   LDASK  P +EGW I++VSVLL+DS K+
Sbjct  59   LSITEKAIMDACNICLWLDASKDVPSIEGWPITEVSVLLIDSAKK  103



>ref|XP_006342961.1| PREDICTED: uncharacterized protein LOC102581370 [Solanum tuberosum]
Length=561

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = +1

Query  193  CIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYP--QAEYLDFKSFCELVVTLKPVLAW  366
            C     P +D+Q+S+AKQ+  +VLLYNYY+RKQ+   + E+L+F SFC+L V LKP L  
Sbjct  35   CKSKKVPTLDQQKSMAKQVGAVVLLYNYYYRKQHQDQKIEFLNFASFCQLAVVLKPTLMT  94

Query  367  HMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLL  546
            ++     +SD  ++++ E+Q S+TEK I  AC++SS LDA++  P+ + W  SKV+V L+
Sbjct  95   YVKLMH-RSDYTDVDNLESQLSLTEKEIMRACDISSTLDAAEVVPLSQKWPTSKVAVFLV  153

Query  547  DSKKE  561
            DS++E
Sbjct  154  DSRRE  158



>ref|XP_008810770.1| PREDICTED: uncharacterized protein LOC103722106 isoform X3 [Phoenix 
dactylifera]
Length=553

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 79/130 (61%), Gaps = 5/130 (4%)
 Frame = +1

Query  178  PHLPVCIPSGTPPID-KQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP+ +     P D +Q +VA+Q+H +VLLYNYYHRKQ+PQ E+L F++FC+     KP
Sbjct  33   PLLPLRVSQREAPTDDQQEAVARQIHAVVLLYNYYHRKQFPQLEFLAFETFCKAASVAKP  92

Query  355  -VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKV  531
              L +     K    S  LN    Q SITEK I  ACN+S  LDAS   P +EGW I KV
Sbjct  93   SFLTYLKYMHKYDDGSGNLN---KQLSITEKKIMDACNISKSLDASNNAPNIEGWPIFKV  149

Query  532  SVLLLDSKKE  561
            ++ L+D  KE
Sbjct  150  AMFLIDHTKE  159



>ref|XP_008790624.1| PREDICTED: uncharacterized protein LOC103707769 isoform X1 [Phoenix 
dactylifera]
Length=748

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 77/129 (60%), Gaps = 3/129 (2%)
 Frame = +1

Query  178  PHLPVCIP-SGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP+ I     P  D+Q +VA+Q+H +VLLYNYYHRK +PQ E+L F+SFC+      P
Sbjct  34   PLLPLRISLQEAPTDDQQEAVARQIHAVVLLYNYYHRKLFPQLEFLAFESFCKAASIAIP  93

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L  ++       D     D   Q SITEK I  ACN+S  LDAS   P MEGW ISKV+
Sbjct  94   TLLTYLKYMHKYDDGS--GDLHKQMSITEKKIMDACNISEALDASNNAPNMEGWPISKVA  151

Query  535  VLLLDSKKE  561
            V L++  KE
Sbjct  152  VFLINHMKE  160



>ref|XP_008790625.1| PREDICTED: uncharacterized protein LOC103707769 isoform X2 [Phoenix 
dactylifera]
Length=719

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 77/129 (60%), Gaps = 3/129 (2%)
 Frame = +1

Query  178  PHLPVCIP-SGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP+ I     P  D+Q +VA+Q+H +VLLYNYYHRK +PQ E+L F+SFC+      P
Sbjct  34   PLLPLRISLQEAPTDDQQEAVARQIHAVVLLYNYYHRKLFPQLEFLAFESFCKAASIAIP  93

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L  ++       D     D   Q SITEK I  ACN+S  LDAS   P MEGW ISKV+
Sbjct  94   TLLTYLKYMHKYDDGS--GDLHKQMSITEKKIMDACNISEALDASNNAPNMEGWPISKVA  151

Query  535  VLLLDSKKE  561
            V L++  KE
Sbjct  152  VFLINHMKE  160



>ref|XP_008810768.1| PREDICTED: uncharacterized protein LOC103722106 isoform X1 [Phoenix 
dactylifera]
Length=677

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 79/130 (61%), Gaps = 5/130 (4%)
 Frame = +1

Query  178  PHLPVCIPSGTPPID-KQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP+ +     P D +Q +VA+Q+H +VLLYNYYHRKQ+PQ E+L F++FC+     KP
Sbjct  33   PLLPLRVSQREAPTDDQQEAVARQIHAVVLLYNYYHRKQFPQLEFLAFETFCKAASVAKP  92

Query  355  -VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKV  531
              L +     K    S  LN    Q SITEK I  ACN+S  LDAS   P +EGW I KV
Sbjct  93   SFLTYLKYMHKYDDGSGNLN---KQLSITEKKIMDACNISKSLDASNNAPNIEGWPIFKV  149

Query  532  SVLLLDSKKE  561
            ++ L+D  KE
Sbjct  150  AMFLIDHTKE  159



>ref|XP_008810769.1| PREDICTED: uncharacterized protein LOC103722106 isoform X2 [Phoenix 
dactylifera]
Length=676

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 79/130 (61%), Gaps = 5/130 (4%)
 Frame = +1

Query  178  PHLPVCIPSGTPPID-KQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP+ +     P D +Q +VA+Q+H +VLLYNYYHRKQ+PQ E+L F++FC+     KP
Sbjct  33   PLLPLRVSQREAPTDDQQEAVARQIHAVVLLYNYYHRKQFPQLEFLAFETFCKAASVAKP  92

Query  355  -VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKV  531
              L +     K    S  LN    Q SITEK I  ACN+S  LDAS   P +EGW I KV
Sbjct  93   SFLTYLKYMHKYDDGSGNLN---KQLSITEKKIMDACNISKSLDASNNAPNIEGWPIFKV  149

Query  532  SVLLLDSKKE  561
            ++ L+D  KE
Sbjct  150  AMFLIDHTKE  159



>ref|XP_010912110.1| PREDICTED: uncharacterized protein LOC105038115 [Elaeis guineensis]
Length=749

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 79/130 (61%), Gaps = 5/130 (4%)
 Frame = +1

Query  178  PHLPVCIPSGTPPID-KQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP+ + S     D +Q +VA+Q+H +VLLYNYYHRKQ+PQ E+L F++FC+     KP
Sbjct  32   PLLPLRVSSQEALTDDQQEAVARQIHAVVLLYNYYHRKQFPQLEFLAFETFCKAASVAKP  91

Query  355  VLAWHMN-CKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKV  531
             L  ++    K    S  LN    Q SITEK I  ACN+S  LDAS   P +EGW   KV
Sbjct  92   SLLTYLKYMHKYDDGSGNLN---KQLSITEKKIMDACNISKALDASNNAPNIEGWPTFKV  148

Query  532  SVLLLDSKKE  561
            +V L+D  KE
Sbjct  149  AVFLIDHTKE  158



>ref|XP_011026403.1| PREDICTED: uncharacterized protein LOC105127021 isoform X2 [Populus 
euphratica]
Length=693

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 79/113 (70%), Gaps = 7/113 (6%)
 Frame = +1

Query  226  QRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVE  405
            Q S+AKQ+H +VLLYNYYHRKQYPQ E+L F++FC+L V +KP L  H+   +       
Sbjct  45   QESIAKQVHAVVLLYNYYHRKQYPQLEFLCFENFCKLAVVIKPALMAHIRLLQRS-----  99

Query  406  LNDSENQ-FSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             ND+E Q F + E++I  AC++S  LDAS+ +  ++GW ISKV+V L+D +KE
Sbjct  100  -NDTEPQPFPLMEESIMEACSISMSLDASEDDLNIDGWPISKVAVFLVDFRKE  151



>ref|XP_011026398.1| PREDICTED: uncharacterized protein LOC105127021 isoform X1 [Populus 
euphratica]
 ref|XP_011026399.1| PREDICTED: uncharacterized protein LOC105127021 isoform X1 [Populus 
euphratica]
 ref|XP_011026400.1| PREDICTED: uncharacterized protein LOC105127021 isoform X1 [Populus 
euphratica]
 ref|XP_011026401.1| PREDICTED: uncharacterized protein LOC105127021 isoform X1 [Populus 
euphratica]
 ref|XP_011026402.1| PREDICTED: uncharacterized protein LOC105127021 isoform X1 [Populus 
euphratica]
Length=703

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 79/113 (70%), Gaps = 7/113 (6%)
 Frame = +1

Query  226  QRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVE  405
            Q S+AKQ+H +VLLYNYYHRKQYPQ E+L F++FC+L V +KP L  H+   +       
Sbjct  45   QESIAKQVHAVVLLYNYYHRKQYPQLEFLCFENFCKLAVVIKPALMAHIRLLQRS-----  99

Query  406  LNDSENQ-FSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             ND+E Q F + E++I  AC++S  LDAS+ +  ++GW ISKV+V L+D +KE
Sbjct  100  -NDTEPQPFPLMEESIMEACSISMSLDASEDDLNIDGWPISKVAVFLVDFRKE  151



>ref|XP_003597503.1| hypothetical protein MTR_2g098720 [Medicago truncatula]
 gb|AES67754.1| hypothetical protein MTR_2g098720 [Medicago truncatula]
Length=397

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  214  PIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQS  393
            P+ +   VA Q+H +VLL NYYH K   +  +L ++ FC+++V L+P L+ +M     Q 
Sbjct  36   PLSQHEKVANQVHAVVLLNNYYHIKLNQELAFLPYREFCKIIVDLRPSLSAYMKFML-QR  94

Query  394  DSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            D  EL D E Q S+TEKAI  + ++   LDASK  P +EGW ISKV+VLL+DSKKE
Sbjct  95   DYAELVDVEQQLSLTEKAIMSSHDICLSLDASKNEPNIEGWPISKVAVLLVDSKKE  150



>gb|KJB37932.1| hypothetical protein B456_006G227200 [Gossypium raimondii]
 gb|KJB37933.1| hypothetical protein B456_006G227200 [Gossypium raimondii]
 gb|KJB37934.1| hypothetical protein B456_006G227200 [Gossypium raimondii]
 gb|KJB37935.1| hypothetical protein B456_006G227200 [Gossypium raimondii]
 gb|KJB37936.1| hypothetical protein B456_006G227200 [Gossypium raimondii]
Length=666

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 78/118 (66%), Gaps = 5/118 (4%)
 Frame = +1

Query  208  TPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            TP +  Q  VAKQ+H +VLLYNY+ RK++P   YLDF++FC+  + LKP L  HM     
Sbjct  34   TPSLATQELVAKQVHAVVLLYNYFLRKRHPDLRYLDFENFCKWALVLKPNLKSHMKL-MV  92

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            ++D  EL++ E+QFS+ EKAIQ AC +S  LDA  A    +G  +SKVS+LL D  KE
Sbjct  93   RTDDTELSEVESQFSLLEKAIQDACVISRSLDALSA----KGLPVSKVSILLTDLSKE  146



>ref|XP_004235580.1| PREDICTED: uncharacterized protein LOC101261598 [Solanum lycopersicum]
Length=560

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 83/125 (66%), Gaps = 3/125 (2%)
 Frame = +1

Query  193  CIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYP--QAEYLDFKSFCELVVTLKPVLAW  366
            C     P + +Q+S+AKQ+  +V LYNYY+RKQ+   + E+L+F SFC+L V LKP L  
Sbjct  35   CKSKEVPTLYQQKSMAKQVGAVVFLYNYYYRKQHQDQKIEFLNFASFCQLAVVLKPTLMT  94

Query  367  HMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLL  546
            +M     +S   ++++ E+Q S+TEK I  AC++SS LD ++  P+ + W  SKV+V L+
Sbjct  95   YMKLMH-RSVYTDVDNLESQLSLTEKEIMRACDISSTLDDAEVVPLSQKWPTSKVAVFLI  153

Query  547  DSKKE  561
            DS++E
Sbjct  154  DSRRE  158



>ref|XP_003597502.1| hypothetical protein MTR_2g098710 [Medicago truncatula]
 gb|AES67753.1| hypothetical protein MTR_2g098710 [Medicago truncatula]
Length=425

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  214  PIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQS  393
            P+ +   VA Q+H +VLL NYYH K   +  +L ++ FC+++V L+P L+ +M     Q 
Sbjct  35   PLSQHEKVANQVHAVVLLNNYYHIKLNQELAFLPYREFCKIIVDLRPPLSAYMKFM-LQP  93

Query  394  DSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            D  EL D E + S+TEKAI  + ++   LDASK  P +EGW ISKV+VLL+DSKKE
Sbjct  94   DYAELVDVEQKLSLTEKAIMSSHDICLSLDASKHVPNIEGWPISKVAVLLVDSKKE  149



>ref|XP_006417970.1| hypothetical protein EUTSA_v10007042mg [Eutrema salsugineum]
 gb|ESQ36323.1| hypothetical protein EUTSA_v10007042mg [Eutrema salsugineum]
Length=640

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 76/128 (59%), Gaps = 5/128 (4%)
 Frame = +1

Query  178  PHLPVC-IPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LP+   PS  P    Q SVAKQ+H +VLLYNYYHRK++P  E+L  +SF  L   ++P
Sbjct  38   PLLPLKPSPSDAPSKAVQESVAKQVHAVVLLYNYYHRKEHPHLEFLSSESFRSLTTDMRP  97

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
             L  H+     +S   E +    Q  + EK I+ AC LS  LDAS    V++ W + KV+
Sbjct  98   ALLQHLK----KSGEAERDGDSEQTVMLEKVIEDACTLSMSLDASSDFSVLKKWPVKKVA  153

Query  535  VLLLDSKK  558
            VLL+DSKK
Sbjct  154  VLLVDSKK  161



>gb|AES67755.2| hypothetical protein MTR_2g098730 [Medicago truncatula]
Length=426

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  214  PIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQS  393
            P+ +   VA Q+H + LL NYYHRK   +  +L ++ FC+++V L+P ++ +M       
Sbjct  36   PLSQHEKVANQVHSVALLNNYYHRKLNQELAFLPYREFCKIIVDLRPAMSAYMKFT-LLP  94

Query  394  DSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            +  EL D+E Q S+ EKAI  A ++   LDASK +P +EGW ISKV+VLL+D++KE
Sbjct  95   EYAELVDAEQQLSLAEKAIMSAYDICLYLDASKNDPNIEGWPISKVAVLLVDNEKE  150



>ref|XP_006380294.1| hypothetical protein POPTR_0007s02040g, partial [Populus trichocarpa]
 gb|ERP58091.1| hypothetical protein POPTR_0007s02040g, partial [Populus trichocarpa]
Length=619

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 74/106 (70%), Gaps = 7/106 (7%)
 Frame = +1

Query  247  LHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVELNDSENQ  426
            +H +VLLYNYYHRKQYPQ E+L  ++FC+L V +KP L  H+   +        ND+E+Q
Sbjct  1    VHAVVLLYNYYHRKQYPQLEFLCLENFCKLAVVIKPALMAHIRLLQRS------NDTESQ  54

Query  427  -FSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             F + E++I  AC++S  LDAS+ +  ++GW ISKV+V L+DS+KE
Sbjct  55   PFPLMEESIMEACSISMSLDASEDDLNIDGWPISKVAVFLVDSRKE  100



>ref|XP_003597504.1| hypothetical protein MTR_2g098730 [Medicago truncatula]
Length=457

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 76/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  214  PIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQS  393
            P+ +   VA Q+H + LL NYYHRK   +  +L ++ FC+++V L+P ++ +M       
Sbjct  36   PLSQHEKVANQVHSVALLNNYYHRKLNQELAFLPYREFCKIIVDLRPAMSAYMKFT-LLP  94

Query  394  DSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            +  EL D+E Q S+ EKAI  A ++   LDASK +P +EGW ISKV+VLL+D++KE
Sbjct  95   EYAELVDAEQQLSLAEKAIMSAYDICLYLDASKNDPNIEGWPISKVAVLLVDNEKE  150



>gb|EPS72437.1| hypothetical protein M569_02323, partial [Genlisea aurea]
Length=285

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 78/119 (66%), Gaps = 4/119 (3%)
 Frame = +1

Query  214  PIDK--QRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKS  387
            P+ K  Q +VA+Q+H +VLLYNYYHRKQ P+   L F  F +L + LKP L+  M     
Sbjct  29   PLSKSAQNAVAEQMHAVVLLYNYYHRKQNPEQRLLSFHDFSKLAMVLKPNLSPFMKTMM-  87

Query  388  QSDSVELND-SENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            ++   EL D  ++  S+ EKAI+ AC++++ LDAS+     +GW ISK++VLL+DS+ E
Sbjct  88   ENRHTELQDFDDHHLSVVEKAIKNACDVAAALDASEDFSSRKGWPISKLAVLLIDSQCE  146



>ref|XP_008790626.1| PREDICTED: uncharacterized protein LOC103707769 isoform X3 [Phoenix 
dactylifera]
Length=692

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 63/105 (60%), Gaps = 2/105 (2%)
 Frame = +1

Query  247  LHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVELNDSENQ  426
            +H +VLLYNYYHRK +PQ E+L F+SFC+      P L  ++       D     D   Q
Sbjct  2    IHAVVLLYNYYHRKLFPQLEFLAFESFCKAASIAIPTLLTYLKYMHKYDDGS--GDLHKQ  59

Query  427  FSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             SITEK I  ACN+S  LDAS   P MEGW ISKV+V L++  KE
Sbjct  60   MSITEKKIMDACNISEALDASNNAPNMEGWPISKVAVFLINHMKE  104



>ref|XP_003636931.1| hypothetical protein MTR_065s0006 [Medicago truncatula]
Length=231

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 63/105 (60%), Gaps = 25/105 (24%)
 Frame = +1

Query  247  LHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVELNDSENQ  426
            +H +VLLYNYYHRKQ+P+ EYL F  FC+L+V L+P L                      
Sbjct  10   VHSVVLLYNYYHRKQHPELEYLPFNEFCKLIVVLRPPLL---------------------  48

Query  427  FSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
                +K +  AC++ + LDASK  P +EGW ISKVSVLL+DSKKE
Sbjct  49   ----KKGLLDACDICNCLDASKNVPNIEGWPISKVSVLLIDSKKE  89



>ref|XP_004959595.1| PREDICTED: uncharacterized protein LOC101755092 [Setaria italica]
Length=670

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 73/115 (63%), Gaps = 5/115 (4%)
 Frame = +1

Query  220  DKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELV-VTLKPVLAWHMNCKKSQSD  396
            +KQ +VA+Q+H  VLLYNYYHRKQ+PQ E+ D + FC    +T    L  ++N    Q  
Sbjct  48   EKQETVARQMHATVLLYNYYHRKQFPQLEFADPERFCMTASLTAGDALLVYLN----QVH  103

Query  397  SVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
                N + +  S+T+KA+  AC+++  LDA+K +P M  W ISKV+VLLLD  K+
Sbjct  104  DHHGNGAGDGLSVTDKAVIEACDIAEALDATKDSPEMTMWPISKVAVLLLDRTKK  158



>ref|XP_004957337.1| PREDICTED: uncharacterized protein LOC101755893 [Setaria italica]
Length=663

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 71/115 (62%), Gaps = 5/115 (4%)
 Frame = +1

Query  220  DKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELV-VTLKPVLAWHMNCKKSQSD  396
            + Q +VA+Q+H  VLLYNYYHRKQ+PQ E+ D + FC    +T    L  ++N    Q  
Sbjct  43   ENQETVARQMHATVLLYNYYHRKQFPQLEFADPERFCMTASLTAGDALLVYLNQVHDQRG  102

Query  397  SVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
                N +    S+T+KA+  AC+++  LDA+K +P M  W ISKV+VLLLD  K+
Sbjct  103  ----NGAGAGLSVTDKAVVDACDIAEALDATKDSPEMTMWPISKVAVLLLDRAKK  153



>ref|XP_006845219.1| hypothetical protein AMTR_s00005p00253820 [Amborella trichopoda]
 gb|ERN06894.1| hypothetical protein AMTR_s00005p00253820 [Amborella trichopoda]
Length=833

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 77/120 (64%), Gaps = 3/120 (3%)
 Frame = +1

Query  202  SGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCK  381
            S   P  +Q+ VA Q+H  VLLYNYYHR ++PQ E+L F++FC++ V  KP L  +M   
Sbjct  33   SALSPAQEQK-VANQMHAAVLLYNYYHRCEFPQLEFLGFENFCKVAVNAKPNLLTYMKFM  91

Query  382  KSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            K    S +  +   + S+TEK ++ AC+++  L+ASK  P ++ W ++KV+V L+DS ++
Sbjct  92   KEF--STKSTEKYQELSLTEKMVKEACDIAEGLNASKPVPNIQSWPVTKVAVFLIDSMRK  149



>ref|XP_010557073.1| PREDICTED: uncharacterized protein LOC104826195 isoform X4 [Tarenaya 
hassleriana]
Length=587

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 77/129 (60%), Gaps = 5/129 (4%)
 Frame = +1

Query  178  PHLPV-CIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LPV    S  P + +Q  VAKQ+H +V+LYNYYHR+++P  EY+  ++FC++    +P
Sbjct  23   PLLPVKSATSDVPSMAEQEPVAKQVHAVVVLYNYYHRRKHPHLEYMSSEAFCKMAAVFRP  82

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
            VL  ++     + + +E  D+  Q S+ ++ I  AC L + LD   A+  +E W I +V 
Sbjct  83   VLLQYLK----EPNEIEQCDASQQTSLVKRVIMNACGLCTNLDVLPASSSIEKWPIGEVV  138

Query  535  VLLLDSKKE  561
            + L+DS ++
Sbjct  139  IFLVDSDRK  147



>ref|XP_010557074.1| PREDICTED: uncharacterized protein LOC104826195 isoform X5 [Tarenaya 
hassleriana]
Length=584

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 77/129 (60%), Gaps = 5/129 (4%)
 Frame = +1

Query  178  PHLPV-CIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LPV    S  P + +Q  VAKQ+H +V+LYNYYHR+++P  EY+  ++FC++    +P
Sbjct  23   PLLPVKSATSDVPSMAEQEPVAKQVHAVVVLYNYYHRRKHPHLEYMSSEAFCKMAAVFRP  82

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
            VL  ++     + + +E  D+  Q S+ ++ I  AC L + LD   A+  +E W I +V 
Sbjct  83   VLLQYLK----EPNEIEQCDASQQTSLVKRVIMNACGLCTNLDVLPASSSIEKWPIGEVV  138

Query  535  VLLLDSKKE  561
            + L+DS ++
Sbjct  139  IFLVDSDRK  147



>ref|XP_010557072.1| PREDICTED: uncharacterized protein LOC104826195 isoform X3 [Tarenaya 
hassleriana]
Length=674

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 77/129 (60%), Gaps = 5/129 (4%)
 Frame = +1

Query  178  PHLPV-CIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LPV    S  P + +Q  VAKQ+H +V+LYNYYHR+++P  EY+  ++FC++    +P
Sbjct  23   PLLPVKSATSDVPSMAEQEPVAKQVHAVVVLYNYYHRRKHPHLEYMSSEAFCKMAAVFRP  82

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
            VL  ++     + + +E  D+  Q S+ ++ I  AC L + LD   A+  +E W I +V 
Sbjct  83   VLLQYLK----EPNEIEQCDASQQTSLVKRVIMNACGLCTNLDVLPASSSIEKWPIGEVV  138

Query  535  VLLLDSKKE  561
            + L+DS ++
Sbjct  139  IFLVDSDRK  147



>ref|XP_010557065.1| PREDICTED: uncharacterized protein LOC104826195 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557066.1| PREDICTED: uncharacterized protein LOC104826195 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557067.1| PREDICTED: uncharacterized protein LOC104826195 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557068.1| PREDICTED: uncharacterized protein LOC104826195 isoform X1 [Tarenaya 
hassleriana]
Length=711

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 77/129 (60%), Gaps = 5/129 (4%)
 Frame = +1

Query  178  PHLPV-CIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKP  354
            P LPV    S  P + +Q  VAKQ+H +V+LYNYYHR+++P  EY+  ++FC++    +P
Sbjct  23   PLLPVKSATSDVPSMAEQEPVAKQVHAVVVLYNYYHRRKHPHLEYMSSEAFCKMAAVFRP  82

Query  355  VLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVS  534
            VL  ++     + + +E  D+  Q S+ ++ I  AC L + LD   A+  +E W I +V 
Sbjct  83   VLLQYLK----EPNEIEQCDASQQTSLVKRVIMNACGLCTNLDVLPASSSIEKWPIGEVV  138

Query  535  VLLLDSKKE  561
            + L+DS ++
Sbjct  139  IFLVDSDRK  147



>ref|XP_009118568.1| PREDICTED: uncharacterized protein LOC103843582 [Brassica rapa]
Length=1202

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 69/120 (58%), Gaps = 13/120 (11%)
 Frame = +1

Query  199  PSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNC  378
            PS  P    + SVAKQ+H +VLLYNYYHR+++P  E L F+SF  L   ++P L  H   
Sbjct  35   PSNVPSKALRESVAKQVHAVVLLYNYYHRREHPHLERLPFESFRSLTTVMRPALLPHF--  92

Query  379  KKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKK  558
            K+S  D V            EK I  AC+LS  LDAS     ++ W I KV+VLL+DSKK
Sbjct  93   KESGEDGV-----------LEKVIVDACSLSMSLDASSDFSTLKKWPIRKVAVLLVDSKK  141


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 68/120 (57%), Gaps = 7/120 (6%)
 Frame = +1

Query  199  PSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNC  378
            P+  P    + +VAKQ+H +VLLYNYYHR+++P  E L F SF  L   ++P L  H   
Sbjct  626  PTDVPSKAVREAVAKQVHAVVLLYNYYHRREHPHLECLSFDSFRSLTTVMRPALLPHF--  683

Query  379  KKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKK  558
            K S  D V       Q    EK I  AC+LS  LDAS     ++ W I KV+VLL+DSKK
Sbjct  684  KDSGEDGV-----LEQTVFLEKVIVDACSLSMSLDASSDFSSLKKWPIKKVAVLLVDSKK  738


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 68/120 (57%), Gaps = 12/120 (10%)
 Frame = +1

Query  199  PSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNC  378
            P+  P +  + SVAKQ+  +V+LYNYYHR+++P  E L F++F  L   +KP L  H   
Sbjct  326  PTDVPSMALRESVAKQVRAVVVLYNYYHRREHPHLECLSFETFRSLTTDVKPALLPHF--  383

Query  379  KKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKK  558
             K   D V L          EK I  AC+LS  LDAS     +E W I KVSVLL+DSKK
Sbjct  384  -KESGDGVVL---------LEKVIVDACSLSISLDASSDFSTLEKWPIKKVSVLLVDSKK  433



>emb|CDY06187.1| BnaA09g50160D [Brassica napus]
Length=1202

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 68/120 (57%), Gaps = 13/120 (11%)
 Frame = +1

Query  199  PSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNC  378
            PS  P    + SVAKQ+H +VLLYNYYHR+++P  E L F+SF  L   ++P L  H   
Sbjct  35   PSDVPSKALRESVAKQVHAVVLLYNYYHRREHPHLERLPFESFRSLTTVMRPALLPHF--  92

Query  379  KKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKK  558
            K+S  D V            EK I  AC+LS  LD S     ++ W I KV+VLL+DSKK
Sbjct  93   KESGEDGV-----------LEKVIVDACSLSMSLDESSDFSTLKKWPIKKVAVLLVDSKK  141


 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 69/120 (58%), Gaps = 7/120 (6%)
 Frame = +1

Query  199  PSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNC  378
            P+  P    + +VAKQ+H +VLLYNYYHR+++P  E L F SF  L   ++P L  H   
Sbjct  626  PTDVPSKAVREAVAKQVHAVVLLYNYYHRREHPHLECLSFDSFRSLTTVMRPALLPHF--  683

Query  379  KKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKK  558
                +DS E    E Q    EK I  AC+LS  LDAS     ++ W I KV+VLL+DSKK
Sbjct  684  ----TDSGEDGVLE-QTIFLEKVIVDACSLSMSLDASSDFSSLKKWPIKKVAVLLVDSKK  738


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 66/120 (55%), Gaps = 12/120 (10%)
 Frame = +1

Query  199  PSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNC  378
            P+  P +  + SVAKQ+  +V+LYNYYHR+++P  E L F++F  L   +KP L  H   
Sbjct  326  PTDVPSMALRESVAKQVRAVVVLYNYYHRREHPHLECLSFETFRSLTTVVKPALLPHF--  383

Query  379  KKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKK  558
             K   D V            EK I  AC+LS  L AS     ++ W I KVSVLL+DSKK
Sbjct  384  -KESGDGV---------VFLEKVIVDACSLSMSLVASSDFSSLKKWPIKKVSVLLVDSKK  433



>emb|CDY10002.1| BnaC08g44490D [Brassica napus]
Length=1200

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 71/120 (59%), Gaps = 8/120 (7%)
 Frame = +1

Query  199  PSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNC  378
            P+  P    + +VAKQ+H +VLLYNYYHR+++P  E L F+SF  L   ++P L  H   
Sbjct  624  PTDVPSKVVREAVAKQVHAVVLLYNYYHRREHPHLERLSFESFRSLTTVMRPALLPHF--  681

Query  379  KKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKK  558
            K+S    +E      Q  + EK I  AC+LS  LDAS     ++ W I KV+VLL+DSKK
Sbjct  682  KESGEGVLE------QTVLLEKVIVDACSLSMSLDASSDFSSLKKWPIKKVAVLLVDSKK  735


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 65/111 (59%), Gaps = 13/111 (12%)
 Frame = +1

Query  226  QRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVE  405
            + SVAKQ+H +VLLYNYYHR+++P  E L F+S   L   ++P L  H   K+S  D V 
Sbjct  44   RESVAKQVHAVVLLYNYYHRREHPHLERLPFESLRSLTTVMRPALLPHF--KESGEDGV-  100

Query  406  LNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKK  558
                       EK I  AC+LS  LDAS     ++ W I KV+VLL+DSKK
Sbjct  101  ----------LEKVIVDACSLSMSLDASSEISTLKKWPIRKVAVLLVDSKK  141


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 65/120 (54%), Gaps = 15/120 (13%)
 Frame = +1

Query  199  PSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNC  378
            P+  P +  + SVAKQ+  +V+LYNYYHR+++P  E L F+ F  L   +KP L  H   
Sbjct  327  PTDVPSMALRESVAKQVRAVVVLYNYYHRREHPHLECLSFEFFRSLTTVVKPALLPHF--  384

Query  379  KKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKK  558
             K   D V L          EK I  AC+LS  LDAS        W I KVSVLL++SKK
Sbjct  385  -KESGDGVVL---------LEKVIVDACSLSMSLDASSD---FSKWPIKKVSVLLVNSKK  431



>gb|KEH17747.1| hypothetical protein MTR_0002s1280 [Medicago truncatula]
Length=325

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 72/119 (61%), Gaps = 4/119 (3%)
 Frame = +1

Query  214  PIDKQRSVAKQLHCI--VLLYNYYH-RKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKK  384
            P+ +   VAKQ+  +  VLL NYYH RK   +  +L ++ FC ++V L+P +  +M    
Sbjct  36   PLSQHEKVAKQVRAVAVVLLNNYYHIRKMNQELAFLPYREFCNIIVDLRPAMLAYMKFML  95

Query  385  SQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             Q +  +L D E Q S+TE  I  + ++   +DASK  P +EGW ISKV+VLL+D KKE
Sbjct  96   -QPNYTDLVDVEQQLSLTENVIMSSHDICLSIDASKNEPNIEGWPISKVAVLLVDIKKE  153



>tpg|DAA62272.1| TPA: hypothetical protein ZEAMMB73_229235 [Zea mays]
Length=566

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 91/163 (56%), Gaps = 20/163 (12%)
 Frame = +1

Query  112  GNGEAMASkevllkvlldelvdPHLPV-CIPSGTPPIDK--------QRSVAKQLHCIVL  264
            G G+A  S EV+      EL+  HL V  +P G   +D+        Q +VA+Q+H  VL
Sbjct  3    GEGDASGSDEVVQLEDAVELLVEHLVVPVLPRGQ--VDREEALSPEAQEAVARQVHATVL  60

Query  265  LYNYYHRKQYPQAEYLDFKSF---CELVVTLKPVLAWHMNCKKSQSDSVELNDSENQFSI  435
            LYNYYHRKQ+PQ E+ + + F     L VT K +L +    +    + V         S+
Sbjct  61   LYNYYHRKQFPQLEFANPERFSMSASLSVTNKNLLMYLNQAQNRLGNGVGAG-----LSV  115

Query  436  TEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLD-SKKE  561
            T+KAI  AC+++  LD +K +P M  W ISKV+VLLL+ +KKE
Sbjct  116  TDKAIVDACDIAEALDPTKDSPEMTTWPISKVAVLLLNRTKKE  158



>ref|XP_003597507.1| hypothetical protein MTR_2g098770 [Medicago truncatula]
 gb|AES67758.1| hypothetical protein MTR_2g098770 [Medicago truncatula]
Length=388

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 72/119 (61%), Gaps = 4/119 (3%)
 Frame = +1

Query  214  PIDKQRSVAKQLHCI--VLLYNYYH-RKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKK  384
            P+ +   VAKQ+  +  VLL NYYH RK   +  +L ++ FC ++V L+P +  +M    
Sbjct  36   PLSQHEKVAKQVRAVAVVLLNNYYHIRKMNQELAFLPYREFCNIIVDLRPAMLAYMKFM-  94

Query  385  SQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             Q +  +L D E Q S+TE  I  + ++   +DASK  P +EGW ISKV+VLL+D KKE
Sbjct  95   LQPNYTDLVDVEQQLSLTENVIMSSHDICLSIDASKNEPNIEGWPISKVAVLLVDIKKE  153



>ref|XP_008652928.1| PREDICTED: uncharacterized protein LOC103633013 [Zea mays]
Length=645

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 91/163 (56%), Gaps = 20/163 (12%)
 Frame = +1

Query  112  GNGEAMASkevllkvlldelvdPHLPV-CIPSGTPPIDK--------QRSVAKQLHCIVL  264
            G G+A  S EV+      EL+  HL V  +P G   +D+        Q +VA+Q+H  VL
Sbjct  3    GEGDASGSDEVVQLEDAVELLVEHLVVPVLPRGQ--VDREEALSPEAQEAVARQVHATVL  60

Query  265  LYNYYHRKQYPQAEYLDFKSF---CELVVTLKPVLAWHMNCKKSQSDSVELNDSENQFSI  435
            LYNYYHRKQ+PQ E+ + + F     L VT K +L +    +    + V         S+
Sbjct  61   LYNYYHRKQFPQLEFANPERFSMSASLSVTNKNLLMYLNQAQNRLGNGVGAG-----LSV  115

Query  436  TEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLD-SKKE  561
            T+KAI  AC+++  LD +K +P M  W ISKV+VLLL+ +KKE
Sbjct  116  TDKAIVDACDIAEALDPTKDSPEMTTWPISKVAVLLLNRTKKE  158



>ref|XP_006661428.1| PREDICTED: uncharacterized protein LOC102721864 [Oryza brachyantha]
Length=669

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 71/117 (61%), Gaps = 11/117 (9%)
 Frame = +1

Query  229  RSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSF--CELVVTLKPVLAW----HMNCKKSQ  390
            R + +++H  V+LYNYYHRKQ+PQ  + D K F  C  +   + +LA+    H + K S 
Sbjct  2    RDLKRRIHMAVILYNYYHRKQFPQLAFADAKRFFRCATLTLGESLLAYSTMVHQHEKSSS  61

Query  391  SDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            S    +N      S+T+KA+  AC ++  LDAS+ +P M  W ISKV+V+LLDS ++
Sbjct  62   SSGEAVN-----LSVTDKAVVDACGIAEALDASQESPDMTMWPISKVAVILLDSTRK  113



>ref|XP_002892313.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68572.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1634

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 70/128 (55%), Gaps = 10/128 (8%)
 Frame = +1

Query  178   PHLPVCIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPV  357
             P LP       P    + SVAKQ+H +VLLYNYYHRK  P  E L F+SF  L   ++P 
Sbjct  1040  PLLPSKPTDDVPSKSVRESVAKQVHALVLLYNYYHRKDNPHLECLSFESFRSLATVMRPA  1099

Query  358   LAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSV  537
             L  H+   K   DS        Q  + EK I  AC+LS  LDAS    ++  + I KV+V
Sbjct  1100  LLQHL---KEDGDS-------GQTVLLEKVIVDACSLSMSLDASSDLFILNKYPIRKVAV  1149

Query  538   LLLDSKKE  561
             LL+DS+K+
Sbjct  1150  LLVDSEKK  1157



>ref|XP_002460519.1| hypothetical protein SORBIDRAFT_02g029790 [Sorghum bicolor]
 gb|EER97040.1| hypothetical protein SORBIDRAFT_02g029790 [Sorghum bicolor]
Length=667

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 69/115 (60%), Gaps = 8/115 (7%)
 Frame = +1

Query  226  QRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFC---ELVVTLKPVLAWHMNCKKSQSD  396
            Q +VA+Q+H  VLLYNYYHRKQ+PQ E+     FC    L V+ K +L +    +    +
Sbjct  189  QETVARQVHATVLLYNYYHRKQFPQLEFASPDRFCMSASLTVSNKNLLMYLNQAQNRLGN  248

Query  397  SVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             V         S+T+KAI  AC+++ +LD +K +P M  W ISKV+VLLL+  K+
Sbjct  249  GVGAG-----LSVTDKAIIDACDIAEVLDPTKDSPEMIMWPISKVAVLLLNRTKK  298



>ref|NP_001063660.1| Os09g0514500 [Oryza sativa Japonica Group]
 dbj|BAC77633.1| aleurone layer morphogenesis protein [Oryza sativa Japonica Group]
 dbj|BAF25574.1| Os09g0514500 [Oryza sativa Japonica Group]
Length=454

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 71/120 (59%), Gaps = 11/120 (9%)
 Frame = +1

Query  220  DKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSF--CELVVTLKPVLAW----HMNCK  381
            + Q  VA+Q+H  V+LYNYYHRKQ+PQ  + D   F  C  +     +LA+    H + K
Sbjct  42   ENQADVARQVHMAVILYNYYHRKQFPQLAFADAMRFFKCASLTLGDSLLAYSNMVHQHEK  101

Query  382  KSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             S S    +N      S+T+KA+  AC ++  LDA++ +P M  W ISKV+VLLLDS ++
Sbjct  102  SSGSPGEGVN-----LSVTDKAVVDACGIAEALDANQDSPDMAMWPISKVAVLLLDSTRK  156



>gb|EAZ45354.1| hypothetical protein OsJ_29999 [Oryza sativa Japonica Group]
Length=574

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 71/120 (59%), Gaps = 11/120 (9%)
 Frame = +1

Query  220  DKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSF--CELVVTLKPVLAW----HMNCK  381
            + Q  VA+Q+H  V+LYNYYHRKQ+PQ  + D   F  C  +     +LA+    H + K
Sbjct  42   ENQADVARQVHMAVILYNYYHRKQFPQLAFADAMRFFKCASLTLGDSLLAYSNMVHQHEK  101

Query  382  KSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             S S    +N      S+T+KA+  AC ++  LDA++ +P M  W ISKV+VLLLDS ++
Sbjct  102  SSGSPGEGVN-----LSVTDKAVVDACGIAEALDANQDSPDMAMWPISKVAVLLLDSTRK  156



>gb|EAZ09742.1| hypothetical protein OsI_32030 [Oryza sativa Indica Group]
Length=629

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 71/120 (59%), Gaps = 11/120 (9%)
 Frame = +1

Query  220  DKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSF--CELVVTLKPVLAW----HMNCK  381
            + Q  VA+Q+H  V+LYNYYHRKQ+PQ  + D   F  C  +     +LA+    H + K
Sbjct  42   ENQADVARQVHMAVILYNYYHRKQFPQLAFADAMRFFKCASLTLGDSLLAYSNMVHQHEK  101

Query  382  KSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             S S    +N      S+T+KA+  AC ++  LDA++ +P M  W ISKV+VLLLDS ++
Sbjct  102  SSGSPGEGVN-----LSVTDKAVVDACGIAEALDANQDSPDMAMWPISKVAVLLLDSTRK  156



>ref|XP_002442290.1| hypothetical protein SORBIDRAFT_08g017520 [Sorghum bicolor]
 gb|EES16128.1| hypothetical protein SORBIDRAFT_08g017520 [Sorghum bicolor]
Length=623

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 69/117 (59%), Gaps = 17/117 (15%)
 Frame = +1

Query  220  DKQRSVAKQLHCIVLLYNYYHRKQYPQAEYL---DFKSFCELVVTLKPVLAWHMNCKKSQ  390
            + Q +VA+Q+H +VLLYNYYHRKQ+PQ ++     F     L VT K +L +        
Sbjct  51   ETQEAVARQVHAVVLLYNYYHRKQFPQLQFASPDQFSKSASLTVTNKNLLMY--------  102

Query  391  SDSVELND-SENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKK  558
                 LN   E   S+T+KAI  AC+++  LDA+K +P M  W ISKV+VLL++  K
Sbjct  103  -----LNGVGEAGLSVTDKAIIDACDIAEALDATKDSPDMMMWPISKVAVLLINQTK  154



>ref|XP_002458095.1| hypothetical protein SORBIDRAFT_03g026860 [Sorghum bicolor]
 gb|EES03215.1| hypothetical protein SORBIDRAFT_03g026860 [Sorghum bicolor]
Length=573

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 69/117 (59%), Gaps = 8/117 (7%)
 Frame = +1

Query  220  DKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCE---LVVTLKPVLAWHMNCKKSQ  390
            + Q  VA+Q+H  V+LYNYYHRKQ+PQ E+     FC    L V+ K +L +      +Q
Sbjct  48   ETQEDVARQVHATVILYNYYHRKQFPQLEFASPDRFCMSACLTVSNKNLLMY-----VNQ  102

Query  391  SDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            + S   N      S+T+KAI  AC+++  LD  K +P M  W ISKV+VLLL+  K+
Sbjct  103  AQSRLFNGVGAGLSVTDKAIIDACDIAEALDPMKGSPEMIMWPISKVAVLLLNRTKK  159



>ref|XP_010485541.1| PREDICTED: uncharacterized protein LOC104763842 isoform X2 [Camelina 
sativa]
Length=622

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 67/112 (60%), Gaps = 5/112 (4%)
 Frame = +1

Query  226  QRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVE  405
            + SVAKQ+H +VLL+NYYHR+  P  E L F+SF  L   L+P L  H+     + DS  
Sbjct  52   RESVAKQVHAVVLLFNYYHRRDNPHLECLSFESFSSLATDLRPALLLHL-----KEDSSG  106

Query  406  LNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             +   +   + EK ++ AC+LS  LDAS    V+  + I  V+VLL+DS+K+
Sbjct  107  RDGDSDHTVLLEKVVKDACSLSMSLDASSDLLVLNKFPIRTVAVLLVDSEKK  158



>ref|XP_010485533.1| PREDICTED: uncharacterized protein LOC104763842 isoform X1 [Camelina 
sativa]
Length=622

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 67/112 (60%), Gaps = 5/112 (4%)
 Frame = +1

Query  226  QRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVE  405
            + SVAKQ+H +VLL+NYYHR+  P  E L F+SF  L   L+P L  H+     + DS  
Sbjct  52   RESVAKQVHAVVLLFNYYHRRDNPHLECLSFESFSSLATDLRPALLLHL-----KEDSSG  106

Query  406  LNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             +   +   + EK ++ AC+LS  LDAS    V+  + I  V+VLL+DS+K+
Sbjct  107  RDGDSDHTVLLEKVVKDACSLSMSLDASSDLLVLNKFPIRTVAVLLVDSEKK  158



>ref|NP_172086.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE27922.1| uncharacterized protein AT1G05950 [Arabidopsis thaliana]
Length=627

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 67/128 (52%), Gaps = 9/128 (7%)
 Frame = +1

Query  178  PHLPVCIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPV  357
            P LP       P    + SVAKQ+H +VLLYNYYHRK  P  E L F+SF  L   +KP 
Sbjct  33   PLLPSKPTDDLPSTSIRESVAKQVHAVVLLYNYYHRKDNPHLECLSFESFRSLATVMKPA  92

Query  358  LAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSV  537
            L  H+          E      Q  + EK I  AC+LS  LDAS    ++    I +V+V
Sbjct  93   LLQHLK---------EDGGVSGQTVLLEKVIVDACSLSMSLDASSDLFILNKCPIRRVAV  143

Query  538  LLLDSKKE  561
            LL+DS+K+
Sbjct  144  LLVDSEKK  151



>gb|AAF80120.1|AC024174_2 Contains similarity to an unknown protein T11A7.7 gi|2335096 
from Arabidopsis thaliana BAC T11A7 gb|AC002339 and contains 
a tropomyosin PF|00261 domain. ESTs gb|AI995205, gb|N37925, 
gb|F13889, gb|AV523107, gb|AV535948, gb|AV558461, gb|F13888 
come from this gene [Arabidopsis thaliana]
Length=1628

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 67/128 (52%), Gaps = 9/128 (7%)
 Frame = +1

Query  178   PHLPVCIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPV  357
             P LP       P    + SVAKQ+H +VLLYNYYHRK  P  E L F+SF  L   +KP 
Sbjct  1034  PLLPSKPTDDLPSTSIRESVAKQVHAVVLLYNYYHRKDNPHLECLSFESFRSLATVMKPA  1093

Query  358   LAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSV  537
             L  H+          E      Q  + EK I  AC+LS  LDAS    ++    I +V+V
Sbjct  1094  LLQHLK---------EDGGVSGQTVLLEKVIVDACSLSMSLDASSDLFILNKCPIRRVAV  1144

Query  538   LLLDSKKE  561
             LL+DS+K+
Sbjct  1145  LLVDSEKK  1152



>ref|XP_010475317.1| PREDICTED: uncharacterized protein LOC104754750 [Camelina sativa]
Length=602

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 67/112 (60%), Gaps = 5/112 (4%)
 Frame = +1

Query  226  QRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVE  405
            + SVAKQ+H +VLL+NYYHR+  P  E L F+SF  L   ++P L  H+     + DS  
Sbjct  52   RESVAKQVHAVVLLFNYYHRRDNPHLECLSFESFSSLATDMRPALLLHL-----KEDSSG  106

Query  406  LNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             +   +   + EK I+ AC+LS  LDAS    V+  + I  V+VLL+DS+K+
Sbjct  107  RDGDLDHTVLLEKVIKDACSLSMSLDASSDLLVLNKFPIRTVAVLLVDSEKK  158



>ref|XP_002460278.1| hypothetical protein SORBIDRAFT_02g025890 [Sorghum bicolor]
 gb|EER96799.1| hypothetical protein SORBIDRAFT_02g025890 [Sorghum bicolor]
Length=575

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 67/115 (58%), Gaps = 8/115 (7%)
 Frame = +1

Query  226  QRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCE---LVVTLKPVLAWHMNCKKSQSD  396
            Q +VA+Q+H  VLLYNYYHRKQ+PQ E+ +   F     L V  K +L +  + +    +
Sbjct  48   QEAVARQVHATVLLYNYYHRKQFPQVEFANLDRFSRSTFLNVRNKNLLMYMNHAQNRLGN  107

Query  397  SVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             V         S+T+KAI  AC+++  LD  K +P M  W ISKV+VLLL+  K+
Sbjct  108  KVGAG-----LSVTDKAIIDACDIAEALDPMKDSPEMILWPISKVAVLLLNPTKK  157



>gb|KHN30102.1| hypothetical protein glysoja_010480 [Glycine soja]
Length=263

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%), Gaps = 8/90 (9%)
 Frame = +1

Query  205  GTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNC--  378
             +P   + + VAKQ+H +VLLYNYYHRKQYP+  +L F  FC L + L+  L+ HM    
Sbjct  35   NSPSPSQHQLVAKQVHSVVLLYNYYHRKQYPELAFLSFVEFCRLALVLRSTLSVHMKSML  94

Query  379  KKSQSDSVELNDSENQFSITEKAIQGACNL  468
            K  +++ VE      Q S+TE  I  ACN+
Sbjct  95   KPDETELVE------QLSLTEGKILNACNI  118



>ref|XP_006307018.1| hypothetical protein CARUB_v10008604mg [Capsella rubella]
 gb|EOA39916.1| hypothetical protein CARUB_v10008604mg [Capsella rubella]
Length=549

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 69/113 (61%), Gaps = 8/113 (7%)
 Frame = +1

Query  226  QRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVE  405
            + SVAKQ+H +VLLYNYYHRK  P  E L  +SF +L   ++P L  H+   K +S    
Sbjct  52   RESVAKQVHALVLLYNYYHRKDNPHLECLSLESFRDLATDMRPALLQHL---KEESG---  105

Query  406  LNDSENQFSI-TEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
              D+++++++  EK I  AC LS  LDAS     +    I KV+VLL+DS+K+
Sbjct  106  -RDADSEYTVLLEKVIVDACRLSMGLDASSDIFFLNKLPIRKVAVLLVDSEKK  157



>ref|XP_006307017.1| hypothetical protein CARUB_v10008604mg [Capsella rubella]
 gb|EOA39915.1| hypothetical protein CARUB_v10008604mg [Capsella rubella]
Length=616

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 69/113 (61%), Gaps = 8/113 (7%)
 Frame = +1

Query  226  QRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVE  405
            + SVAKQ+H +VLLYNYYHRK  P  E L  +SF +L   ++P L  H+   K +S    
Sbjct  52   RESVAKQVHALVLLYNYYHRKDNPHLECLSLESFRDLATDMRPALLQHL---KEESG---  105

Query  406  LNDSENQFSI-TEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
              D+++++++  EK I  AC LS  LDAS     +    I KV+VLL+DS+K+
Sbjct  106  -RDADSEYTVLLEKVIVDACRLSMGLDASSDIFFLNKLPIRKVAVLLVDSEKK  157



>ref|XP_010557069.1| PREDICTED: uncharacterized protein LOC104826195 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010557070.1| PREDICTED: uncharacterized protein LOC104826195 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010557071.1| PREDICTED: uncharacterized protein LOC104826195 isoform X2 [Tarenaya 
hassleriana]
Length=679

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +1

Query  244  QLHCIVLLYNYYHRKQYPQAEYLDFKSFCELVVTLKPVLAWHMNCKKSQSDSVELNDSEN  423
            ++H +V+LYNYYHR+++P  EY+  ++FC++    +PVL  ++     + + +E  D+  
Sbjct  14   KVHAVVVLYNYYHRRKHPHLEYMSSEAFCKMAAVFRPVLLQYLK----EPNEIEQCDASQ  69

Query  424  QFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            Q S+ ++ I  AC L + LD   A+  +E W I +V + L+DS ++
Sbjct  70   QTSLVKRVIMNACGLCTNLDVLPASSSIEKWPIGEVVIFLVDSDRK  115



>ref|XP_002442289.1| hypothetical protein SORBIDRAFT_08g017510 [Sorghum bicolor]
 gb|EES16127.1| hypothetical protein SORBIDRAFT_08g017510 [Sorghum bicolor]
Length=222

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 64/115 (56%), Gaps = 17/115 (15%)
 Frame = +1

Query  226  QRSVAKQLHCIVLLYNYYHRKQYPQAEYL---DFKSFCELVVTLKPVLAWHMNCKKSQSD  396
            Q     ++H +VLLYNYYHRKQ+PQ ++     F     L VT K +L +          
Sbjct  30   QLHFGTRVHAVVLLYNYYHRKQFPQLQFASPDQFSKSASLTVTNKNLLMY----------  79

Query  397  SVELND-SENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKK  558
               LN   E   S+T+KAI  AC+++  LDA+K +P M  W ISKV+VLL++  K
Sbjct  80   ---LNGVGEAGLSVTDKAIIDACDIAEALDATKDSPDMMMWPISKVAVLLINQTK  131



>gb|EMS45395.1| hypothetical protein TRIUR3_14576 [Triticum urartu]
Length=1137

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 61/107 (57%), Gaps = 6/107 (6%)
 Frame = +1

Query  247  LHCIVLLYNYYHRKQYPQAEYLDFKSF--CELVVTLKPVLAWHMNCKKSQSDSVELNDSE  420
            +H  ++LYNYYHRK +PQ  + D K F  C  +   + +LA+     + +++S       
Sbjct  177  IHTAIILYNYYHRKMFPQLAFADPKQFFECASLSVGEDLLAYLSMVHEHENNS----GKH  232

Query  421  NQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             + SIT K    AC ++  LDASK +P M  W ISKV+VLLLD  K+
Sbjct  233  AELSITHKVALQACEIAGQLDASKHSPEMALWPISKVAVLLLDPTKK  279



>ref|XP_010233334.1| PREDICTED: uncharacterized protein LOC104583229 [Brachypodium 
distachyon]
Length=516

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 72/131 (55%), Gaps = 11/131 (8%)
 Frame = +1

Query  178  PHLPVCIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSF--CELVVTLK  351
            P LP      TP  + +R+VA+Q+H  V+LYNYYHR   PQ  + D K F  C      +
Sbjct  30   PVLPRAATDVTPA-EMERAVARQIHTAVILYNYYHRSLSPQLAFADVKRFLLCASHSVGE  88

Query  352  PVLAW-HMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISK  528
             +  + ++  +K+  D V       + S+T++A   AC ++  LDAS+  P M  W I+K
Sbjct  89   DLFPFSNVVHEKNPGDDV-------KPSVTDRAAMDACEIAEALDASQDFPEMSLWPIAK  141

Query  529  VSVLLLDSKKE  561
            V+VLLLD  ++
Sbjct  142  VAVLLLDPTRK  152



>gb|EMS66244.1| hypothetical protein TRIUR3_09292 [Triticum urartu]
Length=602

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 60/104 (58%), Gaps = 6/104 (6%)
 Frame = +1

Query  244  QLHCIVLLYNYYHRKQYPQAEYLDFKSF--CELVVTLKPVLAWHMNCKKSQSDSVELNDS  417
            Q+H  ++LYNYYHRK  PQ  + D K F  C  +   + +LA+     + +++       
Sbjct  93   QIHTAIILYNYYHRKMSPQLAFADAKRFFVCASLSAGEDLLAYLSMVHERENNP----GK  148

Query  418  ENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLD  549
              + S+T++A   AC ++  LDASK +P M  W ISKV+VLLLD
Sbjct  149  HVRLSVTDRAAIQACEIAEELDASKDSPDMATWPISKVAVLLLD  192



>gb|EMT22038.1| hypothetical protein F775_01210 [Aegilops tauschii]
Length=648

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 69/141 (49%), Gaps = 31/141 (22%)
 Frame = +1

Query  220  DKQRSVAKQL-------------------------HCIVLLYNYYHRKQYPQAEYLDFKS  324
            DKQR+VA+QL                         H  ++LYNYYHRK  PQ  + D + 
Sbjct  35   DKQRAVAQQLSMNLNWIGLCDIVAKWMFLSTQRLIHTAIILYNYYHRKMSPQLAFADPEQ  94

Query  325  F--CELVVTLKPVLAWHMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKAN  498
            F  C  +   + +LA+     + +++S        + SIT K    AC ++  LDASK +
Sbjct  95   FFECASLSVGEDLLAYLSMVHEHENNS----GKHAKLSITHKVALQACEIAEQLDASKHS  150

Query  499  PVMEGWEISKVSVLLLDSKKE  561
            P M  W ISKV+VLLLD  K+
Sbjct  151  PEMALWPISKVAVLLLDPTKK  171



>ref|XP_006443057.1| hypothetical protein CICLE_v10024150mg [Citrus clementina]
 ref|XP_006443059.1| hypothetical protein CICLE_v10024444mg [Citrus clementina]
 ref|XP_006495122.1| PREDICTED: uncharacterized protein LOC102610471 isoform X1 [Citrus 
sinensis]
 gb|ESR56297.1| hypothetical protein CICLE_v10024150mg [Citrus clementina]
 gb|ESR56299.1| hypothetical protein CICLE_v10024444mg [Citrus clementina]
Length=195

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            +S+  EL+D + Q S+TEK I  AC++S+ LDASK  P  EGW ISKV+VLL+DS+KE
Sbjct  6    RSNDSELDDPDKQLSVTEKKIMDACDISNSLDASKDIPSAEGWPISKVAVLLIDSRKE  63



>gb|KDO40438.1| hypothetical protein CISIN_1g046679mg, partial [Citrus sinensis]
Length=198

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  388  QSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            +S+  EL+D + Q S+TEK I  AC++S+ LDASK  P  EGW ISKV+VLL+DS+KE
Sbjct  6    RSNDSELDDPDKQLSVTEKKIMDACDISNSLDASKDIPSAEGWPISKVAVLLIDSRKE  63



>gb|EMT06544.1| hypothetical protein F775_30073 [Aegilops tauschii]
Length=538

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 59/103 (57%), Gaps = 6/103 (6%)
 Frame = +1

Query  247  LHCIVLLYNYYHRKQYPQAEYLDFKSF--CELVVTLKPVLAWHMNCKKSQSDSVELNDSE  420
            +H  ++LYNYYHRK  PQ  + D K F  C  +   + +LA+     + +S+        
Sbjct  5    IHTAIILYNYYHRKMSPQLAFADPKRFFVCASLSAGEDLLAYLSMVHERESNP----GKH  60

Query  421  NQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLD  549
             + S+T++A   AC ++  LDASK +P M  W ISKV+VLLLD
Sbjct  61   VRLSVTDRAAIQACEIAEELDASKDSPDMAMWPISKVAVLLLD  103



>ref|XP_010231706.1| PREDICTED: uncharacterized protein LOC104582750 [Brachypodium 
distachyon]
Length=637

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 10/127 (8%)
 Frame = +1

Query  178  PHLPVCIPSGTPPIDKQRSVAKQLHCIVLLYNYYHRKQYPQAEYLDFKSF--CELVVTLK  351
            P LP    +     + +++VA+Q+H  V+LYNYYHR   PQ  + D K F  C  +   +
Sbjct  32   PVLPAGARAAAVTPEMEKAVAQQIHTAVILYNYYHRNLSPQLAFADAKRFLLCASLSVGE  91

Query  352  PVLAW-HMNCKKSQSDSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISK  528
             + ++  M  +K+  + +       + S+T++A+  AC ++  LDAS   P M  W I+K
Sbjct  92   DLFSFLSMVNEKNPGEDL-------RPSVTDRAVIDACEIAEALDASIDFPDMSLWPIAK  144

Query  529  VSVLLLD  549
            V+VLLLD
Sbjct  145  VAVLLLD  151



>ref|XP_011457280.1| PREDICTED: uncharacterized protein LOC101295192 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=681

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  400  VELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
             EL+D E Q S+TE+ I  AC +S+ LDAS   P  EGW ISKV+VLL+DSKKE
Sbjct  10   TELDDLEKQLSVTERTIMDACEISTSLDASMGTPNTEGWPISKVTVLLVDSKKE  63



>ref|XP_009344381.1| PREDICTED: uncharacterized protein LOC103936263 [Pyrus x bretschneideri]
Length=654

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  394  DSVELNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            +  +L+D E Q S+TEKAI  AC++S  LDA K  P  EGW ISKV+VLL+DSKKE
Sbjct  11   NDAKLDDLEKQLSVTEKAIVDACSMSLSLDALKDVPNTEGWPISKVTVLLVDSKKE  66



>gb|EMT07234.1| hypothetical protein F775_03282 [Aegilops tauschii]
Length=690

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 58/106 (55%), Gaps = 9/106 (8%)
 Frame = +1

Query  238  AKQLHCIVLLYNYYHRKQYPQAEYLDFKSF--CELVVTLKPVLAWHMNCKKSQSDSVELN  411
            A ++H  ++LYNYYHR  +P   + D K F  C      + +L  +    K Q+ S +  
Sbjct  166  AYKIHTAIILYNYYHRMMFPYLAFADAKLFLVCASHFIGEDILTHY---HKQQNKSGKHV  222

Query  412  DSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLD  549
             S    SI ++A   AC ++  LDASK +P M  W ISKV+VLLLD
Sbjct  223  SS----SIFDRAAMQACEIAQGLDASKDSPDMALWPISKVAVLLLD  264



>ref|XP_002442274.1| hypothetical protein SORBIDRAFT_08g017370 [Sorghum bicolor]
 gb|EES16112.1| hypothetical protein SORBIDRAFT_08g017370 [Sorghum bicolor]
Length=120

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 52/100 (52%), Gaps = 11/100 (11%)
 Frame = +1

Query  235  VAKQLHCIVLLYNYYHRKQYPQAEYLDFKSFC---ELVVTLKPVLAWHMNCKKSQSDSVE  405
            +A   H +  +YNYY RKQ+ Q E      FC    L +T K +L + +N   ++     
Sbjct  29   LAAGPHDVSPIYNYYRRKQFRQLELASPDLFCMSASLTLTNKNLLMY-LNHPHNR-----  82

Query  406  LNDSENQFSITEKAIQGACNLSSMLDASKANPVMEGWEIS  525
              ++E + S T K I  AC+++  LD++K +P M  W IS
Sbjct  83   --NAEAELSFTNKTIIDACDIAEALDSTKDSPKMTMWPIS  120



>gb|EYU38904.1| hypothetical protein MIMGU_mgv1a022859mg, partial [Erythranthe 
guttata]
Length=217

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  418  ENQFSITEKAIQGACNLSSMLDASKANPVMEGWEISKVSVLLLDSKKE  561
            EN+ SITEKA+Q AC +++ LDAS+  P ++ W I +++++L+DS  E
Sbjct  17   ENELSITEKAVQHACEIAACLDASRDFPNVKEWPIYEIAIVLIDSGNE  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880