BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP002C02 517 bp,:Filtered

Length=471
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618543.1|  PREDICTED: probable serine/threonine-protein...  60.5    9e-08   Nicotiana tomentosiformis
ref|XP_009769426.1|  PREDICTED: homeobox protein 2-like               58.9    1e-07   Nicotiana sylvestris
dbj|BAM28759.1|  ROX1 homologue                                       58.9    2e-07   Nicotiana tabacum [American tobacco]
dbj|BAM28758.1|  ROX1 homologue                                       58.9    2e-07   Nicotiana benthamiana
ref|XP_009757117.1|  PREDICTED: protein E6                            58.5    3e-07   Nicotiana sylvestris
ref|XP_002279294.1|  PREDICTED: protein E6                            56.2    9e-07   Vitis vinifera
ref|XP_009613470.1|  PREDICTED: homeobox protein 2                    56.6    1e-06   Nicotiana tomentosiformis
gb|ABH01084.1|  putative ROX1                                         56.6    1e-06   Nicotiana tabacum [American tobacco]
ref|XP_011086042.1|  PREDICTED: LOW QUALITY PROTEIN: protein E6-like  53.9    8e-06   Sesamum indicum [beniseed]
ref|XP_004232917.1|  PREDICTED: homeobox protein 2-like               53.9    8e-06   Solanum lycopersicum
ref|XP_006364298.1|  PREDICTED: protein E6-like                       53.9    9e-06   Solanum tuberosum [potatoes]
gb|EYU43374.1|  hypothetical protein MIMGU_mgv1a012195mg              50.4    1e-04   Erythranthe guttata [common monkey flower]
ref|XP_008225146.1|  PREDICTED: protein E6                            50.8    1e-04   Prunus mume [ume]
ref|XP_011096354.1|  PREDICTED: protein E6-like                       48.9    4e-04   Sesamum indicum [beniseed]
ref|XP_006583833.1|  PREDICTED: protein E6-like isoform X2            48.1    8e-04   
gb|KHN15489.1|  Protein E6                                            47.8    0.001   Glycine soja [wild soybean]
ref|XP_003529348.1|  PREDICTED: protein E6-like isoform X1            47.8    0.001   



>ref|XP_009618543.1| PREDICTED: probable serine/threonine-protein kinase clkA [Nicotiana 
tomentosiformis]
Length=497

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            EQQG+S TRF ENG+Y+YDVNTEKYA  PYENSR
Sbjct  434  EQQGISGTRFFENGKYFYDVNTEKYANDPYENSR  467



>ref|XP_009769426.1| PREDICTED: homeobox protein 2-like [Nicotiana sylvestris]
Length=267

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQ MSDTRF+ENG+Y YDVNTEKY R PYENSR
Sbjct  199  QQQRMSDTRFLENGKYSYDVNTEKYVRDPYENSR  232



>dbj|BAM28759.1| ROX1 homologue [Nicotiana tabacum]
Length=346

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ NG++YYD+N EK+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAEKHARDPYENAR  306



>dbj|BAM28758.1| ROX1 homologue [Nicotiana benthamiana]
Length=346

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ NG++YYD+N EK+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAEKHARDPYENAR  306



>ref|XP_009757117.1| PREDICTED: protein E6 [Nicotiana sylvestris]
Length=346

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ NG++YYD+N EK+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINGEKHARDPYENAR  306



>ref|XP_002279294.1| PREDICTED: protein E6 [Vitis vinifera]
 emb|CAN60306.1| hypothetical protein VITISV_005068 [Vitis vinifera]
Length=253

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ENGRYYYD+N+EK  R+ YENSR
Sbjct  172  KQQGMSDTRFLENGRYYYDLNSEKNYRNEYENSR  205



>ref|XP_009613470.1| PREDICTED: homeobox protein 2 [Nicotiana tomentosiformis]
Length=346

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ NG++YYD+N  K+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAGKHARDPYENAR  306



>gb|ABH01084.1| putative ROX1 [Nicotiana tabacum]
Length=346

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ NG++YYD+N  K+AR PYEN+R
Sbjct  273  QQQGMSDTRFLGNGKFYYDINAGKHARDPYENAR  306



>ref|XP_011086042.1| PREDICTED: LOW QUALITY PROTEIN: protein E6-like [Sesamum indicum]
Length=282

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 1/32 (3%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKY-ARHPYE  222
            + QGMSDTRF+ENG+YYYDVNT+KY + HPYE
Sbjct  201  QPQGMSDTRFLENGKYYYDVNTDKYSSNHPYE  232



>ref|XP_004232917.1| PREDICTED: homeobox protein 2-like [Solanum lycopersicum]
Length=342

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ NG++YYD+N  ++AR PYEN++
Sbjct  271  QQQGMSDTRFLGNGKFYYDINAGRHARDPYENAK  304



>ref|XP_006364298.1| PREDICTED: protein E6-like [Solanum tuberosum]
Length=352

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHPYENSR  231
            +QQGMSDTRF+ NG++YYD+N  ++AR PYEN++
Sbjct  278  QQQGMSDTRFLGNGKFYYDINAGRHARDPYENAK  311



>gb|EYU43374.1| hypothetical protein MIMGU_mgv1a012195mg [Erythranthe guttata]
Length=259

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 1/30 (3%)
 Frame = +1

Query  136  QGMSDTRFMENGRYYYDVNTEKY-ARHPYE  222
            QGMSDTR +ENG+YYYD+NTEKY + HPYE
Sbjct  177  QGMSDTRSLENGKYYYDLNTEKYNSNHPYE  206



>ref|XP_008225146.1| PREDICTED: protein E6 [Prunus mume]
Length=296

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEK-YARHPYENSR  231
            E+QGMSDTRF+ENGRY+YD+ +EK Y ++ YENSR
Sbjct  227  EKQGMSDTRFLENGRYHYDIGSEKNYNQNQYENSR  261



>ref|XP_011096354.1| PREDICTED: protein E6-like [Sesamum indicum]
Length=302

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYAR-HPYENSR  231
            E QGMSDTR + NG+YYYD+NT +Y+R HPYE+ R
Sbjct  219  EPQGMSDTRSVGNGKYYYDINTGRYSRNHPYESLR  253



>ref|XP_006583833.1| PREDICTED: protein E6-like isoform X2 [Glycine max]
Length=340

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 1/29 (3%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHP  216
            E+QG+SDTRFME G+Y+YDVN+EKY  HP
Sbjct  265  ERQGLSDTRFMEGGKYFYDVNSEKY-NHP  292



>gb|KHN15489.1| Protein E6 [Glycine soja]
Length=376

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 1/29 (3%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHP  216
            E+QG+SDTRFME G+Y+YDVN+EKY  HP
Sbjct  301  ERQGLSDTRFMEGGKYFYDVNSEKY-NHP  328



>ref|XP_003529348.1| PREDICTED: protein E6-like isoform X1 [Glycine max]
Length=376

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 1/29 (3%)
 Frame = +1

Query  130  EQQGMSDTRFMENGRYYYDVNTEKYARHP  216
            E+QG+SDTRFME G+Y+YDVN+EKY  HP
Sbjct  301  ERQGLSDTRFMEGGKYFYDVNSEKY-NHP  328



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554587825180