BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP002C04 617 bp,

Length=589
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006361572.1|  PREDICTED: UPF0496 protein 1-like                  206   4e-61   Solanum tuberosum [potatoes]
ref|XP_004250688.1|  PREDICTED: UPF0496 protein 1-like                  198   7e-58   Solanum lycopersicum
ref|XP_009801742.1|  PREDICTED: UPF0496 protein 1-like                  192   9e-56   Nicotiana sylvestris
ref|XP_009586590.1|  PREDICTED: UPF0496 protein 1-like                  192   1e-55   Nicotiana tomentosiformis
gb|EYU39376.1|  hypothetical protein MIMGU_mgv1a019801mg                186   4e-53   Erythranthe guttata [common monkey flower]
emb|CDP02406.1|  unnamed protein product                                180   8e-52   Coffea canephora [robusta coffee]
ref|XP_004507409.1|  PREDICTED: UPF0496 protein At4g34320-like          181   2e-51   Cicer arietinum [garbanzo]
ref|XP_004289620.1|  PREDICTED: UPF0496 protein At4g34320-like          177   3e-50   Fragaria vesca subsp. vesca
gb|KHN25354.1|  UPF0496 protein                                         175   3e-50   Glycine soja [wild soybean]
ref|XP_003537895.1|  PREDICTED: UPF0496 protein At4g34320-like          177   3e-50   Glycine max [soybeans]
ref|XP_003541076.1|  PREDICTED: UPF0496 protein At4g34320-like          176   1e-49   Glycine max [soybeans]
ref|XP_002519094.1|  AT14A, putative                                    176   2e-49   Ricinus communis
gb|KDP46219.1|  hypothetical protein JCGZ_10059                         175   4e-49   Jatropha curcas
ref|XP_007042727.1|  UPF0496 protein                                    174   4e-49   Theobroma cacao [chocolate]
ref|XP_002313064.1|  hypothetical protein POPTR_0009s11550g             174   5e-49   Populus trichocarpa [western balsam poplar]
ref|XP_007201071.1|  hypothetical protein PRUPE_ppa007273mg             173   1e-48   Prunus persica
gb|KEH30404.1|  UPF0496 plant-like protein                              173   1e-48   Medicago truncatula
gb|KJB32195.1|  hypothetical protein B456_005G228900                    173   1e-48   Gossypium raimondii
ref|XP_007131859.1|  hypothetical protein PHAVU_011G047500g             173   2e-48   Phaseolus vulgaris [French bean]
ref|XP_009344780.1|  PREDICTED: UPF0496 protein At4g34320-like          172   3e-48   Pyrus x bretschneideri [bai li]
gb|KDO51452.1|  hypothetical protein CISIN_1g040233mg                   172   3e-48   Citrus sinensis [Valencia orange]
ref|XP_006423198.1|  hypothetical protein CICLE_v10030403mg             172   3e-48   Citrus clementina
ref|XP_008365973.1|  PREDICTED: UPF0496 protein At4g34320-like          172   6e-48   Malus domestica [apple tree]
ref|XP_008236784.1|  PREDICTED: UPF0496 protein At4g34320-like          172   6e-48   Prunus mume [ume]
ref|XP_011048925.1|  PREDICTED: UPF0496 protein At4g34320-like          171   8e-48   Populus euphratica
ref|XP_011037574.1|  PREDICTED: UPF0496 protein At4g34320-like          171   1e-47   Populus euphratica
emb|CDO97084.1|  unnamed protein product                                169   4e-47   Coffea canephora [robusta coffee]
ref|XP_011085548.1|  PREDICTED: UPF0496 protein 1-like                  170   6e-47   Sesamum indicum [beniseed]
ref|XP_010647846.1|  PREDICTED: UPF0496 protein At4g34320-like is...    169   6e-47   Vitis vinifera
ref|XP_009797274.1|  PREDICTED: UPF0496 protein At4g34320-like          169   7e-47   Nicotiana sylvestris
ref|XP_009605015.1|  PREDICTED: UPF0496 protein At4g34320-like          169   8e-47   Nicotiana tomentosiformis
ref|XP_008387354.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0496 prot...    168   1e-46   
ref|XP_009334187.1|  PREDICTED: UPF0496 protein At4g34320-like          168   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_002281050.2|  PREDICTED: UPF0496 protein At4g34320-like is...    169   1e-46   Vitis vinifera
gb|EYU44304.1|  hypothetical protein MIMGU_mgv1a007475mg                168   2e-46   Erythranthe guttata [common monkey flower]
ref|XP_006412239.1|  hypothetical protein EUTSA_v100255251mg            165   2e-46   Eutrema salsugineum
gb|KJB79486.1|  hypothetical protein B456_013G052500                    167   3e-46   Gossypium raimondii
gb|KJB79485.1|  hypothetical protein B456_013G052500                    167   5e-46   Gossypium raimondii
ref|NP_195158.1|  uncharacterized protein                               166   7e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006365509.1|  PREDICTED: UPF0496 protein At4g34320-like          166   1e-45   Solanum tuberosum [potatoes]
ref|XP_011088346.1|  PREDICTED: UPF0496 protein At4g34320               166   1e-45   Sesamum indicum [beniseed]
ref|XP_006285511.1|  hypothetical protein CARUB_v10006952mg             166   1e-45   Capsella rubella
ref|XP_002869155.1|  hypothetical protein ARALYDRAFT_491233             165   2e-45   Arabidopsis lyrata subsp. lyrata
ref|XP_009138282.1|  PREDICTED: UPF0496 protein At4g34320               165   2e-45   Brassica rapa
ref|XP_009138287.1|  PREDICTED: UPF0496 protein At4g34320-like          165   2e-45   Brassica rapa
ref|XP_010432431.1|  PREDICTED: UPF0496 protein At4g34320               165   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_008806206.1|  PREDICTED: UPF0496 protein 1-like                  164   2e-45   Phoenix dactylifera
ref|XP_010939026.1|  PREDICTED: UPF0496 protein 1-like                  165   3e-45   Elaeis guineensis
ref|XP_004230936.1|  PREDICTED: UPF0496 protein At4g34320-like          164   3e-45   Solanum lycopersicum
gb|KHN02045.1|  UPF0496 protein                                         163   5e-45   Glycine soja [wild soybean]
ref|XP_010437629.1|  PREDICTED: UPF0496 protein At4g34320-like is...    164   5e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010414492.1|  PREDICTED: UPF0496 protein At2g18630               164   8e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010447101.1|  PREDICTED: UPF0496 protein At4g34320-like          163   8e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010489568.1|  PREDICTED: UPF0496 protein At2g18630               164   8e-45   Camelina sativa [gold-of-pleasure]
ref|XP_004498189.1|  PREDICTED: UPF0496 protein At4g34320-like          163   9e-45   Cicer arietinum [garbanzo]
ref|XP_003529196.1|  PREDICTED: UPF0496 protein At4g34320-like          163   1e-44   Glycine max [soybeans]
ref|XP_002306083.1|  hypothetical protein POPTR_0004s15800g             162   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_010467691.1|  PREDICTED: UPF0496 protein At2g18630-like          163   2e-44   Camelina sativa [gold-of-pleasure]
emb|CDY30310.1|  BnaA09g09670D                                          163   2e-44   Brassica napus [oilseed rape]
ref|XP_006296613.1|  hypothetical protein CARUB_v10013876mg             163   2e-44   Capsella rubella
ref|XP_007153142.1|  hypothetical protein PHAVU_003G010400g             162   2e-44   Phaseolus vulgaris [French bean]
ref|XP_010558085.1|  PREDICTED: UPF0496 protein At5g66675-like is...    165   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_010558093.1|  PREDICTED: UPF0496 protein At5g66675-like is...    164   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_009408039.1|  PREDICTED: UPF0496 protein 1-like                  162   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009112552.1|  PREDICTED: UPF0496 protein At2g18630-like          162   4e-44   Brassica rapa
ref|XP_002468329.1|  hypothetical protein SORBIDRAFT_01g043880          161   6e-44   Sorghum bicolor [broomcorn]
ref|XP_006649570.1|  PREDICTED: UPF0496 protein 1-like                  161   6e-44   Oryza brachyantha
ref|XP_010530852.1|  PREDICTED: UPF0496 protein At4g34320-like is...    161   7e-44   Tarenaya hassleriana [spider flower]
ref|XP_010530851.1|  PREDICTED: UPF0496 protein At4g34320-like is...    161   8e-44   Tarenaya hassleriana [spider flower]
ref|XP_009108740.1|  PREDICTED: UPF0496 protein At4g34320-like          160   9e-44   Brassica rapa
emb|CDY51496.1|  BnaC09g51110D                                          160   1e-43   Brassica napus [oilseed rape]
emb|CDX76273.1|  BnaA08g11270D                                          160   1e-43   Brassica napus [oilseed rape]
emb|CDY13018.1|  BnaC07g03170D                                          160   2e-43   Brassica napus [oilseed rape]
gb|KJB48452.1|  hypothetical protein B456_008G069800                    160   2e-43   Gossypium raimondii
ref|XP_007047030.1|  Uncharacterized protein TCM_000456                 160   3e-43   Theobroma cacao [chocolate]
emb|CDY45304.1|  BnaA03g52770D                                          158   3e-43   Brassica napus [oilseed rape]
gb|AAD08932.1|  At14a, putative                                         159   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179453.2|  uncharacterized protein                               159   4e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDY46260.1|  BnaC03g66210D                                          159   4e-43   Brassica napus [oilseed rape]
ref|XP_009386153.1|  PREDICTED: UPF0496 protein 1-like                  159   4e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK28347.1|  hypothetical protein AALP_AA8G504300                    159   5e-43   Arabis alpina [alpine rockcress]
ref|XP_009114703.1|  PREDICTED: UPF0496 protein At2g18630 isoform X2    159   6e-43   Brassica rapa
gb|KHG15186.1|  hypothetical protein F383_03556                         159   7e-43   Gossypium arboreum [tree cotton]
ref|XP_009114701.1|  PREDICTED: UPF0496 protein At2g18630 isoform X1    159   7e-43   Brassica rapa
emb|CDY43904.1|  BnaA07g01810D                                          159   8e-43   Brassica napus [oilseed rape]
ref|XP_011092769.1|  PREDICTED: UPF0496 protein At4g34320-like          158   9e-43   Sesamum indicum [beniseed]
gb|KEH40778.1|  UPF0496 plant-like protein                              157   2e-42   Medicago truncatula
ref|NP_001049283.1|  Os03g0199100                                       157   2e-42   
gb|AFK35402.1|  unknown                                                 157   2e-42   Lotus japonicus
ref|XP_009112322.1|  PREDICTED: UPF0496 protein At5g66675               158   2e-42   Brassica rapa
ref|XP_009388042.1|  PREDICTED: UPF0496 protein 1-like                  157   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006409128.1|  hypothetical protein EUTSA_v10022714mg             157   2e-42   Eutrema salsugineum
ref|NP_001145902.1|  hypothetical protein                               157   3e-42   Zea mays [maize]
ref|XP_008447055.1|  PREDICTED: UPF0496 protein At4g34320-like          157   3e-42   Cucumis melo [Oriental melon]
ref|XP_006393860.1|  hypothetical protein EUTSA_v10004318mg             157   3e-42   Eutrema salsugineum
ref|XP_010680903.1|  PREDICTED: UPF0496 protein 1-like                  157   3e-42   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006425739.1|  hypothetical protein CICLE_v10025839mg             157   3e-42   Citrus clementina
ref|XP_004148297.1|  PREDICTED: UPF0496 protein At4g34320-like          156   3e-42   Cucumis sativus [cucumbers]
ref|XP_010943147.1|  PREDICTED: UPF0496 protein 1-like                  157   4e-42   Elaeis guineensis
ref|XP_002865053.1|  hypothetical protein ARALYDRAFT_496934             156   7e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_010028566.1|  PREDICTED: UPF0496 protein At4g34320-like          155   7e-42   Eucalyptus grandis [rose gum]
ref|XP_010550396.1|  PREDICTED: UPF0496 protein At5g66675-like          156   7e-42   Tarenaya hassleriana [spider flower]
emb|CDX81379.1|  BnaC09g07900D                                          156   8e-42   Brassica napus [oilseed rape]
gb|AFK35357.1|  unknown                                                 154   2e-41   Medicago truncatula
ref|XP_010029837.1|  PREDICTED: UPF0496 protein At2g18630-like          154   2e-41   Eucalyptus grandis [rose gum]
gb|KDP31809.1|  hypothetical protein JCGZ_12270                         154   5e-41   Jatropha curcas
ref|XP_004985322.1|  PREDICTED: UPF0496 protein 1-like                  153   5e-41   Setaria italica
ref|XP_003558574.1|  PREDICTED: UPF0496 protein 1                       154   6e-41   Brachypodium distachyon [annual false brome]
ref|NP_850929.1|  uncharacterized protein                               154   6e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006573602.1|  PREDICTED: UPF0496 protein At2g18630-like is...    153   6e-41   Glycine max [soybeans]
gb|EYU41177.1|  hypothetical protein MIMGU_mgv1a008261mg                153   8e-41   Erythranthe guttata [common monkey flower]
ref|XP_008652317.1|  PREDICTED: UPF0496 protein 1                       152   1e-40   
ref|XP_010999947.1|  PREDICTED: UPF0496 protein At2g18630-like is...    151   2e-40   Populus euphratica
dbj|BAJ93975.1|  predicted protein                                      152   3e-40   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006280557.1|  hypothetical protein CARUB_v10026498mg             152   3e-40   Capsella rubella
ref|XP_010999946.1|  PREDICTED: UPF0496 protein At2g18630-like is...    151   4e-40   Populus euphratica
gb|EPS58212.1|  hypothetical protein M569_16603                         151   5e-40   Genlisea aurea
gb|KHN36151.1|  UPF0496 protein                                         150   6e-40   Glycine soja [wild soybean]
ref|XP_006383250.1|  hypothetical protein POPTR_0005s12870g             150   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_008459259.1|  PREDICTED: UPF0496 protein At4g34320-like          149   1e-39   Cucumis melo [Oriental melon]
ref|XP_010099360.1|  hypothetical protein L484_009177                   149   2e-39   Morus notabilis
ref|XP_004300597.1|  PREDICTED: UPF0496 protein At2g18630-like          149   3e-39   Fragaria vesca subsp. vesca
ref|NP_195159.1|  uncharacterized protein                               148   3e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004972533.1|  PREDICTED: UPF0496 protein 1-like                  148   5e-39   Setaria italica
gb|KHN00564.1|  UPF0496 protein                                         148   6e-39   Glycine soja [wild soybean]
gb|KGN61767.1|  hypothetical protein Csa_2G238830                       148   9e-39   Cucumis sativus [cucumbers]
gb|EYU37760.1|  hypothetical protein MIMGU_mgv1a008357mg                147   9e-39   Erythranthe guttata [common monkey flower]
ref|XP_004161622.1|  PREDICTED: UPF0496 protein At4g34320-like          148   9e-39   
ref|XP_004145340.1|  PREDICTED: UPF0496 protein At4g34320-like          148   9e-39   
ref|XP_010531185.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0496 prot...    147   1e-38   Tarenaya hassleriana [spider flower]
gb|EPS58408.1|  hypothetical protein M569_16405                         147   1e-38   Genlisea aurea
ref|XP_010649192.1|  PREDICTED: UPF0496 protein At4g34320-like          147   1e-38   Vitis vinifera
ref|XP_009379180.1|  PREDICTED: UPF0496 protein At2g18630-like          147   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_002884146.1|  hypothetical protein ARALYDRAFT_319811             147   2e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_010254953.1|  PREDICTED: UPF0496 protein At4g34320-like          146   2e-38   Nelumbo nucifera [Indian lotus]
ref|XP_006856114.1|  hypothetical protein AMTR_s00059p00142910          146   2e-38   Amborella trichopoda
gb|EMT23432.1|  hypothetical protein F775_11302                         144   4e-38   Aegilops tauschii
ref|XP_009374219.1|  PREDICTED: UPF0496 protein At4g34320-like          146   4e-38   Pyrus x bretschneideri [bai li]
ref|XP_010026158.1|  PREDICTED: UPF0496 protein At2g18630-like          144   1e-37   Eucalyptus grandis [rose gum]
ref|XP_010247000.1|  PREDICTED: UPF0496 protein At4g34320-like          144   2e-37   Nelumbo nucifera [Indian lotus]
ref|XP_002310784.2|  hypothetical protein POPTR_0007s12320g             144   2e-37   Populus trichocarpa [western balsam poplar]
gb|EPS58393.1|  hypothetical protein M569_16421                         144   3e-37   Genlisea aurea
gb|KCW58575.1|  hypothetical protein EUGRSUZ_H01233                     144   3e-37   Eucalyptus grandis [rose gum]
ref|XP_010690930.1|  PREDICTED: UPF0496 protein At4g34320-like          143   4e-37   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008775796.1|  PREDICTED: UPF0496 protein 1-like isoform X3       143   5e-37   Phoenix dactylifera
ref|XP_008775794.1|  PREDICTED: UPF0496 protein 1-like isoform X1       143   6e-37   Phoenix dactylifera
ref|XP_008775795.1|  PREDICTED: UPF0496 protein 1-like isoform X2       143   7e-37   Phoenix dactylifera
ref|XP_010042669.1|  PREDICTED: UPF0496 protein At2g18630-like          142   8e-37   Eucalyptus grandis [rose gum]
ref|XP_006286139.1|  hypothetical protein CARUB_v10007694mg             141   2e-36   Capsella rubella
ref|XP_002525095.1|  AT14A, putative                                    141   3e-36   Ricinus communis
ref|XP_008338852.1|  PREDICTED: UPF0496 protein At2g18630-like          140   3e-36   Malus domestica [apple tree]
ref|XP_008660446.1|  PREDICTED: UPF0496 protein 1-like                  140   6e-36   Zea mays [maize]
ref|XP_010026389.1|  PREDICTED: UPF0496 protein 1-like                  139   1e-35   Eucalyptus grandis [rose gum]
ref|XP_003611921.1|  hypothetical protein MTR_5g019430                  137   6e-35   Medicago truncatula
ref|XP_009138584.1|  PREDICTED: UPF0496 protein At4g34320-like          132   2e-34   Brassica rapa
ref|XP_010680904.1|  PREDICTED: UPF0496 protein 1-like                  135   5e-34   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008352479.1|  PREDICTED: UPF0496 protein At4g34320-like          135   5e-34   
ref|XP_006285951.1|  hypothetical protein CARUB_v10007471mg             134   5e-34   Capsella rubella
ref|XP_008457897.1|  PREDICTED: UPF0496 protein At2g18630-like is...    134   6e-34   Cucumis melo [Oriental melon]
ref|XP_008457896.1|  PREDICTED: UPF0496 protein At2g18630-like is...    135   7e-34   Cucumis melo [Oriental melon]
ref|XP_003537511.1|  PREDICTED: UPF0496 protein At2g18630-like is...    133   3e-33   Glycine max [soybeans]
ref|XP_010041211.1|  PREDICTED: UPF0496 protein At4g34320-like          130   3e-33   Eucalyptus grandis [rose gum]
ref|XP_010465105.1|  PREDICTED: UPF0496 protein At5g66670-like          132   5e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010432430.1|  PREDICTED: UPF0496 protein At4g34320-like          132   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010447099.1|  PREDICTED: UPF0496 protein At4g34320-like          131   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_007202121.1|  hypothetical protein PRUPE_ppa006925mg             131   1e-32   Prunus persica
ref|XP_010026159.1|  PREDICTED: UPF0496 protein 1-like                  130   1e-32   Eucalyptus grandis [rose gum]
ref|XP_004148443.1|  PREDICTED: UPF0496 protein At2g18630-like          130   2e-32   Cucumis sativus [cucumbers]
ref|XP_010484606.1|  PREDICTED: UPF0496 protein At5g66670-like          131   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010444753.1|  PREDICTED: UPF0496 protein At5g66675-like          131   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010026157.1|  PREDICTED: UPF0496 protein At2g18630-like          130   3e-32   Eucalyptus grandis [rose gum]
ref|XP_010484602.1|  PREDICTED: UPF0496 protein At5g66675               130   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_011025711.1|  PREDICTED: UPF0496 protein At2g18630               129   4e-32   Populus euphratica
ref|XP_008241622.1|  PREDICTED: UPF0496 protein At2g18630               129   4e-32   Prunus mume [ume]
ref|XP_009386739.1|  PREDICTED: UPF0496 protein 1-like                  129   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010444756.1|  PREDICTED: UPF0496 protein At5g66670-like is...    128   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010444757.1|  PREDICTED: UPF0496 protein At5g66670-like is...    128   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006279638.1|  hypothetical protein CARUB_v10026516mg             128   2e-31   Capsella rubella
ref|XP_009396890.1|  PREDICTED: UPF0496 protein 1-like isoform X1       128   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396891.1|  PREDICTED: UPF0496 protein 1-like isoform X2       127   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL58139.1|AC093093_12  hypothetical protein                         127   3e-31   Oryza sativa Japonica Group [Japonica rice]
sp|Q7XFE1.2|U496E_ORYSJ  RecName: Full=Putative UPF0496 protein 5       127   7e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009103499.1|  PREDICTED: UPF0496 protein At5g66670-like          126   9e-31   Brassica rapa
ref|XP_009394364.1|  PREDICTED: UPF0496 protein 1-like isoform X2       126   9e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010465078.1|  PREDICTED: UPF0496 protein At5g66675-like          126   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_007156894.1|  hypothetical protein PHAVU_002G026300g             125   2e-30   Phaseolus vulgaris [French bean]
emb|CDY45250.1|  BnaA07g12400D                                          124   4e-30   Brassica napus [oilseed rape]
ref|XP_003629491.1|  hypothetical protein MTR_8g078100                  123   1e-29   Medicago truncatula
gb|KCW59243.1|  hypothetical protein EUGRSUZ_H01920                     121   2e-29   Eucalyptus grandis [rose gum]
emb|CDY69791.1|  BnaCnng65370D                                          122   4e-29   Brassica napus [oilseed rape]
ref|XP_010026393.1|  PREDICTED: UPF0496 protein At4g34320-like          121   8e-29   Eucalyptus grandis [rose gum]
gb|EEC66800.1|  hypothetical protein OsI_33205                          120   1e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_010026153.1|  PREDICTED: UPF0496 protein At5g66675-like          119   1e-28   Eucalyptus grandis [rose gum]
sp|A2Z6C5.1|U496E_ORYSI  RecName: Full=Putative UPF0496 protein 5       120   2e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_010070449.1|  PREDICTED: UPF0496 protein At2g18630-like          119   2e-28   Eucalyptus grandis [rose gum]
gb|KHN16742.1|  UPF0496 protein                                         114   3e-28   Glycine soja [wild soybean]
gb|KHN44506.1|  UPF0496 protein                                         118   6e-28   Glycine soja [wild soybean]
gb|KJB17817.1|  hypothetical protein B456_003G016900                    117   9e-28   Gossypium raimondii
ref|XP_009406021.1|  PREDICTED: UPF0496 protein 1-like                  117   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010026391.1|  PREDICTED: UPF0496 protein 1-like                  115   2e-27   Eucalyptus grandis [rose gum]
ref|XP_010437628.1|  PREDICTED: UPF0496 protein At4g34320-like          115   5e-27   Camelina sativa [gold-of-pleasure]
gb|KCW64258.1|  hypothetical protein EUGRSUZ_G01899                     115   7e-27   Eucalyptus grandis [rose gum]
ref|XP_010432428.1|  PREDICTED: UPF0496 protein At4g34320-like          114   1e-26   Camelina sativa [gold-of-pleasure]
gb|KHG21625.1|  hypothetical protein F383_27631                         113   3e-26   Gossypium arboreum [tree cotton]
ref|NP_201467.1|  uncharacterized protein                               113   4e-26   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28300.1|  unknown                                                 113   5e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201468.1|  uncharacterized protein                               113   5e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72478.1|  BnaC07g45000D                                          111   5e-26   Brassica napus [oilseed rape]
ref|XP_002865055.1|  hypothetical protein ARALYDRAFT_920059             112   6e-26   Arabidopsis lyrata subsp. lyrata
gb|KCW44471.1|  hypothetical protein EUGRSUZ_L020211                    110   1e-25   Eucalyptus grandis [rose gum]
ref|XP_010026156.1|  PREDICTED: UPF0496 protein At2g18630-like          110   2e-25   Eucalyptus grandis [rose gum]
gb|KCW58574.1|  hypothetical protein EUGRSUZ_H01231                     110   2e-25   Eucalyptus grandis [rose gum]
ref|XP_006283979.1|  hypothetical protein CARUB_v10005102mg             110   2e-25   Capsella rubella
ref|XP_010451056.1|  PREDICTED: UPF0496 protein At4g34320-like          110   3e-25   Camelina sativa [gold-of-pleasure]
gb|KJB17820.1|  hypothetical protein B456_003G017100                    110   4e-25   Gossypium raimondii
ref|XP_010068111.1|  PREDICTED: UPF0496 protein At4g34320-like          108   1e-24   Eucalyptus grandis [rose gum]
ref|XP_002865054.1|  hypothetical protein ARALYDRAFT_920058             108   1e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_010451057.1|  PREDICTED: UPF0496 protein At4g34320-like          108   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010068114.1|  PREDICTED: UPF0496 protein At4g34320-like          108   2e-24   Eucalyptus grandis [rose gum]
gb|KCW62868.1|  hypothetical protein EUGRSUZ_G00464                     108   2e-24   Eucalyptus grandis [rose gum]
ref|XP_010066381.1|  PREDICTED: UPF0496 protein At4g34320-like          108   2e-24   Eucalyptus grandis [rose gum]
gb|KCW58572.1|  hypothetical protein EUGRSUZ_H01229                     108   2e-24   Eucalyptus grandis [rose gum]
ref|XP_010447098.1|  PREDICTED: UPF0496 protein At4g34320-like          108   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010042346.1|  PREDICTED: UPF0496 protein At4g34320-like          108   2e-24   Eucalyptus grandis [rose gum]
gb|KCW62869.1|  hypothetical protein EUGRSUZ_G00466                     107   6e-24   Eucalyptus grandis [rose gum]
ref|XP_010068116.1|  PREDICTED: UPF0496 protein At4g34320-like          107   6e-24   Eucalyptus grandis [rose gum]
ref|XP_002869154.1|  hypothetical protein ARALYDRAFT_353391             106   9e-24   Arabidopsis lyrata subsp. lyrata
gb|EPS73740.1|  hypothetical protein M569_01016                         103   3e-23   Genlisea aurea
gb|KCW62329.1|  hypothetical protein EUGRSUZ_H04971                     104   4e-23   Eucalyptus grandis [rose gum]
ref|XP_007199031.1|  hypothetical protein PRUPE_ppa017922mg             103   4e-23   Prunus persica
ref|XP_010027373.1|  PREDICTED: UPF0496 protein At4g34320-like          104   5e-23   Eucalyptus grandis [rose gum]
emb|CDY54199.1|  BnaCnng26390D                                          104   5e-23   Brassica napus [oilseed rape]
gb|KFK28345.1|  hypothetical protein AALP_AA8G504100                    107   5e-23   Arabis alpina [alpine rockcress]
ref|XP_010910757.1|  PREDICTED: UPF0496 protein 1-like                  100   1e-21   Elaeis guineensis
ref|XP_002960974.1|  hypothetical protein SELMODRAFT_402496           98.2    7e-21   Selaginella moellendorffii
ref|XP_002960085.1|  hypothetical protein SELMODRAFT_74510            98.2    7e-21   Selaginella moellendorffii
ref|XP_002984054.1|  hypothetical protein SELMODRAFT_119122           98.2    7e-21   Selaginella moellendorffii
ref|XP_002960745.1|  hypothetical protein SELMODRAFT_74185            97.8    9e-21   Selaginella moellendorffii
ref|XP_010451058.1|  PREDICTED: uncharacterized protein LOC104733148  99.4    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010068110.1|  PREDICTED: UPF0496 protein At4g34320-like        94.4    2e-20   Eucalyptus grandis [rose gum]
ref|XP_002983926.1|  hypothetical protein SELMODRAFT_119515           97.1    2e-20   Selaginella moellendorffii
ref|XP_004301900.1|  PREDICTED: uncharacterized protein LOC101291734  91.3    1e-17   Fragaria vesca subsp. vesca
ref|XP_010042437.1|  PREDICTED: UPF0496 protein At4g34320-like        87.4    3e-17   Eucalyptus grandis [rose gum]
ref|XP_001757691.1|  predicted protein                                87.8    4e-17   Physcomitrella patens
ref|XP_010026155.1|  PREDICTED: UPF0496 protein At2g18630-like        85.1    6e-17   Eucalyptus grandis [rose gum]
emb|CDY33577.1|  BnaC06g29750D                                        82.8    2e-15   Brassica napus [oilseed rape]
gb|KCW64260.1|  hypothetical protein EUGRSUZ_G019022                  81.3    3e-15   Eucalyptus grandis [rose gum]
ref|XP_010026392.1|  PREDICTED: uncharacterized protein LOC104416741  82.8    7e-15   Eucalyptus grandis [rose gum]
ref|XP_010026152.1|  PREDICTED: UPF0496 protein At2g18630-like        79.0    2e-14   Eucalyptus grandis [rose gum]
ref|XP_009394362.1|  PREDICTED: long chain base biosynthesis prot...  79.7    8e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011025710.1|  PREDICTED: UPF0496 protein At2g18630-like is...  77.4    1e-13   Populus euphratica
gb|KFK37698.1|  hypothetical protein AALP_AA3G017200                  77.4    1e-13   Arabis alpina [alpine rockcress]
ref|XP_009389878.1|  PREDICTED: UPF0496 protein 1-like                77.0    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011025709.1|  PREDICTED: UPF0496 protein At2g18630-like is...  77.0    2e-13   Populus euphratica
ref|XP_009387837.1|  PREDICTED: UPF0496 protein At4g34320-like        76.3    3e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010041287.1|  PREDICTED: UPF0496 protein At4g34320-like        74.3    4e-13   Eucalyptus grandis [rose gum]
ref|XP_010550397.1|  PREDICTED: UPF0496 protein At5g66675-like        74.7    1e-12   Tarenaya hassleriana [spider flower]
ref|XP_009105631.1|  PREDICTED: UPF0496 protein At5g66670-like        72.4    6e-12   Brassica rapa
emb|CDY33576.1|  BnaC06g29760D                                        72.4    1e-11   Brassica napus [oilseed rape]
emb|CBI32550.3|  unnamed protein product                              69.7    2e-11   Vitis vinifera
ref|XP_002984051.1|  hypothetical protein SELMODRAFT_423223           71.6    3e-11   Selaginella moellendorffii
ref|XP_010534644.1|  PREDICTED: UPF0496 protein At4g34320-like        70.9    3e-11   Tarenaya hassleriana [spider flower]
ref|XP_009105438.1|  PREDICTED: UPF0496 protein At5g66660-like        70.9    3e-11   Brassica rapa
gb|KJB17822.1|  hypothetical protein B456_003G017300                  69.7    6e-11   Gossypium raimondii
gb|AFW89347.1|  hypothetical protein ZEAMMB73_964178                  64.7    3e-10   Zea mays [maize]
ref|XP_002525093.1|  AT14A, putative                                  67.4    5e-10   Ricinus communis
ref|XP_002310783.1|  hypothetical protein POPTR_0007s12310g           65.1    1e-09   Populus trichocarpa [western balsam poplar]
emb|CDX95978.1|  BnaA07g27530D                                        65.9    2e-09   Brassica napus [oilseed rape]
dbj|BAD93736.1|  At14a-2 integrin - like protein                      65.5    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189469.1|  AT14A-like protein                                  65.1    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010534149.1|  PREDICTED: UPF0496 protein At3g57100-like        64.7    3e-09   Tarenaya hassleriana [spider flower]
gb|AAN60297.1|  unknown                                               63.5    9e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008236803.1|  PREDICTED: UPF0496 protein At4g34320-like        63.9    9e-09   Prunus mume [ume]
ref|XP_010026390.1|  PREDICTED: UPF0496 protein At2g18630-like        61.6    1e-08   Eucalyptus grandis [rose gum]
gb|AAN60266.1|  unknown                                               63.2    1e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAL16206.1|AF428437_1  AT3g28270/MZF16_5                           62.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566836.1|  uncharacterized protein                             62.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001757787.1|  predicted protein                                62.4    2e-08   Physcomitrella patens
ref|XP_010521290.1|  PREDICTED: UPF0496 protein At3g57100-like        61.6    5e-08   Tarenaya hassleriana [spider flower]
gb|KCW64263.1|  hypothetical protein EUGRSUZ_G019031                  58.9    5e-08   
gb|KJB17819.1|  hypothetical protein B456_003G017000                  60.8    6e-08   
gb|KCW59239.1|  hypothetical protein EUGRSUZ_H01914                   58.2    1e-07   
ref|XP_010068633.1|  PREDICTED: UPF0496 protein 1-like                58.9    2e-07   
gb|ABR25727.1|  unknown                                               56.6    3e-07   
ref|XP_006662290.1|  PREDICTED: putative UPF0496 protein 5-like       58.5    4e-07   
ref|XP_008777232.1|  PREDICTED: UPF0496 protein 1-like                57.0    1e-06   
gb|KJB17821.1|  hypothetical protein B456_003G017200                  56.6    2e-06   
sp|Q6E240.3|U496E_ARATH  RecName: Full=UPF0496 protein At3g28310/...  56.2    3e-06   
ref|NP_189472.1|  uncharacterized protein                             55.8    4e-06   
gb|AAT68381.1|  hypothetical protein At3g28320                        55.5    4e-06   
ref|XP_010502825.1|  PREDICTED: UPF0496 protein At3g28270-like        55.8    4e-06   
gb|EYU41176.1|  hypothetical protein MIMGU_mgv1a022893mg              53.5    4e-06   
ref|XP_007199414.1|  hypothetical protein PRUPE_ppa026278mg           55.8    5e-06   
ref|XP_008236802.1|  PREDICTED: UPF0496 protein At4g34320-like        55.5    5e-06   
ref|XP_010534304.1|  PREDICTED: UPF0496 protein At3g57100-like is...  54.3    1e-05   
ref|XP_008776622.1|  PREDICTED: UPF0496 protein 1-like                53.5    2e-05   
ref|XP_006279201.1|  hypothetical protein CARUB_v10000007mg           53.1    3e-05   
dbj|BAC42823.1|  putative At14a-2 protein                             52.4    4e-05   
ref|XP_006290444.1|  hypothetical protein CARUB_v10019413mg           52.8    5e-05   
ref|XP_010419440.1|  PREDICTED: UPF0496 protein At3g57100-like        52.4    6e-05   
ref|XP_010534290.1|  PREDICTED: UPF0496 protein At3g57100-like        52.0    8e-05   
emb|CDX76060.1|  BnaA04g03240D                                        52.0    9e-05   
ref|XP_009139346.1|  PREDICTED: UPF0496 protein At3g57100-like        52.0    9e-05   
ref|XP_010424327.1|  PREDICTED: UPF0496 protein At3g57100-like        51.2    2e-04   
ref|XP_010507094.1|  PREDICTED: UPF0496 protein At3g28270-like        50.8    2e-04   
ref|XP_010472135.1|  PREDICTED: UPF0496 protein At3g57100-like        50.4    3e-04   
ref|XP_006291317.1|  hypothetical protein CARUB_v10017451mg           50.4    3e-04   
ref|XP_010556076.1|  PREDICTED: UPF0496 protein At4g34320-like        48.9    4e-04   
ref|XP_010412426.1|  PREDICTED: UPF0496 protein At3g28270-like        49.7    4e-04   
ref|XP_010502824.1|  PREDICTED: UPF0496 protein At3g28270-like        49.3    7e-04   
ref|XP_006279202.1|  hypothetical protein CARUB_v100000060mg          49.3    7e-04   



>ref|XP_006361572.1| PREDICTED: UPF0496 protein 1-like [Solanum tuberosum]
Length=389

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 158/196 (81%), Gaps = 3/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A +SQSI++ AL KFE E   I     DS  L+++TL +LK FK AGDPFT KFFS F +
Sbjct  133  ARNSQSIIQVALTKFENE---INGNEGDSELLFTETLQQLKSFKAAGDPFTAKFFSSFQA  189

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY  Q  +L K+K K S+LDKKL +VK+W+R+SN+IFATVFVS +ICS+VAA VTAPP+V
Sbjct  190  VYTHQNALLTKLKSKMSKLDKKLSRVKTWKRVSNIIFATVFVSAIICSIVAAAVTAPPMV  249

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALAAAASVPLGTVGKWIN+MWKKYE++LKR+REILT++ AG ++VIQDL +IQ LVD+L
Sbjct  250  TALAAAASVPLGTVGKWINSMWKKYEDELKRDREILTSMEAGTFLVIQDLVNIQVLVDKL  309

Query  542  QEQIQGLLYNADFAMQ  589
            Q   +GLL++A+FA+ 
Sbjct  310  QIIFEGLLHSANFAIN  325



>ref|XP_004250688.1| PREDICTED: UPF0496 protein 1-like [Solanum lycopersicum]
Length=407

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 154/196 (79%), Gaps = 3/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A +SQSI++ AL KFE E   I     DS  L+++TL + K FK AGDPFT KFFS F +
Sbjct  130  ARNSQSIIQVALTKFENE---INGNQGDSQLLFTETLQQFKSFKAAGDPFTAKFFSSFQA  186

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY  Q  +L K+K K S+LDKKL +VK+W+R+SN+IFATVFVS +ICS+VAA VTAPP+V
Sbjct  187  VYTHQNALLTKLKSKMSKLDKKLNRVKTWKRVSNIIFATVFVSAIICSIVAAAVTAPPMV  246

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALAAAASVPLGTVGKWIN+MW KYE++LKR+R IL ++ AG ++VIQDL +IQ LVD+L
Sbjct  247  TALAAAASVPLGTVGKWINSMWNKYEDELKRDRGILNSMEAGTFLVIQDLVNIQVLVDKL  306

Query  542  QEQIQGLLYNADFAMQ  589
            Q   +GLL++A+FA+ 
Sbjct  307  QIIFEGLLHSANFAIN  322



>ref|XP_009801742.1| PREDICTED: UPF0496 protein 1-like [Nicotiana sylvestris]
Length=400

 Score =   192 bits (489),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 165/198 (83%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGH--DSVQLYSKTLAELKKFKDAGDPFTEKFFSLF  175
            A  SQSI+  AL KFE ES+     G+  DS  L+S+TL +LK FK AGDPFT +FFS F
Sbjct  144  ARTSQSIILVALTKFENESS-----GNEGDSKLLFSETLEQLKSFKAAGDPFTARFFSSF  198

Query  176  HSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtapp  355
            HSVY QQE +L K+K KK++LDKKL +VK+W+R+SN+IFATVFVS +ICS+VAA VTAPP
Sbjct  199  HSVYLQQEALLMKLKSKKNKLDKKLSRVKTWKRVSNIIFATVFVSAIICSIVAAAVTAPP  258

Query  356  vvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVD  535
            +VTALAAAASVPLGTVGKWIN+MWKKYE++LKREREILT++ AG+++VIQDLE I+ L D
Sbjct  259  IVTALAAAASVPLGTVGKWINSMWKKYEDELKREREILTSMEAGSFVVIQDLEHIRVLAD  318

Query  536  RLQEQIQGLLYNADFAMQ  589
            +LQ  ++GLL++ADFA++
Sbjct  319  KLQIIVEGLLHSADFAIR  336



>ref|XP_009586590.1| PREDICTED: UPF0496 protein 1-like [Nicotiana tomentosiformis]
Length=400

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 163/196 (83%), Gaps = 3/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQSI+  AL KFE ES+       DS  L+S+TL +LK FK AGDPFT KFFS FH+
Sbjct  144  ARTSQSIILVALTKFENESSANEV---DSKLLFSETLEQLKSFKAAGDPFTAKFFSSFHT  200

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQE +L K+K KKS+LDKKL +VK+W+R+SN+IFATVFVS +ICS+VAA VTAPP+V
Sbjct  201  VYLQQEALLMKLKSKKSKLDKKLSRVKTWKRVSNIIFATVFVSAIICSIVAAAVTAPPIV  260

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALAAAASVPLGTVGKWIN+MWKKYE++LKREREILT++ AG+++VIQDLE I+ L D+L
Sbjct  261  TALAAAASVPLGTVGKWINSMWKKYEDELKREREILTSMQAGSFVVIQDLEHIRVLADKL  320

Query  542  QEQIQGLLYNADFAMQ  589
            Q  ++GLL++ADFA++
Sbjct  321  QIIVEGLLHSADFAIK  336



>gb|EYU39376.1| hypothetical protein MIMGU_mgv1a019801mg [Erythranthe guttata]
Length=418

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 151/196 (77%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAG--DPFTEKFFSLF  175
            A H +S++  AL+KFE E      P ++    YS TLAEL+ F  A   DPF E+FFS+F
Sbjct  153  AAHIESVVNIALRKFEHEHHSTATPDNN----YSSTLAELRNFNAAAAADPFGEEFFSVF  208

Query  176  HSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtapp  355
            +SVY +Q +ML+++K KKS+LD KL K+K+W+++SNVIF   F SVLICSVVAA ++APP
Sbjct  209  NSVYSKQIVMLERLKSKKSKLDNKLGKLKAWKKVSNVIFVVTFASVLICSVVAAALSAPP  268

Query  356  vvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVD  535
            VVTALAAAA+VPLG++G+WIN++WK YENDL+ +REI+ ++  G +IVI+DLESI+ LVD
Sbjct  269  VVTALAAAAAVPLGSMGRWINSLWKTYENDLRGQREIIGSMQIGTFIVIKDLESIRVLVD  328

Query  536  RLQEQIQGLLYNADFA  583
            R + +I+GLL NADF 
Sbjct  329  RFRIKIEGLLANADFG  344



>emb|CDP02406.1| unnamed protein product [Coffea canephora]
Length=311

 Score =   180 bits (456),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 152/195 (78%), Gaps = 1/195 (1%)
 Frame = +2

Query  8    HSQSILRFALQKFEEESAKI-TEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSV  184
            H+QSI+  ALQKFEEE          +SV  Y KTL EL  FK  GDPFT++FFSLF  V
Sbjct  52   HTQSIVLLALQKFEEEHENAQAHSQEESVNPYPKTLQELSNFKATGDPFTQEFFSLFQDV  111

Query  185  YKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvt  364
            YKQQ LML+K++ KK +LDKKL+ +K WR++SNVIF   FVSVLICSVVAA VTAPPVVT
Sbjct  112  YKQQVLMLEKLQAKKRKLDKKLKSMKGWRKVSNVIFIAAFVSVLICSVVAAAVTAPPVVT  171

Query  365  alaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQ  544
            ALAAAA+VPLG++GKW+N++W K E DLK +RE++ ++  GNY+VI+DL+SI+ LVD+LQ
Sbjct  172  ALAAAAAVPLGSMGKWLNSIWSKCERDLKGQREVIFSMQIGNYVVIKDLDSIRVLVDKLQ  231

Query  545  EQIQGLLYNADFAMQ  589
             +I+ LL  ADFAM+
Sbjct  232  IEIEALLQTADFAMR  246



>ref|XP_004507409.1| PREDICTED: UPF0496 protein At4g34320-like [Cicer arietinum]
Length=377

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 151/196 (77%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q ++  A+Q+FEEES    E G +    YSKTL ELK FK+AGDPFTE+FF +F S
Sbjct  135  ARDTQLLILVAIQQFEEES----ESGDNR---YSKTLQELKNFKEAGDPFTEEFFQIFQS  187

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ LML+K++ +K++LDKKL+ +KSWR++S++IF   F +VLICSVVAA + APPV 
Sbjct  188  VYKQQILMLEKLQVRKNKLDKKLKYIKSWRKVSSMIFVATFAAVLICSVVAAAIAAPPVA  247

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+AAA S+P+G++GKWI+++WK YE  LK ++E++ ++ AG Y+ I+DL++I+ LVDRL
Sbjct  248  AAIAAATSIPIGSMGKWIDSLWKNYEIALKGQKEVIASMQAGTYVAIKDLDNIRVLVDRL  307

Query  542  QEQIQGLLYNADFAMQ  589
            Q +I+ L +  DFA++
Sbjct  308  QIEIESLFHTVDFAIE  323



>ref|XP_004289620.1| PREDICTED: UPF0496 protein At4g34320-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011457687.1| PREDICTED: UPF0496 protein At4g34320-like [Fragaria vesca subsp. 
vesca]
Length=375

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 150/196 (77%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEE    TE G      Y++TLAELK FK AGDPFTE+FF +F +
Sbjct  134  ARDSQLLILVALQQFEEE----TEVGGSR---YTRTLAELKNFKAAGDPFTEEFFQMFQT  186

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ LML+K+  +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  187  VYRQQLLMLEKLHLRKNKLDKKLKYINAWRKVSSIIFVATFAAVLICSVVAAAMAAPPVA  246

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA S+P+G++GKWI+++WK YE+ +K ++E+++++  G Y+ I+DL+SI+ L+DRL
Sbjct  247  AALAAATSIPIGSMGKWIDSLWKNYESAMKGQKEVISSMQVGTYVAIKDLDSIRVLIDRL  306

Query  542  QEQIQGLLYNADFAMQ  589
            + +IQ L+ NA FA++
Sbjct  307  EIEIQSLMDNASFAIE  322



>gb|KHN25354.1| UPF0496 protein [Glycine soja]
Length=291

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 150/196 (77%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  A+Q+FEEES      G +    Y++TL E K FK AGDPFTE+FF +F S
Sbjct  50   ARDSQLLIHVAVQQFEEESG----SGDNR---YARTLQEFKNFKAAGDPFTEEFFQIFQS  102

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q LML+K++ +K++LDKKL+ + SWR++S++IF   F +VLICSVVAA + APPV 
Sbjct  103  VYKHQILMLEKLQLRKNKLDKKLKYIHSWRKVSSMIFVATFAAVLICSVVAAAIAAPPVA  162

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+AAA S+P+G++GKWI+++W+ YEN LK ++E+++++ AG Y+ I+DL++I+ L+DRL
Sbjct  163  AAIAAATSIPIGSMGKWIDSLWRNYENALKGQKEVISSMQAGTYVAIKDLDNIRILIDRL  222

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ LL+N DFA++
Sbjct  223  EIEIESLLHNVDFAIE  238



>ref|XP_003537895.1| PREDICTED: UPF0496 protein At4g34320-like [Glycine max]
 gb|KHN14849.1| UPF0496 protein [Glycine soja]
Length=374

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 148/196 (76%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEES+     G      Y +TL E K FK AGDPFTE+FF +F S
Sbjct  131  ARDSQLLIHVALQQFEEESS-----GSGGDNRYPRTLQEFKNFKAAGDPFTEEFFQIFQS  185

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q  ML+K++ +K++LDKKL+ + SWR++S++IF   F +VLICSVVAA + APPV 
Sbjct  186  VYKHQIFMLEKLQLRKNKLDKKLKYIHSWRKVSSMIFVATFAAVLICSVVAAAIAAPPVA  245

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+AAA S+P+G++GKWI+++W+ YEN LK ++E+++++ AG Y+ I+DL++I+ L+DRL
Sbjct  246  AAIAAATSIPIGSMGKWIDSLWRNYENALKGQKEVISSMQAGTYVAIKDLDNIRVLIDRL  305

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ LL+N DFA++
Sbjct  306  EIEIESLLHNVDFAIE  321



>ref|XP_003541076.1| PREDICTED: UPF0496 protein At4g34320-like [Glycine max]
Length=373

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 150/196 (77%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  A+Q+FEEES      G +    Y++TL E K FK AGDPFTE+FF +F S
Sbjct  132  ARDSQLLIHVAVQQFEEESG----SGDNR---YARTLQEFKNFKAAGDPFTEEFFQIFQS  184

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q LML+K++ +K++LDKKL+ + SWR++S++IF   F +VLICSVVAA + APPV 
Sbjct  185  VYKHQILMLEKLQLRKNKLDKKLKYIHSWRKVSSMIFVATFAAVLICSVVAAAIAAPPVA  244

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+AAA S+P+G++GKWI+++W+ YEN LK ++E+++++ AG Y+ I+DL++I+ L+DRL
Sbjct  245  AAIAAATSIPIGSMGKWIDSLWRNYENALKGQKEVISSMQAGTYVAIKDLDNIRILIDRL  304

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ LL+N DFA++
Sbjct  305  EIEIESLLHNVDFAIE  320



>ref|XP_002519094.1| AT14A, putative [Ricinus communis]
 gb|EEF43305.1| AT14A, putative [Ricinus communis]
Length=380

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 149/196 (76%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ  +  ALQ+FEEE+    E G +    Y KTL  LK FK AGDPFTE+FF +F S
Sbjct  133  ARDSQLFILVALQQFEEEN----EAGGNR---YVKTLEGLKNFKSAGDPFTEEFFQIFQS  185

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ LML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  186  VYRQQMLMLEKLQHRKNKLDKKLKCLHAWRKVSSIIFVATFAAVLICSVVAAAMAAPPVA  245

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA S+PLG++GKWI+++WK YEN LK E+E+++T+  G Y+ I+DL++I+ L++RL
Sbjct  246  AALAAATSIPLGSMGKWIDSLWKNYENALKGEKELISTMQVGTYVAIKDLDNIRVLINRL  305

Query  542  QEQIQGLLYNADFAMQ  589
            +  I+ L++NA+FA++
Sbjct  306  EIDIEALMHNAEFAIE  321



>gb|KDP46219.1| hypothetical protein JCGZ_10059 [Jatropha curcas]
Length=380

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 145/196 (74%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ  +  ALQ+FEEES        +    + KTL  LK FK AGDPFTE FF LF S
Sbjct  139  ARDSQLFILVALQQFEEESV-------NGGNRFGKTLEGLKNFKSAGDPFTEDFFQLFQS  191

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ LML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  192  VYRQQILMLEKLQSRKNKLDKKLKYIHAWRKVSSIIFVATFAAVLICSVVAAAMAAPPVA  251

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA S+PLG++GKWI+++WK YEN LK ++E+ +T+  G Y+ I+DL++I+ L+DRL
Sbjct  252  AALAAATSIPLGSMGKWIDSLWKNYENALKGQKELTSTMQVGTYVAIKDLDNIRLLIDRL  311

Query  542  QEQIQGLLYNADFAMQ  589
            +  I+GL+ NA+FA++
Sbjct  312  EIDIEGLMVNAEFAIE  327



>ref|XP_007042727.1| UPF0496 protein [Theobroma cacao]
 gb|EOX98558.1| UPF0496 protein [Theobroma cacao]
Length=373

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 148/196 (76%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEES    E G      Y +TL ELK FK AGDPFTE+FF +F S
Sbjct  132  ARDSQLLILVALQQFEEES----EVGGSR---YVRTLEELKNFKAAGDPFTEEFFQIFQS  184

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  MLDK++ +K++LDKKL+ V +WR++S++IF     +VLICSVVAA + APPV 
Sbjct  185  VYRQQIAMLDKLQLRKNKLDKKLKYVHAWRKVSSMIFVATCATVLICSVVAAAMAAPPVA  244

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA S+PLG++GKWI+++WK YEN LK ++E+++++ AG Y+ I+DL++I+ L+DRL
Sbjct  245  AALAAATSIPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTYVAIKDLDNIRVLIDRL  304

Query  542  QEQIQGLLYNADFAMQ  589
            +  I+ LL NA+FA++
Sbjct  305  EIDIEALLQNAEFAIE  320



>ref|XP_002313064.1| hypothetical protein POPTR_0009s11550g [Populus trichocarpa]
 gb|EEE87019.1| hypothetical protein POPTR_0009s11550g [Populus trichocarpa]
Length=374

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 148/196 (76%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEES    E G      Y KTL ELK FK AGDPFTE+FF +F S
Sbjct  133  ARDSQLLILVALQQFEEES----EAGGSK---YVKTLEELKSFKAAGDPFTEEFFQIFQS  185

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  186  VYRQQITMLEKLQLRKNKLDKKLKCIHAWRKVSSIIFVATFATVLICSVVAAAMAAPPVA  245

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA+S+PLG++GKWI++MWK YEN LK ++E+++T+  G Y+ I+DL++I+ L++RL
Sbjct  246  AALAAASSIPLGSMGKWIDSMWKNYENALKGQKEVISTMQVGTYVAIKDLDTIRVLINRL  305

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ L+   DFA++
Sbjct  306  EIEIEALMQTTDFAIE  321



>ref|XP_007201071.1| hypothetical protein PRUPE_ppa007273mg [Prunus persica]
 gb|EMJ02270.1| hypothetical protein PRUPE_ppa007273mg [Prunus persica]
Length=375

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 150/196 (77%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEE    TE G      Y++TL ELK FK  GDPFTE+FF +F S
Sbjct  134  ARDSQLLILVALQQFEEE----TEMGGSR---YTRTLGELKNFKAIGDPFTEEFFQIFQS  186

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  187  VYRQQIQMLEKLQLRKNKLDKKLKYIHAWRKVSSIIFVATFAAVLICSVVAAAMAAPPVA  246

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA+S+P+G++GKWI+++WK YEN L+ ++E+++++  G Y+ I+DL++I+ L+DRL
Sbjct  247  AALAAASSIPVGSMGKWIDSLWKNYENALRGQKEVISSMQVGTYVAIKDLDNIRVLIDRL  306

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ LL+NA FA++
Sbjct  307  EVEIESLLHNASFAIE  322



>gb|KEH30404.1| UPF0496 plant-like protein [Medicago truncatula]
Length=374

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 149/196 (76%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  A+Q+FEEES    E G    + Y++TL ELK FK AGDPFTE+FF +F S
Sbjct  133  ARDSQLLILVAIQRFEEES----ESGD---KCYARTLQELKNFKTAGDPFTEEFFQIFQS  185

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ  ML+K++ +K++LDKKL+ + SWR++S++IF   F +VLICSVVAA + APPV 
Sbjct  186  VYKQQTSMLEKLQIRKNKLDKKLKGIHSWRKVSSMIFVATFAAVLICSVVAAAIAAPPVA  245

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA S+P+G++GKWI+++W+ YE  LK ++E++ ++ AG Y+ I+DL++I+ L+DRL
Sbjct  246  AALAAATSIPIGSMGKWIDSLWRNYEIALKGQKEVIGSMQAGTYVAIKDLDNIRVLIDRL  305

Query  542  QEQIQGLLYNADFAMQ  589
            + +++ LL+  DFA++
Sbjct  306  EIEVESLLHTVDFAIE  321



>gb|KJB32195.1| hypothetical protein B456_005G228900 [Gossypium raimondii]
Length=382

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 151/198 (76%), Gaps = 5/198 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQ--LYSKTLAELKKFKDAGDPFTEKFFSLF  175
            A  SQ ++  ALQ+F+EE+      G DS     Y++TL ELK FK AGDPFTE+FF  F
Sbjct  135  ARDSQLLILVALQQFDEETET---GGRDSGSEIKYARTLEELKNFKAAGDPFTEEFFQNF  191

Query  176  HSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtapp  355
             SVYKQQ  ML+K++ +K++LDKKLR + +WR++S++IF   F +VLICSVVAA + APP
Sbjct  192  QSVYKQQMAMLEKLQLRKNKLDKKLRYIHAWRKVSSMIFVATFATVLICSVVAAAMAAPP  251

Query  356  vvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVD  535
            V  ALAAAAS+PLG++GKWI+++WK YEN LK ++E+++++ AG Y+ I+DL++I+ L+D
Sbjct  252  VAAALAAAASIPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTYVAIKDLDNIRILID  311

Query  536  RLQEQIQGLLYNADFAMQ  589
            RL+ +I+ +L  ADFA++
Sbjct  312  RLEIEIESMLKTADFAVE  329



>ref|XP_007131859.1| hypothetical protein PHAVU_011G047500g [Phaseolus vulgaris]
 gb|ESW03853.1| hypothetical protein PHAVU_011G047500g [Phaseolus vulgaris]
Length=372

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 147/195 (75%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            +  SQ ++  ALQ+FEEES      G +    Y +TL E K FK AGDPFT++FF +F S
Sbjct  131  SRDSQLLILVALQQFEEESV----LGDNR---YVRTLQEFKNFKAAGDPFTQEFFQIFQS  183

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
             YK Q LM +K++ +K++LDKKL+ +KSWR++S++IF   F +VLICSVVAA + APP+ 
Sbjct  184  AYKHQILMFEKLQLRKNKLDKKLKYIKSWRKVSSMIFVATFAAVLICSVVAAAIAAPPIA  243

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+AAA S+P+G++GKW++++WK YEN LK ++E+++++ AG Y+ I+DL+SI+ L+DRL
Sbjct  244  AAIAAATSIPIGSMGKWMDSLWKNYENALKGQKEVISSMQAGTYVAIKDLDSIRVLIDRL  303

Query  542  QEQIQGLLYNADFAM  586
            Q +I+ LL+N DFA+
Sbjct  304  QIEIESLLHNVDFAI  318



>ref|XP_009344780.1| PREDICTED: UPF0496 protein At4g34320-like [Pyrus x bretschneideri]
Length=375

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 146/195 (75%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEE    TE G      Y++TL ELK FK  GDPFTE+FF +F S
Sbjct  134  ARDSQLLILVALQRFEEE----TEMGGGQ---YTRTLEELKNFKAIGDPFTEEFFQIFQS  186

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            +YKQQ LML+K++ +K++LDKKLR + +WR+++ +IF   F +VLICSVVA  + APPV 
Sbjct  187  IYKQQILMLEKLQMRKNKLDKKLRCINAWRKVTGMIFVATFAAVLICSVVAGGLAAPPVA  246

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA+S+P+G++G WI+++WK YEN L+ ++E+++++  G Y+ I+DL++I+ LVDRL
Sbjct  247  AALAAASSIPVGSMGNWIDSLWKNYENVLRGQKEVISSMQVGTYVAIKDLDNIRVLVDRL  306

Query  542  QEQIQGLLYNADFAM  586
            +  I+ LL+NA FA+
Sbjct  307  EIDIESLLHNAIFAI  321



>gb|KDO51452.1| hypothetical protein CISIN_1g040233mg [Citrus sinensis]
Length=366

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 149/196 (76%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEE+      GH     Y +TL ELK FK AGDPFTE+FF +F S
Sbjct  124  ARDSQLLILVALQQFEEEND--MGAGHR----YVRTLEELKNFKAAGDPFTEEFFQIFQS  177

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ  ML+K++ +K++LDKKL+ + SWR++S++IFA  F +VLICSVVAA + APPV 
Sbjct  178  VYKQQISMLEKLQLRKNKLDKKLKYIHSWRKVSSIIFAATFATVLICSVVAAAMAAPPVA  237

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA+S+PLG++GKWI+++WK YE+ LK ++E+++++  G YI I+DL++I+ L+DRL
Sbjct  238  AALAAASSIPLGSMGKWIDSLWKNYEHALKGQKEMISSMQVGTYIAIKDLDNIRVLIDRL  297

Query  542  QEQIQGLLYNADFAMQ  589
            + +++ LL N DF ++
Sbjct  298  EIEVEALLQNVDFVIE  313



>ref|XP_006423198.1| hypothetical protein CICLE_v10030403mg [Citrus clementina]
 ref|XP_006472632.1| PREDICTED: UPF0496 protein At4g34320-like [Citrus sinensis]
 ref|XP_006487193.1| PREDICTED: UPF0496 protein At4g34320-like [Citrus sinensis]
 gb|ESR36438.1| hypothetical protein CICLE_v10030403mg [Citrus clementina]
Length=366

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 149/196 (76%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEE+      GH     Y +TL ELK FK AGDPFTE+FF +F S
Sbjct  124  ARDSQLLILVALQQFEEEND--MGAGHR----YVRTLEELKNFKAAGDPFTEEFFQIFQS  177

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ  ML+K++ +K++LDKKL+ + SWR++S++IFA  F +VLICSVVAA + APPV 
Sbjct  178  VYKQQISMLEKLQLRKNKLDKKLKYIHSWRKVSSIIFAATFATVLICSVVAAAMAAPPVA  237

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA+S+PLG++GKWI+++WK YE+ LK ++E+++++  G YI I+DL++I+ L+DRL
Sbjct  238  AALAAASSIPLGSMGKWIDSLWKNYEHALKGQKEMISSMQVGTYIAIKDLDNIRVLIDRL  297

Query  542  QEQIQGLLYNADFAMQ  589
            + +++ LL N DF ++
Sbjct  298  EIEVEALLQNVDFVIE  313



>ref|XP_008365973.1| PREDICTED: UPF0496 protein At4g34320-like [Malus domestica]
Length=375

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 147/195 (75%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEE    TE G      Y++TL ELK FK  GDPFTE+FF +F S
Sbjct  134  ARDSQLLILVALQRFEEE----TEMGGGQ---YTRTLEELKNFKAIGDPFTEEFFQIFQS  186

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            +YKQQ LML+K++ +K++LDKKL+ + +WR+++ +IF   F +VLICSVVAA + APPV 
Sbjct  187  IYKQQILMLEKLQMRKNKLDKKLKCINAWRKVTGMIFVATFAAVLICSVVAAAMAAPPVA  246

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA+S+P+G++G WI+++WK YEN L+ ++E+++++  G Y+ I+DL++I+ L+DRL
Sbjct  247  AALAAASSIPVGSMGNWIDSLWKNYENALRGQKEVISSMQVGTYVAIKDLDNIRVLIDRL  306

Query  542  QEQIQGLLYNADFAM  586
            +  I+ LL+NA FA+
Sbjct  307  EIDIESLLHNASFAI  321



>ref|XP_008236784.1| PREDICTED: UPF0496 protein At4g34320-like [Prunus mume]
Length=375

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 149/196 (76%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEE    TE G      Y++TL ELK FK  GDPFTE+FF +F S
Sbjct  134  ARDSQLLILVALQQFEEE----TEMGGSR---YTRTLDELKTFKAIGDPFTEEFFQIFQS  186

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ LM +K++ +K++LDKK + + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  187  VYRQQILMFEKLQLRKNKLDKKFKYIHAWRKVSSIIFVATFAAVLICSVVAAAMAAPPVA  246

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA+S+P+G++GKWI+++WK YEN L+ ++E+++++  G Y+ I+DL++I+ L+DRL
Sbjct  247  AALAAASSIPVGSMGKWIDSLWKNYENALRGQKEVISSMQVGTYVAIKDLDNIRVLIDRL  306

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ LL+NA FA++
Sbjct  307  EVEIESLLHNASFAIE  322



>ref|XP_011048925.1| PREDICTED: UPF0496 protein At4g34320-like [Populus euphratica]
Length=374

 Score =   171 bits (434),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 148/196 (76%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEES    E G      Y KTL ELK FK AGDPFTE+FF +F S
Sbjct  133  ARDSQLLILVALQQFEEES----EAGGSK---YVKTLEELKSFKAAGDPFTEEFFQIFQS  185

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  186  VYRQQITMLEKLQLRKNKLDKKLKCIHAWRKVSSIIFVATFATVLICSVVAAAMAAPPVA  245

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA+S+PLG++GKWI+++WK YEN LK ++E+++T+  G ++ I+DL++I+ L++RL
Sbjct  246  AALAAASSIPLGSMGKWIDSLWKNYENALKGQKEVISTMQVGTFVAIKDLDTIRVLINRL  305

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ L+   DFA++
Sbjct  306  EIEIEALMQTTDFAIE  321



>ref|XP_011037574.1| PREDICTED: UPF0496 protein At4g34320-like [Populus euphratica]
 ref|XP_011037575.1| PREDICTED: UPF0496 protein At4g34320-like [Populus euphratica]
Length=374

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 152/196 (78%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  +L++FEEES      G +    Y +TL ELK FK AGDPFT++FF +F S
Sbjct  133  ARDSQLLILVSLKQFEEES---DAGGRE----YVRTLEELKNFKAAGDPFTDEFFQIFQS  185

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ +ML+K++ +K++LDKKL+ + +WR++S++IF  +F +VLICSVVAA +TAPPVV
Sbjct  186  VYRQQIMMLEKLQLRKNKLDKKLKCIHAWRKVSSMIFVAIFATVLICSVVAAAMTAPPVV  245

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+AAA+++PLG++GKWI+++WK YEN LK ++E+++T+  G Y+ I+DL++I+ L+DRL
Sbjct  246  AAVAAASTIPLGSMGKWIDSLWKNYENALKGQKEVISTMQVGTYVAIKDLDNIRVLIDRL  305

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ L+   DFA++
Sbjct  306  EIEIEALMRTTDFAIE  321



>emb|CDO97084.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 147/197 (75%), Gaps = 11/197 (6%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQ--LYSKTLAELKKFKDAGDPFTEKFFSLF  175
            A  SQ ++  ALQ+FEEE         D V+   Y++TL ELK FK AGDPFTE+FF +F
Sbjct  129  ARDSQLLIMVALQQFEEE---------DGVEGNRYNRTLDELKNFKAAGDPFTEEFFEIF  179

Query  176  HSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtapp  355
             SVY+QQ LML+K++ +KS+LDKKL+ + +WR++S++IF   F +VLICSVVAA + APP
Sbjct  180  QSVYRQQILMLEKLQMRKSKLDKKLKYIHAWRKLSSIIFVATFAAVLICSVVAAAMAAPP  239

Query  356  vvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVD  535
            V  ALAAA S+PLG++GKWI+++ + YEN +K ++EI+++I  G Y+ I+DL++I+ L+D
Sbjct  240  VAAALAAATSIPLGSMGKWIDSLLQSYENAVKGQKEIMSSIHVGTYVTIKDLDNIRVLID  299

Query  536  RLQEQIQGLLYNADFAM  586
            RL+  I+ LL N DFA+
Sbjct  300  RLEIDIESLLANVDFAI  316



>ref|XP_011085548.1| PREDICTED: UPF0496 protein 1-like [Sesamum indicum]
Length=409

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 151/196 (77%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A H +SI+  AL+KF+EE    T  G  S + YS+TL EL+ F+ A DPFT++FF +F S
Sbjct  153  AGHIESIINVALRKFDEEHC--TFAGEGSAKNYSRTLEELRNFRLAADPFTQEFFRVFSS  210

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V+ +Q  ML++++ KK +LDK+L K+K WR++SNVIF   F SV ICSVVAA VTAPPVV
Sbjct  211  VHSKQITMLERLQAKKKKLDKQLGKLKVWRKVSNVIFIVTFASVWICSVVAAPVTAPPVV  270

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALAAAA+VPLG++G+W+N++WK  E DL+ +R+I++++  G+Y+VI+DL+SI+ LVDR 
Sbjct  271  TALAAAAAVPLGSMGRWLNSLWKNCERDLRGQRDIISSMQIGSYVVIKDLDSIRVLVDRF  330

Query  542  QEQIQGLLYNADFAMQ  589
            + +++ LL NA+FA +
Sbjct  331  RVELEALLANAEFATR  346



>ref|XP_010647846.1| PREDICTED: UPF0496 protein At4g34320-like isoform X2 [Vitis vinifera]
Length=373

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 149/198 (75%), Gaps = 11/198 (6%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQ--LYSKTLAELKKFKDAGDPFTEKFFSLF  175
            A  SQ ++  ALQ+FEEE         D V+   Y +TL ELKKFK AGDPFTE+FF +F
Sbjct  132  ARDSQLLIVVALQQFEEE---------DEVEGSRYLRTLEELKKFKAAGDPFTEEFFQIF  182

Query  176  HSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtapp  355
             SVY+QQ LML+K++ +KS+LDKKL+ + +WR++S++IFA  F +VLICSVVAA + APP
Sbjct  183  QSVYRQQMLMLEKLQLRKSKLDKKLKYIHAWRKVSSMIFAATFAAVLICSVVAAAMAAPP  242

Query  356  vvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVD  535
            V  ALAAAAS+PLGT+GKWI+++ K YEN LK ++E+++++  G Y+ I+DL++I+ L+D
Sbjct  243  VAAALAAAASLPLGTMGKWIDSLLKNYENALKGQKEVISSMQVGTYVAIKDLDTIRVLID  302

Query  536  RLQEQIQGLLYNADFAMQ  589
            RL+ +I+ LL   D+ ++
Sbjct  303  RLEIEIESLLQTTDYVIK  320



>ref|XP_009797274.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana sylvestris]
 ref|XP_009797275.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana sylvestris]
 ref|XP_009797276.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana sylvestris]
 ref|XP_009797277.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana sylvestris]
Length=370

 Score =   169 bits (427),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 145/195 (74%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEES    E        Y+KTL ELK FK AGDPFTE+FF +F S
Sbjct  129  ARDSQLLILVALQQFEEESG--VEGNR-----YTKTLEELKNFKAAGDPFTEEFFQIFQS  181

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ LML+K++ KK++LDK+L+ + +WR++SN+IF   F +VLICSVVAA + APPV 
Sbjct  182  VYTQQMLMLEKLQLKKNKLDKRLKYIHAWRKVSNIIFVATFAAVLICSVVAAAIAAPPVA  241

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            +ALAAA S+PLG++GKWI+++ K YEN +K ++E++ T+  G +I I+DL+SI+ L+DRL
Sbjct  242  SALAAATSIPLGSMGKWIDSLLKNYENAVKGQKELINTMHVGTFITIKDLDSIRVLIDRL  301

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL   +FA+
Sbjct  302  EIEIESLLKKVEFAI  316



>ref|XP_009605015.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana tomentosiformis]
 ref|XP_009605016.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana tomentosiformis]
 ref|XP_009605017.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana tomentosiformis]
 ref|XP_009605018.1| PREDICTED: UPF0496 protein At4g34320-like [Nicotiana tomentosiformis]
Length=370

 Score =   169 bits (427),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 145/195 (74%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEES    E        Y+KTL ELK FK AGDPFTE+FF +F S
Sbjct  129  ARDSQLLILVALQQFEEESG--VEGNR-----YTKTLEELKNFKAAGDPFTEEFFQIFQS  181

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ LML+K++ KK++LDK+L+ + +WR++SN+IF   F +VLICSVVAA + APPV 
Sbjct  182  VYTQQMLMLEKLQLKKNKLDKRLKYIHAWRKVSNIIFVATFAAVLICSVVAAAIAAPPVA  241

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            +ALAAA S+PLG++GKWI+++ K YEN +K ++E++ T+  G +I I+DL+SI+ L+DRL
Sbjct  242  SALAAATSIPLGSMGKWIDSLLKNYENAVKGQKELINTMHVGTFITIKDLDSIRVLIDRL  301

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL   +FA+
Sbjct  302  EIEIESLLKKVEFAI  316



>ref|XP_008387354.1| PREDICTED: LOW QUALITY PROTEIN: UPF0496 protein At4g34320-like 
[Malus domestica]
Length=382

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 146/196 (74%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEE    TE G      Y++TL ELK FK  GDPFTE+FF +F S
Sbjct  133  ARDSQLLILVALQQFEEE----TEMGGSR---YTRTLEELKNFKTIGDPFTEEFFQIFQS  185

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ  ML+K++ +K++LDKKL+ + +WR+++N+IF   F +VLICSVVAA + APPV 
Sbjct  186  VYKQQISMLEKLQLRKNKLDKKLKGINAWRKVTNMIFVATFAAVLICSVVAAAMAAPPVA  245

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA+S+P+G++GKWI+++WK YE  L   +E+L+++  G Y+ I+DL++I+ L+DRL
Sbjct  246  AALAAASSIPIGSMGKWIDSLWKNYELALXGSKEVLSSMQVGTYVAIKDLDNIRVLIDRL  305

Query  542  QEQIQGLLYNADFAMQ  589
            +  I+ +L+NA FA++
Sbjct  306  EIDIESILHNASFAIE  321



>ref|XP_009334187.1| PREDICTED: UPF0496 protein At4g34320-like [Pyrus x bretschneideri]
Length=374

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 147/196 (75%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEE    TE G      Y++TL ELK FK  GDPFTE+FF +F S
Sbjct  133  ARDSQLLILVALQQFEEE----TEMGGSR---YTRTLEELKNFKAIGDPFTEEFFQIFQS  185

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ  ML+K++ +K++LDKKL+ + +WR+++++IF   F +VLICSVVAA + APPV 
Sbjct  186  VYKQQIAMLEKLQLRKNKLDKKLKGINAWRKVTSMIFVATFAAVLICSVVAAAMAAPPVA  245

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA+S+P+G+ GKWI+++WK YE  ++ +RE+L+++  G Y+ I+DL++I+ L+DRL
Sbjct  246  AALAAASSIPIGSTGKWIDSLWKNYELAVRGQREVLSSMQVGTYVAIKDLDNIRVLIDRL  305

Query  542  QEQIQGLLYNADFAMQ  589
            +  I+ +L+NA FA++
Sbjct  306  EIDIESILHNASFAIE  321



>ref|XP_002281050.2| PREDICTED: UPF0496 protein At4g34320-like isoform X1 [Vitis vinifera]
Length=446

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 149/198 (75%), Gaps = 11/198 (6%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQ--LYSKTLAELKKFKDAGDPFTEKFFSLF  175
            A  SQ ++  ALQ+FEEE         D V+   Y +TL ELKKFK AGDPFTE+FF +F
Sbjct  205  ARDSQLLIVVALQQFEEE---------DEVEGSRYLRTLEELKKFKAAGDPFTEEFFQIF  255

Query  176  HSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtapp  355
             SVY+QQ LML+K++ +KS+LDKKL+ + +WR++S++IFA  F +VLICSVVAA + APP
Sbjct  256  QSVYRQQMLMLEKLQLRKSKLDKKLKYIHAWRKVSSMIFAATFAAVLICSVVAAAMAAPP  315

Query  356  vvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVD  535
            V  ALAAAAS+PLGT+GKWI+++ K YEN LK ++E+++++  G Y+ I+DL++I+ L+D
Sbjct  316  VAAALAAAASLPLGTMGKWIDSLLKNYENALKGQKEVISSMQVGTYVAIKDLDTIRVLID  375

Query  536  RLQEQIQGLLYNADFAMQ  589
            RL+ +I+ LL   D+ ++
Sbjct  376  RLEIEIESLLQTTDYVIK  393



>gb|EYU44304.1| hypothetical protein MIMGU_mgv1a007475mg [Erythranthe guttata]
Length=406

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 148/194 (76%), Gaps = 5/194 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A H +SI+  AL+KF EE       G D  + YS+TL ELK F+  GDPFT +FF +F+S
Sbjct  152  AGHIESIINVALKKFHEEH---NSGGGD--KDYSRTLDELKNFQTTGDPFTHEFFKVFNS  206

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY +Q  ML+K++ KK +LD+K+ KV +WR++SNVIF   F SVLICSVVAA V+AP VV
Sbjct  207  VYSKQLSMLEKLQVKKRKLDRKMGKVSAWRKVSNVIFIVAFASVLICSVVAAAVSAPAVV  266

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALAAAA+VPLG++GKW+N++WK  E DL+ +REI++++  G+YIVI+DL++I+ LVD+ 
Sbjct  267  TALAAAAAVPLGSMGKWLNSIWKNCERDLRGQREIISSMQIGSYIVIKDLDNIRVLVDKF  326

Query  542  QEQIQGLLYNADFA  583
            + +I+ LL NA+FA
Sbjct  327  RIEIEALLANAEFA  340



>ref|XP_006412239.1| hypothetical protein EUTSA_v100255251mg, partial [Eutrema salsugineum]
 gb|ESQ53692.1| hypothetical protein EUTSA_v100255251mg, partial [Eutrema salsugineum]
Length=269

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 149/196 (76%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FE+ES  + E G+     Y KTL ELK FK+A  PF E FF +F S
Sbjct  22   ARDSQLLILVALQQFEDES--LVEGGNG----YKKTLEELKNFKEAESPFNEDFFKMFQS  75

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ LML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  76   VYKQQMLMLEKLQLRKNKLDKKLKCIHTWRKLSSIIFVATFATVLICSVVAAAMAAPPVA  135

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA ++PLG++GKWI+++WK YEN LK ++E+++++ AG ++ ++DL++I+ L++RL
Sbjct  136  AALAAATALPLGSMGKWIDSLWKNYENALKGQKEMISSMQAGTFVAVKDLDTIRVLIERL  195

Query  542  QEQIQGLLYNADFAMQ  589
            + +I G++  A+FA++
Sbjct  196  EIEITGMVKCAEFAVE  211



>gb|KJB79486.1| hypothetical protein B456_013G052500 [Gossypium raimondii]
Length=373

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 148/196 (76%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FE+ES         +   Y KTL EL+ FK AG+PFT++FF +F S
Sbjct  131  ARDSQLLILMALQQFEDES-------EVNGSKYVKTLEELRNFKAAGNPFTDEFFQIFQS  183

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML+K+ ++K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  184  VYRQQIAMLEKLHQRKNKLDKKLKCIHTWRKVSSMIFVATFATVLICSVVAAAMAAPPVA  243

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA S+PLG++GKWI+++W+ YEN LK ++E++T++ AG Y+ I+DL++I+ LV+RL
Sbjct  244  AALAAATSIPLGSMGKWIDSLWRNYENVLKGQKEVITSMQAGTYVAIKDLDNIRVLVERL  303

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ LL NA FA++
Sbjct  304  EIEIEALLQNAGFAIE  319



>gb|KJB79485.1| hypothetical protein B456_013G052500 [Gossypium raimondii]
Length=390

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 148/196 (76%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FE+ES         +   Y KTL EL+ FK AG+PFT++FF +F S
Sbjct  148  ARDSQLLILMALQQFEDES-------EVNGSKYVKTLEELRNFKAAGNPFTDEFFQIFQS  200

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML+K+ ++K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  201  VYRQQIAMLEKLHQRKNKLDKKLKCIHTWRKVSSMIFVATFATVLICSVVAAAMAAPPVA  260

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA S+PLG++GKWI+++W+ YEN LK ++E++T++ AG Y+ I+DL++I+ LV+RL
Sbjct  261  AALAAATSIPLGSMGKWIDSLWRNYENVLKGQKEVITSMQAGTYVAIKDLDNIRVLVERL  320

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ LL NA FA++
Sbjct  321  EIEIEALLQNAGFAIE  336



>ref|NP_195158.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SYZ7.1|U496A_ARATH RecName: Full=UPF0496 protein At4g34320 [Arabidopsis thaliana]
 emb|CAB36709.1| putative protein [Arabidopsis thaliana]
 emb|CAB80149.1| putative protein [Arabidopsis thaliana]
 gb|AEE86359.1| uncharacterized protein AT4G34320 [Arabidopsis thaliana]
Length=374

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 149/196 (76%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  S  ++  ALQ+FE+ES  + + G+     Y KTL ELK FKDA  PF E FF +F S
Sbjct  127  ARDSHLLILVALQQFEDES--LVQGGNG----YKKTLEELKNFKDAESPFNEDFFKMFQS  180

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ LML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  181  VYKQQMLMLEKLQHRKNKLDKKLKCIHTWRKLSSIIFVATFATVLICSVVAAAMAAPPVA  240

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA +VPLG++GKWI+++WK YEN LK ++E+++++ AG ++ ++DL++I+ L++RL
Sbjct  241  AALAAATAVPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIRVLIERL  300

Query  542  QEQIQGLLYNADFAMQ  589
            + +I G++ +A+FA++
Sbjct  301  EIEITGMVKSAEFAVE  316



>ref|XP_006365509.1| PREDICTED: UPF0496 protein At4g34320-like [Solanum tuberosum]
Length=370

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 147/195 (75%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEES    E        Y+KTL ELK F+ AGDPFTE+FF +F S
Sbjct  129  ARDSQLLILVALQQFEEESG--VEGNR-----YTKTLEELKNFRAAGDPFTEEFFQIFQS  181

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ LML+K++ KK++LDK+L+ + +WR++SN+IF   F +VLICSVVAA + APPV 
Sbjct  182  VYRQQMLMLEKLQLKKNKLDKRLKYIHAWRKVSNIIFVATFAAVLICSVVAAAIAAPPVA  241

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            +ALAAAAS+PLG++GKWI+++ K YE+ +K ++E++ T+  G +I I+DL+SI+ L+DRL
Sbjct  242  SALAAAASIPLGSMGKWIDSLLKNYEDAVKGQKELINTMHVGTFITIKDLDSIRVLIDRL  301

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL   +FA+
Sbjct  302  EIEIESLLKKVEFAI  316



>ref|XP_011088346.1| PREDICTED: UPF0496 protein At4g34320 [Sesamum indicum]
 ref|XP_011088347.1| PREDICTED: UPF0496 protein At4g34320 [Sesamum indicum]
 ref|XP_011088348.1| PREDICTED: UPF0496 protein At4g34320 [Sesamum indicum]
Length=382

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 145/203 (71%), Gaps = 13/203 (6%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A   Q ++  ALQ+FEEE       G      Y +TL ELK F+DAGDPFTE+FF +F S
Sbjct  131  ARDRQLLIHVALQQFEEEDGVEGNNGR-----YLRTLEELKNFRDAGDPFTEEFFQIFQS  185

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvv--------aa  337
            VY+QQ LML+K++ +K++LDKKL+ + +WR++S++IFA  F +VLICSVV        AA
Sbjct  186  VYRQQMLMLEKLQSRKNKLDKKLKYIHAWRKVSSIIFAATFAAVLICSVVXXXXVAGGAA  245

Query  338  vvtappvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLES  517
             + APPV  ALAAA S+PLG++G+WI+++ K YEN +K ++EI+  +  G Y+ I+DL+S
Sbjct  246  ALAAPPVAAALAAATSIPLGSMGRWIDSLLKNYENAVKGQKEIINCMNVGTYVTIKDLDS  305

Query  518  IQRLVDRLQEQIQGLLYNADFAM  586
            I+ L+DRL+ +I+ L+ +ADFA+
Sbjct  306  IRVLIDRLEIEIESLMQSADFAI  328



>ref|XP_006285511.1| hypothetical protein CARUB_v10006952mg [Capsella rubella]
 gb|EOA18409.1| hypothetical protein CARUB_v10006952mg [Capsella rubella]
Length=376

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 149/196 (76%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  S  ++  ALQ+FE+ES  + + G+     Y KTL ELK FKDA  PF E FF +F S
Sbjct  129  ARDSHLLIHVALQQFEDES--LVQGGNG----YKKTLEELKNFKDAESPFNEDFFKMFQS  182

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ LML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  183  VYKQQMLMLEKLQLRKNKLDKKLKCIHTWRKLSSIIFVATFATVLICSVVAAAMAAPPVA  242

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA +VPLG++GKWI+++WK YEN LK ++E+++++ AG ++ ++DL++I+ L++RL
Sbjct  243  AALAAATAVPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIRVLIERL  302

Query  542  QEQIQGLLYNADFAMQ  589
            + +I G++ +A+FA++
Sbjct  303  EIEITGMVKSAEFAVE  318



>ref|XP_002869155.1| hypothetical protein ARALYDRAFT_491233 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45414.1| hypothetical protein ARALYDRAFT_491233 [Arabidopsis lyrata subsp. 
lyrata]
Length=374

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 149/196 (76%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  S  ++  ALQ+FE+ES  + + G+     Y KTL ELK FKDA  PF E FF +F S
Sbjct  127  ARDSHLLILVALQQFEDES--LVQGGNG----YKKTLEELKNFKDAESPFNEDFFKMFQS  180

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ LML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  181  VYKQQMLMLEKLQLRKNKLDKKLKCIHTWRKLSSIIFVATFATVLICSVVAAAMAAPPVA  240

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA +VPLG++GKWI+++WK YEN LK ++E+++++ AG ++ ++DL++I+ L++RL
Sbjct  241  AALAAATAVPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIRVLIERL  300

Query  542  QEQIQGLLYNADFAMQ  589
            + +I G++ +A+FA++
Sbjct  301  EIEITGMVKSAEFAVE  316



>ref|XP_009138282.1| PREDICTED: UPF0496 protein At4g34320 [Brassica rapa]
 ref|XP_009138284.1| PREDICTED: UPF0496 protein At4g34320 [Brassica rapa]
Length=378

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 149/196 (76%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FE+ES  + E G+     Y KTL ELK FK+A  PF E FF +F S
Sbjct  131  ARDSQLLILVALQQFEDES--LVEGGNG----YEKTLEELKNFKEAESPFDEDFFKMFQS  184

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q LML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  185  VYKHQMLMLEKLQHRKNKLDKKLKSIHTWRKLSSIIFVATFATVLICSVVAAAMAAPPVA  244

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA ++PLG++GKW++++WK YEN LK ++E+++++ AG ++ ++DL++I+ L++RL
Sbjct  245  AALAAATAIPLGSMGKWVDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIRILIERL  304

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+G++  A+FA++
Sbjct  305  EIEIKGMVMCAEFAVE  320



>ref|XP_009138287.1| PREDICTED: UPF0496 protein At4g34320-like [Brassica rapa]
 ref|XP_009138288.1| PREDICTED: UPF0496 protein At4g34320-like [Brassica rapa]
 ref|XP_009138289.1| PREDICTED: UPF0496 protein At4g34320-like [Brassica rapa]
Length=378

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 149/196 (76%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FE+ES  + E G+     Y KTL ELK FK+A  PF E FF +F S
Sbjct  131  ARDSQLLILVALQQFEDES--LVEGGNG----YEKTLEELKNFKEAESPFDEDFFKMFQS  184

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q LML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  185  VYKHQMLMLEKLQHRKNKLDKKLKSIHTWRKLSSIIFVATFATVLICSVVAAAMAAPPVA  244

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA ++PLG++GKW++++WK YEN LK ++E+++++ AG ++ ++DL++I+ L++RL
Sbjct  245  AALAAATAIPLGSMGKWVDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIRILIERL  304

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+G++  A+FA++
Sbjct  305  EIEIKGMVMCAEFAVE  320



>ref|XP_010432431.1| PREDICTED: UPF0496 protein At4g34320 [Camelina sativa]
Length=374

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 149/196 (76%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  S  ++  ALQ+FE+ES  + + G+     Y KTL ELK FKDA  PF E FF +F S
Sbjct  127  ARDSHLLILVALQQFEDES--LVQGGNG----YKKTLEELKNFKDAESPFNEDFFKMFQS  180

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ +ML+K++ +K++LDKKL+ + +WR+IS++IF   F +VLICSVVAA + APPV 
Sbjct  181  VYKQQMVMLEKLQLRKNKLDKKLKCIHTWRKISSIIFVATFATVLICSVVAAAMAAPPVA  240

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA +VPLG++GKWI+++WK YEN LK ++E+++++ AG ++ ++DL++I+ L++RL
Sbjct  241  AALAAATAVPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIRVLIERL  300

Query  542  QEQIQGLLYNADFAMQ  589
            + +I G++ +A+FA++
Sbjct  301  EIEITGMVKSAEFAVE  316



>ref|XP_008806206.1| PREDICTED: UPF0496 protein 1-like [Phoenix dactylifera]
Length=354

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 148/196 (76%), Gaps = 3/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I+  ALQ+FE+E   + E   +    Y KTL EL+ FK AGDPFTE+FF +F S
Sbjct  109  ARDSQLIIHVALQRFEDEEEVVEEDSRNK---YVKTLEELRHFKAAGDPFTEEFFHVFQS  165

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ  ML+K++++K++LDKKL+ +K+WR++S++IF   F ++LICSVVAA V APPV 
Sbjct  166  VYTQQLSMLEKLQQRKNKLDKKLKSIKAWRKVSSIIFVATFATILICSVVAAAVAAPPVA  225

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAAS+P+G++GKWI+++ K Y+  +K ++EIL+++  G YI+I+DL+SIQ LVDRL
Sbjct  226  AALAAAASIPVGSMGKWIDSLLKGYQQAVKGQKEILSSMQVGTYIMIKDLDSIQVLVDRL  285

Query  542  QEQIQGLLYNADFAMQ  589
            + QI  LL NA+ A++
Sbjct  286  EVQIDALLDNAELALR  301



>ref|XP_010939026.1| PREDICTED: UPF0496 protein 1-like [Elaeis guineensis]
Length=386

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 149/196 (76%), Gaps = 3/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I+  ALQ FEEE   +     DS + Y KTL EL+ FK AGDPFTE+FF +F S
Sbjct  141  ARDSQLIIHVALQHFEEEEEVVE---EDSKKKYLKTLEELRHFKAAGDPFTEEFFQVFQS  197

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  M +K++++K+++DKKL+ +K+WR++S++IF   F ++LICSVVAA V APPV 
Sbjct  198  VYRQQLSMFEKLQQRKNKVDKKLKSIKAWRKVSSIIFVATFATILICSVVAAAVAAPPVA  257

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAAS+P+G++GKWI+++ K Y+  +K ++EIL+++  G YI+I+DL+SI+ L+DRL
Sbjct  258  AALAAAASIPVGSMGKWIDSLLKGYQQAVKGQKEILSSMQVGTYIMIKDLDSIRVLIDRL  317

Query  542  QEQIQGLLYNADFAMQ  589
            + QI  LL NADFA++
Sbjct  318  EIQINALLDNADFALR  333



>ref|XP_004230936.1| PREDICTED: UPF0496 protein At4g34320-like [Solanum lycopersicum]
 ref|XP_004230937.1| PREDICTED: UPF0496 protein At4g34320-like [Solanum lycopersicum]
 ref|XP_010315295.1| PREDICTED: UPF0496 protein At4g34320-like [Solanum lycopersicum]
 ref|XP_010315296.1| PREDICTED: UPF0496 protein At4g34320-like [Solanum lycopersicum]
 ref|XP_010315297.1| PREDICTED: UPF0496 protein At4g34320-like [Solanum lycopersicum]
 ref|XP_010315298.1| PREDICTED: UPF0496 protein At4g34320-like [Solanum lycopersicum]
Length=370

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 146/195 (75%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEES    E        Y+KTL ELK F+ AGDPFTE+FF +F S
Sbjct  129  ARDSQLLILVALQQFEEESG--VEGNR-----YTKTLEELKNFRAAGDPFTEEFFQIFQS  181

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ LML+K++ KK++LDK+L+ + +WR++SN+IF   F +VLICSVVAA + APPV 
Sbjct  182  VYTQQMLMLEKLQLKKNKLDKRLKYIHAWRKVSNIIFVATFAAVLICSVVAAAIAAPPVA  241

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            +ALAAAAS+PLG++GKWI+++ K YE+ +K ++E++ T+  G +I I+DL+SI+ L+DRL
Sbjct  242  SALAAAASIPLGSMGKWIDSLLKNYEDAVKGQKELVNTMHVGTFITIKDLDSIRVLIDRL  301

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL   +FA+
Sbjct  302  EIEIESLLKKVEFAI  316



>gb|KHN02045.1| UPF0496 protein [Glycine soja]
Length=350

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 141/196 (72%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q ++  ALQ+FEEE    T  G      Y++TL ELK FK AGDPFTE+FF ++ S
Sbjct  109  ARDNQLLILMALQQFEEE----TSLGETR---YTRTLQELKNFKAAGDPFTEEFFQMYQS  161

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ LML+K++ ++S+LDKK++++ +WR++S+VIFA    +VLICSVVAA +  P V 
Sbjct  162  VYNQQILMLEKLRVRQSKLDKKVKQIHTWRKVSSVIFAATVAAVLICSVVAAAIATPHVA  221

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAA  ++P+G++GKWI+++ K YEN +K  +E+  ++  G Y+ I+DL++I+ L+DRL
Sbjct  222  AALAAVTAIPIGSMGKWIDSLLKNYENAMKGHKEVAISMQVGAYVAIKDLDNIRVLIDRL  281

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ L  N +FA++
Sbjct  282  EVEIESLFQNVEFALE  297



>ref|XP_010437629.1| PREDICTED: UPF0496 protein At4g34320-like isoform X1 [Camelina 
sativa]
 ref|XP_010437630.1| PREDICTED: UPF0496 protein At4g34320-like isoform X2 [Camelina 
sativa]
 ref|XP_010437631.1| PREDICTED: UPF0496 protein At4g34320-like isoform X2 [Camelina 
sativa]
 ref|XP_010437632.1| PREDICTED: UPF0496 protein At4g34320-like isoform X2 [Camelina 
sativa]
Length=374

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 149/196 (76%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  S  ++  ALQ+FE+ES  + + G+     Y KTL ELK FKDA  PF E FF +F S
Sbjct  127  ARDSHLLILVALQQFEDES--LVQGGNG----YKKTLEELKNFKDAESPFNEDFFKMFQS  180

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ +ML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  181  VYKQQMVMLEKLQLRKNKLDKKLKCIHTWRKLSSIIFVATFATVLICSVVAAAMAAPPVA  240

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA +VPLG++GKWI+++WK YEN LK ++E+++++ AG ++ ++DL++I+ L++RL
Sbjct  241  AALAAATAVPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIRVLIERL  300

Query  542  QEQIQGLLYNADFAMQ  589
            + +I G++ +A+FA++
Sbjct  301  EIEITGMVKSAEFAVE  316



>ref|XP_010414492.1| PREDICTED: UPF0496 protein At2g18630 [Camelina sativa]
Length=399

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 147/195 (75%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ +++FA+++FEEE A+I   G +  + Y KTL ELK+FKD G+PFT+KFF LF  
Sbjct  138  ARRSQVVIQFAVKQFEEE-AEIQVNGDNENRKYEKTLDELKRFKDLGEPFTKKFFELFDL  196

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK+Q LMLD++ + K +LD++L  +KSWRR+SN++F T FVSVLI SVVAA V APPVV
Sbjct  197  VYKKQVLMLDELHKLKKKLDRRLGNIKSWRRVSNMVFVTAFVSVLIFSVVAAAVAAPPVV  256

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+A A +VP+G++GKW N +W KYE  +K ++EI+T+I  G +I ++++++I  LV ++
Sbjct  257  AAIAGALAVPVGSLGKWCNTLWTKYEKVVKGQKEIITSIRIGTFISVKEMDNISVLVRKV  316

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL  A+FA+
Sbjct  317  EVEIESLLKKAEFAV  331



>ref|XP_010447101.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
 ref|XP_010447102.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
 ref|XP_010447103.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=374

 Score =   163 bits (413),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 149/196 (76%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  S  ++  ALQ+FE+ES  + + G+     Y KTL ELK FKDA  PF E FF +F S
Sbjct  127  ARDSHLLILVALQQFEDES--LVQGGNG----YKKTLEELKNFKDAESPFNEDFFKMFQS  180

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ +ML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  181  VYKQQMVMLEKLQIRKNKLDKKLKCIHTWRKLSSIIFVATFATVLICSVVAAAMAAPPVA  240

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA +VPLG++GKWI+++WK YEN LK ++E+++++ AG ++ ++DL++I+ L++RL
Sbjct  241  AALAAATAVPLGSMGKWIDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIRVLIERL  300

Query  542  QEQIQGLLYNADFAMQ  589
            + +I G++ +A+FA++
Sbjct  301  EIEITGMVKSAEFAVE  316



>ref|XP_010489568.1| PREDICTED: UPF0496 protein At2g18630 [Camelina sativa]
Length=399

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 147/195 (75%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ +++FA+++FEEE A+I   G +  + Y KTL ELK+FKD G+PFT+KFF LF  
Sbjct  138  ARRSQVVIQFAVKQFEEE-AEIHVNGDNENKKYEKTLEELKRFKDLGEPFTKKFFELFDL  196

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK+Q LMLD++ + K +LD++L  +KSWRR+SN++F T FVSVLI SVVAA V APPVV
Sbjct  197  VYKKQVLMLDELHKLKKKLDRRLGNIKSWRRVSNMVFVTAFVSVLIFSVVAAAVAAPPVV  256

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+A A +VP+G++GKW N +W KYE  +K ++EI+T+I  G +I ++++++I  LV ++
Sbjct  257  AAIAGALAVPVGSLGKWCNTLWTKYEKVVKGQKEIITSIRIGTFISVKEMDNISVLVRKV  316

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL  A+FA+
Sbjct  317  EVEIESLLKKAEFAV  331



>ref|XP_004498189.1| PREDICTED: UPF0496 protein At4g34320-like [Cicer arietinum]
Length=373

 Score =   163 bits (413),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 141/196 (72%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQKFEEE    T  G +    Y++TL ELK FKDAGDPFTE+F  ++ S
Sbjct  131  AKDSQLLIHAALQKFEEE----TGSGENR---YTRTLQELKSFKDAGDPFTEEFIQIYQS  183

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ LM +K++ +KS+ DKKL+++++WR++S +IF     SVLICSVVAA V +P V 
Sbjct  184  VYNQQILMFEKLQLRKSKFDKKLKQIRTWRKVSFIIFVVTVASVLICSVVAAAVASPHVA  243

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAA  ++P+G++GKWI+++ K YEN LK  +E+  ++  G+Y+ I+DL++I+ LV+RL
Sbjct  244  AALAAVTAIPIGSMGKWIDSLMKNYENVLKGHKEVTISMVVGSYVAIKDLDNIRVLVNRL  303

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ L  N DFA++
Sbjct  304  EVEIESLQENVDFAIE  319



>ref|XP_003529196.1| PREDICTED: UPF0496 protein At4g34320-like [Glycine max]
Length=371

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 141/196 (72%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q ++  ALQ+FEEE    T  G      Y++TL ELK FK AGDPFTE+FF ++ S
Sbjct  130  ARDNQLLILMALQQFEEE----TSLGETR---YTRTLQELKNFKAAGDPFTEEFFQMYQS  182

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ LML+K++ ++S+LDKK++++ +WR++S+VIFA    +VLICSVVAA +  P V 
Sbjct  183  VYNQQILMLEKLRVRQSKLDKKVKQIHTWRKVSSVIFAATVAAVLICSVVAAAIATPHVA  242

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAA  ++P+G++GKWI+++ K YEN +K  +E+  ++  G Y+ I+DL++I+ L+DRL
Sbjct  243  AALAAVTAIPIGSMGKWIDSLLKNYENAMKGHKEVAISMQVGAYVAIKDLDNIRVLIDRL  302

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ L  N +FA++
Sbjct  303  EVEIESLFQNVEFALE  318



>ref|XP_002306083.1| hypothetical protein POPTR_0004s15800g [Populus trichocarpa]
 gb|EEE86594.1| hypothetical protein POPTR_0004s15800g [Populus trichocarpa]
Length=363

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  98   YSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRI  277
            Y +TL ELK FK AGDPFT++FF +F SVY+QQ +ML+K++ +K++LDKKL+ + +WR++
Sbjct  147  YVRTLEELKNFKAAGDPFTDEFFQIFQSVYRQQIMMLEKLQLRKNKLDKKLKCIHTWRKV  206

Query  278  SNVIFATVFVSVLICsvvaavvtappvvtalaaaasvplGTVGKWINNMWKKYENDLKRE  457
            S++IF   F +VLICSVVAA +TAPPVV A+AAA+++PLG++GKWI+++WK YEN LK +
Sbjct  207  SSMIFVATFATVLICSVVAAAMTAPPVVAAVAAASTIPLGSMGKWIDSLWKNYENALKGQ  266

Query  458  REILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYNADFAMQ  589
            +E+++T+  G Y+ I+DL++I+ L+DRL+ +I+ L+   DFA++
Sbjct  267  KEVISTMQVGTYVAIKDLDNIRVLIDRLEIEIEALMRTTDFAIE  310



>ref|XP_010467691.1| PREDICTED: UPF0496 protein At2g18630-like [Camelina sativa]
Length=399

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 147/195 (75%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ +++FA+++FEEE A++   G +  + Y KTL ELK+FKD G+PFT+KFF LF  
Sbjct  138  ARRSQVVIQFAVKQFEEE-AEVHVNGDNENKKYEKTLDELKRFKDLGEPFTKKFFELFDL  196

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK+Q LMLD++ + K +LD++L  +KSWRR+SN++F T FVSVLI SVVAA V APPVV
Sbjct  197  VYKKQVLMLDELHKLKKKLDRRLGNIKSWRRVSNMVFVTAFVSVLIFSVVAAAVAAPPVV  256

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+A A +VP+G++GKW N +W KYE  +K ++EI+T+I  G +I ++++++I  LV ++
Sbjct  257  AAIAGALAVPVGSLGKWCNTLWTKYEKVVKGQKEIITSIRIGTFISVKEMDNISVLVRKV  316

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL  A+FA+
Sbjct  317  EVEIESLLKKAEFAV  331



>emb|CDY30310.1| BnaA09g09670D [Brassica napus]
Length=384

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 142/195 (73%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FA+++FEEE              Y KTL ELK+F  AGDPF+++FF+LF S
Sbjct  140  ARRSQVIIKFAVKQFEEED-------------YEKTLEELKRFTLAGDPFSKEFFALFDS  186

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V++ Q +ML+++   K RLDKKL+ VK+WRR+SNV+F T FVSVLI SVVAA V APPVV
Sbjct  187  VHRHQVMMLEELHRLKRRLDKKLKSVKTWRRVSNVVFVTAFVSVLIFSVVAAAVAAPPVV  246

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALA A +VP+G+VGKW N+ W+KYE  ++ ++EI+T+I  G Y+ +++++SI  LV R+
Sbjct  247  AALAGALAVPVGSVGKWCNSFWEKYEKVVRGQKEIMTSIRIGTYVSVREMDSISVLVRRV  306

Query  542  QEQIQGLLYNADFAM  586
            + +I  LL NA+FA+
Sbjct  307  EVEIGSLLKNAEFAV  321



>ref|XP_006296613.1| hypothetical protein CARUB_v10013876mg [Capsella rubella]
 gb|EOA29511.1| hypothetical protein CARUB_v10013876mg [Capsella rubella]
Length=399

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 147/195 (75%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ +++FA+++FEEES +I   G +  + Y KTL ELKKF D G+PFT++FF+LF  
Sbjct  138  ARRSQVVIQFAVKQFEEES-EIPVNGDNENRKYEKTLEELKKFTDLGEPFTKRFFALFDL  196

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK+Q LML+++ + K +LDK+L  +K+WRR+SN++F T FVSVLI SVVAA V APPVV
Sbjct  197  VYKKQVLMLEELHKLKRKLDKRLGNIKTWRRVSNMVFVTAFVSVLIFSVVAAAVAAPPVV  256

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+A A +VP+G+VGKW N +W KYE  ++ ++EI+T+I  G YI ++++++I  LV ++
Sbjct  257  AAIAGALAVPVGSVGKWCNTLWTKYEKVVRGQKEIITSIRIGTYISVKEMDNISILVRKV  316

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL  A+FA+
Sbjct  317  EVEIESLLKKAEFAV  331



>ref|XP_007153142.1| hypothetical protein PHAVU_003G010400g [Phaseolus vulgaris]
 gb|ESW25136.1| hypothetical protein PHAVU_003G010400g [Phaseolus vulgaris]
Length=371

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 144/196 (73%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEE    TE G    + Y++TL ELK FK +GDPFTE+FF ++ S
Sbjct  130  ARDSQLLIFAALQQFEEE----TELGE---KRYTRTLQELKNFKASGDPFTEEFFQMYQS  182

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ LML+K++ ++S+LDKK+++V +WR++S++IF     +VLICSVVAA + +P V 
Sbjct  183  VYNQQILMLEKLQVRQSKLDKKVKQVHTWRKVSSMIFVATVAAVLICSVVAAAIASPHVA  242

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            T LAA ++VP+G++GKWI+ M K YE  ++  RE++ ++  G Y+ I+DL+SI+ L+D++
Sbjct  243  TILAAVSAVPIGSMGKWIDTMLKSYETAVRGHREVIISMQVGTYVAIKDLDSIRVLIDKV  302

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ +L N +FA++
Sbjct  303  EIEIESVLQNVEFAIE  318



>ref|XP_010558085.1| PREDICTED: UPF0496 protein At5g66675-like isoform X1 [Tarenaya 
hassleriana]
Length=511

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 152/196 (78%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FA+++FE ES  + + G++    YSKTL EL KFK AGDPF E FF+LF S
Sbjct  250  ARVSQMIIQFAVKQFEMESLDV-DRGNNK---YSKTLEELNKFKAAGDPFDEDFFTLFES  305

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ L+LD++ ++K +LDKK++ +K+WR++SNV+F T FVSVLI SVVAA V APPVV
Sbjct  306  VYEQQILLLDQLHKQKRKLDKKMKNIKTWRKVSNVVFMTAFVSVLIFSVVAAAVAAPPVV  365

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TA+AAA +VP+G+VGKW N +WKKYE+ +K +++I+ +I  G ++ I+D+++I+  VD+L
Sbjct  366  TAVAAALAVPIGSVGKWCNYLWKKYESSVKGQKDIVLSIKIGAFVTIKDMDNIRIHVDKL  425

Query  542  QEQIQGLLYNADFAMQ  589
            + +++ +L   DFA++
Sbjct  426  KIEMESMLQKVDFALK  441



>ref|XP_010558093.1| PREDICTED: UPF0496 protein At5g66675-like isoform X2 [Tarenaya 
hassleriana]
Length=478

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 152/196 (78%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FA+++FE ES  + + G++    YSKTL EL KFK AGDPF E FF+LF S
Sbjct  217  ARVSQMIIQFAVKQFEMESLDV-DRGNNK---YSKTLEELNKFKAAGDPFDEDFFTLFES  272

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ L+LD++ ++K +LDKK++ +K+WR++SNV+F T FVSVLI SVVAA V APPVV
Sbjct  273  VYEQQILLLDQLHKQKRKLDKKMKNIKTWRKVSNVVFMTAFVSVLIFSVVAAAVAAPPVV  332

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TA+AAA +VP+G+VGKW N +WKKYE+ +K +++I+ +I  G ++ I+D+++I+  VD+L
Sbjct  333  TAVAAALAVPIGSVGKWCNYLWKKYESSVKGQKDIVLSIKIGAFVTIKDMDNIRIHVDKL  392

Query  542  QEQIQGLLYNADFAMQ  589
            + +++ +L   DFA++
Sbjct  393  KIEMESMLQKVDFALK  408



>ref|XP_009408039.1| PREDICTED: UPF0496 protein 1-like [Musa acuminata subsp. malaccensis]
Length=387

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGH-DSVQLYSKTLAELKKFKDAGDPFTEKFFSLFH  178
            A   Q I++ ALQ F EE A+       D+ + YS+TL EL+ FK AGDPFTE+FF +F 
Sbjct  138  ARDGQLIIQVALQHFAEEEAEPEPEPQKDAKKKYSRTLEELRLFKAAGDPFTEEFFQVFQ  197

Query  179  SVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappv  358
            SV+ QQ LML+K++++K++LDK+LR +K+WRR+S+ IFA  F +VLICSVVAA V APPV
Sbjct  198  SVHGQQLLMLEKLQQRKNKLDKQLRSIKAWRRVSSTIFAATFAAVLICSVVAAAVAAPPV  257

Query  359  vtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDR  538
              ALAAAAS+P+G++GKWI+++   Y+N +K +RE+L ++  G Y+ I+D+ESI+ L+D+
Sbjct  258  AAALAAAASIPIGSMGKWIDSLLHDYQNAVKGQREVLRSMQVGTYVAIKDMESIRVLIDK  317

Query  539  LQEQIQGLLYNADFAMQ  589
            ++ ++  LL +A+FAM+
Sbjct  318  VEMEMASLLADAEFAME  334



>ref|XP_009112552.1| PREDICTED: UPF0496 protein At2g18630-like [Brassica rapa]
 ref|XP_009112553.1| PREDICTED: UPF0496 protein At2g18630-like [Brassica rapa]
 ref|XP_009112554.1| PREDICTED: UPF0496 protein At2g18630-like [Brassica rapa]
Length=389

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 141/195 (72%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FA+++FEEE              Y KTL ELK+F  AGDPF+++FF+LF S
Sbjct  140  ARRSQVIIKFAVKQFEEEE-------------YKKTLEELKRFTLAGDPFSKEFFALFDS  186

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V++ Q +ML+++   K RLDKKL+ VK+WRR+SNV+F T FVSVLI SVVAA V APPVV
Sbjct  187  VHRHQVMMLEELHRLKRRLDKKLKSVKTWRRVSNVVFVTAFVSVLIFSVVAAAVAAPPVV  246

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALA A +VP+G+VGKW N+ W KYE  ++ ++EI+T+I  G Y+ +++++SI  LV R+
Sbjct  247  AALAGALAVPVGSVGKWCNSFWDKYEKVVRGQKEIVTSIRIGTYVSVREMDSISVLVRRV  306

Query  542  QEQIQGLLYNADFAM  586
            + +I  LL NA+FA+
Sbjct  307  EVEIGSLLKNAEFAV  321



>ref|XP_002468329.1| hypothetical protein SORBIDRAFT_01g043880 [Sorghum bicolor]
 gb|EER95327.1| hypothetical protein SORBIDRAFT_01g043880 [Sorghum bicolor]
Length=381

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 147/194 (76%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ +L  ALQ+F++E      P       Y++TL EL++FK AGDPFT++FF+ F +
Sbjct  137  ARDSQLLLHVALQRFDDEQNSDAAPSAR----YARTLHELRQFKAAGDPFTDEFFAAFQA  192

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML+K++++K RLD+K++ +K+WRR+S++IFAT F +VLICSVVAA + APPV 
Sbjct  193  VYRQQLAMLEKLQQRKHRLDRKIKTIKAWRRVSSIIFATTFAAVLICSVVAAAIAAPPVA  252

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAA+VPLG++GKWI+++ K Y++ L+ ++E+++T+  G +I I+DL+SI+ L++R+
Sbjct  253  AALAAAAAVPLGSMGKWIDSLLKGYQDALRGQKEVVSTMQVGTFIAIKDLDSIRVLINRV  312

Query  542  QEQIQGLLYNADFA  583
            + ++  ++   +FA
Sbjct  313  EAEVSSMVDCVEFA  326



>ref|XP_006649570.1| PREDICTED: UPF0496 protein 1-like [Oryza brachyantha]
Length=387

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 147/197 (75%), Gaps = 3/197 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEE---SAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSL  172
            A  SQ +L  ALQ+F++E    A   E        Y++TL EL++FK AGDPFTE+FFS 
Sbjct  135  ARDSQLLLHVALQRFDDEEDNDAGGQEDDAAPSARYARTLHELRQFKAAGDPFTEEFFSA  194

Query  173  FHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtap  352
            F +VY+QQ  ML+K++++K RLDKK+R +K+WRR+S++IFAT F +VLICSVVAA + AP
Sbjct  195  FQAVYRQQLTMLEKLQQRKHRLDKKVRAIKAWRRVSSIIFATTFAAVLICSVVAAAIAAP  254

Query  353  pvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLV  532
            PV  ALAAAAS+P+G++GKWI+++ K Y++ L+ ++E+++ +  G +I I+DL+SI+ L+
Sbjct  255  PVAAALAAAASIPVGSMGKWIDSLLKGYQDALRGQKEVVSAMQVGTFIAIKDLDSIRVLI  314

Query  533  DRLQEQIQGLLYNADFA  583
            +R++ +I  ++   +FA
Sbjct  315  NRVELEISSMIDCVEFA  331



>ref|XP_010530852.1| PREDICTED: UPF0496 protein At4g34320-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010530853.1| PREDICTED: UPF0496 protein At4g34320-like isoform X2 [Tarenaya 
hassleriana]
Length=384

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  98   YSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRI  277
            Y KTL ELK FK+AG PF E FF +F SVY+QQ LML+K++ ++++LDKKL+ + SWRR+
Sbjct  161  YEKTLEELKNFKEAGSPFDEDFFRIFQSVYRQQMLMLEKLQLRRNKLDKKLKSIHSWRRL  220

Query  278  SNVIFATVFVSVLICsvvaavvtappvvtalaaaasvplGTVGKWINNMWKKYENDLKRE  457
            S++IF   F +VLICSVVAA + APPV  ALAAA S+PLG++GKWI+++WK YEN LK +
Sbjct  221  SSMIFVPTFATVLICSVVAAAMAAPPVAAALAAATSIPLGSMGKWIDSLWKNYENALKGQ  280

Query  458  REILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYNADFAMQ  589
            +E+++++ AG Y+ I+DL++I+ L++RL+ +I+G++ +A+FA++
Sbjct  281  KEVISSMQAGTYVAIKDLDNIRVLIERLEIEIEGMVKSAEFAVE  324



>ref|XP_010530851.1| PREDICTED: UPF0496 protein At4g34320-like isoform X1 [Tarenaya 
hassleriana]
Length=395

 Score =   161 bits (408),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  98   YSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRI  277
            Y KTL ELK FK+AG PF E FF +F SVY+QQ LML+K++ ++++LDKKL+ + SWRR+
Sbjct  172  YEKTLEELKNFKEAGSPFDEDFFRIFQSVYRQQMLMLEKLQLRRNKLDKKLKSIHSWRRL  231

Query  278  SNVIFATVFVSVLICsvvaavvtappvvtalaaaasvplGTVGKWINNMWKKYENDLKRE  457
            S++IF   F +VLICSVVAA + APPV  ALAAA S+PLG++GKWI+++WK YEN LK +
Sbjct  232  SSMIFVPTFATVLICSVVAAAMAAPPVAAALAAATSIPLGSMGKWIDSLWKNYENALKGQ  291

Query  458  REILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYNADFAMQ  589
            +E+++++ AG Y+ I+DL++I+ L++RL+ +I+G++ +A+FA++
Sbjct  292  KEVISSMQAGTYVAIKDLDNIRVLIERLEIEIEGMVKSAEFAVE  335



>ref|XP_009108740.1| PREDICTED: UPF0496 protein At4g34320-like [Brassica rapa]
 ref|XP_009108741.1| PREDICTED: UPF0496 protein At4g34320-like [Brassica rapa]
Length=378

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 144/196 (73%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FE+ES  + E  +     Y KTL ELK FKDA  PF++ FF +F S
Sbjct  131  ARDSQLLILVALQQFEDES--LVEGCNG----YEKTLDELKNFKDAESPFSKDFFKMFQS  184

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q LML+K++ +K++LDKKL+ + +WR++ N+IF   F +VLICSVVAA + APPV 
Sbjct  185  VYKHQMLMLEKLQLRKNKLDKKLKCIHTWRKLCNIIFVATFATVLICSVVAAAIAAPPVA  244

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA +VP+G++GKWI+++WK YEN LK +RE+++++ AG Y+ ++DL++I+ L+++L
Sbjct  245  AALAAATAVPVGSMGKWIDSLWKNYENSLKGQREVISSMQAGTYVAVKDLDNIRVLIEQL  304

Query  542  QEQIQGLLYNADFAMQ  589
            +  I G++  A F ++
Sbjct  305  EIDISGMVTCAAFTVE  320



>emb|CDY51496.1| BnaC09g51110D [Brassica napus]
Length=384

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 142/195 (73%), Gaps = 13/195 (7%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FA+++FEEE              Y KTL ELK+F  AGDPF+++FF+LF S
Sbjct  140  ARRSQVIIKFAVKQFEEED-------------YEKTLEELKRFTLAGDPFSKEFFALFDS  186

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V++ Q +ML+++   K RLDKKL+ VK+WRR+SNV+F T FVSVLI SVVAA V APPVV
Sbjct  187  VHRHQVMMLEELHRLKRRLDKKLKSVKTWRRVSNVVFVTAFVSVLIFSVVAAAVAAPPVV  246

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALA A +VP+G+VGKW N++W+KYE  ++ ++EI+T+I  G Y+ ++++++I  LV R+
Sbjct  247  AALAGALTVPVGSVGKWCNSLWEKYEKVVRGQKEIVTSIRIGTYVSVREMDNISVLVRRV  306

Query  542  QEQIQGLLYNADFAM  586
            + +   LL NA+FA+
Sbjct  307  EVEFGSLLKNAEFAV  321



>emb|CDX76273.1| BnaA08g11270D [Brassica napus]
Length=388

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 148/203 (73%), Gaps = 10/203 (5%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQL-------YSKTLAELKKFKDAGDPFTEK  160
            A  SQ ++  ALQ FE+ES      G+ +++        Y KTL ELK FKDA  PF++ 
Sbjct  131  ARDSQLLILVALQHFEDESLV---EGNTNLEFVFIGCNGYEKTLDELKNFKDAESPFSKD  187

Query  161  FFSLFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaav  340
            FF +F SVYK Q LML+K++ +K++LDKKL+ + +WR++ N+IF   F +VLICSVVAA 
Sbjct  188  FFKMFQSVYKHQMLMLEKLQLRKNKLDKKLKCIHTWRKLCNIIFVATFATVLICSVVAAA  247

Query  341  vtappvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESI  520
            + APPV  ALAAA +VP+G++GKWI+++WK YEN LK +RE+++++ AG Y+ ++DL++I
Sbjct  248  MAAPPVAAALAAATAVPVGSMGKWIDSLWKNYENALKGQREVISSMQAGTYVAVKDLDNI  307

Query  521  QRLVDRLQEQIQGLLYNADFAMQ  589
            + L+++L+ +I+G++  A FA++
Sbjct  308  RVLIEQLEIEIRGMVTCAAFAVE  330



>emb|CDY13018.1| BnaC07g03170D [Brassica napus]
Length=392

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 145/195 (74%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FA+++FEEE            + Y KTL ELK+FK AGDPFT++FF LF S
Sbjct  139  AKRSQVIIQFAVKQFEEEDEDEEN----EDRKYEKTLEELKRFKLAGDPFTKEFFDLFDS  194

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V+K Q +MLD++ + K RLDKKL+ +K+WRR+SN++F T FVSVLI SVVAA V APPVV
Sbjct  195  VHKHQVMMLDELHKLKRRLDKKLKNIKTWRRVSNMVFVTAFVSVLIFSVVAAAVAAPPVV  254

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+A A +VP+G+VGKW N++W KYE  +K ++EI+T++  G YI ++++++I  LV R+
Sbjct  255  AAIAGALAVPVGSVGKWCNSLWTKYEKVVKGQKEIVTSVRIGTYISVKEMDNISVLVRRV  314

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL NA+FA+
Sbjct  315  EVEIESLLKNAEFAV  329



>gb|KJB48452.1| hypothetical protein B456_008G069800 [Gossypium raimondii]
Length=390

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 148/196 (76%), Gaps = 3/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A ++Q I++ A++ FEEE     + G D  +++ KTL EL+KFK A +PFT++FF LF S
Sbjct  134  ARNNQLIIQLAVKNFEEEVG--LQVGDDE-RIFVKTLEELRKFKAAEEPFTKEFFILFDS  190

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V +QQELML K+  +K  LDKK++ +K+WRR+SNV+F   FVSVL+ SVVAA + APPVV
Sbjct  191  VRRQQELMLQKLLSRKRELDKKMKSLKTWRRVSNVLFVATFVSVLLFSVVAAAIAAPPVV  250

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA A +VP+G+VGKW N +WK+YEN+L+ ++E++  +  G+ I I D+E+I+ L+ RL
Sbjct  251  TALAGAMAVPIGSVGKWCNWLWKRYENELQGQKELIIGMEIGSRITIYDMENIKVLISRL  310

Query  542  QEQIQGLLYNADFAMQ  589
            + +++ LL+NADFA++
Sbjct  311  EIEMESLLHNADFAVR  326



>ref|XP_007047030.1| Uncharacterized protein TCM_000456 [Theobroma cacao]
 gb|EOX91187.1| Uncharacterized protein TCM_000456 [Theobroma cacao]
Length=390

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 148/196 (76%), Gaps = 3/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A ++Q I++ A++KFEEE     + G D  + + KTL EL+KFK A +PF+++FF LF S
Sbjct  134  ARNNQLIIQLAVRKFEEEVE--LQVGTDGKK-FVKTLEELRKFKAAEEPFSKEFFLLFDS  190

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V +QQE ML K+  +K ++DKKL+ +K+WRR+SNV+F   FVSVLI SVVAA V APPVV
Sbjct  191  VRRQQESMLGKLLVRKRKIDKKLKSLKTWRRVSNVLFVATFVSVLIFSVVAAAVAAPPVV  250

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA A +VP+G+VGKW N +WK+YEN+LK +RE++TT+  G  I I +L++I+ LV RL
Sbjct  251  TALAGALAVPIGSVGKWCNWLWKRYENELKGQRELITTVELGARITIGNLDNIRMLVGRL  310

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ LL+ ADFA++
Sbjct  311  EIEIESLLHYADFALR  326



>emb|CDY45304.1| BnaA03g52770D [Brassica napus]
Length=325

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 142/187 (76%), Gaps = 6/187 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FE+ES  + E G+     Y KTL ELK FK+A  PF E FF +F S
Sbjct  131  ARDSQLLILVALQQFEDES--LVEGGNG----YEKTLEELKNFKEAESPFDEDFFKMFQS  184

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q LML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  185  VYKHQMLMLEKLQHRKNKLDKKLKSIHTWRKLSSIIFVATFATVLICSVVAAAMAAPPVA  244

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA ++PLG++GKW++++WK YEN LK ++E+++++ AG ++ ++DL++I+ L++RL
Sbjct  245  AALAAATAIPLGSMGKWVDSLWKNYENALKGQKEVISSMQAGTFVAVKDLDNIRILIERL  304

Query  542  QEQIQGL  562
            + +I+G+
Sbjct  305  EIEIKGM  311



>gb|AAD08932.1| At14a, putative [Arabidopsis thaliana]
 gb|AAM15135.1| At14a, putative [Arabidopsis thaliana]
Length=392

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 144/195 (74%), Gaps = 6/195 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FA+ +FEEE+           + Y KTL ELK+FK AG+PFT++FF+LF  
Sbjct  137  ARRSQVIIQFAVNQFEEENE------DKENRKYEKTLEELKRFKVAGEPFTKEFFALFDL  190

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ +ML+++ + K +LDK+LR +K+WRR+SN++F T FVSVLI SVVAA V APPVV
Sbjct  191  VYKQQVMMLEELHKLKRKLDKRLRNIKTWRRVSNMVFVTAFVSVLIFSVVAAAVAAPPVV  250

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+A A +VP+G+VGKW N +W KYE  ++ ++EI+T+I  G YI ++++++I  LV ++
Sbjct  251  AAIAGALAVPVGSVGKWCNTLWTKYEKVVRGQKEIITSIRIGTYISVKEMDNISILVRKV  310

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL  A+FA+
Sbjct  311  EVEIESLLKKAEFAI  325



>ref|NP_179453.2| uncharacterized protein [Arabidopsis thaliana]
 sp|Q56XQ0.3|U496I_ARATH RecName: Full=UPF0496 protein At2g18630 [Arabidopsis thaliana]
 dbj|BAD95236.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC06787.1| uncharacterized protein AT2G18630 [Arabidopsis thaliana]
Length=393

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 144/195 (74%), Gaps = 6/195 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FA+ +FEEE+           + Y KTL ELK+FK AG+PFT++FF+LF  
Sbjct  138  ARRSQVIIQFAVNQFEEENE------DKENRKYEKTLEELKRFKVAGEPFTKEFFALFDL  191

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ +ML+++ + K +LDK+LR +K+WRR+SN++F T FVSVLI SVVAA V APPVV
Sbjct  192  VYKQQVMMLEELHKLKRKLDKRLRNIKTWRRVSNMVFVTAFVSVLIFSVVAAAVAAPPVV  251

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+A A +VP+G+VGKW N +W KYE  ++ ++EI+T+I  G YI ++++++I  LV ++
Sbjct  252  AAIAGALAVPVGSVGKWCNTLWTKYEKVVRGQKEIITSIRIGTYISVKEMDNISILVRKV  311

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL  A+FA+
Sbjct  312  EVEIESLLKKAEFAI  326



>emb|CDY46260.1| BnaC03g66210D [Brassica napus]
Length=388

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 144/200 (72%), Gaps = 4/200 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHD----SVQLYSKTLAELKKFKDAGDPFTEKFFS  169
            A  SQ ++  ALQ+FE+ES    +            Y KTL ELK FKDA  PF++ FF 
Sbjct  131  ARDSQLLILVALQQFEDESLLTYDFNIHYYFVGCNGYEKTLDELKNFKDAESPFSKDFFK  190

Query  170  LFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvta  349
            +F SVYK Q LML+K++ +K++LDKKL+ + +WR++ N+IF   F +VLICSVVAA + A
Sbjct  191  MFQSVYKHQMLMLEKLQLRKNKLDKKLKCIHTWRKLCNIIFVATFATVLICSVVAAAMAA  250

Query  350  ppvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRL  529
            PPV  ALAAA +VP+G++GKWI+++WK YEN LK +RE+++++ AG Y+ ++DL++I+ L
Sbjct  251  PPVAAALAAATAVPVGSMGKWIDSLWKNYENALKGQREVISSMQAGTYVAVKDLDNIRVL  310

Query  530  VDRLQEQIQGLLYNADFAMQ  589
            +++L+  I+G++  A FA++
Sbjct  311  IEQLEIDIRGMVTCASFAVE  330



>ref|XP_009386153.1| PREDICTED: UPF0496 protein 1-like [Musa acuminata subsp. malaccensis]
Length=391

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 148/196 (76%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I+  ALQ+F E   + TE   D  + YS+TL EL+ F  AGDPFTE+FF +F S
Sbjct  145  ARDSQLIIHVALQRFAEGEDE-TE-AEDCNKKYSRTLDELRLFNTAGDPFTEEFFRVFQS  202

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ LML+K++ +K++LDKKL+ +K+WR++S++IFA    +VLICSVVAA V+APPV 
Sbjct  203  VYRQQLLMLEKLQLRKNKLDKKLKSIKAWRKVSSIIFAATLAAVLICSVVAAAVSAPPVA  262

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAAS+P+G++ KWI+++ K Y N ++ ++E++ ++  G +IVI+DL+SI+  +D+L
Sbjct  263  AALAAAASIPIGSMAKWIDSLLKDYGNSVQGQKEVVGSMQVGTFIVIKDLDSIRVSIDKL  322

Query  542  QEQIQGLLYNADFAMQ  589
            + +I  LL NADFA++
Sbjct  323  EIEIVSLLDNADFAIK  338



>gb|KFK28347.1| hypothetical protein AALP_AA8G504300 [Arabis alpina]
Length=401

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 144/197 (73%), Gaps = 4/197 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFE-EESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFH  178
            A   Q I++FA+++FE E S K  EPG +    Y+KTL EL KFK +GDPF   FF LF 
Sbjct  137  ARIGQMIIQFAVKQFEIESSKKSVEPGSNK---YAKTLEELNKFKASGDPFDGDFFMLFE  193

Query  179  SVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappv  358
            SVY+QQ ++L+ + ++K +LDKKL+ +K+W++ISNV+F T FVSVLI SVVAA V     
Sbjct  194  SVYEQQVMLLEILHKQKRKLDKKLKNIKNWKKISNVVFVTAFVSVLIFSVVAAAVXXXXX  253

Query  359  vtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDR  538
            VTA+AAA +VP+G+VGKW N++WKKYE  +K +++I+ ++  G Y+ ++D+E+I+  VD+
Sbjct  254  VTAVAAALAVPIGSVGKWCNHLWKKYETAVKGQKDIVLSMRIGAYVTMKDMENIRVHVDK  313

Query  539  LQEQIQGLLYNADFAMQ  589
            L+ +++ ++   DFA++
Sbjct  314  LKIEMESMMQKVDFALK  330



>ref|XP_009114703.1| PREDICTED: UPF0496 protein At2g18630 isoform X2 [Brassica rapa]
Length=391

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 144/195 (74%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FA++ FEEE            + Y KTL ELK+FK AGDPFT++FF LF S
Sbjct  139  AKRSQVIIQFAVKLFEEEEDDGNN----EDRKYEKTLEELKRFKLAGDPFTKEFFHLFDS  194

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V+K Q +MLD++ + K RLDKKL+ +K+WRR+SN++F T FVSVLI SVVAA V APPVV
Sbjct  195  VHKHQVMMLDELHKLKRRLDKKLKNIKTWRRVSNMVFVTAFVSVLIFSVVAAAVAAPPVV  254

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+A A +VP+G+VGKW N++W KYE  +K ++EI+T++  G YI ++++++I  LV R+
Sbjct  255  AAIAGALAVPVGSVGKWCNSLWTKYEKVVKGQKEIVTSVRIGTYISVKEMDNISVLVRRV  314

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL NA+FA+
Sbjct  315  EVEIESLLKNAEFAV  329



>gb|KHG15186.1| hypothetical protein F383_03556 [Gossypium arboreum]
Length=431

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 147/196 (75%), Gaps = 3/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A ++Q I++ A++ FEEE     + G D  + + KTL EL+KFK A +PFT++FF LF S
Sbjct  175  ARNNQLIIQLAVKNFEEEVG--LQVGDDERK-FVKTLEELRKFKAAEEPFTKEFFILFDS  231

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V +QQELML K+  +K +LDKK+  +K+WRR+SNV+F   FVSVLI SVVAA + APPVV
Sbjct  232  VRRQQELMLRKLVSRKRKLDKKMESLKTWRRVSNVLFVATFVSVLIFSVVAAAIAAPPVV  291

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA A +VP+G+VGKW N +WK+YEN+L+ ++E++  +  G+ I I D+E+I+ L+ RL
Sbjct  292  TALAGAMAVPIGSVGKWCNWLWKRYENELQGQKELIIGMEIGSCITIYDMENIKVLISRL  351

Query  542  QEQIQGLLYNADFAMQ  589
            + +++ LL+NADFA++
Sbjct  352  EIEMESLLHNADFAVR  367



>ref|XP_009114701.1| PREDICTED: UPF0496 protein At2g18630 isoform X1 [Brassica rapa]
 ref|XP_009114702.1| PREDICTED: UPF0496 protein At2g18630 isoform X1 [Brassica rapa]
Length=397

 Score =   159 bits (401),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 143/195 (73%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FA++ FEEE              Y KTL ELK+FK AGDPFT++FF LF S
Sbjct  139  AKRSQVIIQFAVKLFEEEEDDGNNEDRK----YEKTLEELKRFKLAGDPFTKEFFHLFDS  194

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V+K Q +MLD++ + K RLDKKL+ +K+WRR+SN++F T FVSVLI SVVAA V APPVV
Sbjct  195  VHKHQVMMLDELHKLKRRLDKKLKNIKTWRRVSNMVFVTAFVSVLIFSVVAAAVAAPPVV  254

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+A A +VP+G+VGKW N++W KYE  +K ++EI+T++  G YI ++++++I  LV R+
Sbjct  255  AAIAGALAVPVGSVGKWCNSLWTKYEKVVKGQKEIVTSVRIGTYISVKEMDNISVLVRRV  314

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL NA+FA+
Sbjct  315  EVEIESLLKNAEFAV  329



>emb|CDY43904.1| BnaA07g01810D [Brassica napus]
Length=392

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 144/195 (74%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FA++ FEEE            + Y KTL ELK+FK AGDPFT++FF LF S
Sbjct  139  AKRSQVIIQFAVKLFEEEEEDGNN----EDRKYEKTLEELKRFKLAGDPFTKEFFHLFDS  194

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V+K Q +MLD++ + K RLDKKL+ +K+WRR+SN++F T FVSVLI SVVAA V APPVV
Sbjct  195  VHKHQVMMLDELHKLKRRLDKKLKNIKTWRRVSNMVFVTAFVSVLIFSVVAAAVAAPPVV  254

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+A A +VP+G+VGKW N++W KYE  +K ++EI+T++  G YI ++++++I  LV R+
Sbjct  255  AAIAGALAVPVGSVGKWCNSLWTKYEKVVKGQKEIVTSVRIGTYISVKEMDNISVLVRRV  314

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL NA+FA+
Sbjct  315  EVEIESLLKNAEFAV  329



>ref|XP_011092769.1| PREDICTED: UPF0496 protein At4g34320-like [Sesamum indicum]
 ref|XP_011092770.1| PREDICTED: UPF0496 protein At4g34320-like [Sesamum indicum]
 ref|XP_011092771.1| PREDICTED: UPF0496 protein At4g34320-like [Sesamum indicum]
 ref|XP_011092772.1| PREDICTED: UPF0496 protein At4g34320-like [Sesamum indicum]
Length=372

 Score =   158 bits (399),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 146/195 (75%), Gaps = 9/195 (5%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FEEE         D  + YSKTL ELK FKDAGDPFTE FF +F S
Sbjct  131  ARDSQLLIHVALQQFEEE---------DGNEKYSKTLEELKSFKDAGDPFTEDFFQIFQS  181

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ LML+K++ KK++LDKKLR + +WR++S++IFA  F +VLICSVVAA + APPV 
Sbjct  182  VYMQQMLMLEKLQLKKNKLDKKLRYIHAWRKVSSIIFAATFAAVLICSVVAAAMAAPPVA  241

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA S+PLG++GKWI+++ K YEN +K ++EI+  +  G Y+ I+DL+SI+ L+DRL
Sbjct  242  AALAAATSIPLGSMGKWIDSLLKNYENAVKGQKEIINCMNVGTYVTIKDLDSIRVLIDRL  301

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL NA+FA+
Sbjct  302  EIEIESLLKNAEFAI  316



>gb|KEH40778.1| UPF0496 plant-like protein [Medicago truncatula]
Length=371

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 138/196 (70%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQKF+EE    T  G +    Y KTL ELK FK  GDPFTE+FF ++ S
Sbjct  129  ARDSQLLIDVALQKFDEE----TVSGDNC---YVKTLQELKSFKAVGDPFTEEFFQIYQS  181

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ LML+K+K +K +LDKKL++++ WR++S +IF     SVLICSVVAA V +P V 
Sbjct  182  VYNQQVLMLEKLKLRKGKLDKKLKQIRIWRKVSFIIFVATVASVLICSVVAAAVASPHVA  241

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+AA  ++P+G++GKWI+++ K YEN LK  +E+  ++  G+Y+ I+DL++I+ LV+RL
Sbjct  242  AAVAAVTAIPIGSMGKWIDSLMKNYENALKGHKEVTISMEVGSYVAIKDLDNIRVLVNRL  301

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ L  N  +A++
Sbjct  302  EVEIESLKTNVGYAIE  317



>ref|NP_001049283.1| Os03g0199100 [Oryza sativa Japonica Group]
 sp|Q10QE9.1|U496A_ORYSJ RecName: Full=UPF0496 protein 1 [Oryza sativa Japonica Group]
 sp|A2XDK8.1|U496A_ORYSI RecName: Full=UPF0496 protein 1 [Oryza sativa Indica Group]
 gb|ABF94480.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11197.1| Os03g0199100 [Oryza sativa Japonica Group]
 gb|EAY88918.1| hypothetical protein OsI_10402 [Oryza sativa Indica Group]
 gb|EAZ25943.1| hypothetical protein OsJ_09795 [Oryza sativa Japonica Group]
Length=388

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEES----AKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFS  169
            A  SQ +L  ALQ+F++E     A   +        Y++TL EL++FK AGDPFTE+FFS
Sbjct  136  ARDSQLLLHVALQRFDDEEDNDAAAAGQEDAAPSARYARTLHELRQFKAAGDPFTEEFFS  195

Query  170  LFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvta  349
             F +VY+QQ  ML+K++++K RLDKK+R +K+WRR+S++IFAT F +VLICSVVAA + A
Sbjct  196  AFQAVYRQQLTMLEKLQQRKHRLDKKVRAIKAWRRVSSIIFATTFAAVLICSVVAAAIAA  255

Query  350  ppvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRL  529
            PPV  ALAAAAS+P+G++GKWI+++ K Y++ L+ ++E+++ +  G +I I+DL+SI+ L
Sbjct  256  PPVAAALAAAASIPVGSMGKWIDSLLKGYQDALRGQKEVVSAMQVGTFIAIKDLDSIRVL  315

Query  530  VDRLQEQIQGLLYNADFA  583
            ++R++ +I  ++   +FA
Sbjct  316  INRVELEISSMIDCVEFA  333



>gb|AFK35402.1| unknown [Lotus japonicus]
Length=352

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 143/196 (73%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q I++  +  F+EE     E G      Y KTL ELK FKDAGDPFTE F+SLF S
Sbjct  133  ARENQVIVKSVITYFDEELQNGVEVGA-----YVKTLQELKNFKDAGDPFTEDFYSLFQS  187

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
             Y QQ LML K++ +K +LDKK + +K+W+R+SN IF   FVSVLI SVVAA V APPVV
Sbjct  188  TYTQQALMLQKLQIRKRKLDKKFKSLKTWKRVSNAIFVAAFVSVLIFSVVAASVAAPPVV  247

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALAAA +VP+G+VGKW N+++K+Y+  L ++RE+++++  G YI ++DL++I+ L D+L
Sbjct  248  TALAAAMAVPIGSVGKWCNSLFKRYKKALMKQREVISSMQVGTYISLKDLDNIRVLTDKL  307

Query  542  QEQIQGLLYNADFAMQ  589
            + Q++ LL NADFA++
Sbjct  308  ELQLESLLQNADFALR  323



>ref|XP_009112322.1| PREDICTED: UPF0496 protein At5g66675 [Brassica rapa]
 ref|XP_009112323.1| PREDICTED: UPF0496 protein At5g66675 [Brassica rapa]
 emb|CDY18618.1| BnaA09g07770D [Brassica napus]
Length=413

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 148/196 (76%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A   Q I++FA+++FE ES+   EPG  +   Y+KTL EL KFK +GDPF   FF LF S
Sbjct  151  ARIGQMIIQFAVKQFEMESSS-PEPGAHN---YAKTLQELNKFKASGDPFDGDFFMLFES  206

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ ++L+ + ++K +LDKKL+ +K W++ISNV+F T FVSVLI SVVAA + APPVV
Sbjct  207  VYEQQVMLLETLHKQKRKLDKKLKNIKHWKKISNVVFVTAFVSVLIFSVVAAAIAAPPVV  266

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TA+AAA +VPLG+VGKW +++WKKYE  ++RE++++ ++  G +I ++D+E+I+  VD+L
Sbjct  267  TAVAAALAVPLGSVGKWCSHLWKKYETAVRREKDVVLSMKVGAHITMKDMENIRVHVDKL  326

Query  542  QEQIQGLLYNADFAMQ  589
            + +++ ++   DFA++
Sbjct  327  KIEMEAMMQRVDFAIE  342



>ref|XP_009388042.1| PREDICTED: UPF0496 protein 1-like [Musa acuminata subsp. malaccensis]
Length=389

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 148/196 (76%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q I+  ALQ+F EE  +      D  + YS+TL EL+ FK AGDPFTE+FF +F S
Sbjct  146  ARDTQLIIHVALQRFAEEEEE-----EDDNKKYSRTLEELRLFKAAGDPFTEEFFRVFQS  200

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ LML+K++ +K++LDKKL+ +K+WR +S++IFA  F +V+ICSVVAA V APPV 
Sbjct  201  VYRQQLLMLEKLQLRKNKLDKKLKSIKAWRTLSSIIFAATFAAVIICSVVAAAVAAPPVA  260

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAAS+P+G++GKWI+++   Y+N LK ++E+L+++  G +I I+D++SI+ L+D+L
Sbjct  261  AALAAAASIPIGSMGKWIDSLLNDYQNALKGQKEVLSSMQVGTFIAIKDMDSIRVLIDKL  320

Query  542  QEQIQGLLYNADFAMQ  589
            +  I  LL +++FA++
Sbjct  321  EMGITSLLDDSEFAIK  336



>ref|XP_006409128.1| hypothetical protein EUTSA_v10022714mg [Eutrema salsugineum]
 gb|ESQ50581.1| hypothetical protein EUTSA_v10022714mg [Eutrema salsugineum]
Length=399

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 151/195 (77%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FA+++FEEES +I   G++  + Y KTL ELK+FK AGDPFT++FF+LF  
Sbjct  138  ARRSQVIIQFAVKQFEEES-EIPLNGNNENRKYEKTLEELKRFKSAGDPFTKEFFALFDL  196

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V+K Q LMLD++ + K +LDKKL+ +K+WRR+SN++F T F+SVLI SVVAA V APPVV
Sbjct  197  VHKHQVLMLDELHKLKRKLDKKLKNIKTWRRVSNMVFVTAFISVLIFSVVAAAVAAPPVV  256

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+A A +VP+G+VGKW N++W KYE  ++ ++EI+TTI  G YI ++++++I  LV ++
Sbjct  257  AAIAGALAVPVGSVGKWCNSLWTKYEKVVRGQKEIITTIRIGTYISVKEMDNISVLVRKV  316

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL NA+FA+
Sbjct  317  EVEIESLLKNAEFAV  331



>ref|NP_001145902.1| hypothetical protein [Zea mays]
 gb|ACL52818.1| unknown [Zea mays]
 gb|AFW89348.1| hypothetical protein ZEAMMB73_728470 [Zea mays]
Length=372

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 148/194 (76%), Gaps = 1/194 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ +L  ALQ+F++E          S + Y++TL EL++FK AGDPFT++FF+ F +
Sbjct  125  ARDSQLLLHVALQRFDDEEDIDAAAAAPSAR-YARTLHELRQFKTAGDPFTDEFFAAFQA  183

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML+K++++K RLDKK++ +K+WRR+S++IFAT F +VLICSVVAA + APPV 
Sbjct  184  VYRQQLAMLEKLQQRKHRLDKKVKTIKAWRRVSSIIFATTFAAVLICSVVAAAIAAPPVA  243

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAA+VPLG++GKWI+++ K Y++ L+ ++E+++T+  G +I I+DL+SI+ L++R+
Sbjct  244  AALAAAAAVPLGSMGKWIDSLLKGYQDALRGQKEVVSTMQVGTFIAIKDLDSIRVLINRV  303

Query  542  QEQIQGLLYNADFA  583
            + +I  ++   +FA
Sbjct  304  ELEISSMVDCVEFA  317



>ref|XP_008447055.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis melo]
Length=372

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 144/196 (73%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  S  ++  A+++FEEE   +   G      Y KTL ELK FK AGDPFT++FF +F++
Sbjct  130  ARDSHLLIVMAIERFEEEVKMVDGNG------YVKTLQELKNFKAAGDPFTDEFFQIFNA  183

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
             Y+ Q  ML+K+  +K++LDKKL+ + +WR++S++IF   F +VLICS+VAA + APPV 
Sbjct  184  AYRHQIGMLEKLLIRKNKLDKKLKSMSTWRKVSSMIFIATFATVLICSIVAAAMAAPPVA  243

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+AAAAS+P+G++GKWI+++WKKYE  LK ++E+++++  G Y+ I+D+++I+ L+D+L
Sbjct  244  AAMAAAASIPVGSMGKWIDSLWKKYEAALKGQKEVVSSMQVGTYLAIKDMDNIRVLIDKL  303

Query  542  QEQIQGLLYNADFAMQ  589
              +I+ LL  ADFA++
Sbjct  304  TVEIESLLKKADFAIE  319



>ref|XP_006393860.1| hypothetical protein EUTSA_v10004318mg [Eutrema salsugineum]
 gb|ESQ31146.1| hypothetical protein EUTSA_v10004318mg [Eutrema salsugineum]
Length=410

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 148/198 (75%), Gaps = 5/198 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKIT--EPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLF  175
            A   Q I++FA+++FE ES+  T  EPG +    Y+KTL EL KFK +GDPF   FF LF
Sbjct  145  ARIGQMIIQFAVKQFEIESSAKTSVEPGTNK---YAKTLQELNKFKASGDPFDADFFLLF  201

Query  176  HSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtapp  355
             SVY+QQ L+L+ + ++K +LD+KL+ +K W++ISNV+F T FVSVLI SVVAA + APP
Sbjct  202  ESVYEQQVLLLEILHKQKRKLDRKLKNIKHWKKISNVVFVTAFVSVLIFSVVAAAIAAPP  261

Query  356  vvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVD  535
            VVTA+AAA +VP+G+VGKW N++W KYE  +K +++I+ ++  G Y+ ++D+E+I+  VD
Sbjct  262  VVTAVAAALAVPIGSVGKWCNHLWSKYETAVKGQKDIVLSMRIGAYVTMKDMENIRVHVD  321

Query  536  RLQEQIQGLLYNADFAMQ  589
            RL+ +++ +++  DFA++
Sbjct  322  RLKIEMESMMHKVDFAIK  339



>ref|XP_010680903.1| PREDICTED: UPF0496 protein 1-like [Beta vulgaris subsp. vulgaris]
Length=387

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 151/192 (79%), Gaps = 4/192 (2%)
 Frame = +2

Query  14   QSILRFALQKFEEESAKITEPGHDSVQ-LYSKTLAELKKFKDAGDPFTEKFFSLFHSVYK  190
            Q I++ AL +FEEE   +   G+ S Q  Y K L ELK FK+AGDPFTE+F ++F SVYK
Sbjct  143  QLIIQVALLQFEEEIGNV---GNVSGQNRYGKILKELKNFKEAGDPFTEEFLTMFQSVYK  199

Query  191  QQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtal  370
            QQ +M +K++ +K +LDKKL+ +K +R++SN+IFA  FV+V+ICSVVAA ++APP+V+A+
Sbjct  200  QQVVMFEKLQLRKHKLDKKLKSLKIYRKVSNIIFAATFVAVIICSVVAAAISAPPMVSAI  259

Query  371  aaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQ  550
            AAAAS P+G +G+W+N++WKKYE++LK +RE++ ++  G YI I+DL+SI+ LVD+L  Q
Sbjct  260  AAAASAPMGGIGRWMNSLWKKYESELKTQRELINSMQVGTYIAIKDLDSIRVLVDKLDIQ  319

Query  551  IQGLLYNADFAM  586
            ++ LL NA+FA+
Sbjct  320  VESLLANAEFAL  331



>ref|XP_006425739.1| hypothetical protein CICLE_v10025839mg [Citrus clementina]
 ref|XP_006425740.1| hypothetical protein CICLE_v10025839mg [Citrus clementina]
 ref|XP_006466717.1| PREDICTED: UPF0496 protein At2g18630-like isoform X1 [Citrus 
sinensis]
 ref|XP_006466718.1| PREDICTED: UPF0496 protein At2g18630-like isoform X2 [Citrus 
sinensis]
 gb|ESR38979.1| hypothetical protein CICLE_v10025839mg [Citrus clementina]
 gb|ESR38980.1| hypothetical protein CICLE_v10025839mg [Citrus clementina]
 gb|KDO79464.1| hypothetical protein CISIN_1g016839mg [Citrus sinensis]
 gb|KDO79465.1| hypothetical protein CISIN_1g016839mg [Citrus sinensis]
Length=381

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 153/196 (78%), Gaps = 3/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A +SQ I++ A+++F+EE  ++ E   +  + Y +TL ELKKFKDAGDPFTE+FF LF S
Sbjct  135  ARNSQLIIQLAVKQFDEE-VELQEVVDE--KRYVRTLDELKKFKDAGDPFTEEFFVLFQS  191

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ LML++++++K +LDKKL+ +K+WR +SNV+F + FV+VLI SVVAA + APP+V
Sbjct  192  VYKQQVLMLERLQKRKRKLDKKLKSMKTWRMVSNVLFVSTFVAVLIFSVVAAAIAAPPLV  251

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA A +VP+G+VGKW N++W  YE  LK ++E+++T+  G Y+ I D++ I+ LV++L
Sbjct  252  TALAGALAVPIGSVGKWCNSLWNSYEKALKGQKELMSTMQIGAYVKIMDMDHIRVLVNKL  311

Query  542  QEQIQGLLYNADFAMQ  589
            + QI+ LL NADFA++
Sbjct  312  EIQIEALLNNADFALR  327



>ref|XP_004148297.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis sativus]
 ref|XP_004163630.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis sativus]
 gb|KGN44316.1| hypothetical protein Csa_7G253710 [Cucumis sativus]
Length=372

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 143/196 (73%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  S  ++  A+++FEEE   +   G      Y +TL ELK FK AGDPFT +FF +F++
Sbjct  130  ARDSHLLIVMAIERFEEEVKMVDGNG------YVRTLQELKNFKAAGDPFTNEFFQIFNA  183

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+ Q  ML+K+  +K++LDKKL+ + +WR++S++IF   F +VLICS+VAA + APPV 
Sbjct  184  VYRHQIGMLEKLVIRKNKLDKKLKSMSTWRKVSSMIFIATFATVLICSIVAAAMAAPPVA  243

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+AAAAS+P+G+VGKWI+++WK YE  LK ++E+++++  G Y+ I+D+++I+ L+D+L
Sbjct  244  AAMAAAASIPVGSVGKWIDSLWKNYEAALKGQKEVVSSMQVGTYLAIKDMDNIRVLIDKL  303

Query  542  QEQIQGLLYNADFAMQ  589
              +I+ LL  ADFA++
Sbjct  304  TMEIESLLKKADFAIE  319



>ref|XP_010943147.1| PREDICTED: UPF0496 protein 1-like [Elaeis guineensis]
Length=393

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 150/196 (77%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I+  ALQ+FEEE  ++ E   D  + Y +T+ EL+ FK AGDPFTE+FF +F S
Sbjct  147  ARDSQLIIHVALQRFEEEEEEVVE--EDCKKKYLRTIEELRHFKAAGDPFTEEFFQVFQS  204

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V +QQ+ ML+K+K++K++LDKKL+ +K+WR++S++IF   F +++ICSVV AVV AP V 
Sbjct  205  VSRQQQSMLEKIKQRKNKLDKKLKSIKAWRKVSSIIFMAAFATLIICSVVTAVVAAPHVA  264

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAAS+P+G++GKWI++++K Y+  ++ ++EIL+++    YIVI+DL+SI+ LVD L
Sbjct  265  AALAAAASIPVGSMGKWIDSLFKGYQQAVEGQKEILSSMQVRTYIVIKDLDSIRVLVDCL  324

Query  542  QEQIQGLLYNADFAMQ  589
            + QI  LL NADFA++
Sbjct  325  EAQINMLLDNADFALR  340



>ref|XP_002865053.1| hypothetical protein ARALYDRAFT_496934 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41312.1| hypothetical protein ARALYDRAFT_496934 [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 148/199 (74%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESA---KITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSL  172
            A   Q +L+FAL++FE ES+   K  EPG  +   Y+KTL EL KFK + DPF   FF L
Sbjct  135  ARIGQMLLQFALKQFEMESSGNNKSVEPG--TTNKYAKTLEELNKFKASADPFDGDFFML  192

Query  173  FHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtap  352
            F SVY+QQ ++L+ + ++K +LDKKL+ +K W++ISNV+F T FVSVLI SVVAA V AP
Sbjct  193  FESVYEQQVMLLEILHKQKRKLDKKLKNIKHWKKISNVVFVTAFVSVLIFSVVAAAVAAP  252

Query  353  pvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLV  532
            PVVTA+AAA +VP+G++GKW N++WKKYE  +K +++I+ ++  G Y+ ++D+++I+ L+
Sbjct  253  PVVTAVAAALAVPVGSIGKWCNHLWKKYETAVKGQKDIVLSMRIGAYVTMKDMDNIRVLI  312

Query  533  DRLQEQIQGLLYNADFAMQ  589
            D+L+ +++ ++   DFA++
Sbjct  313  DKLKIEMESMMQKVDFALK  331



>ref|XP_010028566.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=365

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 139/196 (71%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FE E  +    G D    Y++TL ELK FK AGDPFT++FF +F +
Sbjct  122  ARDSQLLILIALQQFEGEDRRAG--GADR---YARTLEELKNFKAAGDPFTKEFFRIFQA  176

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+    ML+K++ +KS+LDKKLR + +WR++S++IFA  F  +LICSVVAA V  P V 
Sbjct  177  VYRNHVTMLEKLQLRKSKLDKKLRYLHAWRKVSSMIFAATFAVILICSVVAAAVAQPHVA  236

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAAS+P+ +VGKWI+++ K YEN +K ++E +  +  G  +VI DLE+I+ LVDRL
Sbjct  237  GALAAAASIPVCSVGKWIDSLLKNYENAVKGQKETIVAMQVGTGLVISDLENIRVLVDRL  296

Query  542  QEQIQGLLYNADFAMQ  589
            + +IQ +L NA+ A++
Sbjct  297  EIEIQSMLQNAELAVE  312



>ref|XP_010550396.1| PREDICTED: UPF0496 protein At5g66675-like [Tarenaya hassleriana]
Length=410

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 147/196 (75%), Gaps = 3/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I+RFA++++E ES  + +  ++    Y KTL EL KFK A DPF E FF+LF S
Sbjct  148  ARISQLIIRFAVKQYEIESQDVDKGNNNK---YPKTLEELNKFKAASDPFDEDFFALFES  204

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ L+L+++ ++K +LDKK++ +K+WR++SNV+F T FVSVLI S+VAA V APPVV
Sbjct  205  VYEQQVLLLEELHKQKMKLDKKMKNIKTWRKVSNVVFMTAFVSVLIFSIVAAAVAAPPVV  264

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TA+AAA +VP+G+VGK  N +WKKY+  +K ++ I+ ++  G Y+ ++D+E+I  LVD+L
Sbjct  265  TAVAAAMAVPIGSVGKLCNYLWKKYDTAVKGQKGIVLSMKIGAYVAMKDMENIGVLVDKL  324

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ +L+  DFA++
Sbjct  325  KIEIESMLHKVDFALK  340



>emb|CDX81379.1| BnaC09g07900D [Brassica napus]
Length=406

 Score =   156 bits (394),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 147/196 (75%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A   Q I++FA+++FE ES+   EPG      Y+KTL EL KFK +GDPF   FF LF S
Sbjct  150  ARIGQMIIQFAVKQFEMESSS-PEPGASK---YAKTLQELNKFKASGDPFDGDFFMLFES  205

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ ++L+ + ++K +LDKKL+ +K W++ISNV+F T FVSVLI SVVAA + APPVV
Sbjct  206  VYEQQVMLLETLHKQKRKLDKKLKNIKHWKKISNVVFVTAFVSVLIFSVVAAAIAAPPVV  265

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TA+AAA +VPLG+VGKW +++WKKYE  ++R+++++ ++  G +I ++D+E+I+  VD+L
Sbjct  266  TAVAAALAVPLGSVGKWCSHLWKKYETAVRRQKDVVLSMKVGAHITMRDMENIRVHVDKL  325

Query  542  QEQIQGLLYNADFAMQ  589
            + +++ ++   DFA++
Sbjct  326  KIEMEAMMQRVDFAIE  341



>gb|AFK35357.1| unknown [Medicago truncatula]
Length=371

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 137/196 (70%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQKF+ E    T  G +    Y KTL ELK FK  GDPFTE+FF ++ S
Sbjct  129  ARDSQLLIDVALQKFDGE----TVSGDNC---YVKTLQELKSFKAVGDPFTEEFFQIYQS  181

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ LML+K+K +K +LDKKL++++ WR++S +IF     SVLICSVVAA V +P V 
Sbjct  182  VYNQQVLMLEKLKLRKGKLDKKLKQIRIWRKVSFIIFVATVASVLICSVVAAAVASPHVA  241

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+AA  ++P+G++GKWI+++ K YEN LK  +E+  ++  G+Y+ I+DL++I+ LV+RL
Sbjct  242  AAVAAVTAIPIGSMGKWIDSLMKNYENALKGHKEVTISMEVGSYVAIKDLDNIRVLVNRL  301

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ L  N  +A++
Sbjct  302  EVEIESLKTNVGYAIE  317



>ref|XP_010029837.1| PREDICTED: UPF0496 protein At2g18630-like [Eucalyptus grandis]
 gb|KCW56806.1| hypothetical protein EUGRSUZ_I02475 [Eucalyptus grandis]
Length=378

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 145/194 (75%), Gaps = 6/194 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ +++FA+Q+FE+    I E        Y+KTL EL+KF+ AGDPFTE+FF +F S
Sbjct  135  ARDSQLLIQFAIQQFEQVEDGIEENK------YAKTLEELQKFRAAGDPFTEEFFVIFQS  188

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ  ML+K++ +K +LDKKL+  K+W+R+SN+IF   FVS LI SVVAA V APPV+
Sbjct  189  VYKQQLAMLEKLQVRKKKLDKKLKSTKTWKRVSNMIFVAAFVSALIFSVVAAAVAAPPVI  248

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA A +VP+G+VGKW +++WK Y++ LK +RE+++++  G YI I+D++SI+ LV +L
Sbjct  249  TALAGAIAVPIGSVGKWCDSLWKNYQSALKGQRELISSMQVGTYITIKDMDSIKVLVSKL  308

Query  542  QEQIQGLLYNADFA  583
            Q +I+  + NADFA
Sbjct  309  QVEIESFMQNADFA  322



>gb|KDP31809.1| hypothetical protein JCGZ_12270 [Jatropha curcas]
Length=386

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 148/197 (75%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSV--QLYSKTLAELKKFKDAGDPFTEKFFSLF  175
            A +SQ I++ AL++FE ESA       D V  + Y+KTL EL+KFK  GDPFTE+F+ LF
Sbjct  140  ARNSQLIIQVALRQFEGESAL-----QDGVIEKKYAKTLEELRKFKTVGDPFTEEFYILF  194

Query  176  HSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtapp  355
             +VY+QQ  ML K++ +K RLDKKL+ +K+WRR+SNV+F T FVSVL+ SVVAA + APP
Sbjct  195  QAVYRQQVSMLQKLQLRKRRLDKKLKSMKTWRRVSNVLFVTAFVSVLVFSVVAAAIAAPP  254

Query  356  vvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVD  535
            VVTALA A +VP+G+VGKW N++W  Y   LKR++E+++T+  G +I I+D+++I+ LV+
Sbjct  255  VVTALAGALAVPIGSVGKWCNSLWNSYMKALKRQKELVSTMQVGTFIAIKDMDNIRVLVN  314

Query  536  RLQEQIQGLLYNADFAM  586
            +L+ +I+ LL N + A+
Sbjct  315  KLELEIESLLQNVNIAL  331



>ref|XP_004985322.1| PREDICTED: UPF0496 protein 1-like [Setaria italica]
Length=379

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 145/194 (75%), Gaps = 3/194 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ +L  ALQ+F++E              Y++TL EL++FK AGDPFTE+FF+ F +
Sbjct  134  ARDSQLLLHVALQRFDDEEDAAAAAPSAR---YARTLHELRQFKAAGDPFTEEFFAAFQA  190

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML+K++++K RLDKK++ +K+WRR+S++IFAT F +VLICSVVAA + APPV 
Sbjct  191  VYRQQLTMLEKLQQRKHRLDKKIKTIKAWRRVSSIIFATTFAAVLICSVVAAAIAAPPVA  250

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAA+VPLG++GKWI+++ K Y++ L+ ++E+++ +  G +I I+DL+SI+ L++R+
Sbjct  251  AALAAAAAVPLGSMGKWIDSLLKGYQDALRGQKEVVSAMQVGTFIAIKDLDSIRVLINRV  310

Query  542  QEQIQGLLYNADFA  583
            + +I  ++   +FA
Sbjct  311  EVEISSMIDCVEFA  324



>ref|XP_003558574.1| PREDICTED: UPF0496 protein 1 [Brachypodium distachyon]
Length=393

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 145/201 (72%), Gaps = 7/201 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQL-------YSKTLAELKKFKDAGDPFTEK  160
            A  SQ +L  ALQ+F++E       G  +          Y++TL EL++FK AGDPFT++
Sbjct  138  ARDSQLLLHVALQRFDDEERGDAPEGASASAAAAAPSARYARTLHELRQFKAAGDPFTDE  197

Query  161  FFSLFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaav  340
            FF  F +VY+QQ  ML+K++++K RLDKK++ +K+WRR+S++IFAT F +VLICSVVAA 
Sbjct  198  FFEAFQAVYRQQLAMLEKLQQRKHRLDKKVKTIKAWRRVSSIIFATTFAAVLICSVVAAA  257

Query  341  vtappvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESI  520
            + APPV  ALAAAA+VP+G++GKWI+++ K Y++ L  ++E+++ +  G +I I+DL+SI
Sbjct  258  IAAPPVAAALAAAAAVPVGSMGKWIDSLLKGYQDALHGQKEVVSAMQVGTFIAIKDLDSI  317

Query  521  QRLVDRLQEQIQGLLYNADFA  583
            + L++R++ +I  ++   +FA
Sbjct  318  RVLINRVEMEISSMVDCVEFA  338



>ref|NP_850929.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8GW16.1|U496H_ARATH RecName: Full=UPF0496 protein At5g66675 [Arabidopsis thaliana]
 dbj|BAC43715.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63419.1| At5g66675 [Arabidopsis thaliana]
 gb|AED98250.1| uncharacterized protein AT5G66675 [Arabidopsis thaliana]
Length=412

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 147/199 (74%), Gaps = 6/199 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESA---KITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSL  172
            A   Q +L+FAL++FE ES+   K  EPG +    Y+KTL EL KFK +GDPF   FF L
Sbjct  146  ARIGQMLLQFALKQFEMESSGSNKSVEPGTNK---YAKTLEELNKFKASGDPFDGDFFML  202

Query  173  FHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtap  352
              SVY+QQ ++L+ + ++K +LDKKL+ +K W++ISNV+F T FVSVLI SVVAA V AP
Sbjct  203  LESVYEQQVMLLEILHKQKRKLDKKLKNIKYWKKISNVVFVTAFVSVLIFSVVAAAVAAP  262

Query  353  pvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLV  532
            PVVTALAAA +VP+G++GKW N++WKKYE  +K +++I+ ++  G Y+ ++D+++I+  V
Sbjct  263  PVVTALAAALAVPIGSIGKWCNHLWKKYETAVKGQKDIVLSMRIGAYVTMKDMDNIRVHV  322

Query  533  DRLQEQIQGLLYNADFAMQ  589
            D+L+ +++ ++   DFA++
Sbjct  323  DKLKIEMESMMQKVDFALK  341



>ref|XP_006573602.1| PREDICTED: UPF0496 protein At2g18630-like isoform X1 [Glycine 
max]
 ref|XP_006573603.1| PREDICTED: UPF0496 protein At2g18630-like isoform X2 [Glycine 
max]
Length=382

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 141/196 (72%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A     I++ A+  FEEE     E        Y KTL ELK FK+AGDPFTE+F+SLF S
Sbjct  137  ARGRHVIVKSAITCFEEEVQNGVEGST-----YLKTLQELKGFKEAGDPFTEEFYSLFQS  191

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML K+K +K +LDKKL+  K+ +R+SN IF   FVSVLI SVVAA + APPVV
Sbjct  192  VYQQQASMLKKLKIRKQKLDKKLKSFKTLKRVSNAIFVAAFVSVLIFSVVAAAIAAPPVV  251

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA A +VP+G+VGKW N+++K+YE  LK +RE+++++  G+YI + DL++I+  +D+L
Sbjct  252  TALAGALAVPIGSVGKWCNSLFKRYETALKGQRELISSMQVGSYITLVDLKNIRLRIDQL  311

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ +L ++DFA++
Sbjct  312  EIKIESMLQSSDFALR  327



>gb|EYU41177.1| hypothetical protein MIMGU_mgv1a008261mg [Erythranthe guttata]
Length=379

 Score =   153 bits (386),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 148/195 (76%), Gaps = 3/195 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FE+E+    E G   V+ YSKTL EL+ FKD GDPFTE FF +F S
Sbjct  132  ARDSQLLIHVALQQFEDENR--VEGGSSEVR-YSKTLEELRNFKDVGDPFTEDFFVIFRS  188

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q LML+++++KK++LDKKLR + +WR++S+VIFA  F +VLICSVVAA + APPV 
Sbjct  189  VYKNQMLMLERLQKKKNKLDKKLRSLHAWRKVSSVIFAATFAAVLICSVVAAAMAAPPVA  248

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAAS+PLG++GKWI+++ K YEN +K ++E++  +  G Y+ I+DL++I+  ++RL
Sbjct  249  AALAAAASIPLGSMGKWIDSLLKNYENAVKGQKEMVNYMNVGTYVAIKDLDNIRVSIERL  308

Query  542  QEQIQGLLYNADFAM  586
            +  I+ +L NADFA+
Sbjct  309  EIDIESMLKNADFAL  323



>ref|XP_008652317.1| PREDICTED: UPF0496 protein 1 [Zea mays]
 ref|XP_008652323.1| PREDICTED: UPF0496 protein 1 [Zea mays]
 tpg|DAA43952.1| TPA: hypothetical protein ZEAMMB73_791340 [Zea mays]
Length=382

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 146/199 (73%), Gaps = 11/199 (6%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYS-----KTLAELKKFKDAGDPFTEKFF  166
            A  SQ +L  ALQ+F++E       G D+          +TL EL++FK AGDPFT++FF
Sbjct  135  ARDSQLLLHVALQRFDDEE------GSDAAAAAPSARYARTLHELRQFKAAGDPFTDEFF  188

Query  167  SLFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvt  346
            + F +VY+QQ  ML+K++++K RLDKK++ +K+WRR+S++IFAT F +VLICSVVAA + 
Sbjct  189  AAFQAVYRQQLAMLEKLQQRKHRLDKKVKTIKAWRRVSSIIFATTFAAVLICSVVAAAIA  248

Query  347  appvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQR  526
            APPV  ALAAAA+VPLG++GKWI+++ K Y++ L+ ++E+++ +  G +I I+DL+SI+ 
Sbjct  249  APPVAAALAAAAAVPLGSMGKWIDSLLKGYQDALRGQKEVVSAMQVGTFIAIKDLDSIRV  308

Query  527  LVDRLQEQIQGLLYNADFA  583
            L++R++ +I  ++   +FA
Sbjct  309  LINRVEVEISSMVDCVEFA  327



>ref|XP_010999947.1| PREDICTED: UPF0496 protein At2g18630-like isoform X2 [Populus 
euphratica]
Length=337

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 125/164 (76%), Gaps = 0/164 (0%)
 Frame = +2

Query  98   YSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRI  277
            Y KTL EL+ F  AGDPFT KFF LF SVY+QQ  ML K++  K +LDKKL+ VK WRR+
Sbjct  164  YVKTLEELQNFMVAGDPFTPKFFMLFQSVYEQQVSMLKKLQSHKRKLDKKLKSVKIWRRV  223

Query  278  SNVIFATVFVSVLICsvvaavvtappvvtalaaaasvplGTVGKWINNMWKKYENDLKRE  457
            SNV+F +VFV+V+I +V AA + APPVV+ALA+A + P+ +VG W N +W +YEN LK +
Sbjct  224  SNVLFVSVFVTVMIFAVAAAAIAAPPVVSALASALADPVHSVGTWCNLLWHRYENALKEQ  283

Query  458  REILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYNADFAMQ  589
            + +++ I  G +I I+D+ESI+ LV++L+ +I+ LL++ADFA++
Sbjct  284  KVLVSAIQVGTFITIKDMESIRVLVNKLEIEIKSLLHHADFAIR  327



>dbj|BAJ93975.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97187.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=383

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 144/194 (74%), Gaps = 2/194 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ +L  ALQ+F++E     +        Y++TL EL++FK AGDPFT++FF  F +
Sbjct  138  ARDSQLLLHVALQRFDDEDDNDGDAA--PAARYARTLHELRQFKAAGDPFTDEFFEAFQA  195

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML+K++++K RLDKK++ +K+WRR+S+VIFA+ F +VLICSVVAA + APPV 
Sbjct  196  VYRQQLAMLEKLQQRKHRLDKKIKTIKAWRRVSSVIFASTFAAVLICSVVAAAIAAPPVA  255

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAA++P+G++GKWI+++ K Y++ ++ ++E+++ +  G +I I+DL++I+ L+ R+
Sbjct  256  AALAAAAAIPIGSMGKWIDSLLKGYQDAVRGQKEVVSAMQVGTFIAIKDLDNIRVLISRV  315

Query  542  QEQIQGLLYNADFA  583
            + +I  ++   DFA
Sbjct  316  EMEISSMIDCVDFA  329



>ref|XP_006280557.1| hypothetical protein CARUB_v10026498mg [Capsella rubella]
 ref|XP_006280558.1| hypothetical protein CARUB_v10026498mg [Capsella rubella]
 gb|EOA13455.1| hypothetical protein CARUB_v10026498mg [Capsella rubella]
 gb|EOA13456.1| hypothetical protein CARUB_v10026498mg [Capsella rubella]
Length=412

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 146/199 (73%), Gaps = 6/199 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESA---KITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSL  172
            A   Q +L+FA+++FE ES+      EPG +    Y+ TL EL KFK +GDPF   FF L
Sbjct  146  ARVGQMLLQFAIKQFEMESSGNNTSVEPGTNK---YANTLEELNKFKASGDPFDGDFFML  202

Query  173  FHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtap  352
            F SVY+QQ ++LD + ++K +LD+KL+ +K W++ISNV+F T FVSVLI SVVAA V AP
Sbjct  203  FESVYEQQVMLLDILHKQKRKLDRKLKNIKHWKKISNVVFVTAFVSVLIFSVVAAAVAAP  262

Query  353  pvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLV  532
            PVVTA+AAA +VP+G++GKW N++WKKYE  +K +++I+ ++  G Y+ ++D+++I+  +
Sbjct  263  PVVTAVAAALAVPIGSIGKWCNHLWKKYETAVKGQKDIVLSMRIGAYVTMKDMDNIRLHI  322

Query  533  DRLQEQIQGLLYNADFAMQ  589
            D+L+ +++ ++   DFA++
Sbjct  323  DKLKIEMESMMQRVDFALK  341



>ref|XP_010999946.1| PREDICTED: UPF0496 protein At2g18630-like isoform X1 [Populus 
euphratica]
Length=381

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 125/164 (76%), Gaps = 0/164 (0%)
 Frame = +2

Query  98   YSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRI  277
            Y KTL EL+ F  AGDPFT KFF LF SVY+QQ  ML K++  K +LDKKL+ VK WRR+
Sbjct  164  YVKTLEELQNFMVAGDPFTPKFFMLFQSVYEQQVSMLKKLQSHKRKLDKKLKSVKIWRRV  223

Query  278  SNVIFATVFVSVLICsvvaavvtappvvtalaaaasvplGTVGKWINNMWKKYENDLKRE  457
            SNV+F +VFV+V+I +V AA + APPVV+ALA+A + P+ +VG W N +W +YEN LK +
Sbjct  224  SNVLFVSVFVTVMIFAVAAAAIAAPPVVSALASALADPVHSVGTWCNLLWHRYENALKEQ  283

Query  458  REILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYNADFAMQ  589
            + +++ I  G +I I+D+ESI+ LV++L+ +I+ LL++ADFA++
Sbjct  284  KVLVSAIQVGTFITIKDMESIRVLVNKLEIEIKSLLHHADFAIR  327



>gb|EPS58212.1| hypothetical protein M569_16603 [Genlisea aurea]
Length=402

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 138/199 (69%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEES---AKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSL  172
            A   +SI++ AL KF EE      + E      + Y KTL EL  FK  GDPF+E FF +
Sbjct  133  AARVESIIKVALHKFHEEQHCLQGVRENSSSEKRCYPKTLEELNNFKAVGDPFSEDFFKV  192

Query  173  FHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtap  352
            F+SV   Q  ML+++K +K +LD+KL  +K++RRISN+IF T F SVL+CSVVAA +TAP
Sbjct  193  FNSVCSGQIAMLERLKSRKKKLDRKLASMKTYRRISNIIFITAFASVLVCSVVAAALTAP  252

Query  353  pvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLV  532
            PV+TALAAAA+VP+G++G W+ ++W KYE DL  + EI+T++  G  I I+DL++I+  +
Sbjct  253  PVLTALAAAAAVPMGSIGTWLASIWSKYEKDLSGQIEIITSMQIGTRIAIKDLDNIRAQI  312

Query  533  DRLQEQIQGLLYNADFAMQ  589
            +R Q +I+ L  +ADFA +
Sbjct  313  ERFQIRIKALSESADFAAE  331



>gb|KHN36151.1| UPF0496 protein [Glycine soja]
Length=382

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 139/196 (71%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A     I++ A+  FEEE     E        Y KTL ELK FK+AGDPFTE+F+SLF S
Sbjct  137  ARGRHVIVKSAITCFEEEVQNGVEGST-----YLKTLQELKGFKEAGDPFTEEFYSLFQS  191

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML K+K +K +LDKKL+  K+ +R+SN I    FVSVLI SVVAA + APP V
Sbjct  192  VYQQQASMLKKLKIRKQKLDKKLKSFKTLKRVSNAICVAAFVSVLIFSVVAAAIAAPPGV  251

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA A +VP+G+VGKW N+++K+YE  LK +RE+++++  G+YI + DL++I+  +D+L
Sbjct  252  TALAGALAVPIGSVGKWCNSLFKRYETALKGQRELISSMQVGSYITLVDLKNIRLRIDQL  311

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ +L ++DFA++
Sbjct  312  EIKIESMLQSSDFALR  327



>ref|XP_006383250.1| hypothetical protein POPTR_0005s12870g [Populus trichocarpa]
 gb|ERP61047.1| hypothetical protein POPTR_0005s12870g [Populus trichocarpa]
Length=381

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 124/164 (76%), Gaps = 0/164 (0%)
 Frame = +2

Query  98   YSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRI  277
            Y KTL EL+KF  AGDPFT KFF L  SVY+QQ  ML K++  K +LDKKL+ VK WRR+
Sbjct  164  YVKTLEELQKFMVAGDPFTPKFFMLLQSVYEQQVSMLKKLQSHKRKLDKKLKSVKIWRRV  223

Query  278  SNVIFATVFVSVLICsvvaavvtappvvtalaaaasvplGTVGKWINNMWKKYENDLKRE  457
            SNV+F +VFV+V+I +V AA + APPVVTALA+A + P+ +VG W N +W +YEN LK +
Sbjct  224  SNVLFVSVFVTVMIFAVAAAAIAAPPVVTALASALADPMRSVGTWCNLLWHRYENALKEQ  283

Query  458  REILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYNADFAMQ  589
            + ++  I  G +I I+D+ESI+ LV++L+ +I+ LL++ADFA++
Sbjct  284  KVLVNAIQVGTFITIKDMESIRVLVNKLEIEIKSLLHHADFAIR  327



>ref|XP_008459259.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis melo]
Length=367

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 152/196 (78%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  A+++FEE+  + ++ G +    + KTL EL+ FK +GDPFT++FF +FHS
Sbjct  124  ARDSQVMILMAVRQFEEDERE-SQMGPNQ---FDKTLRELRNFKASGDPFTDEFFRIFHS  179

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q  ML+K+++KK++LDKKL+ + +WR++S +IFA  F +VLICSVVA V+ APPV 
Sbjct  180  VYKHQTAMLEKLQQKKNKLDKKLKSISTWRKLSCMIFAATFAAVLICSVVATVIMAPPVA  239

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             AL+AA+S+PLG++GKWI+++WK YEN +K ++E++ ++  G YI I+D+++I+ LV++L
Sbjct  240  AALSAASSIPLGSMGKWIDSLWKSYENAVKGQKEVINSMQVGTYIAIKDMDNIRILVEKL  299

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+G+L  ADFA++
Sbjct  300  EIEIKGMLEKADFAIK  315



>ref|XP_010099360.1| hypothetical protein L484_009177 [Morus notabilis]
 gb|EXB77881.1| hypothetical protein L484_009177 [Morus notabilis]
Length=389

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 143/195 (73%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q ++R A+ +F+EE     E    +   + KTL EL KFK AGDPFT++FF LF S
Sbjct  144  ATGNQLVVRAAVNRFKEE----LEGSEANGGTFEKTLHELAKFKAAGDPFTDEFFVLFQS  199

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V  QQ +ML+K++ +K +LDKKL+ VK+WR++SNVIF   FVS+LI SVVAA + APPVV
Sbjct  200  VLNQQYVMLEKLQTRKRKLDKKLKSVKTWRKVSNVIFVAAFVSLLIFSVVAAAIAAPPVV  259

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TAL  A +VP+G+VGKW N+ W +Y N ++ +REI++++  G Y+ ++DLESI+ LV++L
Sbjct  260  TALLGALAVPIGSVGKWCNSFWNRYGNTVRGQREIISSMQVGTYVTLKDLESIKALVNKL  319

Query  542  QEQIQGLLYNADFAM  586
            + +++ LL+NA FA+
Sbjct  320  EIEVESLLHNAQFAL  334



>ref|XP_004300597.1| PREDICTED: UPF0496 protein At2g18630-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465464.1| PREDICTED: UPF0496 protein At2g18630-like [Fragaria vesca subsp. 
vesca]
Length=384

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 144/196 (73%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A ++Q I++ A+++FEEE     E G D  +   +TL EL+ FK AGDPFTE+FF LF +
Sbjct  143  AVNNQLIIQAAVRRFEEE----VEAGFDG-KGCVRTLQELRAFKAAGDPFTEEFFVLFQA  197

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ  ML K++ +K +LDKKL+ VK+WR++SNVIF   FVSVLI SVVAA + APP+V
Sbjct  198  VYNQQASMLQKLQVRKRKLDKKLKSVKAWRKVSNVIFVATFVSVLIFSVVAAAIAAPPLV  257

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA A +VP+G+VGKW N +W +YE  LK +REI++++  G+ I + DL +I+ LV +L
Sbjct  258  TALAGALAVPIGSVGKWCNMLWSRYERALKGQREIISSMQVGSMITMTDLNNIRVLVGKL  317

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ LL NADFA++
Sbjct  318  EIEIEALLQNADFAIR  333



>ref|NP_195159.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SYZ8.1|U496B_ARATH RecName: Full=UPF0496 protein At4g34330 [Arabidopsis thaliana]
 emb|CAB36710.1| putative protein [Arabidopsis thaliana]
 emb|CAB80150.1| putative protein [Arabidopsis thaliana]
 gb|AEE86360.1| uncharacterized protein AT4G34330 [Arabidopsis thaliana]
Length=354

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 121/162 (75%), Gaps = 1/162 (1%)
 Frame = +2

Query  98   YSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRI  277
            Y KTL ELK+FKDA  PF + FF +F SVY QQ+ MLDK++ ++++LDKKL+++++WR++
Sbjct  138  YKKTLQELKRFKDADRPFDQDFFKMFQSVYNQQKWMLDKLQRRQNKLDKKLKRIRTWRKL  197

Query  278  SNVIFATVFVSVLICsvvaavvtappvvtalaaaasvplGTVGKWINNMWKKYENDLKRE  457
            S++IF   F +++IC  V A   A P V A  AAA+ P+G++GKWI+++WK YEN++K +
Sbjct  198  SSIIFMATFATLVIC-SVLAATMAAPHVAAALAAATPPVGSMGKWIDSLWKNYENEIKGQ  256

Query  458  REILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYNADFA  583
             E+ +++  G Y+ +QDL +I+ L+ RL  +I+G++ NA++A
Sbjct  257  TEVFSSMYVGTYVAVQDLNNIKDLIKRLDTEIRGMVKNAEYA  298



>ref|XP_004972533.1| PREDICTED: UPF0496 protein 1-like [Setaria italica]
Length=378

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 137/194 (71%), Gaps = 5/194 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ +L  ALQ+F++E              Y++TL EL++FK AGDPFTE+FF+ F +
Sbjct  135  ARDSQLLLHVALQRFDDEEYAAAPSAR-----YARTLHELRQFKAAGDPFTEEFFAAFQA  189

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML K++ +K RLDKK++ +K WRR+S++IFAT F +VLICSVVAA + A PV 
Sbjct  190  VYRQQLTMLKKLQRRKHRLDKKIKTIKVWRRVSSIIFATTFAAVLICSVVAAAIAALPVA  249

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAA+VP G++ KWI+++ K Y++ L+ + E+++ +    +I I+DL+SI+ L++R+
Sbjct  250  AALAAAAAVPQGSMRKWIDSLLKGYQDALRGQEEVVSAMQVAKFIGIKDLDSIRVLINRV  309

Query  542  QEQIQGLLYNADFA  583
            + +I  ++   +FA
Sbjct  310  EVEISSMIDCVEFA  323



>gb|KHN00564.1| UPF0496 protein [Glycine soja]
Length=376

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 147/196 (75%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q I++  +  FEEE     + G + V  Y KTL ELKKFKDAGDPFTE+F+ LF S
Sbjct  133  ARENQMIVKSVVTYFEEE----VQNGAEGVT-YVKTLQELKKFKDAGDPFTEEFYLLFQS  187

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ  ML K++ +K +LDKKL+ +K+WRR+SN IF   FVSVLI SVVAA + APPVV
Sbjct  188  VYTQQASMLQKLQIRKRKLDKKLKSLKTWRRVSNAIFVAAFVSVLIFSVVAASIAAPPVV  247

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALAAA +VP+G+VGKW N+++K+YE  LK +RE+++++  G YI ++DL++I+ L+++L
Sbjct  248  TALAAALAVPIGSVGKWCNSLFKRYEKALKGQREVVSSMQIGTYISLKDLDNIRVLINKL  307

Query  542  QEQIQGLLYNADFAMQ  589
            +  ++ LL NADFA++
Sbjct  308  ELVLESLLQNADFAIK  323



>gb|KGN61767.1| hypothetical protein Csa_2G238830 [Cucumis sativus]
Length=420

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 152/196 (78%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  A+++FEE+  + ++ G +    + KTL EL+ FK +GDPFT++FF +FHS
Sbjct  178  ARDSQVMILMAVRQFEEDERE-SQMGPNQ---FDKTLRELRNFKASGDPFTDEFFRIFHS  233

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q  ML+K+++KK++LDKKL+ + +WR++S ++FA  F +VLICSVVA V+ APPV 
Sbjct  234  VYKHQTAMLEKLQQKKNKLDKKLKSISTWRKLSCMMFAATFAAVLICSVVATVIMAPPVA  293

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             AL+AA+S+PLG++GKWI+++WK YEN +K ++E++ ++  G YI I+D+++I+ LV++L
Sbjct  294  AALSAASSIPLGSMGKWIDSLWKSYENAVKGQKEVINSMQVGTYIAIKDMDNIRILVEKL  353

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+G+L  ADFA++
Sbjct  354  EIEIEGMLEKADFAIK  369



>gb|EYU37760.1| hypothetical protein MIMGU_mgv1a008357mg [Erythranthe guttata]
Length=376

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 146/194 (75%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A   Q ++  ALQ+FEEE  KI E        YSKTL ELK FKDAGDPFT+ FF +F S
Sbjct  133  ARDRQLLIHIALQQFEEEDNKIEEGKVK----YSKTLKELKNFKDAGDPFTDDFFKIFQS  188

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ  ML+K++ KK++LDKKL+ + +WR++S++IFA  F +VLICSVVAA + APPV 
Sbjct  189  VYSQQISMLEKLQLKKNKLDKKLKYIHAWRKVSSIIFAATFAAVLICSVVAAAMAAPPVA  248

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAASVPLG++G+WI+++ K YEN +K ++EI+  +  G+Y+ I+DL++I+ L+DRL
Sbjct  249  AALAAAASVPLGSMGRWIDSLLKNYENAVKGQKEIIGYMSVGSYVTIKDLDNIRVLIDRL  308

Query  542  QEQIQGLLYNADFA  583
            + +I+ LL +ADFA
Sbjct  309  EIEIESLLKSADFA  322



>ref|XP_004161622.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis sativus]
Length=421

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 152/196 (78%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  A+++FEE+  + ++ G +    + KTL EL+ FK +GDPFT++FF +FHS
Sbjct  179  ARDSQVMILMAVRQFEEDERE-SQMGPNQ---FDKTLRELRNFKASGDPFTDEFFRIFHS  234

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q  ML+K+++KK++LDKKL+ + +WR++S ++FA  F +VLICSVVA V+ APPV 
Sbjct  235  VYKHQTAMLEKLQQKKNKLDKKLKSISTWRKLSCMMFAATFAAVLICSVVATVIMAPPVA  294

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             AL+AA+S+PLG++GKWI+++WK YEN +K ++E++ ++  G YI I+D+++I+ LV++L
Sbjct  295  AALSAASSIPLGSMGKWIDSLWKSYENAVKGQKEVINSMQVGTYIAIKDMDNIRILVEKL  354

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+G+L  ADFA++
Sbjct  355  EIEIEGMLEKADFAIK  370



>ref|XP_004145340.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis sativus]
 ref|XP_004153334.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis sativus]
Length=421

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 152/196 (78%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  A+++FEE+  + ++ G +    + KTL EL+ FK +GDPFT++FF +FHS
Sbjct  179  ARDSQVMILMAVRQFEEDERE-SQMGPNQ---FDKTLRELRNFKASGDPFTDEFFRIFHS  234

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q  ML+K+++KK++LDKKL+ + +WR++S ++FA  F +VLICSVVA V+ APPV 
Sbjct  235  VYKHQTAMLEKLQQKKNKLDKKLKSISTWRKLSCMMFAATFAAVLICSVVATVIMAPPVA  294

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             AL+AA+S+PLG++GKWI+++WK YEN +K ++E++ ++  G YI I+D+++I+ LV++L
Sbjct  295  AALSAASSIPLGSMGKWIDSLWKSYENAVKGQKEVINSMQVGTYIAIKDMDNIRILVEKL  354

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+G+L  ADFA++
Sbjct  355  EIEIEGMLEKADFAIK  370



>ref|XP_010531185.1| PREDICTED: LOW QUALITY PROTEIN: UPF0496 protein At2g18630-like 
[Tarenaya hassleriana]
Length=382

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 136/195 (70%), Gaps = 17/195 (9%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FA+++FEEE  +  +        Y KTL +LK+FK+ G PFTE+FF LF  
Sbjct  137  ARRSQVIIQFAVKQFEEEDGENKK--------YVKTLEDLKRFKEEGQPFTEEFFVLFDL  188

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML+++ ++K +LDK+L+ +K+WRR+SNV+F T FVS         V  APPVV
Sbjct  189  VYRQQVSMLEELHKQKRKLDKRLKMIKTWRRVSNVVFVTCFVS---------VXAAPPVV  239

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+A A +VP+G+VGKW N +WKKYE  ++ ++EI+T+I  G YI ++D+E+I+ LV +L
Sbjct  240  AAIAGALAVPVGSVGKWCNFLWKKYEKVVRGQKEIITSIKIGTYIAVKDMENIRVLVHKL  299

Query  542  QEQIQGLLYNADFAM  586
            + +I+  L  A+FA+
Sbjct  300  EVEIESFLKKAEFAV  314



>gb|EPS58408.1| hypothetical protein M569_16405 [Genlisea aurea]
Length=406

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 135/188 (72%), Gaps = 7/188 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A H +SI+  AL  FEEE        +     YS+TL EL+KF++A DPFT +FF +F S
Sbjct  155  AGHIESIVNVALGTFEEER-------YAQNNDYSRTLDELRKFREAADPFTAEFFRVFSS  207

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY +Q   L+K++ KK ++D+KL K+K WRR+SNVIF   F SVLICSVVAA V APPVV
Sbjct  208  VYSKQVSTLEKLQLKKRKMDEKLGKLKVWRRVSNVIFVVTFASVLICSVVAAAVAAPPVV  267

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALAAAA+VPLG+ G+W++++WK  E DLK ++EI+  +  G ++VI+D++SI+  VDR 
Sbjct  268  TALAAAAAVPLGSTGRWLSSLWKNCERDLKSQKEIVNAMQIGAFVVIKDMDSIRVQVDRF  327

Query  542  QEQIQGLL  565
            Q +++ +L
Sbjct  328  QIELEAML  335



>ref|XP_010649192.1| PREDICTED: UPF0496 protein At4g34320-like [Vitis vinifera]
 ref|XP_010649193.1| PREDICTED: UPF0496 protein At4g34320-like [Vitis vinifera]
 ref|XP_010649194.1| PREDICTED: UPF0496 protein At4g34320-like [Vitis vinifera]
 ref|XP_010649195.1| PREDICTED: UPF0496 protein At4g34320-like [Vitis vinifera]
 ref|XP_010649196.1| PREDICTED: UPF0496 protein At4g34320-like [Vitis vinifera]
Length=380

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 145/197 (74%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAK-ITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFH  178
            A  SQ I++ ALQ+FEEE    + E  H       KTL EL+ FK AG PF++ FF LF 
Sbjct  134  ARDSQLIVQVALQRFEEEEKDGVGENKH------LKTLQELRNFKAAGKPFSDDFFELFQ  187

Query  179  SVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappv  358
            SVY  Q+LML+K++++K +LDKKL+ ++ WR++S ++F + FVSVLI SVVAA + APPV
Sbjct  188  SVYSGQKLMLEKLRQRKRKLDKKLKSLQGWRKVSTIVFVSAFVSVLIFSVVAAAIAAPPV  247

Query  359  vtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDR  538
            VTALA A +VP+G++GKW +++WKKYE +LK  REI++++  G+ I I+DLE I+ LV++
Sbjct  248  VTALAGALAVPIGSMGKWFDSIWKKYEKELKGRREIISSMQVGSLIAIKDLEDIRVLVEK  307

Query  539  LQEQIQGLLYNADFAMQ  589
            L+  I+ LL NADFA+Q
Sbjct  308  LEIDIESLLQNADFAIQ  324



>ref|XP_009379180.1| PREDICTED: UPF0496 protein At2g18630-like [Pyrus x bretschneideri]
Length=371

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 143/196 (73%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A ++Q I++ A+++FEEE       G D     ++TL EL+ FK AGDPFT++FF LF +
Sbjct  126  ALNTQLIIQAAVRQFEEEVG----AGADG-NGCARTLKELRAFKVAGDPFTDEFFILFQA  180

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q  M +K++ +K +LDKK + +K+WRR+SNVIF   FVSVL+ SVVAA + APP+V
Sbjct  181  VYKNQASMFEKLQLRKRKLDKKFKSMKAWRRLSNVIFVATFVSVLVFSVVAAAIAAPPLV  240

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA A +VP+G+VGKW N +W  YE  LK +REI++++  G ++ ++DL+SI+ LVD+ 
Sbjct  241  TALAGAFAVPIGSVGKWCNMLWNNYERGLKEQREIISSMQIGTFVTMKDLDSIRVLVDKF  300

Query  542  QEQIQGLLYNADFAMQ  589
            +  I+ LL+NADFA++
Sbjct  301  EIGIESLLHNADFAIR  316



>ref|XP_002884146.1| hypothetical protein ARALYDRAFT_319811 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60405.1| hypothetical protein ARALYDRAFT_319811 [Arabidopsis lyrata subsp. 
lyrata]
Length=398

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 148/195 (76%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FA+++FEEE A+I   G    + Y KTL ELK+FK AG+PFT++FF+LF  
Sbjct  138  ARRSQVIIQFAVKQFEEE-AEIPVNGDKENRKYEKTLKELKRFKVAGEPFTKEFFALFDL  196

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ +ML+++ + K +LDKKL+ +K+WRR+SN++F T FVSVLI SVVAA V APPVV
Sbjct  197  VYKQQVMMLEELHKLKKKLDKKLKNIKTWRRVSNMVFVTAFVSVLIFSVVAAAVAAPPVV  256

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+A A +VP+G+VGKW N +W KYE  ++ ++EI+T+I  G YI ++++++I  LV ++
Sbjct  257  AAIAGALAVPVGSVGKWCNTLWTKYEKVVRGQKEIITSIRIGTYISVKEMDNISILVRKV  316

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL  A+FA+
Sbjct  317  EVEIESLLKKAEFAI  331



>ref|XP_010254953.1| PREDICTED: UPF0496 protein At4g34320-like [Nelumbo nucifera]
Length=375

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 148/196 (76%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ IL  ALQ+FEEE       G +  + Y KT  ELK FK AGDPFTE+FF +F+S
Sbjct  132  ARDSQLILHVALQQFEEED------GVEGQKKYLKTSEELKNFKAAGDPFTEEFFQVFNS  185

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ LML+K+  +K +LDKKL+ VK+WR++S++IFA  F +VLICSVVAA + APPV 
Sbjct  186  VYKQQVLMLEKLMLRKRKLDKKLKSVKAWRKVSSIIFAAAFAAVLICSVVAAAMAAPPVA  245

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA S+PLG++GKW +++W+ YE  LK ++E++ ++ AG YI I+DL+SI+ LVDRL
Sbjct  246  AALAAATSIPLGSMGKWFDSLWRDYEVALKGQKEVIHSMQAGTYIAIKDLDSIRVLVDRL  305

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ L+ NADFA++
Sbjct  306  EIEIESLMQNADFALR  321



>ref|XP_006856114.1| hypothetical protein AMTR_s00059p00142910 [Amborella trichopoda]
 gb|ERN17581.1| hypothetical protein AMTR_s00059p00142910 [Amborella trichopoda]
Length=369

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 140/196 (71%), Gaps = 10/196 (5%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A   Q I++ ALQ+F E        GH     + KTL EL+ FK A  PFTE+FF+L  S
Sbjct  131  AKDGQMIIQVALQQFAEAG-----EGH-----HQKTLEELRSFKMAASPFTEEFFTLLQS  180

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ  ML K+  KKS+LDKKL+ +K WRR+S++IFA+VF +VLICSVVAA V APPV 
Sbjct  181  VYSQQVSMLKKLVAKKSKLDKKLKSIKVWRRVSSIIFASVFATVLICSVVAAAVAAPPVA  240

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA+++P+G+ GKW++++WK YE  LK ++E++ ++  G Y+ I+DL++I+ LVDRL
Sbjct  241  AALAAASAIPIGSAGKWVDSLWKNYEVALKSQKEVINSMHVGAYVAIKDLDNIRVLVDRL  300

Query  542  QEQIQGLLYNADFAMQ  589
            + +I  LL N DFA+Q
Sbjct  301  EIEIGSLLQNVDFALQ  316



>gb|EMT23432.1| hypothetical protein F775_11302 [Aegilops tauschii]
Length=311

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 145/194 (75%), Gaps = 2/194 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ +L  ALQ+F++E     +        Y++TL EL++FK AGDPF+++FF  F +
Sbjct  65   ARDSQLLLHVALQRFDDEDDNDADAA--PAARYARTLHELRQFKAAGDPFSDEFFEAFQA  122

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML+K++++K RLDKK++ +K+WRR+S+VIFA+ F +VLICSVVAA + APPV 
Sbjct  123  VYRQQLAMLEKLQQRKHRLDKKIKTIKAWRRVSSVIFASTFAAVLICSVVAAAIAAPPVA  182

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAA++P+G++GKWI+++ K Y++ ++ ++E+++ +  G +I I+DL++I+ L++R+
Sbjct  183  AALAAAAAIPIGSMGKWIDSLLKGYQDAVRGQKEVVSAMQVGTFIAIKDLDNIRVLINRV  242

Query  542  QEQIQGLLYNADFA  583
            + +I  ++   DFA
Sbjct  243  EMEISSMIDCVDFA  256



>ref|XP_009374219.1| PREDICTED: UPF0496 protein At4g34320-like [Pyrus x bretschneideri]
Length=390

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 142/196 (72%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A ++Q I++ A+++FEEE       G D     ++TL EL+ FK AGDPFT++FF LF +
Sbjct  145  ALNNQLIIQAAVKQFEEEVG----AGADG-NGCARTLKELRAFKAAGDPFTDEFFILFQA  199

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q  M +K++ +K +LDKKL+ VK+WRR+SNVIF   F+SVL+ SVVAA + APP+V
Sbjct  200  VYKNQASMFEKLQLRKRKLDKKLKSVKAWRRVSNVIFVATFISVLVFSVVAAAIAAPPLV  259

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA A +VP+G+VGKW N +W  YE  LK +REI+ ++  G ++ ++DL+SI+ LVD+ 
Sbjct  260  TALAGALAVPIGSVGKWCNMLWNNYERGLKGQREIIGSMQIGTFVTLKDLDSIRVLVDKF  319

Query  542  QEQIQGLLYNADFAMQ  589
            +  I+ LL NADFA++
Sbjct  320  EIGIESLLQNADFAIR  335



>ref|XP_010026158.1| PREDICTED: UPF0496 protein At2g18630-like [Eucalyptus grandis]
Length=370

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 134/195 (69%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            AH SQ  +R AL  FEEE  K  E      + Y+ TL  L++F++AGDPFTE+F+ +FHS
Sbjct  127  AHDSQLNIRLALVHFEEEGGKNVER-----ERYAGTLLALQRFREAGDPFTEEFWKVFHS  181

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V KQQ+ ML K++    +LDKK++  ++WRR++N IF T FVS LI SVVA  + APPVV
Sbjct  182  VLKQQKEMLPKLEACVKKLDKKVKSAQTWRRVTNAIFVTAFVSTLILSVVAVAIAAPPVV  241

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALAAA + P+G+VGKW ++ WK Y  +LK ++ ++  +  G  I I+D ++I+ LV +L
Sbjct  242  TALAAALAAPIGSVGKWCDSWWKNYRRELKGKKVLIDIMYEGTKISIEDFKTIRSLVGKL  301

Query  542  QEQIQGLLYNADFAM  586
            + +I+ ++  ADFA+
Sbjct  302  EIEIESIVQKADFAL  316



>ref|XP_010247000.1| PREDICTED: UPF0496 protein At4g34320-like [Nelumbo nucifera]
Length=375

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 146/196 (74%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ IL  ALQ+FE+E       G D  + YS+TL ELK FK A DPFTE+FF +F S
Sbjct  132  ARDSQLILHVALQQFEDED------GADGKKKYSRTLEELKNFKAAEDPFTEEFFQVFQS  185

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ LML K+  +K +LDKKL+ VK+WR++S++IFA  F +VLICSVVAA + APPV 
Sbjct  186  VYKQQVLMLQKLLLRKRKLDKKLKSVKAWRKVSSIIFAAAFAAVLICSVVAAAMAAPPVA  245

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA S+PLG++GKW + +W+ YEN LK ++E++ ++ AG YI I+DL+SI+ LVDRL
Sbjct  246  AALAAATSIPLGSMGKWFDPLWRDYENALKGQKEVINSMQAGTYIAIKDLDSIRVLVDRL  305

Query  542  QEQIQGLLYNADFAMQ  589
            + ++  L+ NADFA++
Sbjct  306  EIEMDSLMQNADFALR  321



>ref|XP_002310784.2| hypothetical protein POPTR_0007s12320g [Populus trichocarpa]
 gb|EEE91234.2| hypothetical protein POPTR_0007s12320g [Populus trichocarpa]
Length=379

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 146/197 (74%), Gaps = 5/197 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQL-YSKTLAELKKFKDAGDPFTEKFFSLFH  178
            A +SQ I++FA+++FEEE     E    +V+  + KTL  L+KFK AGDPFT +FF+LF 
Sbjct  133  AQNSQLIIQFAIKQFEEE----VEMQDGAVEKKFVKTLEGLQKFKAAGDPFTPQFFALFQ  188

Query  179  SVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappv  358
            SV +QQ  ML K++ +K +LDKK++ +K+WRR+SNV+F + FVSVLI SVVAA + APPV
Sbjct  189  SVSEQQVSMLKKLQSRKKKLDKKMKSMKTWRRVSNVLFVSAFVSVLIISVVAAAIAAPPV  248

Query  359  vtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDR  538
            +TA+A A +VP+G+VGKW N +W +YE  LK ++E++ ++  G ++ I D++SI+ LV +
Sbjct  249  LTAVAGAIAVPVGSVGKWCNMLWNRYEKALKEQKELVRSMQVGTFVTINDMDSIRVLVIK  308

Query  539  LQEQIQGLLYNADFAMQ  589
            LQ  IQ LL NADFA++
Sbjct  309  LQMGIQSLLDNADFAIR  325



>gb|EPS58393.1| hypothetical protein M569_16421 [Genlisea aurea]
Length=388

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 135/192 (70%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q  L  ALQ+ E E  K   P   S     K L ELK+FK+ G+PF E FF   HS
Sbjct  141  ARDAQIRLLVALQELEGEEGK---PWAKSQ--CCKALEELKRFKETGNPFGEDFFQCLHS  195

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V++ Q LMLDK++ KK +LD KL+ +++WRRIS++IFAT F ++LICSVVAA ++  P+ 
Sbjct  196  VHQHQMLMLDKLQRKKRKLDGKLKSIQAWRRISSIIFATTFAALLICSVVAAALSLGPIA  255

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
              L+AAAS+P+G++GKWI+++ +K E  ++ ++EI+ ++  G+Y+ ++DL+ I+ +VD+L
Sbjct  256  AGLSAAASIPIGSIGKWIDSLLRKREAAIRGQKEIVNSMKVGSYVAVKDLDGIRVMVDKL  315

Query  542  QEQIQGLLYNAD  577
            + +++ ++ +AD
Sbjct  316  EMEMEWMMRDAD  327



>gb|KCW58575.1| hypothetical protein EUGRSUZ_H01233 [Eucalyptus grandis]
Length=410

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 134/195 (69%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            AH SQ  +R AL  FEEE  K  E      + Y+ TL  L++F++AGDPFTE+F+ +FHS
Sbjct  127  AHDSQLNIRLALVHFEEEGGKNVER-----ERYAGTLLALQRFREAGDPFTEEFWKVFHS  181

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V KQQ+ ML K++    +LDKK++  ++WRR++N IF T FVS LI SVVA  + APPVV
Sbjct  182  VLKQQKEMLPKLEACVKKLDKKVKSAQTWRRVTNAIFVTAFVSTLILSVVAVAIAAPPVV  241

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALAAA + P+G+VGKW ++ WK Y  +LK ++ ++  +  G  I I+D ++I+ LV +L
Sbjct  242  TALAAALAAPIGSVGKWCDSWWKNYRRELKGKKVLIDIMYEGTKISIEDFKTIRSLVGKL  301

Query  542  QEQIQGLLYNADFAM  586
            + +I+ ++  ADFA+
Sbjct  302  EIEIESIVQKADFAL  316



>ref|XP_010690930.1| PREDICTED: UPF0496 protein At4g34320-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690931.1| PREDICTED: UPF0496 protein At4g34320-like [Beta vulgaris subsp. 
vulgaris]
Length=371

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 144/192 (75%), Gaps = 7/192 (4%)
 Frame = +2

Query  11   SQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYK  190
            SQ ++  ALQ+FE+E       G +  + Y KTL ELK FK  GDPFTE+FF +F SVYK
Sbjct  133  SQLLIMVALQQFEDED------GAEKTR-YQKTLEELKHFKAVGDPFTEEFFQIFQSVYK  185

Query  191  QQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtal  370
            QQ  ML+K++ KK++LDKKL+ V +WR++S++IF   F +VLICSVVAA + APPV  A+
Sbjct  186  QQLSMLEKLQLKKNKLDKKLKYVHAWRKVSSIIFVATFAAVLICSVVAAAMAAPPVAAAV  245

Query  371  aaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQ  550
            AAA S+P+G++G+WI+++WK YE  LK ++E+++++  G YI I+DL++I+ L+D+LQ +
Sbjct  246  AAATSIPVGSMGRWIDSLWKNYETALKGQKEVISSMQVGTYIAIKDLDNIRVLIDKLQIE  305

Query  551  IQGLLYNADFAM  586
            ++ LL  ADFA+
Sbjct  306  LESLLRTADFAI  317



>ref|XP_008775796.1| PREDICTED: UPF0496 protein 1-like isoform X3 [Phoenix dactylifera]
 ref|XP_008775797.1| PREDICTED: UPF0496 protein 1-like isoform X3 [Phoenix dactylifera]
Length=387

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 147/196 (75%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ IL  ALQ FEEE  ++ E   D  + Y +TL EL+ FK AGDPFTE+FF  F S
Sbjct  141  ARDSQLILHVALQHFEEEKEEVVE--QDCKKKYLRTLEELRHFKAAGDPFTEEFFKEFQS  198

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V++QQ  ML+K+ ++K++L+KKL+ +K+WR++SN+IFA    +++ICSV AA V APPV 
Sbjct  199  VHRQQLSMLEKLNQRKNKLNKKLKSIKTWRKVSNIIFAATVATIIICSVAAAAVAAPPVA  258

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAAS+P+G++GKWI++++K Y+  LK ++ IL+++    YIVI+DL+SI  LV+RL
Sbjct  259  AALAAAASIPVGSMGKWIDSLFKDYQEALKGQKGILSSMQVRTYIVIKDLDSIGVLVNRL  318

Query  542  QEQIQGLLYNADFAMQ  589
            ++QI  LL NADFA++
Sbjct  319  EDQINVLLENADFALR  334



>ref|XP_008775794.1| PREDICTED: UPF0496 protein 1-like isoform X1 [Phoenix dactylifera]
Length=410

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 147/196 (75%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ IL  ALQ FEEE  ++ E   D  + Y +TL EL+ FK AGDPFTE+FF  F S
Sbjct  141  ARDSQLILHVALQHFEEEKEEVVE--QDCKKKYLRTLEELRHFKAAGDPFTEEFFKEFQS  198

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V++QQ  ML+K+ ++K++L+KKL+ +K+WR++SN+IFA    +++ICSV AA V APPV 
Sbjct  199  VHRQQLSMLEKLNQRKNKLNKKLKSIKTWRKVSNIIFAATVATIIICSVAAAAVAAPPVA  258

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAAS+P+G++GKWI++++K Y+  LK ++ IL+++    YIVI+DL+SI  LV+RL
Sbjct  259  AALAAAASIPVGSMGKWIDSLFKDYQEALKGQKGILSSMQVRTYIVIKDLDSIGVLVNRL  318

Query  542  QEQIQGLLYNADFAMQ  589
            ++QI  LL NADFA++
Sbjct  319  EDQINVLLENADFALR  334



>ref|XP_008775795.1| PREDICTED: UPF0496 protein 1-like isoform X2 [Phoenix dactylifera]
Length=407

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 147/196 (75%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ IL  ALQ FEEE  ++ E   D  + Y +TL EL+ FK AGDPFTE+FF  F S
Sbjct  141  ARDSQLILHVALQHFEEEKEEVVE--QDCKKKYLRTLEELRHFKAAGDPFTEEFFKEFQS  198

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V++QQ  ML+K+ ++K++L+KKL+ +K+WR++SN+IFA    +++ICSV AA V APPV 
Sbjct  199  VHRQQLSMLEKLNQRKNKLNKKLKSIKTWRKVSNIIFAATVATIIICSVAAAAVAAPPVA  258

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAAS+P+G++GKWI++++K Y+  LK ++ IL+++    YIVI+DL+SI  LV+RL
Sbjct  259  AALAAAASIPVGSMGKWIDSLFKDYQEALKGQKGILSSMQVRTYIVIKDLDSIGVLVNRL  318

Query  542  QEQIQGLLYNADFAMQ  589
            ++QI  LL NADFA++
Sbjct  319  EDQINVLLENADFALR  334



>ref|XP_010042669.1| PREDICTED: UPF0496 protein At2g18630-like [Eucalyptus grandis]
Length=373

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 134/195 (69%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            AH SQ  +R AL  FEEE  +  E      + Y  TL  L++F++AGDPFTE+F+ +FHS
Sbjct  127  AHDSQLNIRHALVHFEEEGGENVER-----ERYVGTLLALQRFREAGDPFTEEFWMVFHS  181

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V KQQ+ ML K++    +LDKK++  ++WRR++N IF T FVS LI SVVA  + APPVV
Sbjct  182  VLKQQKEMLPKLEACMKKLDKKVKSAETWRRVTNAIFVTAFVSTLILSVVAVAIAAPPVV  241

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALAAA + P+G+VGKW ++ WK Y  +LK ++ ++  +  G  I I+DL++I+ LV +L
Sbjct  242  TALAAALAAPIGSVGKWCDSWWKNYRRELKGKKVLIDIMFEGTKISIEDLKTIRSLVGKL  301

Query  542  QEQIQGLLYNADFAM  586
            + +I+ ++  ADFA+
Sbjct  302  EIEIESIVQKADFAL  316



>ref|XP_006286139.1| hypothetical protein CARUB_v10007694mg [Capsella rubella]
 gb|EOA19037.1| hypothetical protein CARUB_v10007694mg [Capsella rubella]
Length=388

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 132/186 (71%), Gaps = 6/186 (3%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            AL++FEEES    + G+     Y KTL +LKKFKDA  PF E F  +F   YKQQ LML+
Sbjct  134  ALRQFEEESP--VQGGNG----YKKTLEKLKKFKDAERPFGEDFVDMFQIAYKQQMLMLE  187

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
            K++    +L+KKL+++++WR+++++IF   + +V IC +VAA +TA P+V  LAA A   
Sbjct  188  KLQLHNYKLEKKLKRIRTWRKLTSIIFVAAYAAVFICCIVAAAMTASPLVEVLAATAVPV  247

Query  392  lGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYN  571
             G  GKWI+++WKKYEN++K +R++++++ AG Y+ +++++ ++ L ++L  +I+ L+ +
Sbjct  248  SGIAGKWIDSLWKKYENEIKGQRDVVSSMQAGTYVAVKEMDIVRFLTEQLDNEIRNLVKS  307

Query  572  ADFAMQ  589
            A++A++
Sbjct  308  AEYAVE  313



>ref|XP_002525095.1| AT14A, putative [Ricinus communis]
 gb|EEF37222.1| AT14A, putative [Ricinus communis]
Length=390

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 146/197 (74%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSV--QLYSKTLAELKKFKDAGDPFTEKFFSLF  175
            A +SQ I++ AL++FEEE A      HD V    Y KTL EL+ FK AGDPFT++F+ LF
Sbjct  141  ARNSQLIIQVALRRFEEEVAL-----HDGVVETKYVKTLEELRNFKAAGDPFTDEFYILF  195

Query  176  HSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtapp  355
             SVY+QQ  ML K++ +K +LDKK++ +K+WRR+SNV+F + FVSVLI SVVAA + APP
Sbjct  196  QSVYRQQVSMLQKLQLRKKKLDKKMKSMKTWRRVSNVLFVSAFVSVLIFSVVAAAIAAPP  255

Query  356  vvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVD  535
            VVTALA A +VP+G+VGKW N++W  Y   LK ++E+++++  G +IVIQD+++I+ LV+
Sbjct  256  VVTALAGALAVPIGSVGKWCNSLWNGYMKALKGQKELVSSMQVGTFIVIQDMDNIRILVN  315

Query  536  RLQEQIQGLLYNADFAM  586
            +L+ +I  LL N + A+
Sbjct  316  KLEAEIDALLQNVNIAL  332



>ref|XP_008338852.1| PREDICTED: UPF0496 protein At2g18630-like [Malus domestica]
Length=374

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 141/196 (72%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A ++Q I++ A+++FEEE       G D     ++TL EL+ FK AGDPFT++FF LF +
Sbjct  129  ALNTQLIIQAAVRQFEEEVG----AGADG-NGCARTLKELRAFKAAGDPFTDEFFILFQA  183

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q  M +K++ +K +LDKK + +K+WRR+SNVIF   FVSVL+ SVVAA + APP+V
Sbjct  184  VYKNQASMFEKLQLRKRKLDKKFKSMKAWRRLSNVIFVATFVSVLVFSVVAAAIAAPPLV  243

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA A ++P+G+VGKW N +W  YE  LK +REI++++    ++ ++DL+SI+ LVD+ 
Sbjct  244  TALAGALAIPIGSVGKWCNILWNNYEKGLKGQREIISSMQIRTFVTMKDLDSIRVLVDKF  303

Query  542  QEQIQGLLYNADFAMQ  589
            +  I+ LL+N DFA++
Sbjct  304  EIGIESLLHNXDFAIR  319



>ref|XP_008660446.1| PREDICTED: UPF0496 protein 1-like [Zea mays]
Length=379

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 141/194 (73%), Gaps = 2/194 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ  LR ALQ+F++E  K ++        Y +TL EL++FK AG+PFT++FF  F +
Sbjct  133  ARDSQLPLRIALQRFDDE--KDSDAAAAPSARYVRTLHELRQFKTAGNPFTDEFFDTFDA  190

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML K+++++ RLDKK++ +++WRR+S++IFAT F +VLICS+VAAV+ APPV 
Sbjct  191  VYQQQLDMLKKLQQRQHRLDKKVKTIQAWRRVSSIIFATTFAAVLICSIVAAVIAAPPVA  250

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAA+VPLG++GKW +++ K  ++ + R+  +++ +  G  I I+DLE+I+ L+ R+
Sbjct  251  AALAAAAAVPLGSMGKWFDSLLKGCQDAVNRQEGVVSEMQFGTLIAIKDLENIKVLIKRV  310

Query  542  QEQIQGLLYNADFA  583
            +E+I  ++   +FA
Sbjct  311  EEEISSMIDCVEFA  324



>ref|XP_010026389.1| PREDICTED: UPF0496 protein 1-like [Eucalyptus grandis]
Length=365

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 121/195 (62%), Gaps = 19/195 (10%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            AH SQS +R AL  FEE+  +     +   + Y +TL EL++F++AGDPFTE+F  LFHS
Sbjct  133  AHDSQSSIRLALVHFEEKRGE-----NVGGKRYLRTLQELQRFREAGDPFTEEFSKLFHS  187

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ  M  K++  K +LDKK++  ++WR ++N IF TVFVS LI              
Sbjct  188  VYKQQGEMSQKLEACKMKLDKKVKSAQTWRWVTNAIFVTVFVSALI--------------  233

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ++ AA   P+GTVGKW ++ WK Y  +LK ++ ++  +  G  + I+DL++I+ LV  L
Sbjct  234  LSVVAALRTPIGTVGKWCDSRWKNYRRELKGKKLLIDLMNEGTKMSIEDLKTIRSLVGML  293

Query  542  QEQIQGLLYNADFAM  586
            + +I+ ++  ADF +
Sbjct  294  EIEIESIMQKADFTL  308



>ref|XP_003611921.1| hypothetical protein MTR_5g019430 [Medicago truncatula]
 gb|AES94879.1| UPF0496 plant-like protein [Medicago truncatula]
Length=380

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 132/189 (70%), Gaps = 5/189 (3%)
 Frame = +2

Query  20   ILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQE  199
            +++ A+  F+EE     E        Y KTL  LK FK+  DPFTE+F+SLF SVY QQ 
Sbjct  143  VVKSAMTCFDEEVQNGVEGST-----YVKTLKGLKDFKETEDPFTEEFYSLFQSVYTQQS  197

Query  200  LMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaa  379
             ML K+  +K  LDKKL+  K+ +R+S+VIF   FV+VLI SVVAA ++APPVVTALA A
Sbjct  198  SMLKKLLIRKQNLDKKLKSHKTLKRVSSVIFVAAFVAVLIFSVVAAAISAPPVVTALAGA  257

Query  380  asvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQG  559
             +VP+G+VGKW N+++KKYE  LK +RE+++++  G YI + D+ +I+  +++L+ +I+ 
Sbjct  258  LAVPIGSVGKWCNSLFKKYETALKGQREVISSMHVGTYIALVDMNNIRVRINQLEIKIES  317

Query  560  LLYNADFAM  586
            ++  ADFA+
Sbjct  318  MVQTADFAL  326



>ref|XP_009138584.1| PREDICTED: UPF0496 protein At4g34320-like [Brassica rapa]
Length=212

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 131/181 (72%), Gaps = 16/181 (9%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  +LQ+FE+ES  + E G+     Y KTL ELK FK+A  PF E FF     
Sbjct  29   ARDSQLLILVSLQQFEDES--LVEGGNG----YEKTLEELKNFKEAESPFDEDFF-----  77

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
                 ++ML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  78   -----KMMLEKLQHRKNKLDKKLKSIHTWRKLSSIIFVATFATVLICSVVAAGMAAPPVA  132

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA ++PLG++GKW++++WK YEN LK ++E+++++ AG Y+ ++DL++I+ L++RL
Sbjct  133  AALAAATAIPLGSMGKWVDSLWKNYENALKGQKEVISSMQAGTYVAVKDLDNIRVLIERL  192

Query  542  Q  544
            +
Sbjct  193  E  193



>ref|XP_010680904.1| PREDICTED: UPF0496 protein 1-like [Beta vulgaris subsp. vulgaris]
Length=398

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 136/193 (70%), Gaps = 7/193 (4%)
 Frame = +2

Query  20   ILRFALQKFEEE---SAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYK  190
            I++ AL++FEEE   +  ++  G      +S TL EL+ FK+AGDPF ++F ++F +VY 
Sbjct  154  IIQVALRRFEEEMRDNHGVSNAGDK----FSNTLKELRSFKEAGDPFGQEFLTIFQAVYN  209

Query  191  QQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtal  370
            QQ  ML +++ +K +LDKKL+ VK +R++ N+IF   FV V+ICSVVAA + APPV  AL
Sbjct  210  QQVQMLRRLQLRKRKLDKKLKSVKVYRKVCNIIFGAAFVGVVICSVVAAAIAAPPVAAAL  269

Query  371  aaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQ  550
            AAA S P+G +GKW N++WKKYE +LK ERE +  +  G  I ++DLE+I+ LV++L+  
Sbjct  270  AAAVSAPIGGMGKWFNSLWKKYERELKSEREWIVELQIGTCIAVKDLENIRVLVEKLEIV  329

Query  551  IQGLLYNADFAMQ  589
            I  LL NADFA++
Sbjct  330  IDSLLSNADFALK  342



>ref|XP_008352479.1| PREDICTED: UPF0496 protein At4g34320-like [Malus domestica]
 ref|XP_008352480.1| PREDICTED: UPF0496 protein At4g34320-like [Malus domestica]
 ref|XP_008361061.1| PREDICTED: UPF0496 protein At4g34320-like [Malus domestica]
 ref|XP_008361063.1| PREDICTED: UPF0496 protein At4g34320-like [Malus domestica]
 ref|XP_008361370.1| PREDICTED: UPF0496 protein At4g34320-like [Malus domestica]
 ref|XP_008361371.1| PREDICTED: UPF0496 protein At4g34320-like [Malus domestica]
Length=390

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 143/196 (73%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A ++Q I++ A+++FEEE       G D     ++TL EL+ FK AGDPFT++FF LF +
Sbjct  145  ALNNQLIIQAAVRQFEEEVGA----GADG-NGCARTLKELRAFKAAGDPFTDEFFRLFQT  199

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q  M +K++ +K +LDKKL+ VK+WRR+SNVIF   FVSVL+ SVVAA + APP+V
Sbjct  200  VYKNQASMFEKLQLRKRKLDKKLKSVKAWRRVSNVIFVATFVSVLVFSVVAAAIAAPPLV  259

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA A +VP+G+VGKW N +W  YE  LK +REI++++  G ++ ++DL+SI+ LVD+ 
Sbjct  260  TALAGALAVPIGSVGKWCNMLWNNYERGLKGQREIISSMQIGTFVTLKDLDSIRVLVDKF  319

Query  542  QEQIQGLLYNADFAMQ  589
            +  I+ LL NADFA++
Sbjct  320  EIGIESLLQNADFAIR  335



>ref|XP_006285951.1| hypothetical protein CARUB_v10007471mg [Capsella rubella]
 gb|EOA18849.1| hypothetical protein CARUB_v10007471mg [Capsella rubella]
Length=372

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 127/193 (66%), Gaps = 7/193 (4%)
 Frame = +2

Query  11   SQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYK  190
            S  ++R ALQ+F EES  + + G+     Y KTL EL KF++A  PF E F S+F ++YK
Sbjct  129  SHLLIRGALQQFNEES--LVQGGNG----YKKTLEELTKFQNAERPFGEDFLSMFQNIYK  182

Query  191  QQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtal  370
            QQ +ML+ ++ +K++LDKKL++V++WR++S++IF   + +VLIC  V A     P + A 
Sbjct  183  QQIIMLETIQVRKNKLDKKLKRVQTWRKLSSIIFVATYATVLIC-AVVAAAMFAPPLAAT  241

Query  371  aaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQ  550
               A+VP+G +GKWI++MWK YE  LK  + ++ ++     + ++DL+ I+ L+++L   
Sbjct  242  LVTAAVPMGAMGKWIDSMWKNYEKGLKGHKGVIESMEVSTTVALKDLDDIRSLIEKLDND  301

Query  551  IQGLLYNADFAMQ  589
            I+ ++  A+ A++
Sbjct  302  IKSMVKGAEDAVE  314



>ref|XP_008457897.1| PREDICTED: UPF0496 protein At2g18630-like isoform X2 [Cucumis 
melo]
Length=379

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 134/193 (69%), Gaps = 5/193 (3%)
 Frame = +2

Query  11   SQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYK  190
            SQ I++ A++KFE +     E   D+ + Y KT  ELKKF++AGDPF E+F +LF S+YK
Sbjct  138  SQFIIKLAVRKFESD-----ENNGDNGERYVKTFEELKKFQEAGDPFGEEFVTLFRSLYK  192

Query  191  QQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtal  370
            +   M  K++ +K +LDKK   +K+W+ +SNVI  T F SVLI SVVAA ++APPVV AL
Sbjct  193  EHLSMFKKLQRQKKKLDKKYTTMKTWKTVSNVILVTAFASVLIFSVVAAAMSAPPVVIAL  252

Query  371  aaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQ  550
             AA +VP+G VGKW N +W +Y N +K E+++L+++   ++I+++D E+I+ LV RL  Q
Sbjct  253  GAALAVPMGPVGKWCNTLWNRYLNSIKVEKQLLSSMEGHSFIILKDFENIRLLVRRLSIQ  312

Query  551  IQGLLYNADFAMQ  589
            +  LL NA+  ++
Sbjct  313  LGSLLQNANLGIR  325



>ref|XP_008457896.1| PREDICTED: UPF0496 protein At2g18630-like isoform X1 [Cucumis 
melo]
Length=414

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 134/193 (69%), Gaps = 5/193 (3%)
 Frame = +2

Query  11   SQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYK  190
            SQ I++ A++KFE +     E   D+ + Y KT  ELKKF++AGDPF E+F +LF S+YK
Sbjct  173  SQFIIKLAVRKFESD-----ENNGDNGERYVKTFEELKKFQEAGDPFGEEFVTLFRSLYK  227

Query  191  QQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtal  370
            +   M  K++ +K +LDKK   +K+W+ +SNVI  T F SVLI SVVAA ++APPVV AL
Sbjct  228  EHLSMFKKLQRQKKKLDKKYTTMKTWKTVSNVILVTAFASVLIFSVVAAAMSAPPVVIAL  287

Query  371  aaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQ  550
             AA +VP+G VGKW N +W +Y N +K E+++L+++   ++I+++D E+I+ LV RL  Q
Sbjct  288  GAALAVPMGPVGKWCNTLWNRYLNSIKVEKQLLSSMEGHSFIILKDFENIRLLVRRLSIQ  347

Query  551  IQGLLYNADFAMQ  589
            +  LL NA+  ++
Sbjct  348  LGSLLQNANLGIR  360



>ref|XP_003537511.1| PREDICTED: UPF0496 protein At2g18630-like isoform X1 [Glycine 
max]
 ref|XP_006590676.1| PREDICTED: UPF0496 protein At2g18630-like isoform X2 [Glycine 
max]
 gb|KHN42014.1| UPF0496 protein [Glycine soja]
Length=382

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 138/196 (70%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A     I++ A+  FEEE     E        Y KTL ELK FK+AGDPFTE+F+SLF S
Sbjct  137  ARERHVIVKSAITCFEEEVQNGVEGST-----YLKTLQELKGFKEAGDPFTEEFYSLFQS  191

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML K++ +K +LDKKL+ +K+ +R+SN IF   FVSVLI SVVAA + APPVV
Sbjct  192  VYQQQASMLKKLQIRKQKLDKKLKSLKTLKRVSNAIFVAAFVSVLIFSVVAAAIAAPPVV  251

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA A +VP+G+VGKW N+++K+YE  LK +RE++ ++  G YI + DL+ IQ  +D+L
Sbjct  252  TALAGALAVPIGSVGKWCNSLFKRYETALKGQRELIISMQVGTYITLVDLKHIQVRIDQL  311

Query  542  QEQIQGLLYNADFAMQ  589
            +  I+ +L ++DFA++
Sbjct  312  EINIESMLQSSDFALR  327



>ref|XP_010041211.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
 gb|KCW44538.1| hypothetical protein EUGRSUZ_L01953 [Eucalyptus grandis]
Length=266

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 132/196 (67%), Gaps = 8/196 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            AH++Q ++  AL  FEEE     +   DS   YS TL +L+ F+  GDP TE FF +F  
Sbjct  41   AHNAQLLIFNALHCFEEE-----DRNGDSR--YSNTLEKLRNFRKTGDPLTE-FFKIFQI  92

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            ++KQ++ M +K++ KK  +D KL+ +++W ++SN+I  T F ++LI SV+ A V A P+ 
Sbjct  93   IHKQKKSMFEKLQIKKKEIDTKLKNIQTWAKVSNMILVTTFEAILIYSVMTAAVFALPIA  152

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TAL AAA+ P+  VGKWI+++WK YE  L  +RE++T++ A  ++ + DL++++ L+D L
Sbjct  153  TALVAAAAFPMDLVGKWIDSLWKNYEKRLMEQREVITSMQASTFVALMDLDTLRILIDHL  212

Query  542  QEQIQGLLYNADFAMQ  589
            + QI+ LL+ ADF ++
Sbjct  213  EVQIKSLLHKADFVIE  228



>ref|XP_010465105.1| PREDICTED: UPF0496 protein At5g66670-like [Camelina sativa]
Length=405

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 131/196 (67%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I+R A+++FE E    T+ G    + Y+KTL EL KFK  GDPF  +F + + S
Sbjct  146  AEISQLIIRLAVKQFETE----TDVGEGKKKKYAKTLEELNKFKSLGDPFDGEFVTQYES  201

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            +Y +Q L+LD++++ K +LDKK R +K+WR +SNV+F T FV+  + SVVAA + APPV+
Sbjct  202  IYDEQILLLDELRKLKVKLDKKQRNLKTWRIVSNVVFVTAFVAAFVLSVVAAAMVAPPVL  261

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            +A+A+  + P+  VG W NNMWK YE  ++R+R +++++ +G     + + +I+  V++L
Sbjct  262  SAVASGLTTPIDVVGMWCNNMWKVYEKAVERQRGVVSSLESGAQANNELMVNIKFEVEKL  321

Query  542  QEQIQGLLYNADFAMQ  589
             E+I  +L   DFA++
Sbjct  322  SERISSILMTIDFAVE  337



>ref|XP_010432430.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=378

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 128/186 (69%), Gaps = 7/186 (4%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            A+++FE+E  ++   G+     Y KTL ELKKFKDA  PF E FF +F  VY+QQ LML+
Sbjct  148  AIRQFEDE--RLVRGGNG----YKKTLKELKKFKDAKTPFGEDFFKMFQIVYEQQMLMLE  201

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
            K++ +  RLD KL+++++WR+IS++IF   + ++LIC  V A   A P V A   +  VP
Sbjct  202  KLQIRTKRLDIKLKRIRTWRKISSIIFVATYATLLIC-SVVAAAIAAPPVAAALVSVIVP  260

Query  392  lGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYN  571
            +G++GKW++++WKKYE  +K ++++  ++  G ++ ++DL++I+ L+ +L  +I+ ++ +
Sbjct  261  MGSMGKWLHSLWKKYETAVKGQKDVFFSMQVGTFVAVKDLDNIRLLIQQLDNEIKMMVTS  320

Query  572  ADFAMQ  589
            A+ A++
Sbjct  321  AESAVE  326



>ref|XP_010447099.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=385

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 127/186 (68%), Gaps = 7/186 (4%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            A+++FEEE  ++   G+     Y KTL ELKKFKDA  PF + FF +F  VY+QQ LML+
Sbjct  155  AIRQFEEE--RLVRGGNG----YKKTLKELKKFKDAETPFGKDFFKMFQIVYEQQMLMLE  208

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
            K++ +  RLD K +++++WR+I+++IF  ++ ++LIC  V A   A   V A  A+   P
Sbjct  209  KLQIRTKRLDNKFKRIRTWRKIASIIFVAIYATLLIC-SVVAAAIAATAVAAALASTIAP  267

Query  392  lGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYN  571
            +G +GKW++++WKKYEN +K ++++  ++  G ++ ++DL+ I+ L+ +L ++I+ ++ +
Sbjct  268  MGAMGKWLHSLWKKYENAVKGQKDVFFSMQEGTFVAVKDLDYIRLLIQQLDKEIKRMVTS  327

Query  572  ADFAMQ  589
            A+ A++
Sbjct  328  AETAVE  333



>ref|XP_007202121.1| hypothetical protein PRUPE_ppa006925mg [Prunus persica]
 gb|EMJ03320.1| hypothetical protein PRUPE_ppa006925mg [Prunus persica]
Length=390

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 145/196 (74%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A ++Q I++ A+++F+EE     E G +  +   +TL EL+ FK AGDPFT++FF LF S
Sbjct  146  ALNNQLIIQAAVRQFQEE----VEAGAEGKRC-ERTLQELRAFKAAGDPFTDEFFILFQS  200

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ  M +K++ +K +LDKKL+ VK+WRR+SNVIF   FVSVL+ SVVAA + APP+V
Sbjct  201  VYKQQASMFEKLQLRKRKLDKKLKSVKAWRRVSNVIFVAGFVSVLVFSVVAAAIAAPPLV  260

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA A +VP+G++GKW N +W +YE  LK +REI++++  G Y+ ++DL++I+ LVD+ 
Sbjct  261  TALAGALAVPIGSIGKWCNLLWNRYERTLKGQREIISSMQIGTYVTMKDLDNIRVLVDKW  320

Query  542  QEQIQGLLYNADFAMQ  589
            + QI+ LL  A FA++
Sbjct  321  EIQIESLLQTAGFALR  336



>ref|XP_010026159.1| PREDICTED: UPF0496 protein 1-like [Eucalyptus grandis]
 gb|KCW58576.1| hypothetical protein EUGRSUZ_H01234 [Eucalyptus grandis]
Length=376

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 134/195 (69%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQS +R AL  FEEE  +     +   + Y +TL EL++F++AGDPFTE+F  L +S
Sbjct  130  ARDSQSSIRLALVHFEEERGE-----NVGGERYVRTLLELQRFREAGDPFTEEFSKLLYS  184

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V KQQE ML K++  K +LDKK++  ++WRR++N IF T FVS LI SVVA  + APPVV
Sbjct  185  VLKQQEEMLVKLEACKKKLDKKVKSAQTWRRVTNAIFMTAFVSTLILSVVAVAIAAPPVV  244

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA + P+GTVGKW ++ WK Y  +LK ++ ++  +  G  I I+DL++I+ LV +L
Sbjct  245  IALAAALAAPIGTVGKWCDSWWKNYRRELKGKKLLVDLMNEGTKISIEDLKTIRSLVGKL  304

Query  542  QEQIQGLLYNADFAM  586
            + +I+ ++  ADFA+
Sbjct  305  EIEIESIVQKADFAL  319



>ref|XP_004148443.1| PREDICTED: UPF0496 protein At2g18630-like [Cucumis sativus]
 ref|XP_004170692.1| PREDICTED: UPF0496 protein At2g18630-like [Cucumis sativus]
 gb|KGN62084.1| hypothetical protein Csa_2G296090 [Cucumis sativus]
Length=378

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 134/193 (69%), Gaps = 6/193 (3%)
 Frame = +2

Query  11   SQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYK  190
            SQ I++ A++KFE      ++   D+ + Y KT  +LKKF++AGDPF E+F +LF S+YK
Sbjct  138  SQFIIKLAVKKFE------SDENGDNGERYVKTFEDLKKFQEAGDPFGEEFVTLFRSLYK  191

Query  191  QQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtal  370
            +   M  K++ +K +LDKK   +++W+ +SNVI  T F SVLI SVVAA ++APPVV AL
Sbjct  192  EHLSMFKKLQHQKKKLDKKYSTMETWKTVSNVILVTAFASVLIFSVVAAAMSAPPVVIAL  251

Query  371  aaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQ  550
             AA +VP+G VGKW N +W +Y N +K E+++L+++   ++I+++D E+I+ LV RL  Q
Sbjct  252  GAALAVPMGPVGKWCNTLWNRYLNSIKVEKQLLSSMEGHSFIILKDFENIRLLVRRLSIQ  311

Query  551  IQGLLYNADFAMQ  589
            +  LL NA+  ++
Sbjct  312  LGSLLQNANLGIR  324



>ref|XP_010484606.1| PREDICTED: UPF0496 protein At5g66670-like [Camelina sativa]
Length=409

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 128/196 (65%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++R A+++FE E    T+ G      Y+KTL EL KFK  GDPF  +F + + S
Sbjct  146  AEISQLVIRLAVKQFEAE----TDVGEGKKNKYAKTLEELNKFKSLGDPFDGEFLTQYES  201

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            +Y +Q L+LD++++ K +LDKK R +K+WR +SNV+F T FV+  + SVVAA + APPV+
Sbjct  202  IYDEQILLLDELRKLKVKLDKKQRNLKTWRIVSNVVFVTAFVAAFVLSVVAAAMVAPPVL  261

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+A+  + P+  VG W NNMWK YE  ++R+R +++++  G     + + +I+  V++L
Sbjct  262  CAVASGLTTPIDIVGMWCNNMWKVYEKAVERQRAVVSSLERGTQANNELMVNIKFEVEKL  321

Query  542  QEQIQGLLYNADFAMQ  589
             E+I  +L   DFA++
Sbjct  322  SERISSILMTIDFAVE  337



>ref|XP_010444753.1| PREDICTED: UPF0496 protein At5g66675-like [Camelina sativa]
 ref|XP_010444754.1| PREDICTED: UPF0496 protein At5g66675-like [Camelina sativa]
 ref|XP_010444755.1| PREDICTED: UPF0496 protein At5g66675-like [Camelina sativa]
Length=418

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 147/202 (73%), Gaps = 8/202 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFE-EESA-----KITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKF  163
            A   Q +L+FAL++FE EES+     K  EP       Y+KTL EL KFK +GDPF   F
Sbjct  147  ARIGQMLLQFALKQFEMEESSGTNNNKSAEPR--GTNKYAKTLEELNKFKASGDPFDGDF  204

Query  164  FSLFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavv  343
            F LF SVY+QQ ++L+ + ++K +LDKKL+ +K W++ISNV+F T FVSVLI SVVAA V
Sbjct  205  FMLFESVYEQQVMLLEVLHKQKRKLDKKLKNIKHWKKISNVVFVTTFVSVLIFSVVAAAV  264

Query  344  tappvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQ  523
             APPVVTA+AAA +VP+G++GKW N++WKKYE  +K +++I+ ++  G Y+ ++D+++I+
Sbjct  265  AAPPVVTAVAAALAVPIGSIGKWCNHLWKKYETAVKGQKDIVLSMRIGAYVTMKDMDNIR  324

Query  524  RLVDRLQEQIQGLLYNADFAMQ  589
              VD+L+ +++ ++   DFA++
Sbjct  325  VHVDKLKIEMESMMQKVDFALK  346



>ref|XP_010026157.1| PREDICTED: UPF0496 protein At2g18630-like [Eucalyptus grandis]
Length=369

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 121/195 (62%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            AH SQS ++ AL   EEE  +     +   + Y +TL EL++ ++AGDPFTE+F  L+HS
Sbjct  100  AHDSQSNIQLALLHVEEERGE-----NVGGKRYVRTLQELQRLREAGDPFTEEFSELYHS  154

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V +QQ  M  K++  K +LDKK++  ++WR ++N I   VFVS LI S VA      PVV
Sbjct  155  VNEQQGEMSQKLEACKEKLDKKVKSAQTWRWVTNAISVIVFVSTLILSAVAVAKAWLPVV  214

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+ AA    +GTVGKW ++ WK Y  +LK ++ ++  +  G  I I+DL++I RLVD+L
Sbjct  215  IAITAALPTSIGTVGKWCDSWWKNYRRELKGKKLLIDLMNKGTKISIEDLKTIWRLVDKL  274

Query  542  QEQIQGLLYNADFAM  586
            + +I+  +  AD  +
Sbjct  275  KIEIESSMKKADITL  289



>ref|XP_010484602.1| PREDICTED: UPF0496 protein At5g66675 [Camelina sativa]
 ref|XP_010484603.1| PREDICTED: UPF0496 protein At5g66675 [Camelina sativa]
 ref|XP_010484604.1| PREDICTED: UPF0496 protein At5g66675 [Camelina sativa]
 ref|XP_010484605.1| PREDICTED: UPF0496 protein At5g66675 [Camelina sativa]
Length=417

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 144/200 (72%), Gaps = 4/200 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDS----VQLYSKTLAELKKFKDAGDPFTEKFFS  169
            A   Q +L+FAL++FE E +  T     +       Y+KTL EL KFK +GDPF   FF 
Sbjct  147  ARIGQMLLQFALKQFEMEESSGTNNNKSAEPRVANKYAKTLEELNKFKASGDPFDGDFFM  206

Query  170  LFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvta  349
            LF SVY+QQ ++L+ + ++K +LDKKL+ +K W++ISNV+F T FVSVLI SVVAA V A
Sbjct  207  LFESVYEQQVMLLEVLHKQKRKLDKKLKNIKHWKKISNVVFVTTFVSVLIFSVVAAAVAA  266

Query  350  ppvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRL  529
            PPVVTA+AAA +VP+G++GKW N++WKKYE  +K +++I+ ++  G Y+ ++D+++I+  
Sbjct  267  PPVVTAVAAALAVPIGSIGKWCNHLWKKYETAVKGQKDIVLSMRIGAYVTMKDMDNIRVH  326

Query  530  VDRLQEQIQGLLYNADFAMQ  589
            VD+L+ +++ ++   DFA++
Sbjct  327  VDKLKIEMESMMQKVDFALK  346



>ref|XP_011025711.1| PREDICTED: UPF0496 protein At2g18630 [Populus euphratica]
Length=379

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 147/197 (75%), Gaps = 5/197 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSV-QLYSKTLAELKKFKDAGDPFTEKFFSLFH  178
            A +SQ I++FA+++FEEE     E    +V + + KTL  L+KFK AGDPFT +FF+LFH
Sbjct  133  AQNSQLIIQFAIKQFEEE----VEMQDGAVGKKFVKTLEGLEKFKAAGDPFTPQFFALFH  188

Query  179  SVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappv  358
            SV +QQ  ML K++ +K +LDKK++ +K+WRR+SNV+F +VFVSVLI SVVAA V APPV
Sbjct  189  SVSEQQVSMLKKLQSRKKKLDKKMKSMKTWRRVSNVLFVSVFVSVLIISVVAAAVAAPPV  248

Query  359  vtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDR  538
            +TALA A +VP+G+VGKW N +W +YE  LK ++E++ ++  G ++ I D+ SI+ LV +
Sbjct  249  LTALAGAMAVPVGSVGKWCNMLWNRYEKALKEQKELVRSMQVGTFVTINDMASIRVLVIK  308

Query  539  LQEQIQGLLYNADFAMQ  589
            LQ  IQ LL NADFA++
Sbjct  309  LQMGIQSLLDNADFAIR  325



>ref|XP_008241622.1| PREDICTED: UPF0496 protein At2g18630 [Prunus mume]
Length=387

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 145/196 (74%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A ++Q I++ A+++F+EE     E G +  +   +TL EL+ FK AG+PFT++FF LF S
Sbjct  143  ALNNQLIIQAAVRQFQEE----VEAGAEG-KRCERTLQELRAFKAAGEPFTDEFFILFQS  197

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQQ  M +K++ +K +LDKKL+ VK+WRR+SNVIF   FVSVL+ SVVAA + APP+V
Sbjct  198  VYKQQASMFEKLQLRKRKLDKKLKSVKAWRRVSNVIFVAGFVSVLVFSVVAAAIAAPPLV  257

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA A +VP+G++GKW N +W +YE  LK +REI++++  G Y+ ++DL++I+ LVD+ 
Sbjct  258  TALAGALAVPIGSIGKWCNLLWNRYERTLKGQREIISSMQIGTYVTMKDLDNIRVLVDKW  317

Query  542  QEQIQGLLYNADFAMQ  589
            + QI+ LL  A FA++
Sbjct  318  EIQIESLLQTAGFALR  333



>ref|XP_009386739.1| PREDICTED: UPF0496 protein 1-like [Musa acuminata subsp. malaccensis]
Length=414

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 136/198 (69%), Gaps = 2/198 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITE--PGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLF  175
            A  S  I++FA+Q+FEEE  +  E     D    Y+ TL +L+ FK AG PFTE+F  + 
Sbjct  163  ARDSHLIIQFAIQRFEEEDKEKNEVVTEEDGKTRYTMTLEKLRHFKAAGSPFTEEFARVL  222

Query  176  HSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtapp  355
             SVY+ Q+LML+K+  +K +LD K++ + +WRR+SN+ F    V+V+ICSVVAA + APP
Sbjct  223  KSVYEHQKLMLEKLLLRKKKLDDKMKSINTWRRVSNITFVAALVAVIICSVVAASIAAPP  282

Query  356  vvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVD  535
            V  ALAAA ++P+G++GKW+N++ K  +N   RE E+LT++  G +I ++DL++I+ LVD
Sbjct  283  VAAALAAATAIPIGSMGKWVNSLLKNCQNAFGRETELLTSMQFGTFIALKDLDTIRVLVD  342

Query  536  RLQEQIQGLLYNADFAMQ  589
            +L+     LL NADFA +
Sbjct  343  KLEIHFNSLLENADFAFR  360



>ref|XP_010444756.1| PREDICTED: UPF0496 protein At5g66670-like isoform X1 [Camelina 
sativa]
Length=405

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 130/196 (66%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++R A+++FE E    T+      + Y+KTL EL KFK  GDPF  +F + + S
Sbjct  146  AEISQLVIRLAVKQFETE----TDVREGKKKKYAKTLEELNKFKSLGDPFDGEFLTQYES  201

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            +Y +Q L+LD++++ K +LDKK R +K+WR +SNV+F T FV+  + SVVAA + APPV+
Sbjct  202  IYDEQILLLDELRKLKVKLDKKQRNLKTWRIVSNVVFVTAFVAAFVLSVVAAAMVAPPVL  261

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            +A+A+  + P+  VG W NNMWK YE  ++R+R +++++ +G     + + +I+  V++L
Sbjct  262  SAVASGLTTPIDVVGMWCNNMWKVYEKAVERQRGVVSSLESGAQANNELMVNIKFEVEKL  321

Query  542  QEQIQGLLYNADFAMQ  589
             E+I  +L   DFA++
Sbjct  322  SERISSILMTIDFAVE  337



>ref|XP_010444757.1| PREDICTED: UPF0496 protein At5g66670-like isoform X2 [Camelina 
sativa]
 ref|XP_010444758.1| PREDICTED: UPF0496 protein At5g66670-like isoform X2 [Camelina 
sativa]
Length=395

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 130/196 (66%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++R A+++FE E    T+      + Y+KTL EL KFK  GDPF  +F + + S
Sbjct  136  AEISQLVIRLAVKQFETE----TDVREGKKKKYAKTLEELNKFKSLGDPFDGEFLTQYES  191

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            +Y +Q L+LD++++ K +LDKK R +K+WR +SNV+F T FV+  + SVVAA + APPV+
Sbjct  192  IYDEQILLLDELRKLKVKLDKKQRNLKTWRIVSNVVFVTAFVAAFVLSVVAAAMVAPPVL  251

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            +A+A+  + P+  VG W NNMWK YE  ++R+R +++++ +G     + + +I+  V++L
Sbjct  252  SAVASGLTTPIDVVGMWCNNMWKVYEKAVERQRGVVSSLESGAQANNELMVNIKFEVEKL  311

Query  542  QEQIQGLLYNADFAMQ  589
             E+I  +L   DFA++
Sbjct  312  SERISSILMTIDFAVE  327



>ref|XP_006279638.1| hypothetical protein CARUB_v10026516mg [Capsella rubella]
 gb|EOA12536.1| hypothetical protein CARUB_v10026516mg [Capsella rubella]
Length=405

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 125/196 (64%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I+RFA+++FE E    T+ G      Y+KTL EL KFK  GDPF  +F + + S
Sbjct  146  AEISQLIIRFAVKQFETE----TDLGVGKKNKYAKTLEELNKFKSMGDPFDGEFVTQYES  201

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            +Y +Q L+LD++++ K +LDKK R VK+WR +SNV+F T FV+  + SV AA + APPV+
Sbjct  202  IYDEQILLLDELRKVKEKLDKKQRNVKTWRIVSNVVFVTAFVAAFVLSVAAAAMVAPPVL  261

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            +A+A+  + P+  VG W NNMWKKYE  ++R+R +++++  G       + +I+  VD L
Sbjct  262  SAVASGLTTPIEVVGMWCNNMWKKYEKAVERQRGVVSSLERGAQANNVMMVNIKFEVDNL  321

Query  542  QEQIQGLLYNADFAMQ  589
              +I  +L   DF  +
Sbjct  322  SIRISSILKTVDFVAE  337



>ref|XP_009396890.1| PREDICTED: UPF0496 protein 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 141/196 (72%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FALQ+FEEE    +     +   Y +TL +L++FK AG+PFTE+F  +FHS
Sbjct  143  ARDSQLIIQFALQRFEEEDEAESREDDKTK--YIETLKKLRQFKAAGNPFTEEFSQVFHS  200

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY  Q+ ML+K+  +K +LD+KL+ VK+WR++SN+IF     + +ICS+VAA + APPV 
Sbjct  201  VYTMQQSMLEKLLLRKRKLDRKLKSVKAWRKVSNMIFVAALAAFIICSIVAAAIAAPPVA  260

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA+++P+G++GKW+ ++ K++++ L  E+E+L+ +  G  + ++DL++++ LVD+L
Sbjct  261  AALAAASAIPIGSLGKWVGSLLKRHQDALVEEKELLSWMQIGTCVALKDLDTLRLLVDKL  320

Query  542  QEQIQGLLYNADFAMQ  589
            +     +L NADFA++
Sbjct  321  EIHFNSVLENADFALR  336



>ref|XP_009396891.1| PREDICTED: UPF0496 protein 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=385

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 141/196 (72%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I++FALQ+FEEE    +     +   Y +TL +L++FK AG+PFTE+F  +FHS
Sbjct  133  ARDSQLIIQFALQRFEEEDEAESREDDKTK--YIETLKKLRQFKAAGNPFTEEFSQVFHS  190

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY  Q+ ML+K+  +K +LD+KL+ VK+WR++SN+IF     + +ICS+VAA + APPV 
Sbjct  191  VYTMQQSMLEKLLLRKRKLDRKLKSVKAWRKVSNMIFVAALAAFIICSIVAAAIAAPPVA  250

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA+++P+G++GKW+ ++ K++++ L  E+E+L+ +  G  + ++DL++++ LVD+L
Sbjct  251  AALAAASAIPIGSLGKWVGSLLKRHQDALVEEKELLSWMQIGTCVALKDLDTLRLLVDKL  310

Query  542  QEQIQGLLYNADFAMQ  589
            +     +L NADFA++
Sbjct  311  EIHFNSVLENADFALR  326



>gb|AAL58139.1|AC093093_12 hypothetical protein [Oryza sativa Japonica Group]
 gb|EEE50818.1| hypothetical protein OsJ_31216 [Oryza sativa Japonica Group]
Length=378

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 136/194 (70%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ +L  ALQ+   E          + +LY+ TL EL++FK AG+PFT++FF+ F +
Sbjct  134  ARDSQLVLHLALQRHHHEPPAAAS----ASELYASTLGELRQFKAAGEPFTDEFFAAFQT  189

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  M+ K++ +K RLD++LR V+ WRR+S ++F T F ++L+CSVVAA + APPV 
Sbjct  190  VYRQQMSMVGKLRRRKRRLDRRLRSVRVWRRVSGIVFLTSFAALLVCSVVAAAIAAPPVA  249

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAAS+P+G+ GKW++++ KKY++ L   +E+++ +  G +I I+DL+SI+ LV+ L
Sbjct  250  AALAAAASMPVGSAGKWMDSLLKKYQDALHGHKEVVSAMQVGTFIAIKDLDSIRVLVEHL  309

Query  542  QEQIQGLLYNADFA  583
            + QI  +  + +FA
Sbjct  310  EVQISSMADSVEFA  323



>sp|Q7XFE1.2|U496E_ORYSJ RecName: Full=Putative UPF0496 protein 5 [Oryza sativa Japonica 
Group]
 gb|AAP53285.2| hypothetical protein LOC_Os10g21540 [Oryza sativa Japonica Group]
Length=423

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 135/194 (70%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ +L  ALQ+   E            +LY+ TL EL++FK AG+PFT++FF+ F +
Sbjct  134  ARDSQLVLHLALQRHHHEPPAAASAS----ELYASTLGELRQFKAAGEPFTDEFFAAFQT  189

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  M+ K++ +K RLD++LR V+ WRR+S ++F T F ++L+CSVVAA + APPV 
Sbjct  190  VYRQQMSMVGKLRRRKRRLDRRLRSVRVWRRVSGIVFLTSFAALLVCSVVAAAIAAPPVA  249

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAAS+P+G+ GKW++++ KKY++ L   +E+++ +  G +I I+DL+SI+ LV+ L
Sbjct  250  AALAAAASMPVGSAGKWMDSLLKKYQDALHGHKEVVSAMQVGTFIAIKDLDSIRVLVEHL  309

Query  542  QEQIQGLLYNADFA  583
            + QI  +  + +FA
Sbjct  310  EVQISSMADSVEFA  323



>ref|XP_009103499.1| PREDICTED: UPF0496 protein At5g66670-like [Brassica rapa]
Length=385

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 133/196 (68%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A +S+ I+R+A+++FE ES    +        Y+KTL EL KFK  GDPF  +F + + S
Sbjct  136  AENSRLIIRYAVKQFEAESEDANK------NKYAKTLEELNKFKAVGDPFDGEFLTQYDS  189

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY++Q L+LD++ + +++LDKK R +K+WRR+SNV+F T FVSVL+ SV AA ++AP V+
Sbjct  190  VYEEQVLLLDELGKLRAKLDKKQRNLKTWRRLSNVVFITAFVSVLLLSVAAAALSAPIVL  249

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TA+AA  +  +  VGKW N MWKKYE  +KR+R +++T+  G  +     +SI+  VD L
Sbjct  250  TAVAAGLTPSIEVVGKWSNKMWKKYEKAVKRQRGLVSTVETGVKVNRIATDSIKLEVDNL  309

Query  542  QEQIQGLLYNADFAMQ  589
            + +++ +L   DFA++
Sbjct  310  RIRLKFILETVDFAVE  325



>ref|XP_009394364.1| PREDICTED: UPF0496 protein 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394365.1| PREDICTED: UPF0496 protein 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=396

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 145/196 (74%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A +SQ I+  ALQ+F ++  ++   G    + Y +TL EL+ FK AGDPFT++FF LF +
Sbjct  152  ARNSQLIIHIALQRFADDEQEVDVDGR---KKYVRTLDELRHFKVAGDPFTQEFFQLFQT  208

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML+K++ +K +LDKKL+++K+WR++S+++FA  F +V+ICSVVAAVV APPV 
Sbjct  209  VYRQQLSMLEKLQLRKGKLDKKLKRLKTWRKVSSIMFAAAFTAVIICSVVAAVVAAPPVA  268

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAAAS+P+   GKWI+++ K Y++ L+R++ IL ++  G  + ++DL+ IQ LVD+L
Sbjct  269  AALAAAASIPI-PAGKWIDSLLKGYQDALERQKGILNSMRVGTDLTLKDLDIIQVLVDKL  327

Query  542  QEQIQGLLYNADFAMQ  589
            + QI  LL  +DF+++
Sbjct  328  EIQIHSLLDASDFSLR  343



>ref|XP_010465078.1| PREDICTED: UPF0496 protein At5g66675-like [Camelina sativa]
 ref|XP_010465086.1| PREDICTED: UPF0496 protein At5g66675-like [Camelina sativa]
 ref|XP_010465095.1| PREDICTED: UPF0496 protein At5g66675-like [Camelina sativa]
Length=412

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 145/196 (74%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A   Q +L+FAL++FE E +  +   +++   Y+KTL  L KFK +GDPF   FF LF S
Sbjct  147  ARIGQMLLQFALKQFEMEES--SATNNNNTNKYAKTLEGLNKFKASGDPFDGDFFMLFES  204

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ ++L+ + ++K +LDKKL+ +K W++ISNV+F T FVSVLI SVVAA V APPVV
Sbjct  205  VYEQQVMLLEVLHKQKRKLDKKLKNIKHWKKISNVVFVTTFVSVLIFSVVAAAVAAPPVV  264

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TA+AAA +VP+G++GKW N++WKKYE  +K +++I+ ++  G Y+ ++D+++I+  VD+L
Sbjct  265  TAVAAALAVPIGSIGKWCNHLWKKYETAVKGQKDIVLSMRIGAYVTMKDMDNIRVHVDKL  324

Query  542  QEQIQGLLYNADFAMQ  589
            + +++ ++   DFA++
Sbjct  325  KIEMESMMQKVDFALK  340



>ref|XP_007156894.1| hypothetical protein PHAVU_002G026300g [Phaseolus vulgaris]
 ref|XP_007156895.1| hypothetical protein PHAVU_002G026300g [Phaseolus vulgaris]
 gb|ESW28888.1| hypothetical protein PHAVU_002G026300g [Phaseolus vulgaris]
 gb|ESW28889.1| hypothetical protein PHAVU_002G026300g [Phaseolus vulgaris]
Length=380

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 135/196 (69%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A     +++ A+  FEEE     E        Y KTL ELK FK+AGDPFTE F+SLF S
Sbjct  137  ARERHVMVKSAITYFEEEVQNGVEGST-----YLKTLQELKVFKEAGDPFTEDFYSLFQS  191

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  ML K++ +K +LDKKL+ +K+ +R+SN IF   FVSVLI SVVAA ++APPVV
Sbjct  192  VYQQQASMLKKLQIRKQKLDKKLKSLKTLKRVSNAIFVAAFVSVLIFSVVAAAISAPPVV  251

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TAL  A  VP+G+VGKW ++++K+YE  L  +R ++ T+   +YI + DL +I+  +D+L
Sbjct  252  TALVGALLVPMGSVGKWCDSLFKRYEKALNGQRNLIITMHDASYITLMDLNNIRVRIDQL  311

Query  542  QEQIQGLLYNADFAMQ  589
            + +I+ +L +ADFA++
Sbjct  312  EIKIESMLQSADFALR  327



>emb|CDY45250.1| BnaA07g12400D [Brassica napus]
Length=386

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 133/196 (68%), Gaps = 6/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A +S+ I+R+A+++FE ES    +        Y+KTL EL KFK  GDPF  +F + + S
Sbjct  136  AENSRLIIRYAVKQFEAESEDANK------NKYAKTLEELNKFKAVGDPFDGEFLTQYDS  189

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY++Q L+LD++ + +++LDKK R +K+WRR+SNV+F T FVSVL+ SV AA ++AP V+
Sbjct  190  VYEEQVLLLDELGKLRAKLDKKQRNLKTWRRLSNVVFITAFVSVLLLSVAAAALSAPIVL  249

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TA+AA  +  +  VGKW N MWKKYE  +KR+R +++T+  G  +     +SI+  V+ L
Sbjct  250  TAVAAGLTPSIEVVGKWSNKMWKKYEKAVKRQRGLVSTVETGVKVNRIATDSIKLEVENL  309

Query  542  QEQIQGLLYNADFAMQ  589
            + +++ +L   DFA++
Sbjct  310  RIRLKFILETVDFAVE  325



>ref|XP_003629491.1| hypothetical protein MTR_8g078100 [Medicago truncatula]
 gb|AET03967.1| UPF0496 plant-like protein [Medicago truncatula]
Length=375

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 141/196 (72%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q +++  +  FEEE     E G        KTL EL+ FKDAGDPFTE+F+ LF S
Sbjct  132  ARENQVMVKSVITYFEEEVQNGLEGGT-----CVKTLQELRNFKDAGDPFTEEFYLLFQS  186

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ  ML K++ +K +LDKKL+ +KSW+R+SN IF   FVSVLI SVVAA + APPVV
Sbjct  187  VYTQQATMLKKLQIRKRKLDKKLKSLKSWKRVSNAIFLAAFVSVLIFSVVAASIAAPPVV  246

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALAAA  VPLG+VGKW N+++K YE  +K +RE+++++  G YI ++DL++I+ L ++L
Sbjct  247  TALAAALVVPLGSVGKWCNSLFKGYEKAIKGQREVVSSMQLGTYISLKDLDNIRVLTNKL  306

Query  542  QEQIQGLLYNADFAMQ  589
            + Q++ LL NADFA++
Sbjct  307  ELQLESLLQNADFALK  322



>gb|KCW59243.1| hypothetical protein EUGRSUZ_H01920 [Eucalyptus grandis]
Length=299

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 124/195 (64%), Gaps = 6/195 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +QS ++ A+  +EEE  +     +   + Y KTL +L++ ++AG PFT +F  LF+S
Sbjct  54   ARDNQSRIQLAIMHYEEERGE-----NVGGEKYVKTLQDLQRLREAGGPFTYEFSMLFNS  108

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V++QQ  ML K++ ++ +LDK+L+  ++WRR++  IF TVF+S LI SVVA      PVV
Sbjct  109  VWEQQAEMLQKLQARE-KLDKELKSAQTWRRVTIAIFVTVFMSALILSVVAVAKAWKPVV  167

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAA    P+ T GKW ++ WKKY  + K ++E++  + AG  I I DL +I+ LV +L
Sbjct  168  IALAAGLPAPIATAGKWCDSWWKKYRRERKGKKELIDLMNAGTRISINDLVTIRLLVSKL  227

Query  542  QEQIQGLLYNADFAM  586
              +I+ +L NA F +
Sbjct  228  GTEIESILQNAGFIL  242



>emb|CDY69791.1| BnaCnng65370D [Brassica napus]
Length=420

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 128/190 (67%), Gaps = 2/190 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQL--YSKTLAELKKFKDAGDPFTEKFFSLF  175
            A  S+ I+R+A++ FE ES  I E  +++     Y+KTLAEL KFK  GDPF  +F + +
Sbjct  143  AEISKLIIRYAVKLFEAESVGIGENNNNNNNKNKYAKTLAELNKFKAMGDPFEGEFETQY  202

Query  176  HSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtapp  355
             SVY+QQ L+L++++  K++LDKK R ++ WR++SNV+FAT FVS+L+ SVVAA V AP 
Sbjct  203  ESVYEQQVLLLEELRNLKAKLDKKQRNLEIWRKLSNVVFATAFVSILVLSVVAAAVVAPQ  262

Query  356  vvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVD  535
            V+  +A+  + P+  VGKW N MW KYE  +K + E+++ + AG  +     E+I+  V+
Sbjct  263  VLIQVASGLTTPIEVVGKWCNEMWNKYEKAVKIQIELVSKVEAGAKVNNVATENIRFEVE  322

Query  536  RLQEQIQGLL  565
            +L+ +I  +L
Sbjct  323  QLRIKILFIL  332



>ref|XP_010026393.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=457

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 124/195 (64%), Gaps = 6/195 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +QS ++ A+  +EEE  +     +   + Y KTL +L++ ++AG PFT +F  LF+S
Sbjct  212  ARDNQSRIQLAIMHYEEERGE-----NVGGEKYVKTLQDLQRLREAGGPFTYEFSMLFNS  266

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V++QQ  ML K++ ++ +LDK+L+  ++WRR++  IF TVF+S LI SVVA      PVV
Sbjct  267  VWEQQAEMLQKLQARE-KLDKELKSAQTWRRVTIAIFVTVFMSALILSVVAVAKAWKPVV  325

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAA    P+ T GKW ++ WKKY  + K ++E++  + AG  I I DL +I+ LV +L
Sbjct  326  IALAAGLPAPIATAGKWCDSWWKKYRRERKGKKELIDLMNAGTRISINDLVTIRLLVSKL  385

Query  542  QEQIQGLLYNADFAM  586
              +I+ +L NA F +
Sbjct  386  GTEIESILQNAGFIL  400



>gb|EEC66800.1| hypothetical protein OsI_33205 [Oryza sativa Indica Group]
Length=383

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 135/194 (70%), Gaps = 2/194 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ +L  A+Q+   E          + +LY+ TL EL++FK AG+PFT++FF+ F +
Sbjct  137  ARDSQLVLHLAVQRHHHEPPAAAAA--SASELYASTLGELRQFKAAGEPFTDEFFAAFQT  194

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  M+ K++ +K RLD++LR V+ WRR+S ++F T F ++L+CSVVAA + APPV 
Sbjct  195  VYRQQMSMVGKLRRRKRRLDRRLRSVRVWRRVSGIVFLTAFAALLVCSVVAAAIAAPPVA  254

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALA AAS+P+G+ GKW++++ KKY++ L   +E+++ +  G +I I+DL+SI+ LV+ L
Sbjct  255  AALAPAASMPVGSAGKWMDSLLKKYQDALHGHKEVVSAMQVGTFIAIKDLDSIRVLVEHL  314

Query  542  QEQIQGLLYNADFA  583
            + QI  +  + +FA
Sbjct  315  EVQISSMADSVEFA  328



>ref|XP_010026153.1| PREDICTED: UPF0496 protein At5g66675-like [Eucalyptus grandis]
 gb|KCW58573.1| hypothetical protein EUGRSUZ_H01230 [Eucalyptus grandis]
Length=300

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 131/195 (67%), Gaps = 6/195 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +QS ++ A+  FEEE  +     +   + Y+KTL EL++F++AG PFT++F  LF+S
Sbjct  55   ARDNQSWIQLAIIHFEEERRE-----NVGGEKYAKTLQELQRFREAGGPFTDEFSMLFNS  109

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V +QQ+ ML K++ ++ +LDKK++  + WRR+ N IF T F+S LI SVVA    A P V
Sbjct  110  VCEQQKEMLQKLQARE-KLDKKVKSAQVWRRVINFIFVTAFMSALIFSVVAVGKAARPAV  168

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            + LAAA + P+GTVGKW N+  +KY   LK ++E++  + AG  I+  DLE+I+ L  +L
Sbjct  169  STLAAALATPIGTVGKWCNSWCEKYRKKLKGKKELVDLMNAGTRILNNDLETIRLLASKL  228

Query  542  QEQIQGLLYNADFAM  586
            + +I+ +L NA+FA+
Sbjct  229  KTEIESILQNANFAL  243



>sp|A2Z6C5.1|U496E_ORYSI RecName: Full=Putative UPF0496 protein 5 [Oryza sativa Indica 
Group]
Length=428

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 135/194 (70%), Gaps = 2/194 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ +L  A+Q+   E          + +LY+ TL EL++FK AG+PFT++FF+ F +
Sbjct  137  ARDSQLVLHLAVQRHHHEPPAAAA--ASASELYASTLGELRQFKAAGEPFTDEFFAAFQT  194

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ  M+ K++ +K RLD++LR V+ WRR+S ++F T F ++L+CSVVAA + APPV 
Sbjct  195  VYRQQMSMVGKLRRRKRRLDRRLRSVRVWRRVSGIVFLTAFAALLVCSVVAAAIAAPPVA  254

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALA AAS+P+G+ GKW++++ KKY++ L   +E+++ +  G +I I+DL+SI+ LV+ L
Sbjct  255  AALAPAASMPVGSAGKWMDSLLKKYQDALHGHKEVVSAMQVGTFIAIKDLDSIRVLVEHL  314

Query  542  QEQIQGLLYNADFA  583
            + QI  +  + +FA
Sbjct  315  EVQISSMADSVEFA  328



>ref|XP_010070449.1| PREDICTED: UPF0496 protein At2g18630-like [Eucalyptus grandis]
Length=350

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 129/202 (64%), Gaps = 12/202 (6%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            AH SQS ++ AL +FEEE A+  + G    + Y KTL EL++F++AGDPFTE+F +LFHS
Sbjct  101  AHDSQSSVQLALVQFEEERAE--DVGG---KRYVKTLQELQRFREAGDPFTEEFSTLFHS  155

Query  182  VYKQQELMLDKMKE-------KKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaav  340
            +YKQQE ML K++         K +LDKK++  ++WR ++  IF TVFVS  I SVV   
Sbjct  156  MYKQQEEMLQKLEACKKKLEACKKKLDKKVKSAQTWRWVTIAIFVTVFVSTFILSVVKVD  215

Query  341  vtappvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESI  520
                 VV  LAAA S P+ T GKW ++ WK ++   + ++ ++  +  G  I I+DL++I
Sbjct  216  KAWRHVVVTLAAALSGPIVTFGKWCDSWWKTHQRKREGKKNLIDLMNVGTRISIEDLKTI  275

Query  521  QRLVDRLQEQIQGLLYNADFAM  586
            + LV +++ +I  +L NAD A+
Sbjct  276  RSLVSKVETEIASILQNADLAL  297



>gb|KHN16742.1| UPF0496 protein [Glycine soja]
Length=161

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = +2

Query  170  LFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvta  349
            ++ SVY QQ LM +K++ ++S+LDKK++++ SWR++S++IF     +VLICSVVAA +  
Sbjct  1    MYQSVYNQQLLMFEKLRVRQSKLDKKVKRIYSWRKVSSMIFVATVAAVLICSVVAAAIAT  60

Query  350  ppvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRL  529
            P V  ALAA  + P+G++GKWI+++   YEN +K  +E+  ++  G Y+ I+D+E+I  L
Sbjct  61   PDVAAALAAVTATPIGSMGKWIDSLLNNYENAMKEPKEVTFSMQVGTYVAIKDMENIWVL  120

Query  530  VDRLQEQIQGLLYNADFAMQ  589
            VDRL+ +I+ LL+N +FA++
Sbjct  121  VDRLEVEIESLLHNVEFAIE  140



>gb|KHN44506.1| UPF0496 protein [Glycine soja]
Length=354

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 116/196 (59%), Gaps = 30/196 (15%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q I++  +  FEEE     + G D V  Y KTL ELKKFKDA DPFTE+F+ LF S
Sbjct  133  ARENQMIVKSVVTYFEEEG----QNGADGVT-YVKTLQELKKFKDARDPFTEEFYLLFQS  187

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY QQ  ML K++ +K +LDKKL+ +K+WRR+SN IF   FVSVLI              
Sbjct  188  VYAQQASMLQKLQIRKRKLDKKLKSLKTWRRVSNAIFVAAFVSVLI--------------  233

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
                         V   I     +YE  LK +RE+++++  G +I ++DL++I+ LV++L
Sbjct  234  ----------FSVVAASI-AAPPRYEKALKGQREVISSMQIGTFISLKDLDNIRVLVNKL  282

Query  542  QEQIQGLLYNADFAMQ  589
            +  ++ LL NADFA++
Sbjct  283  EGVLESLLQNADFAIK  298



>gb|KJB17817.1| hypothetical protein B456_003G016900 [Gossypium raimondii]
 gb|KJB17818.1| hypothetical protein B456_003G016900 [Gossypium raimondii]
Length=390

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 135/195 (69%), Gaps = 3/195 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A + Q I++ A++ F+EE     E G D  + + KTL EL++FK A  PF ++FF L   
Sbjct  134  ARNDQLIIQLAVKYFDEEVG--LEVGVDEKK-FVKTLEELRRFKAADKPFPKEFFVLLDL  190

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V KQQE ML K+  +K +LDKKL+ +K+WRR+SNV+F   FVSVLI SVVAA V+APPVV
Sbjct  191  VRKQQESMLGKLLVRKRKLDKKLKSLKTWRRVSNVLFVATFVSVLIFSVVAAAVSAPPVV  250

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA+A +VP+G+VGKW  ++WK+YE ++K +  + TT+     I I D++ I+ LV  L
Sbjct  251  TALASALTVPIGSVGKWCTSLWKRYEKEVKEQMGLTTTMELFARITIYDMDDIRVLVTNL  310

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL  ADFA+
Sbjct  311  EIKIESLLKTADFAL  325



>ref|XP_009406021.1| PREDICTED: UPF0496 protein 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009406022.1| PREDICTED: UPF0496 protein 1-like [Musa acuminata subsp. malaccensis]
Length=394

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 138/197 (70%), Gaps = 1/197 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPG-HDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFH  178
            A  S  I+ FALQ FE E+    E    D  + Y+ TL +L+ FK AG+PFTE+F  +F 
Sbjct  144  ARDSHLIIHFALQHFENENKDKGEMEIEDGKRKYAMTLEKLRHFKAAGNPFTEEFSQVFQ  203

Query  179  SVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappv  358
            SVY+QQ+LML+K+  +K +LDKKLR + +WR++SN+IF +   +V+ICSVVAA V APPV
Sbjct  204  SVYRQQQLMLEKLLLRKKKLDKKLRSINAWRKVSNIIFVSALAAVVICSVVAAAVAAPPV  263

Query  359  vtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDR  538
              ALAAA ++P+G+ GKWIN++ K Y+N L  ER+IL+++  G  I ++DL++I+ +VD 
Sbjct  264  AAALAAACTIPIGSAGKWINSLLKNYQNALGEERDILSSMQFGTCIALKDLDTIRVMVDN  323

Query  539  LQEQIQGLLYNADFAMQ  589
            L+     L  +ADFA++
Sbjct  324  LEIHFNSLSEDADFALK  340



>ref|XP_010026391.1| PREDICTED: UPF0496 protein 1-like [Eucalyptus grandis]
 gb|KCW59241.1| hypothetical protein EUGRSUZ_H01916 [Eucalyptus grandis]
Length=300

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 124/196 (63%), Gaps = 5/196 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQS +  AL  FEEE A+     +   + Y +TL EL++F++AGDPFTE+F  LF S
Sbjct  54   ARDSQSSVHLALVHFEEERAE-----NVGGRRYVRTLQELQRFREAGDPFTEEFSKLFRS  108

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            + KQQE ML K++  K +LDKK++  ++WR ++  IF  VFVS  I SVV        VV
Sbjct  109  MCKQQEEMLQKLEACKKKLDKKVKSAQTWRWVTITIFVIVFVSTFILSVVKVDKAWRHVV  168

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
              LAAA S P+ TVGKW ++ WK ++   + ++ ++  +  G  I I+DL++I+ LV ++
Sbjct  169  VTLAAALSGPIVTVGKWCDSWWKTHQRKREGKKNLIDLMNVGTRISIEDLKTIRSLVSKV  228

Query  542  QEQIQGLLYNADFAMQ  589
            + +I  +L NADFA++
Sbjct  229  ETEIASILQNADFALR  244



>ref|XP_010437628.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=356

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 117/195 (60%), Gaps = 21/195 (11%)
 Frame = +2

Query  5    HHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSV  184
            HH   ++   L++FEEES  + + G+     Y KTL +LK F DA +PF E FF++F SV
Sbjct  125  HH---LILGVLRQFEEES--LVQGGNG----YKKTLEKLKNFTDAQNPFGEDFFNMFQSV  175

Query  185  YKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvt  364
            YKQQ LML+K++ ++++LD            S++IF   + +VLIC              
Sbjct  176  YKQQMLMLEKLQLRRNKLDT----------CSSIIFVATYATVLIC--SVVAAAMSAPPV  223

Query  365  alaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQ  544
            A A AA VPLGT+GKWI+ +WK YE  LK  +++++++  G Y+ ++DL+ I+ L+  L 
Sbjct  224  APALAAPVPLGTMGKWIDLLWKNYEKALKGHKDVISSMQPGTYVAVKDLDDIRLLIQELD  283

Query  545  EQIQGLLYNADFAMQ  589
             +I+ +  + D+A++
Sbjct  284  IEIRSINKSDDYAVE  298



>gb|KCW64258.1| hypothetical protein EUGRSUZ_G01899 [Eucalyptus grandis]
Length=389

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 106/186 (57%), Gaps = 23/186 (12%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            AL  FEEE  +    G  S   YSK L EL KFK+AGDPFT++FF +F ++YKQQ+ ML 
Sbjct  171  ALHCFEEEDGE----GRCS---YSKILEELTKFKEAGDPFTKEFFEIFQTIYKQQKSML-  222

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
                         + +++WR+IS++I    F ++LI            +      AA+  
Sbjct  223  -------------KNIQTWRKISSMILVATFAAILI--YSVMTAMVASLPVMAVPAAATT  267

Query  392  lGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYN  571
            +  +GKWI+++WK YE  LKR +E++T++ A  ++ ++ L+ ++  +D L  Q++ LL  
Sbjct  268  MDAIGKWIDSLWKNYEEALKRPKEVITSMQASIFVALKVLDKMRITIDPLDVQMKSLLQK  327

Query  572  ADFAMQ  589
            ADF ++
Sbjct  328  ADFLIE  333



>ref|XP_010432428.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
 ref|XP_010432429.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=378

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 117/195 (60%), Gaps = 16/195 (8%)
 Frame = +2

Query  5    HHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSV  184
            HH   ++   L++FEEES  + + G+     Y KTL +LK F+DA +PF + FF++F SV
Sbjct  129  HH---LILGVLRQFEEES--LVQGGNG----YKKTLEKLKNFEDAQNPFGQNFFNMFQSV  179

Query  185  YKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvt  364
            Y QQ LML+K++ ++ + DKKL+        S+++F   + +VLIC              
Sbjct  180  YTQQMLMLEKLQLRRKKSDKKLK-----HNCSSIVFVATYATVLIC--SVVAAAISAPPV  232

Query  365  alaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQ  544
            A A A  VPLGT+GKWI+ +WK YE  LK  +++++++  G Y+ ++DL+ I+ L+  L 
Sbjct  233  APALAVPVPLGTMGKWIDLLWKNYEKALKGHKDVISSMQPGTYVAVKDLDDIRLLIQELD  292

Query  545  EQIQGLLYNADFAMQ  589
             +I+ +  +  +A++
Sbjct  293  IEIRSIKKSDKYAVE  307



>gb|KHG21625.1| hypothetical protein F383_27631 [Gossypium arboreum]
Length=427

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 135/195 (69%), Gaps = 3/195 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A + Q I++ A++ F+EE     E G +  + + KTL EL++FK A  PF ++FF L   
Sbjct  171  ARNDQLIIQLAVKYFDEEVG--LEVGVNEKK-FVKTLEELRRFKVADKPFPKEFFVLLDL  227

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V KQQE ML K+  +K +LDKKL+ +K+WRR+SNV+F   FVSVLI SVVAA V+APPVV
Sbjct  228  VRKQQESMLGKLLVRKRKLDKKLKSLKTWRRVSNVLFVATFVSVLIFSVVAAAVSAPPVV  287

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA+A +VP+G+VGKW  ++WK+YE ++K +  + TT+     I I D++ I+ LV  L
Sbjct  288  TALASALTVPIGSVGKWCTSLWKRYEKEVKEQMGLTTTMELFARITIYDMDDIRVLVTNL  347

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL  A+FA+
Sbjct  348  EIKIESLLKTANFAL  362



>ref|NP_201467.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9LVR4.1|U496F_ARATH RecName: Full=UPF0496 protein At5g66660 [Arabidopsis thaliana]
 dbj|BAA97272.1| At14a protein-like [Arabidopsis thaliana]
 gb|ABE65589.1| hypothetical protein At5g66660 [Arabidopsis thaliana]
 gb|AED98247.1| uncharacterized protein AT5G66660 [Arabidopsis thaliana]
Length=398

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 127/192 (66%), Gaps = 0/192 (0%)
 Frame = +2

Query  11   SQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYK  190
            SQ I+RFA+++FE ES      G    + Y+KTL EL KFK  GDPF  +  + F SVY 
Sbjct  149  SQLIIRFAVKQFEAESVDTDLGGDKKKKKYTKTLEELNKFKAMGDPFDGELVTQFDSVYD  208

Query  191  QQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtal  370
            QQ L L+++++++ +LDKK R VK+ R +SNV FAT +VSVL+ SVVA  ++APPVV A+
Sbjct  209  QQVLFLEELRKQRRKLDKKQRNVKTLRTVSNVFFATAYVSVLVLSVVATTMSAPPVVCAV  268

Query  371  aaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQ  550
            A+ ++ P+   GKW + MWKKYE  +KR+R ++ T+ +   +  + +++I+  VD L+  
Sbjct  269  ASGSTAPIEITGKWFSQMWKKYEKAVKRQRGLVLTMESRVQVNNEAMKNIRSDVDELRSW  328

Query  551  IQGLLYNADFAM  586
            +  +L   DFA+
Sbjct  329  VSSILETVDFAV  340



>gb|ABK28300.1| unknown [Arabidopsis thaliana]
Length=399

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 127/192 (66%), Gaps = 0/192 (0%)
 Frame = +2

Query  11   SQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYK  190
            SQ I+RFA+++FE ES      G    + Y+KTL EL KFK  GDPF  +  + F SVY 
Sbjct  149  SQLIIRFAVKQFEAESVDTDLGGDKKKKKYTKTLEELNKFKAMGDPFDGELVTQFDSVYD  208

Query  191  QQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtal  370
            QQ L L+++++++ +LDKK R VK+ R +SNV FAT +VSVL+ SVVA  ++APPVV A+
Sbjct  209  QQVLFLEELRKQRRKLDKKQRNVKTLRTVSNVFFATAYVSVLVLSVVATTMSAPPVVCAV  268

Query  371  aaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQ  550
            A+ ++ P+   GKW + MWKKYE  +KR+R ++ T+ +   +  + +++I+  VD L+  
Sbjct  269  ASGSTAPIEITGKWFSQMWKKYEKAVKRQRGLVLTMESRVQVNNEAMKNIRSDVDELRSW  328

Query  551  IQGLLYNADFAM  586
            +  +L   DFA+
Sbjct  329  VSSILETVDFAV  340



>ref|NP_201468.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001078809.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9LVR3.1|U496G_ARATH RecName: Full=UPF0496 protein At5g66670 [Arabidopsis thaliana]
 dbj|BAA97273.1| At14a protein-like [Arabidopsis thaliana]
 gb|AAZ52793.1| hypothetical protein At5g66670 [Arabidopsis thaliana]
 gb|AAZ52794.1| hypothetical protein At5g66670 [Arabidopsis thaliana]
 gb|ABE97199.1| hypothetical protein At5g66670 [Arabidopsis thaliana]
 gb|AED98248.1| uncharacterized protein AT5G66670 [Arabidopsis thaliana]
 gb|AED98249.1| uncharacterized protein AT5G66670 [Arabidopsis thaliana]
Length=408

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 128/195 (66%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I+RFA+++FE E+   T+ G    + Y KTL E+ KFK  GDPF  +F + + S
Sbjct  146  AEISQLIIRFAVKQFETETVD-TDLGESKKKKYVKTLEEMNKFKAMGDPFDGEFVTQYKS  204

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY +Q L+LD++++ K +L KKLR +K+WR +SNV+FAT FV+V + SVVAA + APPV+
Sbjct  205  VYDEQVLLLDELRKLKVKLGKKLRNIKTWRILSNVVFATAFVTVFVLSVVAAAMMAPPVL  264

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            +A+A+  + P+  VG W N MWK+YE  +KR+R ++ T+  G       + +I+  V+ L
Sbjct  265  SAVASGLTTPIEVVGMWCNKMWKEYEKAVKRQRGLVLTMELGVQANNVTMVNIKFEVENL  324

Query  542  QEQIQGLLYNADFAM  586
              +I  +L   +FA+
Sbjct  325  SIRISSILKTVNFAV  339



>emb|CDX72478.1| BnaC07g45000D [Brassica napus]
Length=289

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 104/141 (74%), Gaps = 6/141 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ ++  ALQ+FE+ES  + E G+     Y KTL ELK FK+A  PF E FF +F S
Sbjct  131  ARDSQLLILVALQQFEDES--LVEGGNG----YEKTLEELKNFKEAESPFDEDFFKMFQS  184

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYK Q LML+K++ +K++LDKKL+ + +WR++S++IF   F +VLICSVVAA + APPV 
Sbjct  185  VYKHQMLMLEKLQHRKNKLDKKLKSIHTWRKLSSIIFVATFATVLICSVVAAAMAAPPVA  244

Query  362  talaaaasvplGTVGKWINNM  424
             ALAAA ++PLG++GKW++++
Sbjct  245  AALAAATAIPLGSMGKWVDSL  265



>ref|XP_002865055.1| hypothetical protein ARALYDRAFT_920059 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41314.1| hypothetical protein ARALYDRAFT_920059 [Arabidopsis lyrata subsp. 
lyrata]
Length=398

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 127/185 (69%), Gaps = 0/185 (0%)
 Frame = +2

Query  11   SQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYK  190
            SQ I+RFA+++FE ES       ++  + Y+KTL EL KFK  GDPF  +F + F SVY 
Sbjct  149  SQLIIRFAVKQFETESEDTDLGENNKKKKYAKTLEELNKFKAMGDPFNGEFVTQFDSVYD  208

Query  191  QQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtal  370
            QQ L+L+++++++ +LDKK R VK+ R +SNV FAT FVSVL+ SVVA  ++APPVV+A+
Sbjct  209  QQVLLLEELRKQRKKLDKKQRNVKTLRTLSNVFFATAFVSVLVLSVVATTMSAPPVVSAV  268

Query  371  aaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQ  550
            A+ ++ P+   GKW + MWKKYE  +KR+R ++  + +   +  + +++++  VD L+ +
Sbjct  269  ASGSTAPIEITGKWFSQMWKKYERAVKRQRGLVLLMESRAQVNNEAMKNVRSEVDELRIR  328

Query  551  IQGLL  565
            +  +L
Sbjct  329  VSLIL  333



>gb|KCW44471.1| hypothetical protein EUGRSUZ_L020211, partial [Eucalyptus grandis]
Length=266

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 104/164 (63%), Gaps = 2/164 (1%)
 Frame = +2

Query  98   YSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRI  277
            YSK L EL KFK+ GDPFT +FF LF ++YK Q+ ML K+  K  +++KKL+ ++ WR+I
Sbjct  44   YSKILEELTKFKETGDPFTREFFELFQTIYKLQKSMLKKLWIKMKKIEKKLKSIQMWRKI  103

Query  278  SNVIFATVFVSVLICsvvaavvtappvvtalaaaasvplGTVGKWINNMWKKYENDLKRE  457
            S++I    F ++LI        T        A AA+  +  +GKWI+++W+  E  LKR 
Sbjct  104  SSMIPVATFAAILI--YSVTTATVASPPVVAALAAATAMDAIGKWIDSLWRNCEEALKRR  161

Query  458  REILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYNADFAMQ  589
             E++T++ A  ++ ++DL+ ++  +D L+EQ++ LL  ADF ++
Sbjct  162  EEVITSMQASIFVALKDLDKMRITIDPLEEQMKSLLQKADFPIE  205



>ref|XP_010026156.1| PREDICTED: UPF0496 protein At2g18630-like [Eucalyptus grandis]
Length=294

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 125/195 (64%), Gaps = 11/195 (6%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +QS ++ A+  FEEE A          +    TL EL++F++AGDPFT++F  LF+S
Sbjct  54   ARDNQSQIQLAIMHFEEERA----------ENVGGTLQELQRFREAGDPFTDEFSMLFNS  103

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V +QQ  ML K++ ++ +LDK+L+  ++WRR++  IF T FVS LI SVVA      PVV
Sbjct  104  VCEQQAEMLQKLQARE-KLDKELKSAQTWRRVTIAIFVTAFVSALIFSVVAVAKAWKPVV  162

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA   P+ T GKW N+  +KY   LK ++E++  + AG  I+I DL +I+ LV +L
Sbjct  163  IALAAALPAPIVTAGKWRNSWCEKYRKKLKGKKELIDLMNAGTRILINDLVTIRLLVSKL  222

Query  542  QEQIQGLLYNADFAM  586
            + +I+ ++  ADFA+
Sbjct  223  ETEIESIMQIADFAL  237



>gb|KCW58574.1| hypothetical protein EUGRSUZ_H01231 [Eucalyptus grandis]
Length=287

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 125/195 (64%), Gaps = 11/195 (6%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +QS ++ A+  FEEE A+              TL EL++F++AGDPFT++F  LF+S
Sbjct  47   ARDNQSQIQLAIMHFEEERAENV----------GGTLQELQRFREAGDPFTDEFSMLFNS  96

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V +QQ  ML K++ ++ +LDK+L+  ++WRR++  IF T FVS LI SVVA      PVV
Sbjct  97   VCEQQAEMLQKLQARE-KLDKELKSAQTWRRVTIAIFVTAFVSALIFSVVAVAKAWKPVV  155

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             ALAAA   P+ T GKW N+  +KY   LK ++E++  + AG  I+I DL +I+ LV +L
Sbjct  156  IALAAALPAPIVTAGKWRNSWCEKYRKKLKGKKELIDLMNAGTRILINDLVTIRLLVSKL  215

Query  542  QEQIQGLLYNADFAM  586
            + +I+ ++  ADFA+
Sbjct  216  ETEIESIMQIADFAL  230



>ref|XP_006283979.1| hypothetical protein CARUB_v10005102mg [Capsella rubella]
 gb|EOA16877.1| hypothetical protein CARUB_v10005102mg [Capsella rubella]
Length=365

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 115/193 (60%), Gaps = 13/193 (7%)
 Frame = +2

Query  11   SQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYK  190
            S  ++R  L + EEES ++ + G+     Y KTL +L KFKDA  P  E F +LF SVYK
Sbjct  128  SHLLIRGVLPQLEEES-QLVQGGNG----YKKTLEKLMKFKDAVSPLGEDFVNLFQSVYK  182

Query  191  QQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtal  370
            QQ LML K++       +K + + + R++S++IF   + +VLIC  V     + P V A 
Sbjct  183  QQMLMLKKLQL------RKYKHIHTLRKLSSIIFVATYATVLIC-SVVVAAMSAPPVVAA  235

Query  371  aaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQ  550
             +  SV LG +GKWI+++WK YE  LK  +++++++ AG Y V +DL  I+ L+  L  +
Sbjct  236  LSTTSVTLGIMGKWIDSLWKNYEKALKAHKDVISSMQAGTYAV-KDLYDIRFLIQELDTE  294

Query  551  IQGLLYNADFAMQ  589
            I+ +  N D+ ++
Sbjct  295  IRSINKNDDYVVE  307



>ref|XP_010451056.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=317

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 112/186 (60%), Gaps = 16/186 (9%)
 Frame = +2

Query  5    HHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSV  184
            HH   ++   L++FEEES  + + G+     Y KTL +LK F+D  +PF + FF++F SV
Sbjct  129  HH---LILGVLRQFEEES--LVQGGNG----YKKTLEKLKNFEDVQNPFGQDFFNMFQSV  179

Query  185  YKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvt  364
            Y +Q LML+K++ ++ + DKKL+        S++IF   + +VLIC              
Sbjct  180  YTRQMLMLEKLQLRRKKSDKKLK-----HNCSSIIFVATYATVLIC--SVVAAAMSAPPV  232

Query  365  alaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQ  544
            A A AA VPLGT+GKWI+ +WK YE  LK  +++++++  G Y+ ++DL+ I+ L+  L 
Sbjct  233  APALAAPVPLGTMGKWIDLLWKNYEKALKGHKDVISSMQPGTYVAVKDLDDIRLLIQELD  292

Query  545  EQIQGL  562
             +I+ +
Sbjct  293  IEIRSI  298



>gb|KJB17820.1| hypothetical protein B456_003G017100 [Gossypium raimondii]
Length=335

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A   Q I++ A++ F+EE     E G D  + + KTL EL++FK A  PF ++FF L   
Sbjct  134  AQTDQLIIQLAVKYFDEEVG--LEIGVDEKK-FVKTLEELRRFKAADKPFPKEFFVLLDL  190

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V KQQE ML K+  +K +LDKKL+ +K+WRR+SNV+F   FVSVLI SVVAA V+APPVV
Sbjct  191  VRKQQESMLGKLLVRKRKLDKKLKSLKTWRRVSNVLFVATFVSVLIFSVVAAAVSAPPVV  250

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TALA+A +VP+ +VGKW  ++WK+YE ++K +  + TT+     I I D++ ++ LV   
Sbjct  251  TALASALTVPIDSVGKWCTSLWKRYEKEVKEQMGLTTTMELFARITIYDMDDLRVLVTNS  310

Query  542  QEQIQGLLYNADFAM  586
            + +I+ LL  ADFA+
Sbjct  311  EIKIESLLKTADFAL  325



>ref|XP_010068111.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=314

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 114/186 (61%), Gaps = 9/186 (5%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            AL  FEEE  +    G  S   Y+K L EL KFK+ GDPFT +FF LF ++YK Q+ ML 
Sbjct  77   ALHCFEEEDGE----GCCS---YTKILEELTKFKETGDPFTREFFELFQTIYKLQKFMLK  129

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
            K+  KK +++KKL+ ++ WR+IS++I    F ++LI        T        A AA+  
Sbjct  130  KLWIKKKKIEKKLKSIQMWRKISSMIPVVTFAAILI--YSVTTATVASPPVVAALAAATA  187

Query  392  lGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYN  571
            +  +GKWI+++W+  E  LKR  E++T++ AG ++ ++DL+ ++  +D L+ Q++ LL  
Sbjct  188  MDAIGKWIDSLWRNCEEALKRREEVITSMQAGIFVALKDLDKMRITIDPLEVQMKSLLQK  247

Query  572  ADFAMQ  589
            ADF ++
Sbjct  248  ADFPIE  253



>ref|XP_002865054.1| hypothetical protein ARALYDRAFT_920058 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41313.1| hypothetical protein ARALYDRAFT_920058 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 128/196 (65%), Gaps = 1/196 (1%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQ I+RFA+++FE E+   T+ G    + Y KTL EL KFK  GDPF  +F + + S
Sbjct  146  AEISQLIIRFAVKQFETETVD-TDLGESKKKKYVKTLEELNKFKAMGDPFDGEFVTQYES  204

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY+QQ L+LD++++ K +L KK R +K+WR +SNV+F T FV+V + SVVAA + APPV+
Sbjct  205  VYEQQILLLDELRKLKVKLGKKQRNIKTWRILSNVVFVTAFVTVFVLSVVAAAMMAPPVL  264

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            +A+A+  + P+  VG W N MWK+YE  +KR+R ++ T+  G       + +I+  V+ L
Sbjct  265  SAVASGLTTPIEVVGTWCNKMWKEYEKAVKRQRGLVLTMELGVQANNVTMVNIKFEVENL  324

Query  542  QEQIQGLLYNADFAMQ  589
              +I  +L   DFA++
Sbjct  325  SIRISSILKTVDFAVE  340



>ref|XP_010451057.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=370

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 122/186 (66%), Gaps = 13/186 (7%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            A+++FEEES  +   G+     Y KTL ELKKFKDA  PF E FF +F    +QQ LML+
Sbjct  146  AIRQFEEES--LVRGGNG----YKKTLKELKKFKDAKTPFGEDFFKMFQ--IEQQMLMLE  197

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
            K++ +  RLD KL+++++WR I   IF   + ++LIC  V A   A P V A  A+  VP
Sbjct  198  KLQIRSKRLDIKLKRIRTWREI---IFVATYATLLIC-SVVAAAIAAPSVAAALASVIVP  253

Query  392  lGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYN  571
            +G +GKW++++WKKYE  +K ++++   +  G ++ ++DL++I+ L+ +L ++I+ ++ +
Sbjct  254  MGAMGKWLHSLWKKYEA-VKGQKDMFFWMQVGTFVAVKDLDNIRLLIQQLDKEIKRMVTS  312

Query  572  ADFAMQ  589
            A+ A++
Sbjct  313  AESAVE  318



>ref|XP_010068114.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=361

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 112/186 (60%), Gaps = 9/186 (5%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            AL  FEEE         +    YSK L EL KFK+ GDPFT +FF LF ++YK Q+ ML 
Sbjct  124  ALHCFEEEDG-------EGCWSYSKILEELTKFKETGDPFTREFFELFQTIYKLQKSMLK  176

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
            K+  KK +++KKL+ ++ WR+IS++I    F ++LI        T        A AA+  
Sbjct  177  KLWIKKKKIEKKLKSIQMWRKISSMISVATFAAILI--YSVTTATVASPPVVAALAAATA  234

Query  392  lGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYN  571
            +  +GKWI+++WK  E  LKR  E++T++ AG ++ ++DL+ ++  +D L+ Q++ LL  
Sbjct  235  MDAIGKWIDSLWKHCEEALKRREEVITSMQAGIFVALKDLDKMRITIDPLEVQMKSLLQK  294

Query  572  ADFAMQ  589
            ADF ++
Sbjct  295  ADFPIE  300



>gb|KCW62868.1| hypothetical protein EUGRSUZ_G00464 [Eucalyptus grandis]
Length=350

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 112/186 (60%), Gaps = 9/186 (5%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            AL  FEEE         +    YSK L EL KFK+ GDPFT +FF LF ++YK Q+ ML 
Sbjct  113  ALHCFEEEDG-------EGCWSYSKILEELTKFKETGDPFTREFFELFQTIYKLQKSMLK  165

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
            K+  KK +++KKL+ ++ WR+IS++I    F ++LI        T        A AA+  
Sbjct  166  KLWIKKKKIEKKLKSIQMWRKISSMISVATFAAILI--YSVTTATVASPPVVAALAAATA  223

Query  392  lGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYN  571
            +  +GKWI+++WK  E  LKR  E++T++ AG ++ ++DL+ ++  +D L+ Q++ LL  
Sbjct  224  MDAIGKWIDSLWKHCEEALKRREEVITSMQAGIFVALKDLDKMRITIDPLEVQMKSLLQK  283

Query  572  ADFAMQ  589
            ADF ++
Sbjct  284  ADFPIE  289



>ref|XP_010066381.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=361

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 114/186 (61%), Gaps = 9/186 (5%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            AL  FEEE  +    G  S   YSK L EL KFK+ GDPFT +FF LF ++YK Q+ ML 
Sbjct  124  ALHCFEEEDGE----GCCS---YSKILEELTKFKETGDPFTREFFELFQTIYKLQKSMLK  176

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
            K+  KK +++KKL+ ++ WR+IS++I    F ++LI        T        A AA+  
Sbjct  177  KLWIKKKKIEKKLKSIQMWRKISSMIPVATFAAILI--YSVTTATVASAPVVAALAAATA  234

Query  392  lGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYN  571
            +  +GKWI+++W+  E  LKR  E++T++ AG ++ ++DL+ ++  +D L+ QI+ LL  
Sbjct  235  MDAIGKWIDSLWRNCEEALKRREEVITSMQAGIFVALKDLDKMRITIDPLEVQIKSLLQK  294

Query  572  ADFAMQ  589
            ADF ++
Sbjct  295  ADFPIE  300



>gb|KCW58572.1| hypothetical protein EUGRSUZ_H01229 [Eucalyptus grandis]
Length=322

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 115/195 (59%), Gaps = 24/195 (12%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q  +R A+  FEEE  +    G +    Y KTL  L+KFK+A +PFT+++  LF S
Sbjct  99   ACDNQFWIRHAIMHFEEERGE--NVGREK---YVKTLQGLQKFKEADNPFTDEYSKLFKS  153

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VYKQ+E ML K                   R++N IF T FVS L  SV+A  + APPVV
Sbjct  154  VYKQKEEMLQK-------------------RVTNAIFVTAFVSTLNFSVIAVAIAAPPVV  194

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             AL  A   P+GTVGKW ++ WK +  +LK ++E++  + AG  I I DL +I+ L  +L
Sbjct  195  IALPTALVAPIGTVGKWCDSRWKNFRGELKGKKELIDLMNAGTRISINDLVTIRLLESKL  254

Query  542  QEQIQGLLYNADFAM  586
            + +I+ +L+NADFA+
Sbjct  255  KTEIELILHNADFAL  269



>ref|XP_010447098.1| PREDICTED: UPF0496 protein At4g34320-like [Camelina sativa]
Length=361

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 125/195 (64%), Gaps = 16/195 (8%)
 Frame = +2

Query  5    HHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSV  184
            HH   ++   L++FEEES  + + G+     Y  TL +LK F+D  +PF + FF++F SV
Sbjct  129  HH---LILGVLRQFEEES--LVQGGNG----YKTTLEKLKNFEDVQNPFGQDFFNMFQSV  179

Query  185  YKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvt  364
            Y +Q LML+K++ ++ + DKKL+        S++IF   + +VLICSVVAA ++APPV  
Sbjct  180  YTRQMLMLEKLQLRRKKSDKKLK-----HNCSSIIFVATYATVLICSVVAAAMSAPPVAP  234

Query  365  alaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQ  544
            ALAA   +  GT+GKWI+ +WK YE  LK  +++++++  G Y+ ++DL+ I+ L+  L 
Sbjct  235  ALAAPVPL--GTMGKWIDLLWKNYEKALKGHKDVISSMQPGTYVAVKDLDDIRLLIQELD  292

Query  545  EQIQGLLYNADFAMQ  589
             +I+ +  +  +A++
Sbjct  293  IEIRSIKKSDKYAVE  307



>ref|XP_010042346.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=361

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 111/186 (60%), Gaps = 9/186 (5%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            AL  FEEE         +    YSK L EL KFK+ GDPFT +FF LF ++YK Q+ ML 
Sbjct  124  ALHCFEEED-------REGCCSYSKILEELTKFKETGDPFTREFFELFQTIYKLQKFMLK  176

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
            K+  KK +++KKL+ ++ WR+IS++I    F ++LI                +A AA+  
Sbjct  177  KLWIKKKKIEKKLKSIQMWRKISSMIPVVTFAAILI--YSVTTAMVASPPVVVALAAATA  234

Query  392  lGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYN  571
            +  +GKWI+++WK  E  LKR  E++T++ A  ++ ++DL+ ++  +D L+ Q++ LL  
Sbjct  235  MDVIGKWIDSLWKNCEEALKRREEVITSMQASIFVALKDLDKMRITIDPLEVQMKSLLQK  294

Query  572  ADFAMQ  589
            ADF ++
Sbjct  295  ADFPIE  300



>gb|KCW62869.1| hypothetical protein EUGRSUZ_G00466 [Eucalyptus grandis]
Length=350

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 114/186 (61%), Gaps = 9/186 (5%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            AL  FEEE  +    G  S   YSK L EL KFK+ GDPFT++FF LF ++YK Q+ ML 
Sbjct  113  ALHYFEEEDGE----GCCS---YSKILEELTKFKENGDPFTKEFFELFQTIYKLQKFMLK  165

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
            K+  KK +++KKL+ ++ WR+IS++I    F ++LI                +A AA+  
Sbjct  166  KLWIKKKKIEKKLKSIQMWRKISSMIPVVTFAAILI--YSVTTAMVASPPVVVALAAATA  223

Query  392  lGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYN  571
            +  +GKWI+++WK  E  LKR  E++T++ A  ++ ++DL+ ++  +D L+ Q++ LL  
Sbjct  224  MDVIGKWIDSLWKHCEEALKRREEVITSMQASIFVALKDLDKMRITIDPLEVQMKSLLQK  283

Query  572  ADFAMQ  589
            ADF ++
Sbjct  284  ADFPIE  289



>ref|XP_010068116.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=361

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 114/186 (61%), Gaps = 9/186 (5%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            AL  FEEE  +    G  S   YSK L EL KFK+ GDPFT++FF LF ++YK Q+ ML 
Sbjct  124  ALHYFEEEDGE----GCCS---YSKILEELTKFKENGDPFTKEFFELFQTIYKLQKFMLK  176

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
            K+  KK +++KKL+ ++ WR+IS++I    F ++LI                +A AA+  
Sbjct  177  KLWIKKKKIEKKLKSIQMWRKISSMIPVVTFAAILI--YSVTTAMVASPPVVVALAAATA  234

Query  392  lGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYN  571
            +  +GKWI+++WK  E  LKR  E++T++ A  ++ ++DL+ ++  +D L+ Q++ LL  
Sbjct  235  MDVIGKWIDSLWKHCEEALKRREEVITSMQASIFVALKDLDKMRITIDPLEVQMKSLLQK  294

Query  572  ADFAMQ  589
            ADF ++
Sbjct  295  ADFPIE  300



>ref|XP_002869154.1| hypothetical protein ARALYDRAFT_353391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45413.1| hypothetical protein ARALYDRAFT_353391 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 111/190 (58%), Gaps = 36/190 (19%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            AL +FEEES  + + G+     Y KTL ELK+FKD   PF + F  +F SVYKQQ LML+
Sbjct  112  ALHQFEEES--LIQYGNG----YKKTLEELKRFKDTERPFDQDFIKMFQSVYKQQMLMLE  165

Query  212  KMK--EKKSRLDKKLRK--VKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaa  379
            K++  +KK+R + +      KS +           +   +C    A +            
Sbjct  166  KLQLCKKKARQEAQAHPHMAKSLQH---------HLHGYVCHYAMAPL------------  204

Query  380  asvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQG  559
                 G++GKWI+++WK YEN +K ++ +++++ AG Y+ ++DL++I+ L++RL  +I+G
Sbjct  205  -----GSMGKWIDSLWKNYENAIKGQKGVISSMQAGTYVAVKDLDNIRDLIERLDIKIRG  259

Query  560  LLYNADFAMQ  589
            ++ NA+FA++
Sbjct  260  MVKNAEFAVE  269



>gb|EPS73740.1| hypothetical protein M569_01016, partial [Genlisea aurea]
Length=240

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 73/107 (68%), Gaps = 6/107 (6%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A H +SI+  AL KF EES+     G +  + Y+ TLAELKKF+ AGDPF   FF +F+S
Sbjct  125  AAHIESIINVALHKFREESS-----GENGGK-YAGTLAELKKFRTAGDPFAGDFFKVFNS  178

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLIC  322
            V   Q  ML+++  +K +LDKKL  +K++RRIS+VIF T F +VL+C
Sbjct  179  VSSGQISMLERLNSRKRKLDKKLANLKTYRRISSVIFITAFAAVLVC  225



>gb|KCW62329.1| hypothetical protein EUGRSUZ_H04971 [Eucalyptus grandis]
Length=350

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 112/186 (60%), Gaps = 9/186 (5%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            AL  FEEE  +    G  S   Y+K L EL KFK+ GDPFT +FF LF ++YK Q+ ML 
Sbjct  113  ALHCFEEEDGE----GCCS---YTKILEELTKFKETGDPFTREFFELFQTIYKLQKFMLK  165

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
            K+  KK +++KKL+ ++ WR+IS++I    F +++I                +A AA+  
Sbjct  166  KLWIKKKKIEKKLKSIQIWRKISSMIPVVTFAAIII--YSVTTAMVASPPVVVALAAATA  223

Query  392  lGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYN  571
            +  +GKWI+++WK  E  LKR  E++T++ AG +  ++DL+ ++  +D L+ Q++ L   
Sbjct  224  MDVIGKWIDSLWKHCEEALKRREEVITSMQAGIFSALKDLDKMRITIDPLEVQMKSLFKK  283

Query  572  ADFAMQ  589
            ADF ++
Sbjct  284  ADFPIE  289



>ref|XP_007199031.1| hypothetical protein PRUPE_ppa017922mg [Prunus persica]
 gb|EMJ00230.1| hypothetical protein PRUPE_ppa017922mg [Prunus persica]
Length=243

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 7/107 (7%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  SQS +  +LQ+F EE    TE G +    YS+TL EL KFK+ GDPFT+++F +F S
Sbjct  77   ARASQSFILVSLQQFVEE----TEIGGNR---YSRTLEELNKFKEIGDPFTKEYFQIFQS  129

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLIC  322
            VY QQ LML+K+K  K++LDKKL+ + +WR++S +IF  +  +V IC
Sbjct  130  VYMQQTLMLEKLKLPKNKLDKKLKSIHAWRKVSTMIFVAIIAAVWIC  176



>ref|XP_010027373.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=361

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 112/186 (60%), Gaps = 9/186 (5%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            AL  FEEE  +    G  S   Y+K L EL KFK+ GDPFT +FF LF ++YK Q+ ML 
Sbjct  124  ALHCFEEEDGE----GCCS---YTKILEELTKFKETGDPFTREFFELFQTIYKLQKFMLK  176

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
            K+  KK +++KKL+ ++ WR+IS++I    F +++I                +A AA+  
Sbjct  177  KLWIKKKKIEKKLKSIQIWRKISSMIPVVTFAAIII--YSVTTAMVASPPVVVALAAATA  234

Query  392  lGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYN  571
            +  +GKWI+++WK  E  LKR  E++T++ AG +  ++DL+ ++  +D L+ Q++ L   
Sbjct  235  MDVIGKWIDSLWKHCEEALKRREEVITSMQAGIFSALKDLDKMRITIDPLEVQMKSLFKK  294

Query  572  ADFAMQ  589
            ADF ++
Sbjct  295  ADFPIE  300



>emb|CDY54199.1| BnaCnng26390D [Brassica napus]
Length=397

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 130/195 (67%), Gaps = 6/195 (3%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A +S+ I+R+A+++FE ES             Y+KTL EL KFK  GDPF  +  + + S
Sbjct  144  AENSRLIIRYAVKQFEAESEDAKRNK------YAKTLEELNKFKAVGDPFDGELLTQYES  197

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V ++Q+L+L+++ + +++LDKK R +K+WRR+SNV+F T FVSVL+ SV AA ++AP V+
Sbjct  198  VCEEQDLLLEELGKLRAKLDKKQRNLKTWRRLSNVVFITAFVSVLLLSVAAAALSAPIVL  257

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TA+AA  +  +  VGKW N MWKKYE  ++ +RE+++T+  G  +     +SI+  V+ L
Sbjct  258  TAVAAGLTPSIEVVGKWSNEMWKKYEKAVRGQRELVSTVETGAKVNRIATDSIRLEVENL  317

Query  542  QEQIQGLLYNADFAM  586
            + +++ +L   DFA+
Sbjct  318  RIKLKFILETVDFAV  332



>gb|KFK28345.1| hypothetical protein AALP_AA8G504100, partial [Arabis alpina]
Length=835

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 131/185 (71%), Gaps = 4/185 (2%)
 Frame = +2

Query  11   SQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYK  190
            SQ I+RFA+++FE E  +    G+     Y+KTL EL KFK  GDPF  +F + + SVY+
Sbjct  595  SQLIIRFAVKQFEAEDLE----GNKKKNKYAKTLEELNKFKAMGDPFDGEFVTPYESVYE  650

Query  191  QQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtal  370
            +Q L+L+++++ K +LDKK R VK+WR +SNV+FAT FVSVL+ SVVAA ++APPV++A+
Sbjct  651  EQVLLLEELRKLKVKLDKKQRNVKTWRILSNVVFATAFVSVLVLSVVAAAMSAPPVISAV  710

Query  371  aaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQ  550
            AA ++ P+  VGKW N+MWK+YE  +KR+R ++ +I  G  +     E+I+  VD+L+ +
Sbjct  711  AAGSTAPIEVVGKWFNDMWKEYEKAVKRQRGLVLSIEIGAKVNNVVTENIRVEVDKLRIK  770

Query  551  IQGLL  565
            I  +L
Sbjct  771  ILWIL  775



>ref|XP_010910757.1| PREDICTED: UPF0496 protein 1-like [Elaeis guineensis]
Length=376

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 110/196 (56%), Gaps = 13/196 (7%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            AH ++SI+  A+Q F+ +              +SK+L +L+ F+  GDPFT  F     S
Sbjct  135  AHEAESIVNSAIQLFDGKE-------------FSKSLEKLRDFRALGDPFTSSFIDELRS  181

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            V + Q   L  +  KK  +DKKL  VK+WR++ +V +A  F +VLICSVV A V  PP  
Sbjct  182  VCEHQRSTLVSLHGKKEEIDKKLGCVKAWRKVWSVAYAATFAAVLICSVVLAAVAVPPAA  241

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
            TA AAAAS  +G++G W + +W+  E  L+ E E++  +    +  IQ+L+ ++  V++L
Sbjct  242  TAAAAAASTAMGSIGAWFDALWENCEGVLEGEVEVIGMVRKETFFAIQELDGMRVAVEKL  301

Query  542  QEQIQGLLYNADFAMQ  589
            +  +  +    +F M+
Sbjct  302  EAMVGSMARETEFGMR  317



>ref|XP_002960974.1| hypothetical protein SELMODRAFT_402496 [Selaginella moellendorffii]
 gb|EFJ38513.1| hypothetical protein SELMODRAFT_402496 [Selaginella moellendorffii]
Length=370

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 119/194 (61%), Gaps = 7/194 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q  ++ A+     E     +P  +  Q     L EL ++ DAG+PFT++F   F +
Sbjct  124  ARENQMSIQVAINMMPSEG----DPNEEQCQ---AILKELNQYVDAGNPFTDEFMDKFQT  176

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY++Q  +  K++ KK  LD+KLR V+ W ++S +I+A    +++IC+VVAAV+T P +V
Sbjct  177  VYQKQMELQRKLQAKKKSLDRKLRYVRGWTKVSTIIYAATCAALVICAVVAAVMTVPAIV  236

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+AA +S+PL T+G+WI +   KYE +L+  R+++       ++ I+++++I+ L++ L
Sbjct  237  GAVAAVSSMPLETLGRWIKSFLTKYEKELQARRDLMREANFKTFVTIKEMDTIRALINSL  296

Query  542  QEQIQGLLYNADFA  583
            +  ++ +++   F 
Sbjct  297  RNSMESIVHCIQFG  310



>ref|XP_002960085.1| hypothetical protein SELMODRAFT_74510 [Selaginella moellendorffii]
 gb|EFJ37624.1| hypothetical protein SELMODRAFT_74510 [Selaginella moellendorffii]
Length=370

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 119/194 (61%), Gaps = 7/194 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q  ++ A+     E     +P  +  Q     L EL ++ DAG+PFT++F   F +
Sbjct  124  ARENQMSIQVAINMMPSEG----DPNEEQCQ---AILKELNQYVDAGNPFTDEFMEKFQT  176

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY++Q  +  K++ KK  LD+KLR V+ W ++S +I+A    +++IC+VVAAV+T P +V
Sbjct  177  VYQKQMELQRKLQAKKKSLDRKLRYVRGWTKVSTIIYAATCAALVICAVVAAVMTVPAIV  236

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+AA +S+PL T+G+WI +   KYE +L+  R+++       ++ I+++++I+ L++ L
Sbjct  237  GAVAAVSSMPLETLGRWIKSFLTKYEKELQARRDLMREANFKTFVTIKEMDTIRALINSL  296

Query  542  QEQIQGLLYNADFA  583
            +  ++ +++   F 
Sbjct  297  RNSMESIVHCIQFG  310



>ref|XP_002984054.1| hypothetical protein SELMODRAFT_119122 [Selaginella moellendorffii]
 gb|EFJ15066.1| hypothetical protein SELMODRAFT_119122 [Selaginella moellendorffii]
Length=370

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 119/194 (61%), Gaps = 7/194 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q  ++ A+     E     +P  +  Q     L EL ++ DAG+PFT++F   F +
Sbjct  124  ARENQMSIQVAINMMPSEG----DPNEEQCQ---AILKELNQYVDAGNPFTDEFMEKFQT  176

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY++Q  +  K++ KK  LD+KLR V+ W ++S +I+A    +++IC+VVAAV+T P +V
Sbjct  177  VYQKQMELQRKLQAKKKSLDRKLRYVRGWTKVSTIIYAATCAALVICAVVAAVMTVPAIV  236

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+AA +S+PL T+G+WI +   KYE +L+  R+++       ++ I+++++I+ L++ L
Sbjct  237  GAVAAVSSMPLETLGRWIKSFLTKYEKELQARRDLMREANFKTFVTIKEMDTIRALINSL  296

Query  542  QEQIQGLLYNADFA  583
            +  ++ +++   F 
Sbjct  297  RNSMESIVHCIQFG  310



>ref|XP_002960745.1| hypothetical protein SELMODRAFT_74185 [Selaginella moellendorffii]
 gb|EFJ38284.1| hypothetical protein SELMODRAFT_74185 [Selaginella moellendorffii]
Length=380

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 118/194 (61%), Gaps = 7/194 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q  ++ A+     E     +P  +  Q     L EL ++ DAG+PFT++F   F +
Sbjct  124  ARENQMSIQVAINMMPSEG----DPSEEQCQ---AILKELNQYVDAGNPFTDEFMEKFQT  176

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY++Q  +  K++ KK  LD+KLR V+ W ++S +I+A    +++IC+VVAAV+T P +V
Sbjct  177  VYQKQMELQRKLQAKKKSLDRKLRYVRGWTKVSTIIYAATCAALVICAVVAAVMTVPAIV  236

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+AA +S+PL T+G+WI +   KYE +L+  R+++       ++ I+++++I+ L++ L
Sbjct  237  GAVAAVSSMPLETLGRWIKSFLTKYEKELQARRDLMREANFKTFVTIKEMDTIRALINSL  296

Query  542  QEQIQGLLYNADFA  583
               ++ +++   F 
Sbjct  297  SNSMESIVHCIQFG  310



>ref|XP_010451058.1| PREDICTED: uncharacterized protein LOC104733148 [Camelina sativa]
Length=587

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 95/163 (58%), Gaps = 21/163 (13%)
 Frame = +2

Query  5    HHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSV  184
            HH   ++   L++FEEES  + + G+     Y KTL +LK F+DA +PF E FF++F SV
Sbjct  443  HH---LILGVLRQFEEES--LVQGGNG----YKKTLEKLKDFEDAQNPFGEDFFNMFQSV  493

Query  185  YKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvt  364
            YKQQ LML+K++ ++++ D            S++IF   + +VLIC              
Sbjct  494  YKQQMLMLEKLQLRRNKPDT----------CSSIIFVATYATVLIC--SVVAAAMSAPHV  541

Query  365  alaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNY  493
            A   AA VPLGT+GKWI+ +WK YE  LK  ++++T++  G Y
Sbjct  542  APGLAAPVPLGTMGKWIDLLWKNYEKALKEHKDVITSMQPGTY  584


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 6/73 (8%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  S  ++  ALQ+FE+ES  + + G+     Y KTL ELK FKDA  PF E FF +F S
Sbjct  243  ARESHLLILVALQQFEDES--LVQGGNG----YKKTLEELKNFKDAESPFNEDFFKMFQS  296

Query  182  VYKQQELMLDKMK  220
            VYKQQ +ML+K++
Sbjct  297  VYKQQMVMLEKLQ  309



>ref|XP_010068110.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=167

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = +2

Query  203  MLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaa  382
            M +K++ KK  +D KL+ +++W ++S++I  T F ++LICSVV A V A PV TAL  AA
Sbjct  1    MFEKLQIKKKEIDTKLKNLQTWAKVSSMILVTTFEAILICSVVTAAVFALPVATALVVAA  60

Query  383  svplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGL  562
            + P+  VGKWI ++WK YE  L  +RE++T++ A  ++ + DL++++ L+D L+ QI+ L
Sbjct  61   AFPMDLVGKWIESLWKNYEKRLMEQREVITSMQASTFVALTDLDTLRILIDHLEVQIKSL  120

Query  563  LYNADFAMQ  589
            L  ADFA++
Sbjct  121  LQKADFAIE  129



>ref|XP_002983926.1| hypothetical protein SELMODRAFT_119515 [Selaginella moellendorffii]
 gb|EFJ14938.1| hypothetical protein SELMODRAFT_119515 [Selaginella moellendorffii]
Length=380

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 117/194 (60%), Gaps = 7/194 (4%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q  ++ A+     E     +P  +  Q     L EL ++ DAG+PFT++F   F  
Sbjct  124  ARENQMSIQVAINMMPNEG----DPSEEQCQ---AILKELNQYVDAGNPFTDEFMEKFQI  176

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
            VY++Q  +  K++ KK  LD+KLR V+ W ++S +I+A    +++IC+VVAAV+T P +V
Sbjct  177  VYQRQMELQRKLQAKKKSLDRKLRYVRGWTKVSTIIYAATCAALVICAVVAAVMTVPAIV  236

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             A+AA +S+PL T+G+WI +   KYE +L+  R+++       ++ I+++++I+ L++ L
Sbjct  237  GAVAAVSSMPLETLGRWIKSFLTKYEKELQARRDLMREANLKTFVTIKEMDTIRALINSL  296

Query  542  QEQIQGLLYNADFA  583
               ++ +++   F 
Sbjct  297  SNSMESIVHCIQFG  310



>ref|XP_004301900.1| PREDICTED: uncharacterized protein LOC101291734 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465479.1| PREDICTED: uncharacterized protein LOC101291734 [Fragaria vesca 
subsp. vesca]
Length=969

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 121/196 (62%), Gaps = 9/196 (5%)
 Frame = +2

Query  8    HSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVY  187
            ++Q I++ A+ +FEEE     E G   V    K L EL+ FK AGDPF E+F SLF +V 
Sbjct  725  NNQLIIQAAVSRFEEEVEAGLE-GKGCV----KILQELRAFKAAGDPFREEFLSLFRAVL  779

Query  188  KQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvta  367
                 ML  ++ +K RLDKKL+ VK+WR++SNV+    FVSVLI SVVAA +TAPP+VT+
Sbjct  780  NGHASMLQILQVRKKRLDKKLKSVKAWRKVSNVLIVATFVSVLIFSVVAAAITAPPLVTS  839

Query  368  laaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGN---YIVIQDLESIQRLVDR  538
            LA A +V +G+  KW   +W  Y + L  +R  + ++  G       + DL +I+ LV++
Sbjct  840  LARALAVSVGSSEKWCKILWSYY-HTLNAQRIEINSMQLGTMDCMFTMTDLNNIRVLVEK  898

Query  539  LQEQIQGLLYNADFAM  586
             + +I+ LL  ADF +
Sbjct  899  CESEIEALLQTADFGI  914



>ref|XP_010042437.1| PREDICTED: UPF0496 protein At4g34320-like [Eucalyptus grandis]
Length=349

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 102/186 (55%), Gaps = 21/186 (11%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            AL  FEEE  +    G  S   Y+K L EL KFK+ GDPFT +FF L     K++++   
Sbjct  124  ALHCFEEEDGE----GCCS---YTKILEELTKFKETGDPFTREFFELKKLWIKKKKIE--  174

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
                      KKL+ ++ WR+IS++I    F ++LI                +A AA+  
Sbjct  175  ----------KKLKSIQMWRKISSMIPVVTFAAILI--YSVTTARVASPPVVVALAAATA  222

Query  392  lGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYN  571
            +  +GKWI+++WK  E  LKR  E++T++ AG +I ++DL+ ++  +D L+ Q++ L   
Sbjct  223  MDAIGKWIDSLWKNCEEALKRREEVITSMQAGIFIALKDLDKMRITIDPLEVQMKSLFKK  282

Query  572  ADFAMQ  589
            ADF ++
Sbjct  283  ADFPIE  288



>ref|XP_001757691.1| predicted protein [Physcomitrella patens]
 gb|EDQ77331.1| predicted protein [Physcomitrella patens]
Length=392

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 91/171 (53%), Gaps = 4/171 (2%)
 Frame = +2

Query  71   EPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLDKMKEKKSRLDKKL  250
            EP  D        L EL+ F  A +PF+E F   F +VY++   M +K++ KK +LD K+
Sbjct  161  EPTQDQC---DTVLKELQGFVRAANPFSEDFSKQFVTVYQRHLEMQNKLQAKKRKLDSKM  217

Query  251  RKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvplGTVGKWINNMWK  430
            R V+ W ++SN+I      +VL+C V+A  + AP V   LA  +  P   +G W+  + +
Sbjct  218  RSVRGWMKVSNIILGATCAAVLLCRVIADAIAAPKVAVDLAEESRKPGRGMGSWLKPLCR  277

Query  431  KYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYNADFA  583
            +YE  ++ +  I+     G ++ IQDL +I+  V+RL+     +  N  F 
Sbjct  278  RYEQ-IRAQAAIIEDASKGTFVAIQDLNNIKASVERLKNDTSAITRNIRFG  327



>ref|XP_010026155.1| PREDICTED: UPF0496 protein At2g18630-like [Eucalyptus grandis]
Length=182

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +2

Query  98   YSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRI  277
            Y KTL EL+KF++AG PFT++F  LF+SVY+QQ  ML K++ ++ +LDKK++  ++W+R+
Sbjct  16   YVKTLQELQKFREAGSPFTDEFSMLFNSVYEQQAEMLQKLQARE-KLDKKVKSAQAWKRV  74

Query  278  SNVIFATVFVSVLI  319
             N IF T FVS LI
Sbjct  75   INAIFVTAFVSALI  88



>emb|CDY33577.1| BnaC06g29750D [Brassica napus]
Length=379

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 109/189 (58%), Gaps = 2/189 (1%)
 Frame = +2

Query  20   ILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQE  199
            I+R A+Q+FE+ES   TE G +  + Y++TL EL K K  GDPF ++F     SV  +  
Sbjct  136  IIRIAIQQFEKESMD-TEIGRNKKK-YAETLEELNKVKARGDPFGDEFKDQLKSVRAEHL  193

Query  200  LMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaa  379
             +L+K+ E+  +LDK+  K+K  RR++ + F+T+ +S L   + + +V  PP+V   A  
Sbjct  194  KILEKVHEQVMKLDKQQGKLKRRRRLTTIFFSTMVLSFLAVEICSNIVGVPPLVQGTAFG  253

Query  380  asvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQG  559
             ++ +  +G ++N M K  E DL R++E++  +     + IQ   +I  LV++L   +  
Sbjct  254  LNLLMTPLGLYLNEMMKNREKDLDRQKEVVNIMEKNTNVNIQWTNTINSLVEKLTTSLSL  313

Query  560  LLYNADFAM  586
            +L + + A+
Sbjct  314  ILGSMELAV  322



>gb|KCW64260.1| hypothetical protein EUGRSUZ_G019022, partial [Eucalyptus grandis]
Length=253

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 89/149 (60%), Gaps = 9/149 (6%)
 Frame = +2

Query  32   ALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLD  211
            AL  FEEE  +    G  S   YSK L EL KFK+ GDPFT +FF LF ++YK Q+ ML 
Sbjct  113  ALHCFEEEDGE----GCCS---YSKILEELTKFKETGDPFTREFFELFQTIYKLQKSMLK  165

Query  212  KMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvp  391
            K+  KK +++KKL+ ++ WR+IS++I    F ++LI        T        A AA+  
Sbjct  166  KLWIKKKKIEKKLKSIQMWRKISSMIPVATFAAILI--YSVTTATVASAPVVAALAAATA  223

Query  392  lGTVGKWINNMWKKYENDLKREREILTTI  478
            +  +GKWI+++W+  E  LKR  E++T++
Sbjct  224  MDAIGKWIDSLWRNCEEALKRREEVITSM  252



>ref|XP_010026392.1| PREDICTED: uncharacterized protein LOC104416741 [Eucalyptus grandis]
Length=711

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 97/163 (60%), Gaps = 7/163 (4%)
 Frame = +2

Query  98   YSKTLAELKKFKDAGDPFTEKFFSLFHSVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRI  277
            Y KT  EL+KFK+A D F  +    F+ VY QQ+ +  +++    +LDKKL+  K W+R+
Sbjct  107  YVKTRQELQKFKNASDLFMNELSKPFNLVYNQQKKLCKELQAFAKKLDKKLKSTKVWKRV  166

Query  278  SNVIFATVFVSVLICsvvaavvtappvvtalaaaasvplGTVGKWINNMWKKYENDLKRE  457
            +N IF T FV+ LI SVVA  + A P VTALAA  + P+GTVGK  +  WK     L+++
Sbjct  167  TNAIFLTAFVATLIFSVVAVAINASPFVTALAAGLAAPIGTVGKSCDTWWKNCHAKLEKK  226

Query  458  REILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYNADFAM  586
            +E++  +     I I +L+ I  L+++L+        NA+F +
Sbjct  227  KELIDMMNMRTLISIVELKRIWSLLNQLKT-------NANFTL  262


 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 99/198 (50%), Gaps = 25/198 (13%)
 Frame = +2

Query  5    HHSQSILRFALQ--KFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFH  178
            +H   IL F  +  +F EE  K     +   + Y +TL EL++F++ GDPFTE+F  LFH
Sbjct  406  NHCLQILDFYTRGDRFPEERGK-----NVGGKRYVRTLQELQRFREVGDPFTEEFSKLFH  460

Query  179  SVYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVS--VLICsvvaavvtap  352
            SVYKQQ             + +KL   K        I   + +     IC          
Sbjct  461  SVYKQQ-----------GEMSQKLEACKKKLDKKVKICTNLEMGDQCHIC-----YRLRV  504

Query  353  pvvtalaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLV  532
             ++ ++ AA    +GTVGKW ++ WK Y  +LK ++ ++  +  G    I+DL++I  L+
Sbjct  505  RLILSVVAALRTSIGTVGKWCDSWWKNYRRELKGKKLLIDLMNEGTKSSIEDLKTIWSLL  564

Query  533  DRLQEQIQGLLYNADFAM  586
             +L+ +I+ ++  ADF +
Sbjct  565  GKLEVEIESIMQKADFTL  582



>ref|XP_010026152.1| PREDICTED: UPF0496 protein At2g18630-like [Eucalyptus grandis]
Length=303

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 101/195 (52%), Gaps = 43/195 (22%)
 Frame = +2

Query  2    AHHSQSILRFALQKFEEESAKITEPGHDSVQLYSKTLAELKKFKDAGDPFTEKFFSLFHS  181
            A  +Q  +R A+  FEEE  +    G +    Y KTL  L+KFK+A +PFT++       
Sbjct  99   ACDNQFWIRHAIMHFEEERGE--NVGREK---YVKTLQGLQKFKEADNPFTDE-------  146

Query  182  VYKQQELMLDKMKEKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvv  361
                                           ++N IF T FVS L  SV+A  + APPVV
Sbjct  147  -------------------------------VTNAIFVTAFVSTLNFSVIAVAIAAPPVV  175

Query  362  talaaaasvplGTVGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRL  541
             AL  A   P+GTVGKW ++ WK +  +LK ++E++  + AG  I I DL +I+ L  +L
Sbjct  176  IALPTALVAPIGTVGKWCDSRWKNFRGELKGKKELIDLMNAGTRISINDLVTIRLLESKL  235

Query  542  QEQIQGLLYNADFAM  586
            + +I+ +L+NADFA+
Sbjct  236  KTEIELILHNADFAL  250



>ref|XP_009394362.1| PREDICTED: long chain base biosynthesis protein 2d-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=651

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 59/123 (48%), Positives = 94/123 (76%), Gaps = 2/123 (2%)
 Frame = +2

Query  221  EKKSRLDKKLRKVKSWRRISNVIFATVFVSVLICsvvaavvtappvvtalaaaasvplGT  400
            EK + +DK L+++K+WR++S+++FA  F +V+ICSVVAAVV APPV  ALAAAAS+P+  
Sbjct  478  EKTAAVDK-LKRLKTWRKVSSIMFAAAFTAVIICSVVAAVVAAPPVAAALAAAASIPI-P  535

Query  401  VGKWINNMWKKYENDLKREREILTTIGAGNYIVIQDLESIQRLVDRLQEQIQGLLYNADF  580
             GKWI+++ K Y++ L+R++ IL ++  G  + ++DL+ IQ LVD+L+ QI  LL  +DF
Sbjct  536  AGKWIDSLLKGYQDALERQKGILNSMRVGTDLTLKDLDIIQVLVDKLEIQIHSLLDASDF  595

Query  581  AMQ  589
            +++
Sbjct  596  SLR  598



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925