BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP002B11 432 bp,:Filtered

Length=382
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAB93342.1|  neoxanthin synthase                                  61.6    2e-08   Solanum lycopersicum
gb|ADZ24717.1|  lycopene b-cyclase                                    61.6    2e-08   Solanum pennellii
ref|XP_009609006.1|  PREDICTED: neoxanthin synthase, chloroplastic    60.5    5e-08   Nicotiana tomentosiformis
ref|NP_001234445.1|  chromoplast-specific lycopene beta-cyclase       59.7    8e-08   
ref|XP_009789371.1|  PREDICTED: neoxanthin synthase, chloroplastic    57.8    4e-07   Nicotiana sylvestris
ref|XP_006361083.1|  PREDICTED: neoxanthin synthase, chloroplasti...  53.5    1e-05   
emb|CDP06888.1|  unnamed protein product                              52.4    2e-05   Coffea canephora [robusta coffee]
ref|XP_003541965.1|  PREDICTED: capsanthin/capsorubin synthase, c...  52.4    3e-05   Glycine max [soybeans]
gb|AIX87499.1|  chromoplast-specific lycopene beta-cyclase            52.0    3e-05   Lycium barbarum [goji berry]
gb|AIX87523.1|  chromoplast-specific lycopene beta-cyclase            52.0    3e-05   Lycium ruthenicum
gb|ACJ66628.1|  lycopene beta-cyclase                                 51.6    5e-05   Actinidia chinensis
ref|XP_011006475.1|  PREDICTED: capsanthin/capsorubin synthase, c...  50.8    7e-05   Populus euphratica
ref|XP_006384755.1|  hypothetical protein POPTR_0004s20800g           50.1    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_004487485.1|  PREDICTED: capsanthin/capsorubin synthase, c...  49.7    2e-04   Cicer arietinum [garbanzo]
ref|XP_011043447.1|  PREDICTED: capsanthin/capsorubin synthase, c...  49.7    2e-04   Populus euphratica
gb|ADZ28517.1|  neoxanthin synthase                                   49.3    2e-04   Camellia nitidissima
ref|XP_002313611.1|  hypothetical protein POPTR_0009s16140g           49.3    2e-04   Populus trichocarpa [western balsam poplar]
gb|KDO58141.1|  hypothetical protein CISIN_1g010693mg                 48.1    5e-04   Citrus sinensis [apfelsine]
ref|XP_006424195.1|  hypothetical protein CICLE_v10028245mg           48.1    5e-04   Citrus clementina



>emb|CAB93342.1| neoxanthin synthase [Solanum lycopersicum]
Length=498

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 48/78 (62%), Gaps = 8/78 (10%)
 Frame = -2

Query  213  MATLLNPLIPSSLIT-----KSLRSPKSPFLSPPTQTKS--CSQAVKSTGKFGSFLDLEP  55
            M TLL P  PS L++     +S+      FLSP T+ KS  C    KS+  F SFLDL P
Sbjct  1    METLLKPF-PSLLLSSPTPYRSIVQQNPSFLSPTTKKKSRKCLLRNKSSKLFCSFLDLAP  59

Query  54   TSKPESLDLDLSWHDPTS  1
            TSKPESLD+++SW DP S
Sbjct  60   TSKPESLDVNISWVDPNS  77



>gb|ADZ24717.1| lycopene b-cyclase [Solanum pennellii]
Length=498

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 47/78 (60%), Gaps = 8/78 (10%)
 Frame = -2

Query  213  MATLLNPLIPSSLIT-----KSLRSPKSPFLSPPTQTKS--CSQAVKSTGKFGSFLDLEP  55
            M  LL P  PS L++     +S+      FLSP TQ KS  C    KS+  F SFLDL P
Sbjct  1    MEALLKPF-PSLLLSSPTPHRSIFQQNPSFLSPTTQKKSRKCLLRNKSSKLFCSFLDLAP  59

Query  54   TSKPESLDLDLSWHDPTS  1
            TSKPESLD+++SW DP S
Sbjct  60   TSKPESLDVNISWVDPNS  77



>ref|XP_009609006.1| PREDICTED: neoxanthin synthase, chloroplastic [Nicotiana tomentosiformis]
Length=499

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 9/77 (12%)
 Frame = -2

Query  213  MATLLNPLIPSSLIT-----KSLRSPKSPFLSPPTQ--TKSCSQAVKSTGK-FGSFLDLE  58
            M TLL P  PS L++     +S+    SPFL+P TQ  ++      KS+ K F SFLDL 
Sbjct  1    METLLKPF-PSPLLSTPTPHRSIFQLNSPFLNPTTQNFSRKVHHRNKSSSKIFCSFLDLS  59

Query  57   PTSKPESLDLDLSWHDP  7
            PTSKPESLD+++SW DP
Sbjct  60   PTSKPESLDVEISWVDP  76



>ref|NP_001234445.1| chromoplast-specific lycopene beta-cyclase [Solanum lycopersicum]
 gb|AAG21133.1| chromoplast-specific lycopene beta-cyclase [Solanum lycopersicum]
Length=498

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 47/78 (60%), Gaps = 8/78 (10%)
 Frame = -2

Query  213  MATLLNPLIPSSLIT-----KSLRSPKSPFLSPPTQTKS--CSQAVKSTGKFGSFLDLEP  55
            M  LL P  PS L++     +S+      FLSP T+ KS  C    KS+  F SFLDL P
Sbjct  1    MEALLKPF-PSLLLSSPTPHRSIFQQNPSFLSPTTKKKSRKCLLRNKSSKLFCSFLDLAP  59

Query  54   TSKPESLDLDLSWHDPTS  1
            TSKPESLD+++SW DP S
Sbjct  60   TSKPESLDVNISWVDPNS  77



>ref|XP_009789371.1| PREDICTED: neoxanthin synthase, chloroplastic [Nicotiana sylvestris]
Length=499

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 47/79 (59%), Gaps = 9/79 (11%)
 Frame = -2

Query  213  MATLLNPLIPSSLIT-----KSLRSPKSPFLSPPTQT---KSCSQAVKSTGKFGSFLDLE  58
            M TLL P  PS L+      +S+    S FL+P TQ    K   +   S+ KF SFLDL 
Sbjct  1    METLLKPF-PSPLLFTPTPHRSIFQLNSTFLNPTTQNFSRKVHRRNKSSSNKFCSFLDLA  59

Query  57   PTSKPESLDLDLSWHDPTS  1
            PTSKPESLD+D+SW DP S
Sbjct  60   PTSKPESLDVDISWVDPNS  78



>ref|XP_006361083.1| PREDICTED: neoxanthin synthase, chloroplastic-like [Solanum tuberosum]
Length=498

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 8/78 (10%)
 Frame = -2

Query  213  MATLLNPLIPSSLIT-----KSLRSPKSPFLSPPTQTKS--CSQAVKSTGKFGSFLDLEP  55
            M TLL P  PS L++     +S+     PFL+P T+ KS  C    KS+  F SFLDL P
Sbjct  1    METLLKPF-PSLLLSSPTSHRSIFQQNPPFLNPTTKKKSRKCHLRNKSSKLFCSFLDLAP  59

Query  54   TSKPESLDLDLSWHDPTS  1
            TSKPES D+++S  DP S
Sbjct  60   TSKPESFDVNISLVDPNS  77



>emb|CDP06888.1| unnamed protein product [Coffea canephora]
Length=495

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 3/49 (6%)
 Frame = -2

Query  144  PFLSPPTQT--KSCSQAVKSTGKFGSFLDLEPTSKPESLDLDLSWHDPT  4
            PF+SP T+T  ++    V+S+ KF SFLDLEP  KPE LD D+SW DP+
Sbjct  28   PFVSPKTKTSARNVRNRVRSS-KFNSFLDLEPAWKPEPLDFDVSWLDPS  75



>ref|XP_003541965.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Glycine 
max]
Length=493

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 38/71 (54%), Gaps = 1/71 (1%)
 Frame = -2

Query  213  MATLLNPLIPSSLITKSLRSPKSPFLSPPTQ-TKSCSQAVKSTGKFGSFLDLEPTSKPES  37
            M T      P  L+        +PF  P T  T S ++ V ST KFG+FLD +P +KPES
Sbjct  1    MGTSFMLFSPPPLLKPHQVPLTTPFPLPQTHHTASRNKRVHSTSKFGNFLDFKPENKPES  60

Query  36   LDLDLSWHDPT  4
            LD DL W  P+
Sbjct  61   LDFDLPWCHPS  71



>gb|AIX87499.1| chromoplast-specific lycopene beta-cyclase [Lycium barbarum]
Length=498

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 44/77 (57%), Gaps = 6/77 (8%)
 Frame = -2

Query  213  MATLLNP----LIPSSLITKSLRSPKSPFLSPPTQ--TKSCSQAVKSTGKFGSFLDLEPT  52
            M TLL P    L+ S +  KS+     PFL P T   ++      KS+    SFLDL PT
Sbjct  1    METLLRPFPSPLLSSPIPNKSIFQLNYPFLKPTTHNFSRKVHHKNKSSKISCSFLDLTPT  60

Query  51   SKPESLDLDLSWHDPTS  1
            SKPESLD+++SW DP S
Sbjct  61   SKPESLDVNISWVDPNS  77



>gb|AIX87523.1| chromoplast-specific lycopene beta-cyclase [Lycium ruthenicum]
Length=498

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 44/77 (57%), Gaps = 6/77 (8%)
 Frame = -2

Query  213  MATLLNP----LIPSSLITKSLRSPKSPFLSPPTQ--TKSCSQAVKSTGKFGSFLDLEPT  52
            M TLL P    L+ S +  KS+     PFL P T   ++      KS+    SFLDL PT
Sbjct  1    METLLRPFPSPLLSSPIPNKSIFQLNYPFLKPTTHNFSRKVHHKNKSSKISCSFLDLTPT  60

Query  51   SKPESLDLDLSWHDPTS  1
            SKPESLD+++SW DP S
Sbjct  61   SKPESLDVNISWVDPNS  77



>gb|ACJ66628.1| lycopene beta-cyclase [Actinidia chinensis]
Length=493

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  147  SPFLSPPTQTKSCSQAVK-STGKFGSFLDLEPTSKPESLDLDLSWHDPTS  1
            +P L P TQT    +  K    KFG+FLDL+P SKPESLD DLSW DP+ 
Sbjct  24   APLLLPNTQTTPRKKHHKIHCSKFGNFLDLKPISKPESLDFDLSWVDPSG  73



>ref|XP_011006475.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Populus 
euphratica]
Length=496

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -2

Query  132  PPTQTKSCSQAVKSTGKFGSFLDLEPTSKPESLDLDLSWHDPTS  1
            P T     S +   + KFGSFLDL+P SKPESLD DLSW DP  
Sbjct  32   PQTTASRKSHSGIQSSKFGSFLDLKPLSKPESLDFDLSWFDPAD  75



>ref|XP_006384755.1| hypothetical protein POPTR_0004s20800g [Populus trichocarpa]
 gb|ERP62552.1| hypothetical protein POPTR_0004s20800g [Populus trichocarpa]
Length=496

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  84  KFGSFLDLEPTSKPESLDLDLSWHDPTS  1
           KFGSFLDL+P SKPESLD DLSW DP  
Sbjct  48  KFGSFLDLKPLSKPESLDFDLSWFDPAD  75



>ref|XP_004487485.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Cicer 
arietinum]
Length=501

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = -2

Query  138  LSPPTQTKSCSQAVKSTGKFGSFLDLEPTSKPESLDLDLSWHDPTS  1
            +S PT  K+ S+ ++ST KFG+FLDL+P  +PESLD DL W  P+ 
Sbjct  34   ISLPTSRKTSSK-IQSTSKFGNFLDLKPEYQPESLDFDLPWFQPSD  78



>ref|XP_011043447.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Populus 
euphratica]
Length=496

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 45/77 (58%), Gaps = 8/77 (10%)
 Frame = -2

Query  213  MATLLNPLIPSSLITKSLR-SPKSPFL--SPP---TQTKSCSQAVKSTGKFGSFLDLEPT  52
            MAT L  L P S   K+ + + KSP L  SP    T ++     ++S+ KFGSFLDL P 
Sbjct  1    MATCLG-LFPPSPAGKAFQPNHKSPLLFSSPKPHITLSRKSRYGIQSS-KFGSFLDLNPE  58

Query  51   SKPESLDLDLSWHDPTS  1
            SKPE LD DLSW DP  
Sbjct  59   SKPEFLDFDLSWFDPAD  75



>gb|ADZ28517.1| neoxanthin synthase [Camellia nitidissima]
Length=493

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 6/75 (8%)
 Frame = -2

Query  213  MATLLNPLIPSSLITKSLRSPKS--PFLSPPTQT--KSCSQAVKSTGKFGSFLDLEPTSK  46
            M TLL    P  LIT S RS  S  P L P T+T  +     +  + K G+FLDL+P SK
Sbjct  1    MGTLLRLPSPPILIT-SQRSNSSFTPLLHPNTKTLPRKFHHRIHCS-KHGNFLDLKPISK  58

Query  45   PESLDLDLSWHDPTS  1
            PESLD DLSW DP++
Sbjct  59   PESLDFDLSWVDPST  73



>ref|XP_002313611.1| hypothetical protein POPTR_0009s16140g [Populus trichocarpa]
 gb|EEE87566.1| hypothetical protein POPTR_0009s16140g [Populus trichocarpa]
Length=496

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 34/52 (65%), Gaps = 5/52 (10%)
 Frame = -2

Query  156  SPKSPFLSPPTQTKSCSQAVKSTGKFGSFLDLEPTSKPESLDLDLSWHDPTS  1
            SPK P ++P  +++   Q    + KFGSFLDL+P SKPE LD DLSW DP  
Sbjct  29   SPK-PHITPSRKSRYGIQ----SSKFGSFLDLKPESKPEFLDFDLSWFDPAD  75



>gb|KDO58141.1| hypothetical protein CISIN_1g010693mg [Citrus sinensis]
Length=503

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 44/81 (54%), Gaps = 11/81 (14%)
 Frame = -2

Query  213  MATLLNPLIPSSL--ITKSLRSPKSPFLS--PPTQTKSCSQAVK-------STGKFGSFL  67
            MATLL+P  PS L  +++ + S  SP  S  P  +  +CS+           T KFG+FL
Sbjct  1    MATLLSPFSPSPLAKVSQIIDSTSSPSFSLFPLGRQNACSRKADHHHHHRIRTSKFGNFL  60

Query  66   DLEPTSKPESLDLDLSWHDPT  4
            +L P S PE LD DL W  P+
Sbjct  61   ELTPESVPEFLDFDLPWFHPS  81



>ref|XP_006424195.1| hypothetical protein CICLE_v10028245mg [Citrus clementina]
 sp|Q9SEA0.1|CCS_CITSI RecName: Full=Capsanthin/capsorubin synthase, chromoplast; Flags: 
Precursor [Citrus sinensis]
 gb|AAF18389.1|AF169241_1 capsanthin/capsorubin synthase [Citrus sinensis]
 gb|ACR09634.1| lycopene beta-cyclase [Citrus sinensis]
 gb|ESR37435.1| hypothetical protein CICLE_v10028245mg [Citrus clementina]
Length=503

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 44/81 (54%), Gaps = 11/81 (14%)
 Frame = -2

Query  213  MATLLNPLIPSSL--ITKSLRSPKSPFLS--PPTQTKSCSQAVK-------STGKFGSFL  67
            MATLL+P  PS L  +++ + S  SP  S  P  +  +CS+           T KFG+FL
Sbjct  1    MATLLSPFSPSPLAKVSQIIDSTSSPSFSLFPLGRQNACSRKADHHHHHRIRTSKFGNFL  60

Query  66   DLEPTSKPESLDLDLSWHDPT  4
            +L P S PE LD DL W  P+
Sbjct  61   ELTPESVPEFLDFDLPWFHPS  81



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567734137750