BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP002C03 641 bp,

Length=606
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011095244.1|  PREDICTED: NAC transcription factor 25-like        103   1e-22   Sesamum indicum [beniseed]
ref|XP_009769986.1|  PREDICTED: NAC transcription factor 25             101   6e-22   Nicotiana sylvestris
emb|CDP05873.1|  unnamed protein product                                100   7e-22   Coffea canephora [robusta coffee]
ref|XP_009594217.1|  PREDICTED: NAC transcription factor 25-like        100   1e-21   Nicotiana tomentosiformis
emb|CBI20351.3|  unnamed protein product                              90.5    3e-18   Vitis vinifera
ref|XP_009759753.1|  PREDICTED: NAC transcription factor 25-like      89.4    7e-18   Nicotiana sylvestris
ref|XP_002532683.1|  NAC domain-containing protein, putative          88.6    2e-17   Ricinus communis
ref|XP_010644222.1|  PREDICTED: NAC transcription factor 25 isofo...  88.2    2e-17   Vitis vinifera
ref|XP_002284654.2|  PREDICTED: NAC transcription factor 25 isofo...  88.2    2e-17   Vitis vinifera
ref|XP_007149615.1|  hypothetical protein PHAVU_005G084600g           88.2    3e-17   Phaseolus vulgaris [French bean]
ref|XP_007021327.1|  NAC domain protein, IPR003441                    87.8    3e-17   Theobroma cacao [chocolate]
ref|XP_007133059.1|  hypothetical protein PHAVU_011G148000g           87.4    4e-17   Phaseolus vulgaris [French bean]
gb|AGL39684.1|  NAC transcription factor 028                          84.0    7e-16   Jatropha curcas
gb|KHG21395.1|  NAC domain-containing 18 -like protein                83.2    7e-16   Gossypium arboreum [tree cotton]
ref|XP_003540450.1|  PREDICTED: NAC domain-containing protein 18-...  84.0    8e-16   Glycine max [soybeans]
ref|XP_010060527.1|  PREDICTED: NAC domain-containing protein 18-...  83.6    1e-15   Eucalyptus grandis [rose gum]
ref|XP_011098344.1|  PREDICTED: NAC domain-containing protein 18      82.8    2e-15   Sesamum indicum [beniseed]
ref|XP_009609295.1|  PREDICTED: NAC transcription factor 25-like      82.4    2e-15   Nicotiana tomentosiformis
ref|XP_008386130.1|  PREDICTED: NAC domain-containing protein 18-...  80.5    2e-14   Malus domestica [apple tree]
gb|AGT56012.1|  sinor-like protein 1                                  79.7    2e-14   Solanum lycopersicum
gb|AHJ79194.1|  NAC domain protein NAC53                              79.7    2e-14   Gossypium hirsutum [American cotton]
gb|KHN36793.1|  NAC domain-containing protein 18                      79.0    6e-14   Glycine soja [wild soybean]
ref|NP_001266277.1|  uncharacterized protein LOC101247735             78.2    6e-14   
ref|XP_003541120.1|  PREDICTED: NAC domain-containing protein 18-...  77.4    2e-13   
ref|XP_003543257.1|  PREDICTED: NAC domain-containing protein 18      77.4    2e-13   Glycine max [soybeans]
ref|XP_002316919.2|  no apical meristem family protein                76.3    4e-13   Populus trichocarpa [western balsam poplar]
ref|XP_009378497.1|  PREDICTED: NAC domain-containing protein 18-...  75.9    7e-13   Pyrus x bretschneideri [bai li]
ref|XP_009334622.1|  PREDICTED: NAC domain-containing protein 18      75.5    8e-13   Pyrus x bretschneideri [bai li]
ref|XP_011029435.1|  PREDICTED: NAC domain-containing protein 18-...  75.1    1e-12   Populus euphratica
ref|NP_001280984.1|  NAC domain-containing protein 18                 74.7    1e-12   Malus domestica [apple tree]
gb|AHJ79165.1|  NAC domain protein NAC24                              74.7    2e-12   Gossypium hirsutum [American cotton]
ref|XP_006362947.1|  PREDICTED: NAC transcription factor 25-like      73.6    4e-12   Solanum tuberosum [potatoes]
gb|KHG07368.1|  NAC domain-containing 18 -like protein                72.8    8e-12   Gossypium arboreum [tree cotton]
ref|XP_010268761.1|  PREDICTED: NAC transcription factor 25-like      72.4    9e-12   Nelumbo nucifera [Indian lotus]
ref|XP_004487678.1|  PREDICTED: NAC domain-containing protein 18-...  71.6    2e-11   Cicer arietinum [garbanzo]
gb|KEH38791.1|  NAC transcription factor-like protein                 70.5    4e-11   Medicago truncatula
gb|AGS08759.1|  NAC domain protein                                    70.1    6e-11   Malus hupehensis
gb|AEQ28762.1|  NAC domain class transcription factor                 69.7    9e-11   Prunus salicina [Japanese plum]
ref|XP_007211475.1|  hypothetical protein PRUPE_ppa007577mg           68.9    2e-10   Prunus persica
gb|AAU43923.2|  NAC domain protein                                    68.9    2e-10   Solanum lycopersicum
ref|NP_001234652.1|  NAC domain protein                               68.9    2e-10   Solanum lycopersicum
gb|ACJ14498.1|  mutant NAC domain protein                             68.6    2e-10   Solanum lycopersicum
ref|XP_010278293.1|  PREDICTED: NAC transcription factor NAM-B2-like  68.6    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_004174082.1|  PREDICTED: LOW QUALITY PROTEIN: NAC transcri...  67.0    6e-10   
ref|XP_004149287.1|  PREDICTED: NAC transcription factor 25-like      66.6    1e-09   Cucumis sativus [cucumbers]
ref|XP_006370307.1|  no apical meristem family protein                64.7    4e-09   Populus trichocarpa [western balsam poplar]
ref|XP_008226677.1|  PREDICTED: NAC transcription factor 25           64.7    4e-09   Prunus mume [ume]
ref|XP_004291668.1|  PREDICTED: NAC domain-containing protein 18-...  63.9    7e-09   Fragaria vesca subsp. vesca
ref|XP_011042501.1|  PREDICTED: NAC domain-containing protein 18-...  63.9    8e-09   Populus euphratica
ref|XP_008452274.1|  PREDICTED: NAC transcription factor 25-like      63.9    8e-09   Cucumis melo [Oriental melon]
emb|CAG28971.1|  NAM-like protein                                     63.5    1e-08   Prunus persica
gb|KDO74154.1|  hypothetical protein CISIN_1g016791mg                 61.6    1e-08   Citrus sinensis [Valencia orange]
gb|KDO74153.1|  hypothetical protein CISIN_1g016791mg                 61.6    3e-08   Citrus sinensis [Valencia orange]
gb|AID55348.1|  NAC protein 1                                         61.6    4e-08   Actinidia arguta
gb|AGC27321.1|  NAC domain protein 10                                 61.6    5e-08   Gossypium hirsutum [American cotton]
gb|AID55352.1|  NAC protein 1                                         61.2    6e-08   Actinidia chinensis
gb|KHG20342.1|  NAC domain-containing 18 -like protein                61.2    6e-08   Gossypium arboreum [tree cotton]
gb|AGC27313.1|  NAC domain protein 10                                 61.2    7e-08   Gossypium hirsutum [American cotton]
gb|KJB81906.1|  hypothetical protein B456_013G167100                  61.2    7e-08   Gossypium raimondii
ref|XP_006451941.1|  hypothetical protein CICLE_v10008628mg           60.8    9e-08   Citrus clementina
gb|EYU33415.1|  hypothetical protein MIMGU_mgv1a009589mg              60.5    1e-07   Erythranthe guttata [common monkey flower]
ref|NP_001274379.1|  NAC domain-containing protein 18-like            57.8    1e-06   Glycine max [soybeans]
gb|KHN36348.1|  NAC domain-containing protein 18                      57.8    1e-06   Glycine soja [wild soybean]
gb|AID55354.1|  NAC protein 3                                         56.2    3e-06   Actinidia chinensis
ref|XP_007025712.1|  NAC domain containing protein 25                 55.8    5e-06   Theobroma cacao [chocolate]
ref|XP_006841705.1|  hypothetical protein AMTR_s00003p00252470        55.1    8e-06   Amborella trichopoda
ref|XP_010089502.1|  NAC domain-containing protein 18                 53.5    3e-05   Morus notabilis
gb|AID55350.1|  NAC protein 3                                         52.4    6e-05   Actinidia arguta
ref|XP_002316635.1|  no apical meristem family protein                50.1    3e-04   Populus trichocarpa [western balsam poplar]
gb|KJB57570.1|  hypothetical protein B456_009G170700                  49.7    6e-04   Gossypium raimondii



>ref|XP_011095244.1| PREDICTED: NAC transcription factor 25-like [Sesamum indicum]
Length=354

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 102/172 (59%), Gaps = 26/172 (15%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITS  177
            P+  ERDD +N+M+GS+ P++   +   HQK H G+   A++YG LLE+D N+YEGM+ +
Sbjct  194  PMTQERDDHINDMIGSVQPTLSLPLG-QHQKIH-GI--KASSYGSLLESDDNLYEGMMNN  249

Query  178  NGS--PIVSAAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTAARTD  351
            N S    + ++A  NLL  K    LP +YWNE+    + +SP TK+FLA+    +  R D
Sbjct  250  NESMNSHLGSSADPNLLQGK--RTLPNLYWNEEG---NANSPPTKRFLAESCDGSIGRAD  304

Query  352  DQSGGGGSIATLLSQLPQQ-----------NVSGDGVFR-QPYPVSGLNWYS  471
            + +    S  T+LSQLPQ               GDGVFR QPY VSG+NWYS
Sbjct  305  ETT--TSSHHTILSQLPQTPSLQQQAILAAGALGDGVFRQQPYQVSGMNWYS  354



>ref|XP_009769986.1| PREDICTED: NAC transcription factor 25 [Nicotiana sylvestris]
Length=353

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 102/182 (56%), Gaps = 35/182 (19%)
 Frame = +1

Query  1    PIDHERDDLNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLE-NDQNIY-EGMIT  174
            PIDHERDDLN+++GS   SIP T    +     G  K+ +NY  LLE +DQNIY +GM  
Sbjct  182  PIDHERDDLNDIMGS---SIPATCIPNNSMSIFGQPKANSNYTTLLETHDQNIYDQGMQF  238

Query  175  SNGS----PIVSAAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLA------DD  324
            S+ S    P+   + + +LLPSK    L  +YWNE+A   +D+S  TK+FL       DD
Sbjct  239  SSKSSSQLPVNVLSTSPSLLPSK--RSLNGLYWNEEA-AANDNSQSTKRFLTENINNMDD  295

Query  325  SHLTAARTDDQSGGGGSIATLLSQLPQ-------------QNVSGDGVFRQPYPVSGLNW  465
                  R+D +    GSIA+LLSQLPQ             Q    DGVFRQPY  SG+NW
Sbjct  296  GLSMNVRSDHEQ--NGSIASLLSQLPQTPSLQQQQQQQILQGSLSDGVFRQPY--SGMNW  351

Query  466  YS  471
            YS
Sbjct  352  YS  353



>emb|CDP05873.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 102/168 (61%), Gaps = 31/168 (18%)
 Frame = +1

Query  1    PIDHERDDLNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYE--GMIT  174
            P+DH+RDD N+M+ SIPPS+P ++  + Q+   GL   A+N+G LLEN+Q+ +E  GM+T
Sbjct  182  PMDHDRDDFNDMMPSIPPSLPPSMSMSSQQKILGL--KASNFGALLENEQSAFEVPGMLT  239

Query  175  SNGSPIVSAAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTAARTDD  354
            SN           +++P+K    LPA+YWN++    +  SP  K+FLAD       RT++
Sbjct  240  SN-----------HVIPAK--RALPALYWNDEG---NPISPSNKRFLADSGDGNIGRTNN  283

Query  355  QSGGGGSIATLLSQLPQQN---------VSGDGVFRQPYPVSGLNWYS  471
                  SIATLLSQLPQ             GDGVFRQPY V+G+NWYS
Sbjct  284  DE--NSSIATLLSQLPQTTSLHQQAMLGSLGDGVFRQPYQVTGMNWYS  329



>ref|XP_009594217.1| PREDICTED: NAC transcription factor 25-like [Nicotiana tomentosiformis]
Length=350

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 102/181 (56%), Gaps = 36/181 (20%)
 Frame = +1

Query  1    PIDHERDDLNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLE-NDQNIY-EGMIT  174
            PIDHERDDLN+++G+    IP         F Q   + ++NY  LLE +DQNIY +GM  
Sbjct  182  PIDHERDDLNDIIGAT--CIPNNSMSMPNPFGQ---QKSSNYTTLLETHDQNIYDQGMQF  236

Query  175  SNGS----PIVSAAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLA------DD  324
            S+ S    P+   + +A++LPSK    L  +YWNE+A T +D+S  TK+FL       DD
Sbjct  237  SSKSSSQLPVNVLSTSASVLPSK--RSLTGLYWNEEA-TANDNSQSTKRFLTENINNLDD  293

Query  325  SHLTAARTDDQSGGGGSIATLLSQLPQ------------QNVSGDGVFRQPYPVSGLNWY  468
                  R+D +    GSIA+LLSQLPQ            Q    DGVFRQPY  SG+NWY
Sbjct  294  GLSMNLRSDHEQ--NGSIASLLSQLPQTPSLHQQQQQILQGSLSDGVFRQPY--SGINWY  349

Query  469  S  471
            S
Sbjct  350  S  350



>emb|CBI20351.3| unnamed protein product [Vitis vinifera]
Length=331

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 87/155 (56%), Gaps = 26/155 (17%)
 Frame = +1

Query  34   MLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITSNGSPIVSAAAAA  213
            MLG +P SI    Q    +F +       NY  LLEN+Q+++EGMI S+G    +++   
Sbjct  194  MLGPVPTSISMGQQSLKLQFPK-----VPNYSALLENEQSLFEGMINSDGINTTTSS---  245

Query  214  NLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTAARTDDQSGGGGSIATLLS  393
             +LP K    LP++YWN+D  T   S+  TK+F A+++     RT D   G  SIATLLS
Sbjct  246  -ILPLK--RTLPSLYWNDDD-TAGPST--TKRFQAENTDGNIGRTTD---GNNSIATLLS  296

Query  394  QLPQQ---------NVSGDGVFRQPYPVSGLNWYS  471
            QLPQ             G+GVFRQP+ + G+NWY+
Sbjct  297  QLPQTPSLHQQSMLGSLGEGVFRQPFQLPGMNWYA  331



>ref|XP_009759753.1| PREDICTED: NAC transcription factor 25-like [Nicotiana sylvestris]
Length=330

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 97/173 (56%), Gaps = 48/173 (28%)
 Frame = +1

Query  1    PIDH-ERDDLNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITS  177
            PIDH ERDD+NEM+G    SIPT I  +   F                 +QN+YEG+I +
Sbjct  190  PIDHHERDDMNEMMGR---SIPTCIANSISPF-----------------EQNMYEGIINN  229

Query  178  NGSPIVSA----AAAANLLPSKHPHHLPA-MYWNEDAPTCSDSSPLTKKFLADDS-----  327
            N S +++     + ++++LP K P  LPA +YWNED  T   +SP  K+FLA++S     
Sbjct  230  NTSDMINVNNVGSISSSVLPPKRP--LPAGLYWNEDHNT---NSPSAKRFLAENSLDNGL  284

Query  328  HLTAARTDDQSGGGGSIATLLSQLPQQNVSG---DGV-FRQPY-PVSGLNWYS  471
            ++   R D+ +       + LSQLPQ  V G   DGV FRQPY  V+G+NWYS
Sbjct  285  NMNITRPDEHN-------SFLSQLPQNQVLGSLSDGVIFRQPYNQVTGMNWYS  330



>ref|XP_002532683.1| NAC domain-containing protein, putative [Ricinus communis]
 gb|EEF29696.1| NAC domain-containing protein, putative [Ricinus communis]
Length=346

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 93/175 (53%), Gaps = 28/175 (16%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITS  177
            P+D E+DD + +MLGSIPPS+    Q   Q     L K   NYG L+END + +     S
Sbjct  182  PMDQEKDDSMEDMLGSIPPSLTIGSQ---QNARLQLLK-GTNYGTLVENDTSFFNDHSIS  237

Query  178  NGSPIVSAAAAA-------NLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLT  336
            N + I   A++        ++LP K    LP++YW++D    +  S  +K++  D    T
Sbjct  238  NTNSISQLASSTCSRPGDLSMLPLKR--TLPSLYWSDDVDMAASPSS-SKRYQGDH---T  291

Query  337  AARTDDQSGGGGSIATLLSQLPQ------QNVS----GDGVFRQPYPVSGLNWYS  471
               +  +S G GS  +LLSQLPQ      Q  +    GDG+FR PY +SGLNWYS
Sbjct  292  GDESVVRSDGNGSFVSLLSQLPQTPPLHQQQATLGSIGDGIFRPPYQLSGLNWYS  346



>ref|XP_010644222.1| PREDICTED: NAC transcription factor 25 isoform X2 [Vitis vinifera]
Length=341

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 91/173 (53%), Gaps = 40/173 (23%)
 Frame = +1

Query  34   MLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITSNG---SPIVS--  198
            MLG +P SI    Q    +F +       NY  LLEN+Q+++EGMI S+G   S  +S  
Sbjct  182  MLGPVPTSISMGQQSLKLQFPK-----VPNYSALLENEQSLFEGMINSDGINSSGTISQL  236

Query  199  -------------AAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTA  339
                         AA  +++LP K    LP++YWN+D  T   S+  TK+F A+++    
Sbjct  237  ACSSSKPDHLSLVAATTSSILPLK--RTLPSLYWNDDD-TAGPST--TKRFQAENTDGNI  291

Query  340  ARTDDQSGGGGSIATLLSQLPQQ---------NVSGDGVFRQPYPVSGLNWYS  471
             RT D   G  SIATLLSQLPQ             G+GVFRQP+ + G+NWY+
Sbjct  292  GRTTD---GNNSIATLLSQLPQTPSLHQQSMLGSLGEGVFRQPFQLPGMNWYA  341



>ref|XP_002284654.2| PREDICTED: NAC transcription factor 25 isoform X1 [Vitis vinifera]
Length=353

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 91/173 (53%), Gaps = 40/173 (23%)
 Frame = +1

Query  34   MLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITSNG---SPIVS--  198
            MLG +P SI    Q    +F +       NY  LLEN+Q+++EGMI S+G   S  +S  
Sbjct  194  MLGPVPTSISMGQQSLKLQFPK-----VPNYSALLENEQSLFEGMINSDGINSSGTISQL  248

Query  199  -------------AAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTA  339
                         AA  +++LP K    LP++YWN+D  T   S+  TK+F A+++    
Sbjct  249  ACSSSKPDHLSLVAATTSSILPLK--RTLPSLYWNDDD-TAGPST--TKRFQAENTDGNI  303

Query  340  ARTDDQSGGGGSIATLLSQLPQQ---------NVSGDGVFRQPYPVSGLNWYS  471
             RT D   G  SIATLLSQLPQ             G+GVFRQP+ + G+NWY+
Sbjct  304  GRTTD---GNNSIATLLSQLPQTPSLHQQSMLGSLGEGVFRQPFQLPGMNWYA  353



>ref|XP_007149615.1| hypothetical protein PHAVU_005G084600g [Phaseolus vulgaris]
 gb|ESW21609.1| hypothetical protein PHAVU_005G084600g [Phaseolus vulgaris]
Length=369

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 94/190 (49%), Gaps = 37/190 (19%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYG-GLLENDQNIYEGMIT  174
            P++H+R+D + +M+G IPPSI   +     ++H  L K +  Y   LLENDQN+ EGM+ 
Sbjct  184  PMEHDREDSMEDMIGGIPPSI--NVGHMSGRYH--LSKMSTGYSSALLENDQNLLEGMMI  239

Query  175  SNGSPIV---------------SAAAAANLLPS------KHPHHLPAMYWN-EDAPTCSD  288
             NGS +                ++ A  + +PS           L ++YWN ED    S 
Sbjct  240  GNGSVMNTSTATTNTTPGAMASNSKAELSFVPSMTHSSNTSKRTLSSLYWNDEDVAGTSS  299

Query  289  SSPLTKKFLADDSHLTAARTDDQSGGGGSIATLLSQLPQQ---------NVSGDGVFRQP  441
            S+        D++H +  RTD ++G   SI TLL+QLPQ             GDG+ R  
Sbjct  300  SNKRFNLESGDNNHGSVVRTDQENGTATSIVTLLNQLPQTPSLHQQSMLGSIGDGLLRTT  359

Query  442  YPVSGLNWYS  471
            Y + G+NWY+
Sbjct  360  YQIPGMNWYA  369



>ref|XP_007021327.1| NAC domain protein, IPR003441 [Theobroma cacao]
 gb|EOY12852.1| NAC domain protein, IPR003441 [Theobroma cacao]
Length=347

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 97/178 (54%), Gaps = 33/178 (19%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQ-NIYEGMIT  174
            P+DH++DD ++EMLG IPPSI    Q  + KF   L     ++G LLEN + +++EGM+ 
Sbjct  182  PMDHDKDDSMDEMLGPIPPSISIGSQH-NAKFQ--LATKGTSFGTLLENQEHSLFEGMMA  238

Query  175  SNGSPIVSAAAAANL-LPSKHP---------HHLPAMYWNEDAPTCSDSSPLTKKFLADD  324
              GS  +++ + + L   S  P           +P+++W ++      +S   K+F  D 
Sbjct  239  --GSDGINSGSISQLGCSSSKPDLSMVNPLKRTVPSLFWTDEDTAGPSTS---KRFHGDS  293

Query  325  SHLTAARTDDQSGGGGSIATLLSQLPQQ---------NVSGDGVFRQPYPVSGLNWYS  471
            +  +  +TD    G GSIATLLSQLPQ             GDG+FR PY +SGLNWYS
Sbjct  294  NDGSMEKTD----GNGSIATLLSQLPQTPPLQQQTMLGSMGDGIFRPPYQLSGLNWYS  347



>ref|XP_007133059.1| hypothetical protein PHAVU_011G148000g [Phaseolus vulgaris]
 gb|ESW05053.1| hypothetical protein PHAVU_011G148000g [Phaseolus vulgaris]
Length=356

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 93/179 (52%), Gaps = 29/179 (16%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANY-GGLLENDQNIYEGMIT  174
            P+DHERDD +++M+G +PPSI   +   + +FH  L K + NY G LLEND+N  EG++ 
Sbjct  183  PMDHERDDSMDDMIGEVPPSI--NVGHMNARFH--LSKMSTNYSGALLENDRNTLEGVVI  238

Query  175  SNGSPIVSAAAAANLLPSK------HPHHLPAMYWNEDAPTCSDSSPL--------TKKF  312
             NG   +S   +A  +PS+         HLP    N  + +    S L         K F
Sbjct  239  GNGVNGISTTTSA--MPSQFGTSNSKAVHLPFALSNNTSASKRTLSTLYNWNDDSDEKHF  296

Query  313  LAD-DSHLTAARTDDQSGGGGSIATLLSQLPQQ------NVSGDGVFRQPYPVSGLNWY  468
              D + +++  RT+D +   GS ATLL+QLPQ          GDG+ R  Y + G NWY
Sbjct  297  NLDCNGNVSVVRTEDNNATPGSFATLLNQLPQTPSLPQIGSMGDGLLRTQYQIQGTNWY  355



>gb|AGL39684.1| NAC transcription factor 028 [Jatropha curcas]
 gb|KDP38908.1| hypothetical protein JCGZ_00665 [Jatropha curcas]
Length=345

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 89/163 (55%), Gaps = 28/163 (17%)
 Frame = +1

Query  34   MLGSIPPSIPT-TIQFTHQKFHQGLFKSAANYGGLLENDQN-IYEGMITSNGSPIVSAAA  207
            MLG IPPSI         Q+  +  F    NYG L+EN+QN ++EGM+  NG   ++   
Sbjct  194  MLGLIPPSISVGNTNNNSQQNAKLQFLKGTNYGLLVENEQNCLFEGMM-HNGE--INQMG  250

Query  208  AAN------LLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTAARTDDQSGGG  369
            ++N      +LP K    LP++YWNE+      SS  +K++ AD    +  R D    G 
Sbjct  251  SSNRPGELSVLPLKR--TLPSLYWNEEIDAAGASS--SKRYQADSGDGSVVRND----GN  302

Query  370  GSIATLLSQLPQ-----QNVS----GDGVFRQPYPVSGLNWYS  471
            GSIA+LLSQLPQ     Q  +    GDG++R P+  SGLNW+S
Sbjct  303  GSIASLLSQLPQTPPLHQQTALGSLGDGIYRPPFQFSGLNWFS  345



>gb|KHG21395.1| NAC domain-containing 18 -like protein [Gossypium arboreum]
Length=265

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 98/171 (57%), Gaps = 31/171 (18%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQ--NIYEGMI  171
            P++H++DD +++MLG++PPSI  + Q  + KFH        ++G LLE+ +  ++++GM+
Sbjct  112  PLEHDKDDSMDDMLGTVPPSISISSQH-NPKFH--FSTKGTSFGTLLEHQEHNSLFDGMM  168

Query  172  TSNGSPIVSAAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTAARTD  351
             S+G   +++A+  N L       LP++YW +D      +S   K+F  D +  +  +TD
Sbjct  169  GSDG---INSASMVNPLK----RALPSLYWTDDETAGPSTS---KRFHGDSNDGSMEKTD  218

Query  352  DQSGGGGSIATLLSQLPQQNVS-----------GDGVFRQPYPVSGLNWYS  471
                G GSIATLLSQLPQ               GDG+FR PY + GLNWYS
Sbjct  219  ----GNGSIATLLSQLPQTPPLQQQQAAMLGSMGDGIFRPPYQLPGLNWYS  265



>ref|XP_003540450.1| PREDICTED: NAC domain-containing protein 18-like [Glycine max]
 gb|KHN28035.1| NAC domain-containing protein 18 [Glycine soja]
Length=375

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 91/194 (47%), Gaps = 39/194 (20%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQ-GLFKSAANYGGLLENDQNIYEGMIT  174
            P++HER+D +++M+G IPPSI   +     +FH      +A N G +LEN+ N+ EGM+ 
Sbjct  184  PMEHEREDSMDDMIGGIPPSI--NVGHMSARFHHLSKMTTAYNSGAMLENEHNLLEGMMI  241

Query  175  SNGSPIVSAAAAANLLPSKHPHH------------------------LPAMYWNEDAPTC  282
             N +  ++    A   P     H                        L ++YWN++  T 
Sbjct  242  GNNNGGMNTTTTATTTPGAMSSHLGGSKAELSFVPTMTHSSNTSKRTLSSLYWNDEDVTG  301

Query  283  SDSSPLTKKFLADD--SHLTAARTDDQSGGGGSIATLLSQLPQQ---------NVSGDGV  429
            + SS       + D  +H +  R D ++G   SIATLL+QLPQ             GDG+
Sbjct  302  TSSSNRRFNLESGDNNNHGSVVRADQENGTASSIATLLNQLPQTPSLHQQSMLGSIGDGL  361

Query  430  FRQPYPVSGLNWYS  471
             R  Y + G+NWY+
Sbjct  362  LRTTYQIPGMNWYA  375



>ref|XP_010060527.1| PREDICTED: NAC domain-containing protein 18-like [Eucalyptus 
grandis]
 gb|KCW67303.1| hypothetical protein EUGRSUZ_F01091 [Eucalyptus grandis]
Length=366

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 101/191 (53%), Gaps = 41/191 (21%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFK-SAANYGGLLENDQNIYEGMIT  174
            P+DHERDD +++ML SIPPS+  T+     K H  L K S  +YG L E++QN++EGM+ 
Sbjct  183  PMDHERDDSMDDMLESIPPSL--TMNPHGMKLH--LSKPSTTSYGVLFEHEQNLFEGMMG  238

Query  175  SNG------------------SPIVSAAAAANL---LPSKHPHHLPAMYWNED--APTCS  285
            +NG                   P ++   A N+   LP K   H  ++YWN+   A   S
Sbjct  239  ANGGGCIPGNVMSHLASSSGLKPELAMVQAPNISSPLPLKRTLH--SLYWNDKDVAAETS  296

Query  286  DSSPLTKKFLADDSHLTAARTDDQSGGGGSIATLLSQLPQ-----QNVS----GDGVFRQ  438
            D S + ++F AD +   +    + +GG  SIA+LL Q+PQ     Q  +    GDG FR 
Sbjct  297  DPSSVKRQFSADRNDPGSVER-NTNGGTSSIASLLGQIPQTPPLHQQTAYGPLGDGGFRP  355

Query  439  PYPVSGLNWYS  471
             + + GLNWY+
Sbjct  356  QFHMPGLNWYA  366



>ref|XP_011098344.1| PREDICTED: NAC domain-containing protein 18 [Sesamum indicum]
Length=338

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 96/184 (52%), Gaps = 55/184 (30%)
 Frame = +1

Query  1    PIDHERDDLNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLEND-QNIYEGMITS  177
            P+D ERD+LN+++GSIPP    TI     KF             L  ND QN YEGM+ +
Sbjct  183  PVDQERDELNDVIGSIPP----TISIGQHKF-------------LDNNDHQNYYEGMMMN  225

Query  178  N------GSPIVSAA----------AAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKK  309
            +      G+   S             A NLLP+K    LP +YWN+     +D+S  TK+
Sbjct  226  DSMNSHLGTNKASTGHHHHHQQLPLVAHNLLPTKRA--LPNLYWND--VEGNDNSASTKR  281

Query  310  FLADDSHLTAARTDDQSGGGGSIATLLSQLP------QQNVSG---DGVF-RQPYPVSGL  459
            FL+++      RTD+ +    SIAT+LSQLP      QQ + G   +GVF +Q Y VSG+
Sbjct  282  FLSEN---CVGRTDETT----SIATILSQLPQTPSLQQQTMLGNLENGVFGQQTYQVSGM  334

Query  460  NWYS  471
            NWYS
Sbjct  335  NWYS  338



>ref|XP_009609295.1| PREDICTED: NAC transcription factor 25-like [Nicotiana tomentosiformis]
Length=329

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 99/172 (58%), Gaps = 47/172 (27%)
 Frame = +1

Query  1    PIDH-ERDDLNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITS  177
            PIDH ERDD+N+M+GS   SIPT I  +   F                 +QN+YEG+I +
Sbjct  190  PIDHHERDDMNDMMGS---SIPTCIATSISPF-----------------EQNMYEGIINN  229

Query  178  NGSPIVS---AAAAANLLPSKHPHHLPA-MYWNEDAPTCSDSSPLTKKFLADDS-----H  330
            N S +++    + ++++LP K P  LPA +YWNED  T   SSP  K+FLA++S     +
Sbjct  230  NTSNMINNNVGSISSSVLPPKQP--LPAGLYWNEDHNT---SSPSAKRFLAENSLDDELN  284

Query  331  LTAARTDDQSGGGGSIATLLSQLPQQNVSG---DG-VFRQPY-PVSGLNWYS  471
            +   R D+Q+       + LSQLPQ  V G   DG VFRQPY  V+G+NWYS
Sbjct  285  MNITRPDEQN-------SFLSQLPQNQVLGSLSDGVVFRQPYNQVTGMNWYS  329



>ref|XP_008386130.1| PREDICTED: NAC domain-containing protein 18-like [Malus domestica]
Length=368

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 92/177 (52%), Gaps = 28/177 (16%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSI-PPSIPTTIQFTHQKFHQGLFKSAANYGG-LLENDQNIYEGMI  171
            P+DHER+D + ++LG + PPSI       + K H  L KS  +YG   +EN+Q  ++GM+
Sbjct  195  PMDHEREDSMEDILGPLMPPSISHVGHHQNMKLH--LPKSNLSYGPPFMENNQIFFDGMM  252

Query  172  TSNGSPIVSAAAAANLLPSKHPHHLPAMYWN---EDAPTCSDSSPLTKKFLADDSHLTAA  342
            +S        +A+ + LP K P  +P++YWN   ED  T +D S   +  L      T +
Sbjct  253  SS-----TDGSASTHQLPQKRPI-VPSLYWNNQEEDDQTAADPSSSKRIQLHQLDTGTNS  306

Query  343  RTDDQSGGGG-----SIATLLSQLPQQ---------NVSGDGVFRQPYPVSGLNWYS  471
              D  +GG       SIA LLSQLPQ             GDG+FR PY + G NWYS
Sbjct  307  NGDGINGGATNNNSTSIANLLSQLPQTPPLHQHAVLGSLGDGLFRTPYQLPGRNWYS  363



>gb|AGT56012.1| sinor-like protein 1 [Solanum lycopersicum]
 gb|AGT56013.1| sinor-like protein 1 [Solanum lycopersicum]
Length=329

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 88/173 (51%), Gaps = 41/173 (24%)
 Frame = +1

Query  1    PIDHERDDLN--EMLGSI---PPSIPTTIQ----FTHQKFHQGLFKSAANYGGLL---EN  144
            PIDHERDDLN   M+GS    P  IP ++     F   K  Q     ++N+G  L   +N
Sbjct  182  PIDHERDDLNIDMMMGSSSIHPSCIPNSMSMPNIFGQPKIPQ---LKSSNFGTTLIHDQN  238

Query  145  DQNIYEGMITSNGSPIVSAAAAANLLPSKHPHHLPAMYWN-EDAPTCSDSSPLTKKFLAD  321
            DQN+YEG     GS   S    ANL            YWN +D    +D+S  TK+FL +
Sbjct  239  DQNLYEG-----GSQYSSKRPLANL------------YWNDQDGGASNDNSQSTKRFLTE  281

Query  322  ---DSHLTAARTDDQSGGGGSIATLLSQLPQQNVSGDGVFRQPYPVSGLNWYS  471
               D     AR D+Q+G   SI +LLSQ        +GVFRQPY  SG+NWYS
Sbjct  282  NMEDGLNMNARADEQNG---SIVSLLSQQQVLGSLSEGVFRQPY--SGMNWYS  329



>gb|AHJ79194.1| NAC domain protein NAC53 [Gossypium hirsutum]
 gb|KJB13428.1| hypothetical protein B456_002G073800 [Gossypium raimondii]
Length=335

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 97/171 (57%), Gaps = 31/171 (18%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQ--NIYEGMI  171
            P++H++DD +++MLG++PPSI    Q  + KFH        ++G LLE+ +  ++++GM+
Sbjct  182  PLEHDKDDSMDDMLGTVPPSISIGSQH-NPKFH--FSTKGTSFGTLLEHQEHNSLFDGMM  238

Query  172  TSNGSPIVSAAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTAARTD  351
             S+G   +++A+  N L       LP++YW +D      +S   K+F  D +  +  +TD
Sbjct  239  GSDG---INSASMVNPLK----RTLPSLYWTDDETAGPSTS---KRFHGDSNDGSMEKTD  288

Query  352  DQSGGGGSIATLLSQLPQQNVS-----------GDGVFRQPYPVSGLNWYS  471
                G GSIATLLSQLPQ               GDG+FR P+ + GLNWYS
Sbjct  289  ----GNGSIATLLSQLPQTPPLQQQQAAMLGSMGDGIFRPPHQLPGLNWYS  335



>gb|KHN36793.1| NAC domain-containing protein 18 [Glycine soja]
Length=375

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 98/194 (51%), Gaps = 39/194 (20%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQ-GLFKSAANYGGLLENDQ-NIYEGMI  171
            P++HER+D +++M+G IPPSI   +     +FH      +A N G LLEND  N+ EGM+
Sbjct  184  PMEHEREDSMDDMIGGIPPSI--NVGHMSARFHHLSKMTTAYNNGALLENDHHNLLEGMM  241

Query  172  TSNGS------------PIVS----AAAAANLLPS------KHPHHLPAMYWNED--APT  279
              N +            P+ S    +    + +P+           L ++YWN++  A T
Sbjct  242  IGNSNGGMNTTTTTTPGPMSSHLGGSKEELSFVPTMTHSSNTSKRTLSSLYWNDEDVAGT  301

Query  280  CSDSSPLTKKFLADDS-HLTAARTDDQSGGGGSIATLLSQLP------QQNV---SGDGV  429
             S +     +   D++ H +  R D ++G   SIATLL+QLP      QQ++    GDG+
Sbjct  302  SSSNKRFNLELSGDNNNHGSVVRDDQENGTASSIATLLNQLPQTPSLHQQSILGSIGDGL  361

Query  430  FRQPYPVSGLNWYS  471
             R  Y + G+NWY+
Sbjct  362  LRTTYQIPGMNWYA  375



>ref|NP_001266277.1| uncharacterized protein LOC101247735 [Solanum lycopersicum]
 gb|AFD22355.1| NAC3 [Solanum lycopersicum]
Length=329

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 87/172 (51%), Gaps = 41/172 (24%)
 Frame = +1

Query  1    PIDHERDDLN--EMLGSI---PPSIPTTIQ----FTHQKFHQGLFKSAANYGGLL---EN  144
            PIDHERDDLN   M+GS    P  IP ++     F   K  Q     ++N+G  L   +N
Sbjct  182  PIDHERDDLNIDMMMGSSSIHPSCIPNSMSMPNIFGQPKIPQ---LKSSNFGTTLIHDQN  238

Query  145  DQNIYEGMITSNGSPIVSAAAAANLLPSKHPHHLPAMYWN-EDAPTCSDSSPLTKKFLAD  321
            DQN+YEG     GS   S    ANL            YWN +D    +D+S  TK+FL +
Sbjct  239  DQNLYEG-----GSQYSSKRPLANL------------YWNDQDGGASNDNSQSTKRFLTE  281

Query  322  ---DSHLTAARTDDQSGGGGSIATLLSQLPQQNVSGDGVFRQPYPVSGLNWY  468
               D     AR D+Q+G   SI +LLSQ        +GVFRQPY  SG+NWY
Sbjct  282  NMEDGLNMNARADEQNG---SIVSLLSQQQVLGSLSEGVFRQPY--SGMNWY  328



>ref|XP_003541120.1| PREDICTED: NAC domain-containing protein 18-like [Glycine max]
 gb|KHN48759.1| NAC domain-containing protein 18 [Glycine soja]
Length=360

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 93/190 (49%), Gaps = 50/190 (26%)
 Frame = +1

Query  10   HERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANY-GGLLENDQNIYEGMITSNG  183
            HERDD +++M+G +PPSI   +     +FH  L + + +Y G LLEND+N  EG++  NG
Sbjct  183  HERDDSIDDMIGEVPPSI--NVGHMSARFH--LSRMSTSYSGALLENDRNTLEGVVIGNG  238

Query  184  S-----------PIVSAA-------AAANLLP---------SKHPHHLPAMYWNEDAPTC  282
            S            ++S++       + A LLP         S     L ++YWN D    
Sbjct  239  SVNGISNTNNITSVISSSHQFGTSNSKAELLPFVPSNNTSNSASKRTLSSLYWNVDD---  295

Query  283  SDSSPLTKKF-LADDSHLTAARTDDQ-----SGGGGSIATLLSQLPQQNV--SGDGVFRQ  438
                   K F L  + +++  RTD +     +G  GS ATLL+QLPQ       DG+ R 
Sbjct  296  ------HKHFNLDSNGNVSVLRTDQENNNNNNGTSGSFATLLNQLPQTPSLPQIDGLLRT  349

Query  439  PYPVSGLNWY  468
            PY + G NWY
Sbjct  350  PYQIQGTNWY  359



>ref|XP_003543257.1| PREDICTED: NAC domain-containing protein 18 [Glycine max]
Length=375

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 98/194 (51%), Gaps = 39/194 (20%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQ-GLFKSAANYGGLLENDQ-NIYEGMI  171
            P++H+R+D +++M+G IPPSI   +     +FH      +A N G LLEND  N+ EGM+
Sbjct  184  PMEHDREDSMDDMIGGIPPSI--NVGHMSARFHHLSKMTTAYNNGALLENDHHNLLEGMM  241

Query  172  TSNGS------------PIVS----AAAAANLLPS------KHPHHLPAMYWNED--APT  279
              N +            P+ S    +    + +P+           L ++YWN++  A T
Sbjct  242  IGNSNGGMNTTTTTTPGPMSSHLGGSKEELSFVPTMTHSSNTSKRTLSSLYWNDEDVAGT  301

Query  280  CSDSSPLTKKFLADDS-HLTAARTDDQSGGGGSIATLLSQLP------QQNV---SGDGV  429
             S +     +   D++ H +  R D ++G   SIATLL+QLP      QQ++    GDG+
Sbjct  302  SSSNKRFNLELSGDNNNHGSVVRDDQENGTASSIATLLNQLPQTPSLHQQSILGSIGDGL  361

Query  430  FRQPYPVSGLNWYS  471
             R  Y + G+NWY+
Sbjct  362  LRTTYQIPGMNWYA  375



>ref|XP_002316919.2| no apical meristem family protein [Populus trichocarpa]
 gb|EEE97531.2| no apical meristem family protein [Populus trichocarpa]
Length=355

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 82/164 (50%), Gaps = 28/164 (17%)
 Frame = +1

Query  34   MLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITSNGSPIVSAAAAA  213
            +LGSIPPSI   +   HQ     L K   NY  LL+ND N++EG+I+SN     S++ + 
Sbjct  202  ILGSIPPSI---LVGNHQNGTLHLAK-GTNYETLLDNDHNLFEGIISSNDGIRSSSSMSH  257

Query  214  NLLPSKHPHH---------LPAMYWNEDAPTCSDSSPLTKKFLADDSHLTAARTDDQSGG  366
                   P H         LP++YW ++      SS   K+F  D +   +   +D   G
Sbjct  258  VASSVSKPDHLPMLPLKRTLPSLYWTDEDMAVPSSS---KRFQGDINGDESVVGND---G  311

Query  367  GGSIATLLSQLPQQN---------VSGDGVFRQPYPVSGLNWYS  471
              SI TLLSQLPQ +           G+G+FR PY + G+NWYS
Sbjct  312  NSSIVTLLSQLPQTSQLHQHTMLGSMGNGIFRPPYQIPGMNWYS  355



>ref|XP_009378497.1| PREDICTED: NAC domain-containing protein 18-like [Pyrus x bretschneideri]
Length=368

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 90/177 (51%), Gaps = 28/177 (16%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSI-PPSIPTTIQFTHQKFHQGLFKSAANYGG-LLENDQNIYEGMI  171
            P+DHER+D + +++G + PPS+         K H  L KS  +YG   +ENDQ  ++G++
Sbjct  195  PMDHEREDSMGDIMGPLMPPSMTHVGHHQDMKLH--LPKSNLSYGPPFMENDQIFFDGIM  252

Query  172  TSNGSPIVSAAAAANLLPSKHPHHLPAMYWN---EDAPTCSDSSPLTKKFLADDSHLTAA  342
            +S        +A+   LP K P  +P++YWN   ED  T +D S   +  L      T +
Sbjct  253  SS-----TDGSASTPQLPLKRPI-VPSLYWNNQEEDDQTAADPSSSKRIQLHQLDTGTNS  306

Query  343  RTDDQSGGGG-----SIATLLSQLPQQ---------NVSGDGVFRQPYPVSGLNWYS  471
              D  +GG       SIA LLSQLPQ             GDG+FR PY + G NWYS
Sbjct  307  NGDGINGGATNNNSTSIANLLSQLPQTPSLHEHAVLGSLGDGLFRTPYQLPGRNWYS  363



>ref|XP_009334622.1| PREDICTED: NAC domain-containing protein 18 [Pyrus x bretschneideri]
Length=370

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 93/176 (53%), Gaps = 27/176 (15%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSI-PPSIPTTIQFTHQKFHQGLFKSAANYGG-LLENDQNIYEGMI  171
            P+DHER+D + +++G + PPSI       + K H    KS ++YG   +ENDQ  ++G++
Sbjct  198  PMDHEREDSMEDIMGPLMPPSISHVGHHQNMKLH--FPKSNSSYGPPFMENDQIFFDGIM  255

Query  172  TSNGSPIVSAAAAANLLPSKHPHHLPAMYWN--EDAPTCSDSSPLTKKFLADDSHLTAAR  345
            +S        +A+ + L  K P  +P++YWN  ED  T +D S   +  L    + T + 
Sbjct  256  SS-----TDGSASTHQLQLKRPI-VPSLYWNNQEDDQTAADPSSSKRIQLHQLDNGTNSY  309

Query  346  TDDQSGGGG-----SIATLLSQLPQQ---------NVSGDGVFRQPYPVSGLNWYS  471
             D  +GG       SIA LLSQLP+             GDG++R PY + G+NWYS
Sbjct  310  GDGINGGSTNNNSTSIANLLSQLPRTPPLHQHAVLGSLGDGIYRTPYQLPGMNWYS  365



>ref|XP_011029435.1| PREDICTED: NAC domain-containing protein 18-like [Populus euphratica]
Length=355

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 82/165 (50%), Gaps = 30/165 (18%)
 Frame = +1

Query  34   MLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITSN--------GSP  189
            +LGSIPPSI   +   HQ     L K   NY  LL+ND N++EG I+SN         S 
Sbjct  202  ILGSIPPSI---LVGNHQNGTLHLAK-GTNYETLLDNDHNLFEGTISSNDGIRSSSSMSH  257

Query  190  IVSAAAAANLLPS-KHPHHLPAMYWN-EDAPTCSDSSPLTKKFLADDSHLTAARTDDQSG  363
            + S  +  + LP       LP++YW  ED    S S    K+F  D   +    +   +G
Sbjct  258  VASTVSKPDHLPRLPLKRTLPSLYWTGEDMAVPSSS----KRFQGD---INGDESVVGNG  310

Query  364  GGGSIATLLSQLPQQN---------VSGDGVFRQPYPVSGLNWYS  471
            G GSI T LSQLPQ +           G+G+FR PY + GLNWYS
Sbjct  311  GNGSIVTPLSQLPQTSQLHQQTMLGSMGNGIFRPPYQIPGLNWYS  355



>ref|NP_001280984.1| NAC domain-containing protein 18 [Malus domestica]
 gb|ADL36807.1| NAC domain class transcription factor [Malus domestica]
Length=364

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 91/176 (52%), Gaps = 27/176 (15%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSI-PPSIPTTIQFTHQKFHQGLFKSAANYGG-LLENDQNIYEGMI  171
            P+DHER+D + +++G + PPSI       + K H    KS ++YG   +ENDQ  ++G++
Sbjct  192  PMDHEREDSMEDIMGPLMPPSISHVGHHQNMKLH--FPKSNSSYGPPFMENDQIFFDGIM  249

Query  172  TSNGSPIVSAAAAANLLPSKHPHHLPAMYWN--EDAPTCSDSSPLTKKFLADDSHLTAAR  345
            +S        +A+ + L  K P  +P+ YWN  ED  T +D S   +  L    + T + 
Sbjct  250  SS-----TDGSASTHQLQLKRPI-VPSWYWNNQEDDQTAADPSSSKRIQLHQLDNGTNSN  303

Query  346  TDDQSGGG-----GSIATLLSQLPQQ---------NVSGDGVFRQPYPVSGLNWYS  471
                +GG       SIA LLSQLPQ             GDG+FR PY + G+NWYS
Sbjct  304  GAGINGGSTNNNSSSIANLLSQLPQTPPLHQHAVLGSLGDGIFRTPYQLPGMNWYS  359



>gb|AHJ79165.1| NAC domain protein NAC24 [Gossypium hirsutum]
 gb|KJB62740.1| hypothetical protein B456_009G433100 [Gossypium raimondii]
Length=344

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 84/158 (53%), Gaps = 19/158 (12%)
 Frame = +1

Query  34   MLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLEN-DQNIYEGMITSNGSPIVSAAAA  210
            MLGSI PSI    Q  + KF      +A ++G LLEN + ++++GM+ +N    ++  + 
Sbjct  194  MLGSIQPSISIGNQHNNPKFQFASKGTATSFGTLLENHEHSLFDGMMGNNSDEGINNGSM  253

Query  211  ANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTAARTDDQSGGGGSIATLL  390
            +  + +    +LP+++W ++    S      KKF  D +  +  + D    G GS+ TLL
Sbjct  254  SQSMVNPLKRNLPSLFWTDE---TSIEPQANKKFHGDSNDGSMEKMD----GNGSVTTLL  306

Query  391  SQLP------QQNVS-----GDGVFRQPYPVSGLNWYS  471
            SQLP      QQ  +     GDG++R P+ + GL+WYS
Sbjct  307  SQLPESPSLQQQQETMMGSMGDGIYRPPFQLPGLHWYS  344



>ref|XP_006362947.1| PREDICTED: NAC transcription factor 25-like [Solanum tuberosum]
Length=351

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 89/178 (50%), Gaps = 40/178 (22%)
 Frame = +1

Query  19   DDLNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGG-LLENDQNIYEGMITSNGSPIV  195
            DDLN+MLGSIP ++P +I        QG+    +NYG  LLEN+ N+Y+G++ +    I 
Sbjct  187  DDLNDMLGSIPQNVPNSIL-------QGV--KPSNYGTILLENESNMYDGIMNNTNDMIN  237

Query  196  SAAAAANLLPSKHPHHLPAMYWNEDAPTCS---DSSPLTKKFLADD--------SHLTAA  342
            +   +     SK   H   +YWN D  T +   + SP TK+FL ++        +++   
Sbjct  238  NNNRSIPQFSSKRSMH-GGLYWNIDETTTTTEGNHSPNTKRFLVENNRDDGLNMNNIARI  296

Query  343  RTDDQSGGGGSIATLLSQLPQQ--------------NVSGDGVFRQPY-PVSGLNWYS  471
               +QS    SIA  LS  PQ               ++S   VFRQPY  V+G+NWYS
Sbjct  297  TNHEQS---SSIANFLSHFPQNTSIQQEQQEQQVLGSLSDGVVFRQPYNQVTGMNWYS  351



>gb|KHG07368.1| NAC domain-containing 18 -like protein [Gossypium arboreum]
Length=347

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 83/161 (52%), Gaps = 22/161 (14%)
 Frame = +1

Query  34   MLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLEN-DQNIYEGMITSNGSPIVSAAAA  210
            MLGSI PSI    Q  + KF      +A ++G LLEN + ++++GM+ +N    ++  + 
Sbjct  194  MLGSIQPSISIGNQHNNPKFQFASKGTATSFGTLLENHEHSLFDGMMGNNSDEGINNGSM  253

Query  211  ANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTAARTDDQSGGGGSIATLL  390
            +  + +    +LP+++W ++  T   ++   KKF  D +  +  + D    G GS+ TLL
Sbjct  254  SQSMVNPLKRNLPSLFWTDETSTEPQAN---KKFHGDSNDGSMEKMD----GNGSVTTLL  306

Query  391  SQLPQ--------------QNVSGDGVFRQPYPVSGLNWYS  471
            SQL Q                  GDG++R P+ + GL+WYS
Sbjct  307  SQLRQSPSLQQQQQQQETMMGSMGDGIYRPPFQLPGLHWYS  347



>ref|XP_010268761.1| PREDICTED: NAC transcription factor 25-like [Nelumbo nucifera]
Length=353

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 92/182 (51%), Gaps = 38/182 (21%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTH-QKFHQGLFKSAANYGGLLENDQNIYEGMIT  174
            P++ +++D +++MLG     +PT+  F   Q+  +   +  A YG LLE D+N +EG++T
Sbjct  185  PMERDKEDSMDDMLG-----LPTSTSFMEVQQSSKQPTQRTATYGSLLETDENFFEGLLT  239

Query  175  SNG--------------SPIVSAAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKF  312
             +G                 +S   AA+L P K    LP+ YWN+ +     S+   K+F
Sbjct  240  DDGVNSTSITQLGSASSKTELSMVPAASLPPLKR--TLPSPYWNDVSAVGPSSA---KRF  294

Query  313  LADDSHLTAARTDDQSGGGGSIATLL-SQLPQQNV--------SGDGVFRQPYPVSGLNW  465
             A++ + + +   D +     I TLL +QLPQ            GDGVFRQPY  SG+NW
Sbjct  295  HANNHNNSGS---DTTNANSPITTLLLNQLPQATPFHSPLLGPMGDGVFRQPYQFSGMNW  351

Query  466  YS  471
             S
Sbjct  352  NS  353



>ref|XP_004487678.1| PREDICTED: NAC domain-containing protein 18-like [Cicer arietinum]
Length=356

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 90/180 (50%), Gaps = 31/180 (17%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITS  177
            P++H+R+D +++M+G +PPSI   +   + +FH     ++ N   LLENDQN+ EGM+ S
Sbjct  183  PVEHDREDSMDDMIGGVPPSI--NVGQMNARFHFSKMSNSYN-NTLLENDQNLLEGMMLS  239

Query  178  NGSPIVSAAAAAN---------LLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKF--LADD  324
            N +   +  A  +            S     L ++YWN+      D +   K+F   +D 
Sbjct  240  NNNNNNNTVATLSSQLGGSASTSNASASKRTLSSLYWNDH----EDVAASNKRFNLESDH  295

Query  325  SHLTAARTDDQSGG-GGSIATLLSQLPQQNVS----------GDGVFR-QPYPVSGLNWY  468
             H +  R D +SG    S A+LL+ LPQ   S          GDG+ R  PY + G+NWY
Sbjct  296  HHGSVVRNDQESGTVATSFASLLNNLPQTPNSLHQQTMLGSIGDGLLRTTPYQIQGMNWY  355



>gb|KEH38791.1| NAC transcription factor-like protein [Medicago truncatula]
Length=354

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 91/182 (50%), Gaps = 37/182 (20%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYG-GLLENDQNIYEGMIT  174
            P++H+R+D +++M+G +PPSI         +FH     S+ NY   LLENDQN+ EGM+ 
Sbjct  183  PVEHDREDSMDDMIGGVPPSINVGQMSVASRFHNFSRLSSNNYNNALLENDQNLLEGMMM  242

Query  175  SNGS--------------PIVSAAAAANLLPSKHPHHLPAMY-WN-EDAPTCSDSSPLTK  306
            +N +              P ++ ++ AN  PSK    L ++Y WN ED      +S   K
Sbjct  243  NNNNTLGGSNSKAELSFVPTMTTSSNAN-SPSK--RTLSSLYNWNDEDVAAQVGTSSSNK  299

Query  307  KFLADDSHLTAARTDDQSGG-GGSIATLLSQLPQ-------QNVSGDGVFRQPYPVSGLN  462
            +F  ++      R D ++G    S A+LL+ LPQ       Q + G      PY + G+N
Sbjct  300  RFSLEN----VVRNDQENGTVATSFASLLNNLPQTSSLHQPQTMLGS----IPYQIQGMN  351

Query  463  WY  468
            WY
Sbjct  352  WY  353



>gb|AGS08759.1| NAC domain protein [Malus hupehensis]
Length=364

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 89/176 (51%), Gaps = 27/176 (15%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSI-PPSIPTTIQFTHQKFHQGLFKSAANYGG-LLENDQNIYEGMI  171
            P+DHER+D + +++G + PPSI       + K H    KS ++YG   +ENDQ  ++G++
Sbjct  192  PMDHEREDSMEDIMGPLMPPSISHVGHHQNMKLH--FPKSNSSYGPPFMENDQIFFDGIM  249

Query  172  TSNGSPIVSAAAAANLLPSKHPHHLPAMYWN--EDAPTCSDSSPLTKKFLADDSHLTAAR  345
            +S        +A+ + L  K P  +P+ YWN  ED  T +D S   +  L    + T + 
Sbjct  250  SS-----TDGSASTHQLQLKRPI-VPSWYWNNQEDDQTAADPSSSKRIQLHQLDNGTNSN  303

Query  346  TDDQSGGG-----GSIATLLSQLPQQ---------NVSGDGVFRQPYPVSGLNWYS  471
                +GG       SI  LLSQL Q             GDG+FR PY + G+NWYS
Sbjct  304  GAGINGGSTNNNSSSITNLLSQLSQTPPLHQHAVLGSLGDGIFRTPYQLPGMNWYS  359



>gb|AEQ28762.1| NAC domain class transcription factor [Prunus salicina]
Length=358

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 87/170 (51%), Gaps = 21/170 (12%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSI-PPSIPTTIQFTHQKFHQGLFKSAANYGG-LLENDQNIYEGMI  171
            P+D ER+D + +M+G + PPSI       HQ  +  L  S  NYG   +ENDQ I++G++
Sbjct  192  PMDLEREDSMEDMMGPLMPPSISHVGH--HQNMNLHLPNSNTNYGPPFIENDQIIFDGIM  249

Query  172  TS-NGSPIVSAAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTAART  348
            +S +GS   S +   + LP K    +P++YWN+     S S  + +    D        +
Sbjct  250  SSTDGS--ASLSNGTSQLPLKR-SIVPSLYWNDRTAGASSSKRVVQLHQLDSG---TNNS  303

Query  349  DDQSGGGGSIATLLSQLPQQ---------NVSGDGVFRQPYPVSGLNWYS  471
               +    SIA LLSQLPQ             GDG+FR PY + G+NW+S
Sbjct  304  VAANNNSTSIANLLSQLPQTPPLHQHAMLGSLGDGLFRTPYQLPGMNWFS  353



>ref|XP_007211475.1| hypothetical protein PRUPE_ppa007577mg [Prunus persica]
 gb|EMJ12674.1| hypothetical protein PRUPE_ppa007577mg [Prunus persica]
Length=363

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 91/174 (52%), Gaps = 25/174 (14%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSI-PPSIPTTIQFTHQKFHQGLFKSAANYGG-LLENDQNIYEGMI  171
            P+D ER+D + +M+G + PPSI       HQ  +  L KS  NYG   +ENDQ I++G++
Sbjct  193  PMDLEREDSMEDMMGPLMPPSISHVGH--HQNMNLHLPKSNTNYGPPFIENDQIIFDGIM  250

Query  172  TS-NGSPIVSAAAAANLLPSKHPHHLPAMYWN--EDAPTCSDSSPLTKKFLADDSHLTAA  342
            +S +GS   S +   + LP K    +P++YWN  ED  T   SS    K +     L + 
Sbjct  251  SSTDGS--ASLSNGTSQLPLKR-SIVPSLYWNDQEDDQTAGASS---SKRVVQLHQLDSG  304

Query  343  RTDDQSGGGG--SIATLLSQLPQQ---------NVSGDGVFRQPYPVSGLNWYS  471
              +  +      SIA LLSQLPQ             GDG+FR PY + G+NW+S
Sbjct  305  TNNSVAANNNSTSIANLLSQLPQTPPLHQHAMLGSLGDGLFRTPYQLPGMNWFS  358



>gb|AAU43923.2| NAC domain protein [Solanum lycopersicum]
Length=355

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 93/182 (51%), Gaps = 44/182 (24%)
 Frame = +1

Query  19   DDLNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGG-LLENDQNIYEGMITSNGSPIV  195
            DDL++MLGSIP ++P +I        QG+    +NYG  LLEN+ N+Y+G++ +    I 
Sbjct  187  DDLHDMLGSIPQNVPNSIL-------QGI--KPSNYGTILLENESNMYDGIMNNTNDIIN  237

Query  196  SAAAAANLLPSKHPHHLPAMYWNEDAPTC------SDSSPLTKKFLADD--------SHL  333
            +   +   + SK   H   +YWN D  T        + SP TK+FL ++        +++
Sbjct  238  NNNRSIPQISSKRTMH-GGLYWNNDEATTTTTTIDRNHSPNTKRFLVENNEDDGLNMNNI  296

Query  334  TAARTDDQSGGGGSIATLLSQLPQ-----------QNVSG---DG-VFRQPY-PVSGLNW  465
            +     +QS    SIA  LSQ PQ           + V G   DG VFRQPY  V+G+NW
Sbjct  297  SRITNHEQS---SSIANFLSQFPQNPSIQQQQQQQEEVLGSLNDGVVFRQPYNQVTGMNW  353

Query  466  YS  471
            YS
Sbjct  354  YS  355



>ref|NP_001234652.1| NAC domain protein [Solanum lycopersicum]
 gb|AAU43922.1| NAC domain protein [Solanum lycopersicum]
Length=355

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 93/182 (51%), Gaps = 44/182 (24%)
 Frame = +1

Query  19   DDLNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGG-LLENDQNIYEGMITSNGSPIV  195
            DDL++MLGSIP ++P +I        QG+    +NYG  LLEN+ N+Y+G++ +    I 
Sbjct  187  DDLHDMLGSIPQNVPNSIL-------QGI--KPSNYGTILLENESNMYDGIMNNTNDIIN  237

Query  196  SAAAAANLLPSKHPHHLPAMYWNEDAPTC------SDSSPLTKKFLADD--------SHL  333
            +   +   + SK   H   +YWN D  T        + SP TK+FL ++        +++
Sbjct  238  NNNRSIPQISSKRTMH-GGLYWNNDEATTTTTTIDRNHSPNTKRFLVENNEDDGLNMNNI  296

Query  334  TAARTDDQSGGGGSIATLLSQLPQ-----------QNVSG---DG-VFRQPY-PVSGLNW  465
            +     +QS    SIA  LSQ PQ           + V G   DG VFRQPY  V+G+NW
Sbjct  297  SRITNHEQS---SSIANFLSQFPQNPSIQQQQQQQEEVLGSLNDGVVFRQPYNQVTGMNW  353

Query  466  YS  471
            YS
Sbjct  354  YS  355



>gb|ACJ14498.1| mutant NAC domain protein [Solanum lycopersicum]
Length=355

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 93/182 (51%), Gaps = 44/182 (24%)
 Frame = +1

Query  19   DDLNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGG-LLENDQNIYEGMITSNGSPIV  195
            DDL++MLGSIP ++P +I        QG+    +NYG  LLEN+ N+Y+G++ +    I 
Sbjct  187  DDLHDMLGSIPQNVPNSIL-------QGI--KPSNYGTILLENESNMYDGIMNNTNDIIN  237

Query  196  SAAAAANLLPSKHPHHLPAMYWNEDAPTC------SDSSPLTKKFLADD--------SHL  333
            +   +   + SK   H   +YWN D  T        + SP TK+FL ++        +++
Sbjct  238  NNNRSIPQISSKRTMH-GGLYWNNDEATTTTTTIDRNHSPNTKRFLVENNEDDGLNMNNI  296

Query  334  TAARTDDQSGGGGSIATLLSQLPQ-----------QNVSG---DG-VFRQPY-PVSGLNW  465
            +     +QS    SIA  LSQ PQ           + V G   DG VFRQPY  V+G+NW
Sbjct  297  SRITNHEQS---SSIANFLSQFPQNPSIQQQQQQQEEVLGSLNDGVVFRQPYNQVTGMNW  353

Query  466  YS  471
            YS
Sbjct  354  YS  355



>ref|XP_010278293.1| PREDICTED: NAC transcription factor NAM-B2-like [Nelumbo nucifera]
Length=359

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 84/179 (47%), Gaps = 38/179 (21%)
 Frame = +1

Query  13   ERDDLNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGG-LLENDQNIYEGMITSNG--  183
            ERD  + M   +  ++PT+     Q   Q   +   NYGG LLE+D N +EG+++ +G  
Sbjct  189  ERDKEDSMTDMM--ALPTSTVEGQQSSKQPPAQRTTNYGGMLLESDDNFFEGLLSEDGVN  246

Query  184  --------SPIVSA-------AAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLA  318
                    S  +S        AA A  LP K P   P+ Y+NE A     SS  TKKF  
Sbjct  247  SSSLPQFGSSSISTTELSMFPAATATQLPLKRP--FPSPYFNEVAAIGPSSS--TKKFHP  302

Query  319  DDSHLTAARTDDQSGGGGSIATLLSQLPQQNVS----------GDGVFRQPYPVSGLNW  465
            D +   +  T+        IATLL+QLPQ              G+GV RQPY +SG+NW
Sbjct  303  DHNSSGSGSTN----ANNPIATLLNQLPQAATPFHNHTLLGSLGEGVLRQPYQLSGINW  357



>ref|XP_004174082.1| PREDICTED: LOW QUALITY PROTEIN: NAC transcription factor 25-like, 
partial [Cucumis sativus]
Length=333

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 82/181 (45%), Gaps = 36/181 (20%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITS  177
            P+D ER+D + EM+GSIP S+    Q+          K   NY  LLENDQN+ +G++ +
Sbjct  165  PMDQEREDSMEEMIGSIPHSLRLNDQYP---------KLGINYSTLLENDQNLLQGIVAN  215

Query  178  NGSPIVSAAAAANLLPSKHPHHLPAMYW---NEDAPTCSDSSPLTKKFLADDSHLTAART  348
            N +   +  A +N   SK P    +++W   ++D    S +  L  +   D +  +  RT
Sbjct  216  NNNDNNNNGAVSNGTNSKRP---ASLFWSDEDQDHSGISSNKRLHFENTTDGASTSITRT  272

Query  349  DDQS-----GGGGSIATLLSQLPQQ---------------NVSGDGVFRQPYPVSGLNWY  468
               S         S  TLL+ LPQ                   GDG+FR  Y + G NWY
Sbjct  273  HSSSHNNLQNSTSSFTTLLTNLPQTPPPPLHHHSGAHSVLASIGDGLFRPAYQIPGANWY  332

Query  469  S  471
            S
Sbjct  333  S  333



>ref|XP_004149287.1| PREDICTED: NAC transcription factor 25-like [Cucumis sativus]
 gb|KGN56220.1| hypothetical protein Csa_3G100800 [Cucumis sativus]
Length=353

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 82/181 (45%), Gaps = 36/181 (20%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITS  177
            P+D ER+D + EM+GSIP S+    Q+          K   NY  LLENDQN+ +G++ +
Sbjct  185  PMDQEREDSMEEMIGSIPHSLRLNDQYP---------KLGINYSTLLENDQNLLQGIVAN  235

Query  178  NGSPIVSAAAAANLLPSKHPHHLPAMYW---NEDAPTCSDSSPLTKKFLADDSHLTAART  348
            N +   +  A +N   SK P    +++W   ++D    S +  L  +   D +  +  RT
Sbjct  236  NNNDNNNNGAVSNGTNSKRP---ASLFWSDEDQDHSGISSNKRLHFENTTDGASTSITRT  292

Query  349  DDQS-----GGGGSIATLLSQLPQQ---------------NVSGDGVFRQPYPVSGLNWY  468
               S         S  TLL+ LPQ                   GDG+FR  Y + G NWY
Sbjct  293  HSSSHNNLQNSTSSFTTLLTNLPQTPPPPLHHHSGAHSVLASIGDGLFRPAYQIPGANWY  352

Query  469  S  471
            S
Sbjct  353  S  353



>ref|XP_006370307.1| no apical meristem family protein [Populus trichocarpa]
 gb|ERP66876.1| no apical meristem family protein [Populus trichocarpa]
Length=360

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 84/167 (50%), Gaps = 34/167 (20%)
 Frame = +1

Query  34   MLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITSNGSPIVSAAAAA  213
            +LGSIPPSI      +HQ     L K   N+G LL+ND N++EG+I+S+     S+++ +
Sbjct  207  VLGSIPPSISVG---SHQNGTLHLAK-GTNFGALLDNDHNLFEGIISSSDGIRSSSSSLS  262

Query  214  N-----------LLPSKHPHHLPAMYWN-EDAPTCSDSSPLTKKFLADDSHLTAARTDDQ  357
            +           +LP K    LP++YW  ED    S S         D+      RTD  
Sbjct  263  HMASSVTKRDLLMLPPK--RTLPSLYWTGEDMVGPSSSKRFQGGINGDE---IVVRTD--  315

Query  358  SGGGGSIATLLSQLP------QQNVSG---DGVFRQPYPVSGLNWYS  471
              G  S+ATLL +LP      QQ + G   DG+FR PY +  +NWYS
Sbjct  316  --GNSSVATLLGELPQTPQLHQQTMLGSMADGIFRSPYQIPSMNWYS  360



>ref|XP_008226677.1| PREDICTED: NAC transcription factor 25 [Prunus mume]
Length=371

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 89/177 (50%), Gaps = 25/177 (14%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTH-QKFHQGLFKSAANYGG-LLENDQNIYEGMI  171
            P+D ER+D + +M+G  P  +P+     H Q  +  L KS  NYG   +END   ++G++
Sbjct  195  PMDLEREDSMEDMMG--PLMLPSISHVGHHQNMNLHLPKSDTNYGPPFIENDPIFFDGIM  252

Query  172  TS-NGSPIVSAAAAANLLPSKHPHHLPAMYWNE---DAPTCSDSSPLTKKFLADDSHLTA  339
            +S NGS  +S   +   LP K    +P+ YWN+   +    + SS    +    DS    
Sbjct  253  SSTNGSASLSNGTSQ--LPLKR-SIVPSFYWNDQDDNQTAGASSSKRVVQLHQLDSGTNN  309

Query  340  ARTDDQSGG----GGSIATLLSQLPQQ---------NVSGDGVFRQPYPVSGLNWYS  471
            + +D  +G       SIA LLSQLPQ             GDG+FR PY + G+NW+S
Sbjct  310  SASDGINGAPNNNSTSIANLLSQLPQTPPLHQHAMLGSLGDGLFRTPYQLPGMNWFS  366



>ref|XP_004291668.1| PREDICTED: NAC domain-containing protein 18-like [Fragaria vesca 
subsp. vesca]
Length=344

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 83/177 (47%), Gaps = 44/177 (25%)
 Frame = +1

Query  1    PIDHERDDLNEMLGSIPPSIPTTIQFTHQKFHQGLFKSA-ANYGGLLENDQNIYEGMITS  177
            P+D E D ++  +GS          F   K H    KS  + YG  ++ND N Y+GM++S
Sbjct  192  PMDLE-DSMDGTMGS---------SFPLSKLHHLPPKSTTSTYGQFMDNDHNFYDGMVSS  241

Query  178  NG-----SPIVSAAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTAA  342
             G     S + ++A A + LP K    LP +YWN D     D +  +++   D S     
Sbjct  242  EGINTSASFLPNSALANSSLPLKR--ELPNLYWNHDP---EDEAGPSRRLHMDSS-----  291

Query  343  RTDDQSGGGGSIATLLSQLPQ-------------QNVSGDGVFRQP-YPVSGLNWYS  471
               DQS G GSIA LLSQLPQ               + GD +FR   Y + G NWYS
Sbjct  292  ---DQSTGNGSIAILLSQLPQTPPPLHQQPMLGTSQLGGDALFRSTQYQLPG-NWYS  344



>ref|XP_011042501.1| PREDICTED: NAC domain-containing protein 18-like [Populus euphratica]
Length=358

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 84/167 (50%), Gaps = 34/167 (20%)
 Frame = +1

Query  34   MLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITSNGSPIVSAAAAA  213
            +LGS PPSI      +HQ     L K   N+G LL+NDQN++EG+I+S+     S+++ +
Sbjct  205  VLGSTPPSISVG---SHQNGTLHLAK-GTNFGALLDNDQNLFEGIISSSDGIRSSSSSLS  260

Query  214  N-----------LLPSKHPHHLPAMYWN-EDAPTCSDSSPLTKKFLADDSHLTAARTDDQ  357
            +           +LP K    LP++YW  ED    S S         D+      RTD  
Sbjct  261  HMASSVSKRDLLMLPPK--RALPSLYWTGEDIIGPSSSKRFQGGINGDE---IVVRTD--  313

Query  358  SGGGGSIATLLSQLP------QQNVSG---DGVFRQPYPVSGLNWYS  471
              G  S+ATLL +LP      QQ + G   DG+FR PY +  +NWYS
Sbjct  314  --GNSSVATLLGELPQTPQLHQQTMLGSMADGIFRPPYQIPSMNWYS  358



>ref|XP_008452274.1| PREDICTED: NAC transcription factor 25-like [Cucumis melo]
Length=353

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 82/182 (45%), Gaps = 37/182 (20%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITS  177
            P+D ER+D + EM+GSIP S+    Q+          K   NY  LLENDQN+ +G++ +
Sbjct  184  PMDQEREDSMEEMIGSIPHSLRLNDQYP---------KLGINYTTLLENDQNLLQGIVAN  234

Query  178  NGSPIVSAAAAANLLPSKHPHHLPAMYW-NEDAPTCSDSSPLTKKF---LADDSHLTAAR  345
            N +   +  A +N   SK P    +++W +ED      SS     F     D +  +  R
Sbjct  235  NSNDNNNNGALSNATNSKRP---ASLFWTDEDQDHSGISSNKRLHFENTTTDGASTSITR  291

Query  346  T-----DDQSGGGGSIATLLSQLPQQ---------------NVSGDGVFRQPYPVSGLNW  465
            T     ++      S  TLL+ LPQ                   GDG+FR  Y + G NW
Sbjct  292  THSSNHNNLQSSTSSFTTLLTNLPQTPPPPMHHHGGAHSVLASIGDGLFRPAYQIPGANW  351

Query  466  YS  471
            YS
Sbjct  352  YS  353



>emb|CAG28971.1| NAM-like protein [Prunus persica]
Length=363

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 90/174 (52%), Gaps = 25/174 (14%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSI-PPSIPTTIQFTHQKFHQGLFKSAANYGG-LLENDQNIYEGMI  171
            P+D ER+D + +M+G + PPSI       HQ  +  L KS  NYG   +ENDQ I++G++
Sbjct  193  PMDLEREDSMEDMMGPLMPPSISHVGH--HQNMNLHLPKSNTNYGPPFIENDQIIFDGIM  250

Query  172  TS-NGSPIVSAAAAANLLPSKHPHHLPAMYWN--EDAPTCSDSSPLTKKFLADDSHLTAA  342
            +S +GS   S +   + LP K    +P++Y N  ED  T   SS    K +     L + 
Sbjct  251  SSTDGS--ASLSNGTSQLPLKR-SIVPSLYRNDQEDDQTAGASS---SKRVVQLHQLDSG  304

Query  343  RTDDQSGGGG--SIATLLSQLPQQ---------NVSGDGVFRQPYPVSGLNWYS  471
              +  +      SIA LLSQLPQ             GDG+FR PY + G+NW+S
Sbjct  305  TNNSVAANNNSTSIANLLSQLPQTPPLHQHAMLGSLGDGLFRTPYQLPGMNWFS  358



>gb|KDO74154.1| hypothetical protein CISIN_1g016791mg [Citrus sinensis]
Length=198

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 79/183 (43%), Gaps = 42/183 (23%)
 Frame = +1

Query  46   IPPS--IPTTIQFTHQKFHQGLFKSAAN-YGGLLENDQNIYEGMITSNGSPIVSAAAAAN  216
            IPPS  I +  Q T+ K H     +  N +G LL N+ N +EG+ TS+     +++   N
Sbjct  17   IPPSLMISSQQQNTNLKLHMPTRGANLNSFGALLVNEPNFFEGL-TSHDGINNNSSNNNN  75

Query  217  LLPSKHPHH---------------------LPAMYWNEDAPTCSDSSPLTKKFLAD----  321
               S H HH                     LP+  W +     S  + + K+F  +    
Sbjct  76   GSISSHHHHQFAASSSSKLQVQAMDSLKRTLPSSSWTDHEDVPSGGALVNKRFHGENNVN  135

Query  322  DSHLTAARTDDQSGGGGSIATLLSQLPQQ------------NVSGDGVFRQPY-PVSGLN  462
            D      RTD    G  SIATLLSQLPQ                GDG+FRQPY  + G+N
Sbjct  136  DDQSIEGRTDHHGNGSSSIATLLSQLPQTPPPPSIHQQAILGSLGDGIFRQPYHQLPGMN  195

Query  463  WYS  471
            WYS
Sbjct  196  WYS  198



>gb|KDO74153.1| hypothetical protein CISIN_1g016791mg [Citrus sinensis]
Length=276

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 79/183 (43%), Gaps = 42/183 (23%)
 Frame = +1

Query  46   IPPS--IPTTIQFTHQKFHQGLFKSAAN-YGGLLENDQNIYEGMITSNGSPIVSAAAAAN  216
            IPPS  I +  Q T+ K H     +  N +G LL N+ N +EG+ TS+     +++   N
Sbjct  95   IPPSLMISSQQQNTNLKLHMPTRGANLNSFGALLVNEPNFFEGL-TSHDGINNNSSNNNN  153

Query  217  LLPSKHPHH---------------------LPAMYWNEDAPTCSDSSPLTKKFLAD----  321
               S H HH                     LP+  W +     S  + + K+F  +    
Sbjct  154  GSISSHHHHQFAASSSSKLQVQAMDSLKRTLPSSSWTDHEDVPSGGALVNKRFHGENNVN  213

Query  322  DSHLTAARTDDQSGGGGSIATLLSQLPQQ------------NVSGDGVFRQPY-PVSGLN  462
            D      RTD    G  SIATLLSQLPQ                GDG+FRQPY  + G+N
Sbjct  214  DDQSIEGRTDHHGNGSSSIATLLSQLPQTPPPPSIHQQAILGSLGDGIFRQPYHQLPGMN  273

Query  463  WYS  471
            WYS
Sbjct  274  WYS  276



>gb|AID55348.1| NAC protein 1 [Actinidia arguta]
Length=321

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 78/158 (49%), Gaps = 19/158 (12%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITS  177
            P+DHERDD +++ML  +PPS     Q T +   +     A +YG  L N+  +++ M+  
Sbjct  182  PLDHERDDTMSDMLARMPPSSIPLCQHTPKLPPE----KATSYGSFLGNEHTLFDEMLGH  237

Query  178  NGSPIVSAAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTAARTDDQ  357
            + +  +S  A+   LP K    LP++YW +D      SS  +K+ +  D +  +    D+
Sbjct  238  DNT-YISHLASKPQLPMKR--ALPSVYWVDDVGEAGSSS--SKRVIHLDGNEGSTSKTDE  292

Query  358  SGGGGSIATLLSQLPQQNVSGDGVFRQPYPVSGLNWYS  471
            +    ++ + LSQLPQ     D VFR         WYS
Sbjct  293  TNSMATLLSSLSQLPQTPSMMDDVFR---------WYS  321



>gb|AGC27321.1| NAC domain protein 10 [Gossypium hirsutum]
Length=347

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 86/181 (48%), Gaps = 35/181 (19%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPT-TIQFTHQKFHQGLFKSAANYGGLLEN-DQNIYEGMI  171
            P+ +E+D+ +++M G +P S+   ++QF  +    G F         LEN + N+++GM+
Sbjct  180  PLGYEKDEAMDDMGGPVPTSMSIGSLQFQTKGTSCGTF---------LENHEHNLFDGML  230

Query  172  TSNGSPIVSAAAAANLLPSKHP----------HHLPAMYWNEDAPTCSDSSPLTKKFLAD  321
             S+G     + +      S  P            +P++YW ++      +SP T K    
Sbjct  231  GSDGMNNNGSMSHLGRCSSSKPDLSMVNPLKRSTVPSLYWTDE----DTASPSTSKTFHG  286

Query  322  DSHLTAARTDDQSGGGGSIATLLSQLP------QQNVSG---DGVFRQPYPVSGLNWYS*  474
            D     +     + G  SIATLLSQLP      QQ + G   DG+FR  Y + GLNWY+ 
Sbjct  287  DHSNDGSLEKPDTNGSNSIATLLSQLPQTPHLQQQTMVGSMEDGIFRPSYQLPGLNWYTL  346

Query  475  N  477
            N
Sbjct  347  N  347



>gb|AID55352.1| NAC protein 1 [Actinidia chinensis]
Length=321

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 80/159 (50%), Gaps = 21/159 (13%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPS-IPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMIT  174
            P+DHERDD +++ML  +PPS IP       Q+  +   + A +YG  L N+  +++ M+ 
Sbjct  182  PMDHERDDTMSDMLARMPPSSIPLC-----QQTPKLPPEKATSYGSFLGNEHTLFDEMLG  236

Query  175  SNGSPIVSAAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTAARTDD  354
             + +  +S  A+   LP K    LP++YW +D      SS  +K+ +  D +  +    D
Sbjct  237  HDNA-YISHLASKPQLPMKR--ALPSVYWVDDVGEAGSSS--SKRLIHLDGNEGSTSKTD  291

Query  355  QSGGGGSIATLLSQLPQQNVSGDGVFRQPYPVSGLNWYS  471
            ++    ++ + LSQLPQ     D VFR         WYS
Sbjct  292  ETNSMATLLSSLSQLPQTPSMMDDVFR---------WYS  321



>gb|KHG20342.1| NAC domain-containing 18 -like protein [Gossypium arboreum]
Length=349

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 86/181 (48%), Gaps = 35/181 (19%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPT-TIQFTHQKFHQGLFKSAANYGGLLEN-DQNIYEGMI  171
            P+ +E+D+ +++M G +P S+   ++QF  +    G F         LEN + N+++GM+
Sbjct  182  PLGYEKDEAMDDMGGPVPTSMSIGSLQFQTKGTSCGTF---------LENHEHNLFDGML  232

Query  172  TSNGSPIVSAAAAANLLPSKHP----------HHLPAMYWNEDAPTCSDSSPLTKKFLAD  321
             S+G     + +      S  P            +P++YW ++      +SP T K    
Sbjct  233  GSDGMNNNGSMSHLGRCSSSKPDLSMVNPLKRSTVPSLYWTDE----DTASPSTSKTFHG  288

Query  322  DSHLTAARTDDQSGGGGSIATLLSQLP------QQNVSG---DGVFRQPYPVSGLNWYS*  474
            D     +     + G  SIATLLSQLP      QQ + G   DG+FR  Y + GLNWY+ 
Sbjct  289  DHSNDGSLEKPDTNGSNSIATLLSQLPQTPHLQQQTMVGSMEDGIFRPSYQLPGLNWYTL  348

Query  475  N  477
            N
Sbjct  349  N  349



>gb|AGC27313.1| NAC domain protein 10 [Gossypium hirsutum]
Length=349

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 86/181 (48%), Gaps = 35/181 (19%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPT-TIQFTHQKFHQGLFKSAANYGGLLEN-DQNIYEGMI  171
            P+ +E+D+ +++M G +P S+   ++QF  +    G F         LEN + N+++GM+
Sbjct  182  PLGYEKDEAIDDMGGPVPTSMSIGSLQFQTKGTSCGTF---------LENHEHNLFDGML  232

Query  172  TSNGSPIVSAAAAANLLPSKHP----------HHLPAMYWNEDAPTCSDSSPLTKKFLAD  321
             S+G     + +      S  P            +P++YW ++      +SP T K    
Sbjct  233  GSDGINNNGSMSHLGCCSSSKPDLSMVNPLKRRTVPSLYWTDE----DTASPSTSKTFHG  288

Query  322  DSHLTAARTDDQSGGGGSIATLLSQLPQ------QNVSG---DGVFRQPYPVSGLNWYS*  474
            D     +     + G  SIATLLSQLPQ      Q + G   DG+FR  Y + GLNWY+ 
Sbjct  289  DHSNDGSLEKPDTNGSISIATLLSQLPQTPHLQQQTMVGSMEDGIFRPSYQLPGLNWYTL  348

Query  475  N  477
            N
Sbjct  349  N  349



>gb|KJB81906.1| hypothetical protein B456_013G167100 [Gossypium raimondii]
Length=349

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 86/181 (48%), Gaps = 35/181 (19%)
 Frame = +1

Query  1    PIDHERDD-LNEMLGSIPPSIPT-TIQFTHQKFHQGLFKSAANYGGLLEN-DQNIYEGMI  171
            P+ +E+D+ +++M G +P S+   ++QF  +    G F         LEN + N+++GM+
Sbjct  182  PLGYEKDEAMDDMGGPVPTSMSIGSLQFQTKGTSCGTF---------LENHEHNLFDGML  232

Query  172  TSNGSPIVSAAAAANLLPSKHP----------HHLPAMYWNEDAPTCSDSSPLTKKFLAD  321
             S+G     + +      S  P            +P++YW ++      +SP T K    
Sbjct  233  GSDGVNNNGSMSHLGCCSSSKPDLSMVNPLKRSTVPSLYWTDE----DTASPSTSKTFHG  288

Query  322  DSHLTAARTDDQSGGGGSIATLLSQLPQ------QNVSG---DGVFRQPYPVSGLNWYS*  474
            D     +     + G  SIATLLSQLPQ      Q + G   DG+FR  Y + GLNWY+ 
Sbjct  289  DHSNDGSLEKPDTNGSISIATLLSQLPQTPHLQQQTMVGSMEDGIFRPSYQLPGLNWYTL  348

Query  475  N  477
            N
Sbjct  349  N  349



>ref|XP_006451941.1| hypothetical protein CICLE_v10008628mg [Citrus clementina]
 ref|XP_006464707.1| PREDICTED: NAC transcription factor 25-like [Citrus sinensis]
 gb|ESR65181.1| hypothetical protein CICLE_v10008628mg [Citrus clementina]
 gb|KDO74152.1| hypothetical protein CISIN_1g016791mg [Citrus sinensis]
Length=382

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 79/183 (43%), Gaps = 42/183 (23%)
 Frame = +1

Query  46   IPPS--IPTTIQFTHQKFHQGLFKSAAN-YGGLLENDQNIYEGMITSNGSPIVSAAAAAN  216
            IPPS  I +  Q T+ K H     +  N +G LL N+ N +EG+ TS+     +++   N
Sbjct  201  IPPSLMISSQQQNTNLKLHMPTRGANLNSFGALLVNEPNFFEGL-TSHDGINNNSSNNNN  259

Query  217  LLPSKHPHH---------------------LPAMYWNEDAPTCSDSSPLTKKFLAD----  321
               S H HH                     LP+  W +     S  + + K+F  +    
Sbjct  260  GSISSHHHHQFAASSSSKLQVQAMDSLKRTLPSSSWTDHEDVPSGGALVNKRFHGENNVN  319

Query  322  DSHLTAARTDDQSGGGGSIATLLSQLPQQ------------NVSGDGVFRQPY-PVSGLN  462
            D      RTD    G  SIATLLSQLPQ                GDG+FRQPY  + G+N
Sbjct  320  DDQSIEGRTDHHGNGSSSIATLLSQLPQTPPPPSIHQQAILGSLGDGIFRQPYHQLPGMN  379

Query  463  WYS  471
            WYS
Sbjct  380  WYS  382



>gb|EYU33415.1| hypothetical protein MIMGU_mgv1a009589mg [Erythranthe guttata]
Length=337

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 87/184 (47%), Gaps = 56/184 (30%)
 Frame = +1

Query  1    PIDHERDDLNE-MLGSIPPSIPTTIQFT--HQKFHQGLFKSAANYGGLLENDQN-IYEGM  168
            P+D ERD+ ++ ++GS    +P  +      Q+F              LEND +  Y+GM
Sbjct  183  PVDQERDEGHDVIMGSFKAGLPAAMAVVGEQQRF--------------LENDHSSFYDGM  228

Query  169  ITSNGS---------PIVSAAAAAN---LLPSKHPHHLPAMYWNEDAPTC--SDSSPLTK  306
            ++             P++ ++AAA+   +L  K    LP +YWN+D      S SSP TK
Sbjct  229  MSGGDHHLKLQHHQFPLLVSSAAADPNSILAGKRA--LPGLYWNDDGGGGGGSASSPPTK  286

Query  307  KFLADDSHLTAARTDDQSGGGGSIATLLSQLP---QQNVS-----GDGVFRQP-YPVSGL  459
            +FL +                GSI + L Q P   QQ+ +     GDGVFRQ  Y +SG+
Sbjct  287  RFLTESCD-------------GSIVSQLPQTPATLQQHQAMLGSLGDGVFRQQQYQISGM  333

Query  460  NWYS  471
            NWY+
Sbjct  334  NWYA  337



>ref|NP_001274379.1| NAC domain-containing protein 18-like [Glycine max]
 gb|AHB63578.1| NAC transcription factor [Glycine max]
Length=368

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 91/191 (48%), Gaps = 45/191 (24%)
 Frame = +1

Query  10   HERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANY-GGLLENDQNIYEGMITSNG  183
            HERDD +++M+G +PPSI   +   + +FH  L K + +Y G LLEND+N  EG++  NG
Sbjct  184  HERDDSMDDMIGEVPPSI--NVGHMNARFH--LSKMSTSYSGALLENDRNTLEGVVIGNG  239

Query  184  S-------------------PIVSAAAAANLLP----------SKHPHHLPAMYWNEDAP  276
            +                      S+ + A LLP          S     L ++YWN D  
Sbjct  240  NVNGINTNSINAISSSSSHHQFASSNSKAELLPFAPSNNNTSNSASKRTLSSLYWNVDDD  299

Query  277  TCSDSSPLTKKF-LADDSHLTAAR----TDDQSGGGGSIATLLSQLPQQNV--SGDGVFR  435
               D     K F L  + +++  R     ++ +G  GS ATLL+QLPQ       DG+ R
Sbjct  300  NDDDDH---KHFNLDSNGNVSVLRTEENNNNTNGTSGSFATLLNQLPQTPSLPQIDGLLR  356

Query  436  QPYPVSGLNWY  468
             PY + G NWY
Sbjct  357  TPYQIQGTNWY  367



>gb|KHN36348.1| NAC domain-containing protein 18 [Glycine soja]
Length=369

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 91/191 (48%), Gaps = 45/191 (24%)
 Frame = +1

Query  10   HERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANY-GGLLENDQNIYEGMITSNG  183
            HERDD +++M+G +PPSI   +   + +FH  L K + +Y G LLEND+N  EG++  NG
Sbjct  185  HERDDSMDDMIGEVPPSI--NVGHMNARFH--LSKMSTSYSGALLENDRNTLEGVVIGNG  240

Query  184  S-------------------PIVSAAAAANLLP----------SKHPHHLPAMYWNEDAP  276
            +                      S+ + A LLP          S     L ++YWN D  
Sbjct  241  NVNGINTNSINAISSSSSHHQFASSNSKAELLPFAPSNNNTSNSASKRTLSSLYWNVDDD  300

Query  277  TCSDSSPLTKKF-LADDSHLTAAR----TDDQSGGGGSIATLLSQLPQQNV--SGDGVFR  435
               D     K F L  + +++  R     ++ +G  GS ATLL+QLPQ       DG+ R
Sbjct  301  NDDDDH---KHFNLDSNGNVSVLRTEENNNNTNGTSGSFATLLNQLPQTPSLPQIDGLLR  357

Query  436  QPYPVSGLNWY  468
             PY + G NWY
Sbjct  358  TPYQIQGTNWY  368



>gb|AID55354.1| NAC protein 3 [Actinidia chinensis]
Length=319

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 80/166 (48%), Gaps = 39/166 (23%)
 Frame = +1

Query  4    IDHERDD----LNEMLGSIP----PSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIY  159
            I HE++D    L   + SIP    P +P T   ++ +              LL++D +++
Sbjct  183  IGHEKEDSMTDLPPTIFSIPQNQTPKLPPTKPISYTQI------------PLLDHDHHLF  230

Query  160  EGMITSNGSPIVSAAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTA  339
            + M++ +     S   AA+L  S     LP +YW       ++ S  +K+     S+ T 
Sbjct  231  DEMLSHS-----STDTAASL--SHLKRTLPPLYW-------ANESEASKRLHEGTSNETV  276

Query  340  ARTDDQSGGGGSIATLLSQLPQQNVS--GDGVFRQPYPVSGLNWYS  471
            ART +      SIA+LLSQ+PQ  +   GDG FRQPY    LNWYS
Sbjct  277  ARTRENDS---SIASLLSQMPQTVMRPIGDGGFRQPYSHPSLNWYS  319



>ref|XP_007025712.1| NAC domain containing protein 25 [Theobroma cacao]
 gb|EOY28334.1| NAC domain containing protein 25 [Theobroma cacao]
Length=351

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 79/186 (42%), Gaps = 45/186 (24%)
 Frame = +1

Query  1    PIDHERD-DLNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITS  177
            P++ ++D     ML ++P S       THQ       K A +YG LLEN++N +EG++T 
Sbjct  182  PMERDKDYSTVGMLATLPTS-------THQNPKPPTSK-ATSYGSLLENEENFFEGILTG  233

Query  178  NGS--------PIVS-----------AAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPL  300
             G         P  S           A+   N  P K    +P  YWNE  P  S  S  
Sbjct  234  EGMQHSTISQIPAASSSSKQDLSMSLASTTTNTFPVK--RTIPPQYWNE--PNSSFGSQS  289

Query  301  TKKFLADDSHLTAARTDDQSGGGGSIATLLSQLPQQ---------NVSGDGVFRQPYPVS  453
             K+F  D +  + A  DD +    S  +LL  LPQ             GDGV RQ + + 
Sbjct  290  GKRFQGDLNSSSTAGIDDTN----SFVSLLHHLPQNAPFYPGTLVGSLGDGVSRQQFILP  345

Query  454  GLNWYS  471
             +NW S
Sbjct  346  SMNWNS  351



>ref|XP_006841705.1| hypothetical protein AMTR_s00003p00252470 [Amborella trichopoda]
 gb|ERN03380.1| hypothetical protein AMTR_s00003p00252470 [Amborella trichopoda]
Length=349

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 86/188 (46%), Gaps = 55/188 (29%)
 Frame = +1

Query  4    IDHERDD-LNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITSN  180
            ++ ER+D +++ML  +P       +   QK         + +G LLEN +N ++G++T +
Sbjct  184  MEREREDSMDDMLAPLPSMDGQPHKLPAQK--------PSTFGALLEN-ENFFDGLLTDD  234

Query  181  GSPIVSAAAAANLLPSKHPHH--------------------LPAMYWNEDAPTCSDSSPL  300
            G  + +   +   LPS H  +                    LP+ YWNE A       PL
Sbjct  235  G--VSNNMNSMPQLPSSHQQNSTKSGGDLPLAPAALPFKRTLPSPYWNEAA------MPL  286

Query  301  TKKFLADDSHLTAARTDDQSGGGGSIATLLSQLP--------QQNVS--GDGVFRQPY-P  447
             K+F ++ S      T   + G  SIATLL+QLP        Q  +S  GDGVFR  Y  
Sbjct  287  AKRFQSNQS------TSGSNDGSNSIATLLNQLPGAAAPFHHQGLLSSIGDGVFRPQYQQ  340

Query  448  VSGLNWYS  471
             SG+NW S
Sbjct  341  FSGINWNS  348



>ref|XP_010089502.1| NAC domain-containing protein 18 [Morus notabilis]
 gb|EXB37905.1| NAC domain-containing protein 18 [Morus notabilis]
Length=391

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 91/199 (46%), Gaps = 45/199 (23%)
 Frame = +1

Query  4    IDHER---DDLNEMLGSIPPSIPTTIQFTHQ--KFHQGLFKSAA--NYGGLL-ENDQNIY  159
            +DH+    D +++MLG I  S  + +       K  Q L KSA   +YG  L END N++
Sbjct  195  LDHQERDHDSIDDMLGPINQSHLSNLVGPQNIGKLQQQLPKSATLLSYGSALSENDHNLF  254

Query  160  EGMITS---NGSPI---------VSAAAAANLLPSKHPHH---------LPAMYWNEDAP  276
            +GM++    NG  I          + A A++    + P H         LP MYWN+   
Sbjct  255  DGMLSCSNDNGININAAAAAAATTTTALASSSCSKQQPDHHQLPMKRAVLPGMYWNDVVD  314

Query  277  TCSDSS----PLTKKFLADDSHLTAARTDDQSGGGGSIATLLSQLPQQNVS---------  417
               D S      TK+   D  H       + +    S+ATLLSQ+P Q  S         
Sbjct  315  NDDDGSGPGSSSTKRLQLD--HDCLGTGTEGNSHANSLATLLSQIPAQTTSLHQQSVLGG  372

Query  418  -GDGVFRQPYPVSGLNWYS  471
             GDG+F++P+ + G+NW+S
Sbjct  373  LGDGLFQRPFQLPGMNWFS  391



>gb|AID55350.1| NAC protein 3 [Actinidia arguta]
Length=319

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 76/167 (46%), Gaps = 39/167 (23%)
 Frame = +1

Query  1    PIDHERD----DLNEMLGSIP----PSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNI  156
            PI HERD    DL   + SIP    P +P     ++                LL+ D ++
Sbjct  182  PIGHERDYSMTDLPSTIFSIPQNQTPKLPPIEPISYTPI------------PLLDPDHHL  229

Query  157  YEGMITSNGSPIVSAAAAANLLPSKHPHHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLT  336
            ++ M++ +   I   AA+ + L       LP +YW       ++ S  +K+     S+ T
Sbjct  230  FDEMLSHS---ITDTAASLSHLKRT----LPPLYW-------ANESEASKRLHEGTSNET  275

Query  337  AARTDDQSGGGGSIATLLSQLPQQNVS--GDGVFRQPYPVSGLNWYS  471
             A T +      SIA+LLSQ+PQ      GDG FRQP+    LNWYS
Sbjct  276  VATTRENDS---SIASLLSQMPQTVTRPIGDGGFRQPHSHPSLNWYS  319



>ref|XP_002316635.1| no apical meristem family protein [Populus trichocarpa]
 gb|EEE97247.1| no apical meristem family protein [Populus trichocarpa]
Length=335

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 62/132 (47%), Gaps = 30/132 (23%)
 Frame = +1

Query  124  YGGLLENDQNIYEGMITSNGSPIVSAAAAANLLPSKH--PHHLPAMYWNEDAPT---CSD  288
            Y  LLEN+   +EG++T +G   +S     N L  K   P+H    YWNE        ++
Sbjct  218  YASLLENEDTFFEGILTGDGMQNIST----NTLSEKRSLPYH---QYWNETTGLPMGLAN  270

Query  289  SSPLTKKFLAD-DSHLTAARTDDQSGGGGSIATLLSQLPQQN----------VSGDGVFR  435
            SS   K+F  D +S +T  + D+ S       +LL+Q PQ              GDGV R
Sbjct  271  SS--AKRFHGDLNSGITGTQEDNNS-----FVSLLNQFPQSTPLVHPSTLLGSLGDGVLR  323

Query  436  QPYPVSGLNWYS  471
            Q + +S LNW S
Sbjct  324  QTFQLSSLNWNS  335



>gb|KJB57570.1| hypothetical protein B456_009G170700 [Gossypium raimondii]
Length=340

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 75/167 (45%), Gaps = 30/167 (18%)
 Frame = +1

Query  13   ERDDLNEMLGSIPPSIPTTIQFTHQKFHQGLFKSAANYGGLLENDQNIYEGMITS--NGS  186
            E D    M G +   +PT+   +HQ  +  L   A +YG LL+++ N +EG++T     S
Sbjct  184  ETDKEYTMEGMLATQLPTS---SHQNLN-ALTSKATSYGSLLQHEDNFFEGILTEGMRSS  239

Query  187  PIVSAAAAANLLPSKHP------HHLPAMYWNEDAPTCSDSSPLTKKFLADDSHLTA--A  342
              +S  A ++ L    P        LP  YWNE +   S S    K+F   D + ++   
Sbjct  240  SNISQLAVSSSLKQNPPMAFPVKRTLPPQYWNEPSSRGSQSG---KRFQQGDINCSSRGG  296

Query  343  RTDDQSGGGGSIATLLSQLPQQN---------VSGDGVFRQPYPVSG  456
              DD +    S  +LL+QLPQ             GDGV RQ + + G
Sbjct  297  NIDDTN----SFVSLLNQLPQNTPFYPGSMVGSLGDGVSRQQFILPG  339



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800