BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP002A06 636 bp,

Length=603
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002284254.1|  PREDICTED: uncharacterized protein LOC100267853    360   1e-117   Vitis vinifera
ref|XP_009790912.1|  PREDICTED: uncharacterized protein LOC104238289    359   3e-116   Nicotiana sylvestris
ref|XP_004237535.1|  PREDICTED: dipeptidyl-peptidase 5-like             357   1e-115   Solanum lycopersicum
ref|XP_006340554.1|  PREDICTED: uncharacterized protein LOC102583576    357   1e-115   Solanum tuberosum [potatoes]
ref|XP_009626968.1|  PREDICTED: dipeptidyl-peptidase 5-like             357   1e-115   Nicotiana tomentosiformis
emb|CBI19572.3|  unnamed protein product                                352   2e-114   Vitis vinifera
gb|KDP38395.1|  hypothetical protein JCGZ_04320                         352   3e-114   Jatropha curcas
ref|XP_011083811.1|  PREDICTED: LOW QUALITY PROTEIN: acylamino-ac...    353   3e-114   Sesamum indicum [beniseed]
ref|XP_002284264.2|  PREDICTED: dipeptidyl-peptidase 5                  353   4e-114   Vitis vinifera
gb|AEQ94129.1|  C-terminal domain-containing protein                    338   5e-114   Elaeis guineensis
ref|XP_011017235.1|  PREDICTED: uncharacterized protein LOC105120...    350   3e-113   Populus euphratica
ref|XP_002302446.2|  hypothetical protein POPTR_0002s13010g             350   4e-113   Populus trichocarpa [western balsam poplar]
ref|XP_011017233.1|  PREDICTED: uncharacterized protein LOC105120...    350   4e-113   Populus euphratica
ref|XP_011013049.1|  PREDICTED: uncharacterized protein LOC105117...    349   4e-113   Populus euphratica
ref|XP_011017237.1|  PREDICTED: uncharacterized protein LOC105120...    350   9e-113   Populus euphratica
ref|XP_011013048.1|  PREDICTED: uncharacterized protein LOC105117...    350   9e-113   Populus euphratica
ref|XP_011013047.1|  PREDICTED: uncharacterized protein LOC105117...    350   9e-113   Populus euphratica
ref|XP_011013046.1|  PREDICTED: uncharacterized protein LOC105117...    350   1e-112   Populus euphratica
ref|XP_010684446.1|  PREDICTED: uncharacterized protein LOC104899...    345   2e-112   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP07619.1|  unnamed protein product                                347   3e-112   Coffea canephora [robusta coffee]
gb|EYU25389.1|  hypothetical protein MIMGU_mgv1a002403mg                347   4e-112   Erythranthe guttata [common monkey flower]
gb|KJB63798.1|  hypothetical protein B456_010G016900                    347   6e-112   Gossypium raimondii
gb|KHM99572.1|  Dipeptidyl peptidase family member 6                    340   7e-112   Glycine soja [wild soybean]
ref|XP_010684445.1|  PREDICTED: uncharacterized protein LOC104899...    347   8e-112   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008220188.1|  PREDICTED: uncharacterized protein LOC103320302    346   1e-111   
ref|XP_007225164.1|  hypothetical protein PRUPE_ppa002365mg             345   2e-111   Prunus persica
ref|XP_003600065.1|  Acyl-peptide hydrolase-like protein                346   3e-111   Medicago truncatula
gb|KHG27260.1|  Dipeptidyl peptidase family member 6                    345   3e-111   Gossypium arboreum [tree cotton]
ref|XP_004291139.2|  PREDICTED: uncharacterized protein LOC101314718    345   4e-111   Fragaria vesca subsp. vesca
ref|XP_004141243.1|  PREDICTED: uncharacterized protein LOC101211004    345   9e-111   Cucumis sativus [cucumbers]
ref|XP_006656768.1|  PREDICTED: acylamino-acid-releasing enzyme-like    341   2e-110   
ref|XP_009367400.1|  PREDICTED: uncharacterized protein LOC103957051    343   3e-110   Pyrus x bretschneideri [bai li]
ref|XP_008393841.1|  PREDICTED: uncharacterized protein LOC103455998    342   5e-110   Malus domestica [apple tree]
gb|ACN28162.1|  unknown                                                 335   7e-110   Zea mays [maize]
ref|XP_007017350.1|  Acylamino-acid-releasing enzyme, putative is...    342   9e-110   Theobroma cacao [chocolate]
ref|XP_004500056.1|  PREDICTED: uncharacterized protein LOC101508...    341   2e-109   Cicer arietinum [garbanzo]
ref|XP_004500058.1|  PREDICTED: uncharacterized protein LOC101508...    341   2e-109   Cicer arietinum [garbanzo]
ref|XP_002510270.1|  acylamino-acid-releasing enzyme, putative          341   2e-109   Ricinus communis
ref|XP_010939403.1|  PREDICTED: uncharacterized protein LOC105058...    338   2e-109   Elaeis guineensis
ref|XP_003532124.2|  PREDICTED: probable dipeptidyl-peptidase 5-like    341   3e-109   Glycine max [soybeans]
gb|KCW44332.1|  hypothetical protein EUGRSUZ_L02208                     334   3e-109   Eucalyptus grandis [rose gum]
ref|XP_007146464.1|  hypothetical protein PHAVU_006G042600g             340   5e-109   Phaseolus vulgaris [French bean]
ref|XP_010268630.1|  PREDICTED: uncharacterized protein LOC104605524    340   5e-109   Nelumbo nucifera [Indian lotus]
ref|XP_010059764.1|  PREDICTED: uncharacterized protein LOC104447755    340   7e-109   Eucalyptus grandis [rose gum]
gb|KCW66196.1|  hypothetical protein EUGRSUZ_F00026                     339   9e-109   Eucalyptus grandis [rose gum]
gb|EPS72679.1|  hypothetical protein M569_02077                         338   1e-108   Genlisea aurea
ref|XP_010939401.1|  PREDICTED: uncharacterized protein LOC105058...    338   1e-108   Elaeis guineensis
gb|EEC80224.1|  hypothetical protein OsI_22153                          337   2e-108   Oryza sativa Indica Group [Indian rice]
ref|NP_001057137.1|  Os06g0215300                                       337   2e-108   
emb|CDP07620.1|  unnamed protein product                                337   2e-108   Coffea canephora [robusta coffee]
dbj|BAK04728.1|  predicted protein                                      338   2e-108   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008220187.1|  PREDICTED: uncharacterized protein LOC103320301    332   3e-108   
ref|XP_008797283.1|  PREDICTED: uncharacterized protein LOC103712...    337   5e-108   Phoenix dactylifera
ref|XP_002438048.1|  hypothetical protein SORBIDRAFT_10g007270          337   6e-108   Sorghum bicolor [broomcorn]
ref|XP_008378199.1|  PREDICTED: uncharacterized protein LOC103441288    337   6e-108   
ref|XP_008658746.1|  PREDICTED: acylaminoacyl-peptidase1 isoform X3     337   6e-108   Zea mays [maize]
ref|NP_001152650.1|  acylaminoacyl-peptidase1                           335   7e-108   Zea mays [maize]
gb|AFW85329.1|  putative acyl-peptide hydrolase                         337   7e-108   Zea mays [maize]
ref|XP_010059767.1|  PREDICTED: uncharacterized protein LOC104447756    335   9e-108   Eucalyptus grandis [rose gum]
ref|XP_009370189.1|  PREDICTED: uncharacterized protein LOC103959562    336   9e-108   Pyrus x bretschneideri [bai li]
gb|KCW66202.1|  hypothetical protein EUGRSUZ_F00027                     335   9e-108   Eucalyptus grandis [rose gum]
ref|XP_010059769.1|  PREDICTED: uncharacterized protein LOC104447758    335   1e-107   Eucalyptus grandis [rose gum]
dbj|BAB09360.1|  acyl-peptide hydrolase-like                            335   1e-107   Arabidopsis thaliana [mouse-ear cress]
gb|KDO84310.1|  hypothetical protein CISIN_1g004756mg                   337   1e-107   Citrus sinensis [apfelsine]
gb|KDO84311.1|  hypothetical protein CISIN_1g004756mg                   336   1e-107   Citrus sinensis [apfelsine]
ref|XP_006473373.1|  PREDICTED: dipeptidyl-peptidase 5-like             336   1e-107   Citrus sinensis [apfelsine]
ref|XP_006434840.1|  hypothetical protein CICLE_v10003676mg             336   2e-107   Citrus clementina
gb|KCW66201.1|  hypothetical protein EUGRSUZ_F00027                     337   2e-107   Eucalyptus grandis [rose gum]
ref|XP_008658745.1|  PREDICTED: acylaminoacyl-peptidase1 isoform X2     337   2e-107   Zea mays [maize]
ref|XP_008658744.1|  PREDICTED: acylaminoacyl-peptidase1 isoform X1     337   2e-107   Zea mays [maize]
ref|XP_010041478.1|  PREDICTED: uncharacterized protein LOC104430423    334   2e-107   Eucalyptus grandis [rose gum]
ref|XP_010435497.1|  PREDICTED: uncharacterized protein LOC104719...    336   2e-107   Camelina sativa [gold-of-pleasure]
ref|NP_198470.3|  putative S9 Tyrosyl aminopeptidase                    335   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435496.1|  PREDICTED: uncharacterized protein LOC104719...    336   3e-107   Camelina sativa [gold-of-pleasure]
ref|XP_004248740.1|  PREDICTED: uncharacterized protein LOC101248248    334   3e-107   Solanum lycopersicum
ref|XP_010450432.1|  PREDICTED: uncharacterized protein LOC104732567    335   3e-107   Camelina sativa [gold-of-pleasure]
ref|XP_003551887.1|  PREDICTED: uncharacterized protein LOC100794...    333   6e-107   Glycine max [soybeans]
ref|XP_004964876.1|  PREDICTED: uncharacterized protein LOC101764...    334   7e-107   Setaria italica
ref|XP_004964875.1|  PREDICTED: uncharacterized protein LOC101764...    334   9e-107   Setaria italica
ref|XP_008452505.1|  PREDICTED: uncharacterized protein LOC103493518    333   9e-107   
ref|XP_004292827.1|  PREDICTED: uncharacterized protein LOC101295106    332   1e-106   Fragaria vesca subsp. vesca
ref|XP_003564098.1|  PREDICTED: uncharacterized protein LOC100823141    333   2e-106   Brachypodium distachyon [annual false brome]
ref|XP_010551210.1|  PREDICTED: uncharacterized protein LOC104821...    333   2e-106   Tarenaya hassleriana [spider flower]
gb|KGN55166.1|  hypothetical protein Csa_4G639050                       332   2e-106   Cucumis sativus [cucumbers]
ref|XP_010551206.1|  PREDICTED: uncharacterized protein LOC104821...    333   3e-106   Tarenaya hassleriana [spider flower]
ref|XP_009628457.1|  PREDICTED: uncharacterized protein LOC104118801    330   4e-106   Nicotiana tomentosiformis
ref|XP_006349631.1|  PREDICTED: probable dipeptidyl-peptidase 5-like    330   9e-106   Solanum tuberosum [potatoes]
ref|XP_008797282.1|  PREDICTED: uncharacterized protein LOC103712...    331   1e-105   Phoenix dactylifera
ref|XP_004964874.1|  PREDICTED: uncharacterized protein LOC101764319    328   4e-105   Setaria italica
ref|XP_009783554.1|  PREDICTED: uncharacterized protein LOC104232138    328   5e-105   Nicotiana sylvestris
ref|XP_009414032.1|  PREDICTED: uncharacterized protein LOC103995...    329   1e-104   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC80225.1|  hypothetical protein OsI_22154                          326   5e-104   Oryza sativa Indica Group [Indian rice]
ref|NP_001057138.1|  Os06g0215400                                       325   6e-104   
gb|EEE65329.1|  hypothetical protein OsJ_20589                          325   8e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008452506.1|  PREDICTED: dipeptidyl-peptidase 5-like isofo...    327   9e-104   Cucumis melo [Oriental melon]
ref|XP_008452511.1|  PREDICTED: dipeptidyl-peptidase 5-like isofo...    326   1e-103   Cucumis melo [Oriental melon]
ref|XP_003558169.1|  PREDICTED: uncharacterized protein LOC100835264    323   3e-103   Brachypodium distachyon [annual false brome]
ref|XP_006829430.1|  hypothetical protein AMTR_s00128p00114010          325   6e-103   Amborella trichopoda
ref|XP_007146465.1|  hypothetical protein PHAVU_006G042700g             322   1e-102   Phaseolus vulgaris [French bean]
ref|XP_004964878.1|  PREDICTED: uncharacterized protein LOC101765802    322   2e-102   Setaria italica
ref|XP_006656769.1|  PREDICTED: uncharacterized protein LOC102718283    320   3e-102   
gb|KCW66190.1|  hypothetical protein EUGRSUZ_F00025                     314   1e-101   Eucalyptus grandis [rose gum]
ref|XP_004964877.1|  PREDICTED: probable dipeptidyl-peptidase 5-like    317   1e-100   Setaria italica
ref|XP_010098716.1|  Dipeptidyl peptidase family member 6               308   1e-100   Morus notabilis
ref|XP_002870472.1|  predicted protein                                  316   3e-100   Arabidopsis lyrata subsp. lyrata
gb|ABK25153.1|  unknown                                                 316   5e-100   Picea sitchensis
ref|XP_006283199.1|  hypothetical protein CARUB_v10004231mg             316   1e-99    Capsella rubella
ref|XP_006395913.1|  hypothetical protein EUTSA_v10003712mg             315   3e-99    Eutrema salsugineum
emb|CDY42399.1|  BnaA08g00150D                                          315   3e-99    Brassica napus [oilseed rape]
ref|XP_009106816.1|  PREDICTED: uncharacterized protein LOC103832547    314   8e-99    Brassica rapa
emb|CDY10518.1|  BnaC03g70960D                                          313   8e-99    Brassica napus [oilseed rape]
ref|XP_010553846.1|  PREDICTED: uncharacterized protein LOC104823807    311   2e-98    Tarenaya hassleriana [spider flower]
dbj|BAK52341.1|  S9 Tyrosyl aminopeptidase                              311   3e-98    Raphanus sativus
ref|XP_007227267.1|  hypothetical protein PRUPE_ppa017763mg             304   1e-97    Prunus persica
ref|XP_002992791.1|  hypothetical protein SELMODRAFT_135896             295   2e-92    Selaginella moellendorffii
ref|XP_002962962.1|  hypothetical protein SELMODRAFT_78836              293   8e-92    Selaginella moellendorffii
gb|KCW66198.1|  hypothetical protein EUGRSUZ_F00026                     293   2e-91    Eucalyptus grandis [rose gum]
ref|XP_004141371.1|  PREDICTED: uncharacterized protein LOC101221766    288   5e-90    
ref|XP_001771588.1|  predicted protein                                  279   4e-86    Physcomitrella patens
ref|WP_006101118.1|  peptidase                                          272   1e-83    Coleofasciculus chthonoplastes
ref|WP_015195487.1|  WD40-like beta Propeller containing protein        270   6e-83    Stanieria cyanosphaera
ref|WP_012308329.1|  peptidase                                          269   1e-82    Synechococcus sp. PCC 7002
ref|WP_008181699.1|  peptidase                                          269   2e-82    Moorea producens
ref|WP_018397687.1|  hypothetical protein                               268   2e-82    filamentous cyanobacterium ESFC-1
ref|WP_002759042.1|  peptidase                                          268   2e-82    Microcystis aeruginosa
ref|WP_030007736.1|  peptidase                                          268   4e-82    Synechococcus sp. NKBG042902
gb|EMT07228.1|  Dipeptidyl peptidase family member 6                    268   4e-82    Aegilops tauschii
ref|WP_015143569.1|  dipeptidyl aminopeptidase/acylaminoacyl pept...    267   6e-82    Pleurocapsa minor
ref|WP_015181252.1|  dipeptidyl aminopeptidase/acylaminoacyl pept...    268   6e-82    Microcoleus sp. PCC 7113
ref|WP_002774643.1|  peptidase                                          267   8e-82    Microcystis aeruginosa
ref|WP_002799027.1|  peptidase                                          267   8e-82    Microcystis aeruginosa
ref|WP_002742297.1|  prolyl oligopeptidase family protein               267   9e-82    Microcystis aeruginosa
ref|WP_016516700.1|  esterase                                           267   9e-82    Microcystis aeruginosa
ref|WP_002738220.1|  prolyl oligopeptidase family protein               266   1e-81    Microcystis aeruginosa
ref|WP_002803183.1|  peptidase                                          266   1e-81    Microcystis aeruginosa
ref|WP_002771736.1|  peptidase                                          266   1e-81    Microcystis aeruginosa
dbj|GAL92519.1|  prolyl oligopeptidase family protein                   266   1e-81    Microcystis aeruginosa NIES-44
ref|WP_002791076.1|  peptidase                                          266   1e-81    Microcystis aeruginosa
ref|WP_012265590.1|  peptidase                                          266   2e-81    Microcystis aeruginosa
ref|WP_002780300.1|  Similar to tr|Q4C513|Q4C513_CROWT Peptidase S9     266   2e-81    Microcystis aeruginosa
ref|WP_019506979.1|  hypothetical protein                               266   2e-81    Pleurocapsa sp. PCC 7319
ref|WP_024970511.1|  peptidase                                          266   2e-81    Microcystis aeruginosa
ref|WP_002754761.1|  peptidase                                          266   2e-81    Microcystis aeruginosa
ref|WP_002789187.1|  peptidase                                          265   3e-81    Microcystis aeruginosa
ref|WP_009626599.1|  peptidase S9, prolyl oligopeptidase active s...    265   6e-81    Pseudanabaena biceps
ref|WP_015204399.1|  peptidase S9, prolyl oligopeptidase active s...    265   6e-81    Crinalium epipsammum
ref|WP_024546571.1|  peptidase                                          265   8e-81    Synechococcus sp. NKBG15041c
ref|WP_012598726.1|  peptidase                                          264   1e-80    Cyanothece sp. PCC 7424
ref|WP_008206656.1|  peptidase                                          264   1e-80    Microcystis sp. T1-4
ref|WP_017304979.1|  hypothetical protein                               264   1e-80    Spirulina subsalsa
gb|EMS46912.1|  Dipeptidyl peptidase family member 6                    266   2e-80    Triticum urartu
ref|WP_011611061.1|  peptidase                                          263   3e-80    Trichodesmium erythraeum
ref|WP_015176530.1|  peptidase S9, prolyl oligopeptidase active s...    263   4e-80    Oscillatoria nigro-viridis
ref|WP_015224372.1|  WD40-like beta Propeller containing protein        261   1e-79    Halothece sp. PCC 7418
ref|WP_036480343.1|  peptidase                                          261   2e-79    Myxosarcina sp. GI1
ref|WP_019495729.1|  hypothetical protein                               260   2e-79    Calothrix sp. PCC 7103
ref|WP_006632460.1|  peptidase                                          260   3e-79    Microcoleus vaginatus
ref|WP_015223610.1|  peptidase S9 prolyl oligopeptidase active si...    259   4e-79    
ref|WP_019499637.1|  hypothetical protein                               259   1e-78    Pseudanabaena sp. PCC 6802
ref|WP_021298368.1|  hypothetical protein                               258   2e-78    Alicyclobacillus acidoterrestris
ref|WP_011244350.1|  peptidase                                          258   2e-78    Synechococcus elongatus
ref|WP_011378291.1|  MULTISPECIES: peptidase                            258   2e-78    Synechococcus
gb|AFW85320.1|  hypothetical protein ZEAMMB73_272531                    256   2e-78    Zea mays [maize]
ref|WP_013320415.1|  peptidase                                          257   4e-78    Cyanothece sp. PCC 7822
ref|WP_015228967.1|  dipeptidyl aminopeptidase/acylaminoacyl pept...    257   4e-78    Dactylococcopsis salina
ref|WP_034419566.1|  peptidase                                          256   6e-78    
ref|WP_007354878.1|  MULTISPECIES: peptidase                            257   8e-78    Kamptonema
ref|WP_026794723.1|  MULTISPECIES: peptidase                            256   8e-78    Planktothrix
ref|WP_007305110.1|  peptidase                                          256   9e-78    Crocosphaera watsonii
ref|WP_008278845.1|  peptidase                                          256   9e-78    Cyanothece sp. CCY0110
emb|CCQ61597.1|  prolyl oligopeptidase family protein                   256   1e-77    Crocosphaera watsonii WH 0401
ref|WP_023067141.1|  dienelactone hydrolase family protein              256   1e-77    Lyngbya aestuarii
gb|ELR99405.1|  dipeptidyl aminopeptidase/acylaminoacyl peptidase       256   1e-77    Gloeocapsa sp. PCC 73106
ref|WP_021830089.1|  prolyl oligopeptidase family protein               256   1e-77    Crocosphaera watsonii
ref|WP_034935407.1|  peptidase                                          256   1e-77    
ref|WP_027249662.1|  peptidase                                          256   1e-77    Planktothrix agardhii
ref|WP_026786106.1|  peptidase                                          256   1e-77    Planktothrix rubescens
ref|WP_017285954.1|  hypothetical protein                               256   1e-77    Leptolyngbya boryana
ref|WP_026798064.1|  peptidase                                          256   1e-77    Planktothrix prolifica
ref|WP_009546699.1|  MULTISPECIES: peptidase                            256   1e-77    Cyanothece
ref|WP_009782357.1|  peptidase                                          256   2e-77    Lyngbya sp. PCC 8106
ref|WP_027254922.1|  peptidase                                          255   2e-77    Planktothrix agardhii
ref|WP_007310402.1|  peptidase                                          256   2e-77    Crocosphaera watsonii
ref|WP_040934755.1|  peptidase                                          255   2e-77    
ref|WP_040939364.1|  peptidase                                          255   2e-77    
ref|WP_006619107.1|  peptidase S9, prolyl oligopeptidase active s...    255   3e-77    Arthrospira platensis
ref|WP_042155696.1|  peptidase                                          255   3e-77    Planktothrix agardhii
ref|WP_017660033.1|  hypothetical protein                               255   4e-77    Geitlerinema sp. PCC 7105
ref|WP_041764852.1|  peptidase                                          254   4e-77    
ref|WP_029421055.1|  peptidase                                          254   4e-77    Alicyclobacillus macrosporangiidus
ref|WP_008054063.1|  peptidase                                          254   4e-77    
gb|AFY37068.1|  WD40-like beta Propeller containing protein             254   5e-77    Leptolyngbya sp. PCC 7376
ref|WP_015220478.1|  peptidase S9 prolyl oligopeptidase active si...    254   6e-77    Cyanobacterium aponinum
ref|WP_006669487.1|  peptidase                                          254   7e-77    Arthrospira maxima
ref|WP_006623627.1|  peptidase                                          254   8e-77    Arthrospira platensis
ref|WP_040942946.1|  peptidase                                          253   9e-77    
ref|WP_026100806.1|  peptidase                                          254   9e-77    Synechococcus sp. PCC 7336
ref|WP_017721873.1|  hypothetical protein                               254   9e-77    Oscillatoria sp. PCC 10802
ref|WP_036004850.1|  peptidase                                          253   1e-76    Leptolyngbya sp. JSC-1
gb|ETX04100.1|  peptidase                                               253   2e-76    Candidatus Entotheonella sp. TSY2
gb|ELS04882.1|  dipeptidyl aminopeptidase/acylaminoacyl peptidase       253   2e-76    Xenococcus sp. PCC 7305
ref|WP_040896678.1|  peptidase                                          253   2e-76    
ref|WP_017295790.1|  hypothetical protein                               252   2e-76    Geminocystis herdmanii
gb|EMS65046.1|  Dipeptidyl peptidase family member 6                    251   4e-76    Triticum urartu
ref|WP_036802276.1|  peptidase                                          251   7e-76    Planomicrobium glaciei
gb|EMT17749.1|  Dipeptidyl peptidase family member 6                    251   1e-75    Aegilops tauschii
ref|XP_002288241.1|  predicted protein                                  251   1e-75    Thalassiosira pseudonana CCMP1335
ref|WP_041425842.1|  peptidase                                          250   2e-75    Synechocystis sp. PCC 6803
ref|WP_010873735.1|  peptidase                                          250   2e-75    
ref|WP_012594079.1|  peptidase                                          249   5e-75    Cyanothece sp. PCC 8801
ref|WP_041419291.1|  peptidase                                          249   5e-75    Simkania negevensis
ref|WP_015783291.1|  peptidase                                          249   5e-75    Cyanothece sp. PCC 8802
emb|CCB88935.1|  peptidase S9, prolyl oligopeptidase active site ...    249   6e-75    Simkania negevensis Z
ref|WP_006457709.1|  peptidase                                          249   7e-75    Synechococcus sp. PCC 7335
gb|EJK62844.1|  hypothetical protein THAOC_16526                        248   2e-74    Thalassiosira oceanica
ref|WP_015165554.1|  peptidase S9, prolyl oligopeptidase active s...    247   3e-74    Pseudanabaena sp. PCC 7367
dbj|BAL52988.1|  peptidase, S9A/B/C family, catalytic domain protein    247   3e-74    uncultured Acetothermia bacterium
dbj|BAL56300.1|  peptidase, S9A/B/C family, catalytic domain protein    247   3e-74    uncultured Acetothermia bacterium
ref|WP_040289833.1|  peptidase                                          247   4e-74    Alicyclobacillus hesperidum
gb|EJY55338.1|  peptidase S9 prolyl oligopeptidase active site do...    246   5e-74    Alicyclobacillus hesperidum URH17-3-68
ref|WP_012629326.1|  peptidase                                          246   8e-74    Cyanothece sp. PCC 7425
gb|EIE90466.1|  hypothetical protein RO3G_15177                         246   9e-74    Rhizopus delemar RA 99-880
emb|CEI99384.1|  hypothetical protein RMCBS344292_13474                 246   1e-73    Rhizopus microsporus
emb|CEG83092.1|  hypothetical protein RMATCC62417_17066                 245   1e-73    Rhizopus microsporus
emb|CEI94449.1|  hypothetical protein RMCBS344292_08659                 245   1e-73    Rhizopus microsporus
ref|WP_040629387.1|  peptidase                                          245   1e-73    Microbulbifer variabilis
gb|EMS57875.1|  Acylamino-acid-releasing enzyme                         246   2e-73    Triticum urartu
ref|WP_044076218.1|  peptidase                                          246   2e-73    Prochlorothrix hollandica
emb|CEG83091.1|  hypothetical protein RMATCC62417_17066                 245   2e-73    Rhizopus microsporus
ref|WP_028475474.1|  peptidase                                          245   2e-73    Nevskia ramosa
ref|WP_009556564.1|  dipeptidyl aminopeptidase/acylaminoacyl pept...    244   5e-73    Oscillatoriales cyanobacterium JSC-12
gb|KCW66197.1|  hypothetical protein EUGRSUZ_F00026                     244   5e-73    Eucalyptus grandis [rose gum]
ref|WP_012871839.1|  peptidase                                          244   7e-73    Sphaerobacter thermophilus
ref|WP_015149312.1|  dipeptidyl aminopeptidase/acylaminoacyl pept...    243   1e-72    Oscillatoria acuminata
ref|WP_011141470.1|  peptidase                                          242   2e-72    Gloeobacter violaceus
emb|CDH52439.1|  peptidase prolyl oligopeptidase active siteregion      243   3e-72    Lichtheimia corymbifera JMRC:FSU:9682
ref|WP_023075509.1|  dipeptidyl aminopeptidase acylaminoacyl pept...    241   4e-72    Leptolyngbya sp. Heron Island J
ref|WP_011430745.1|  peptidase                                          241   4e-72    Synechococcus sp. JA-3-3Ab
ref|WP_041887859.1|  peptidase                                          241   7e-72    
ref|WP_025514862.1|  peptidase                                          241   7e-72    
ref|WP_027323935.1|  peptidase                                          241   9e-72    Bacillus sp. URHB0009
ref|XP_005821627.1|  hypothetical protein GUITHDRAFT_160229             241   1e-71    Guillardia theta CCMP2712
ref|WP_013034086.1|  peptidase                                          240   1e-71    Nitrosococcus halophilus
ref|WP_013220803.1|  peptidase                                          239   2e-71    Nitrosococcus watsonii
ref|WP_027302496.1|  peptidase                                          239   3e-71    Rhodospirillales bacterium URHD0088
emb|CDS08273.1|  hypothetical protein LRAMOSA02221                      239   3e-71    Lichtheimia ramosa
ref|WP_043317892.1|  peptidase                                          238   4e-71    
ref|WP_011433603.1|  peptidase                                          239   4e-71    Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_019588695.1|  hypothetical protein                               239   5e-71    Deinococcus apachensis
ref|WP_038530538.1|  peptidase                                          238   6e-71    Synechocystis sp. PCC 6714
gb|AIE74375.1|  prolyl oligopeptidase family protein                    238   6e-71    Synechocystis sp. PCC 6714
gb|EGF31913.1|  peptidase, S9C (acylaminoacyl-peptidase) family         238   1e-70    Oxalobacteraceae bacterium IMCC9480
ref|WP_040724804.1|  peptidase                                          238   1e-70    
ref|WP_036500116.1|  peptidase                                          237   2e-70    Nitrosococcus oceani
ref|WP_002810141.1|  peptidase                                          236   3e-70    Nitrosococcus oceani
ref|XP_002610150.1|  hypothetical protein BRAFLDRAFT_121562             236   3e-70    Branchiostoma floridae
ref|WP_012121509.1|  peptidase                                          236   4e-70    Roseiflexus castenholzii
ref|WP_039780941.1|  peptidase                                          236   5e-70    
ref|WP_022605286.1|  dipeptidyl aminopeptidase/acylaminoacyl-pept...    236   7e-70    Rubidibacter lacunae
ref|XP_005852322.1|  hypothetical protein CHLNCDRAFT_33357              237   7e-70    Chlorella variabilis
emb|CEP11301.1|  hypothetical protein                                   236   8e-70    Parasitella parasitica
ref|WP_044562566.1|  hypothetical protein                               235   9e-70    Azospirillum sp. B4
ref|WP_029011085.1|  peptidase                                          235   9e-70    Azospirillum halopraeferens
ref|WP_040844805.1|  hypothetical protein                               235   1e-69    Nitrospirillum amazonense
gb|EGY01765.1|  peptidase S9 prolyl oligopeptidase                      235   2e-69    Nitrospirillum amazonense Y2
ref|WP_015158446.1|  dipeptidyl aminopeptidase/acylaminoacyl pept...    234   2e-69    Chamaesiphon minutus
ref|WP_011956783.1|  peptidase                                          234   3e-69    Roseiflexus sp. RS-1
ref|WP_036262123.1|  peptidase S9                                       233   6e-69    Methylocapsa aurea
ref|WP_007185301.1|  peptidase                                          233   9e-69    Hydrocarboniphaga effusa
ref|WP_006503555.1|  putative S9 family peptidase                       233   1e-68    Austwickia chelonae
gb|EPB85777.1|  hypothetical protein HMPREF1544_07446                   233   1e-68    Mucor circinelloides f. circinelloides 1006PhL
ref|WP_038680541.1|  peptidase                                          232   2e-68    Rubrobacter radiotolerans
ref|WP_010130875.1|  peptidase                                          231   2e-68    
ref|WP_026607376.1|  peptidase S9                                       231   3e-68    
dbj|GAN07854.1|  peptidase                                              231   3e-68    Mucor ambiguus
ref|XP_009046982.1|  hypothetical protein LOTGIDRAFT_238013             231   5e-68    Lottia gigantea
ref|WP_029138733.1|  hypothetical protein                               231   6e-68    
ref|WP_011467718.1|  hypothetical protein                               231   7e-68    Saccharophagus degradans
ref|WP_044582820.1|  peptidase S9                                       230   1e-67    
ref|WP_044433754.1|  peptidase                                          230   1e-67    
ref|WP_007644155.1|  peptidase                                          229   1e-67    
ref|WP_039912963.1|  peptidase                                          229   2e-67    
ref|XP_009038168.1|  hypothetical protein AURANDRAFT_28304              229   2e-67    
ref|WP_037081387.1|  peptidase S9                                       229   2e-67    
ref|WP_028459095.1|  peptidase                                          229   2e-67    
ref|WP_041552011.1|  peptidase                                          228   2e-67    
ref|WP_037457483.1|  peptidase                                          229   3e-67    
ref|WP_003629804.1|  peptidase S9                                       229   3e-67    
ref|WP_042786526.1|  peptidase S9                                       228   4e-67    
ref|WP_043692957.1|  peptidase S9                                       228   5e-67    
gb|ACE83422.1|  prolyl oligopeptidase family                            228   5e-67    
gb|ELT96587.1|  hypothetical protein CAPTEDRAFT_219862                  228   5e-67    
ref|WP_006914416.1|  S9C family peptidase                               228   6e-67    
ref|WP_023171237.1|  peptidase S9 prolyl oligopeptidase                 227   8e-67    
ref|WP_027330779.1|  peptidase                                          227   1e-66    
ref|WP_026133255.1|  peptidase                                          227   1e-66    
ref|XP_001636103.1|  predicted protein                                  227   1e-66    
ref|WP_018625446.1|  hypothetical protein                               226   1e-66    
gb|EKY14474.1|  peptidase, S9A/B/C family, catalytic domain protein     223   2e-66    
ref|WP_039708186.1|  hypothetical protein                               226   2e-66    
ref|WP_007912953.1|  peptidase                                          226   2e-66    
ref|WP_036859866.1|  peptidase                                          226   2e-66    
ref|WP_022867915.1|  peptidase S9                                       226   3e-66    
ref|WP_025772188.1|  hypothetical protein                               223   4e-66    
ref|WP_028882962.1|  peptidase S9                                       226   4e-66    
gb|KGB21996.1|  prolyl oligopeptidase family protein                    225   4e-66    
ref|WP_028886096.1|  peptidase S9                                       226   4e-66    
ref|WP_034753865.1|  peptidase                                          226   4e-66    
ref|WP_015123024.1|  dipeptidyl aminopeptidase/acylaminoacyl pept...    226   4e-66    
ref|WP_004449191.1|  peptidase S9                                       226   5e-66    
ref|WP_035353898.1|  peptidase S9                                       225   5e-66    
ref|WP_019602775.1|  hypothetical protein                               225   5e-66    
ref|WP_012812310.1|  peptidase S9                                       226   7e-66    
ref|WP_018015773.1|  hypothetical protein                               225   7e-66    
ref|WP_038553053.1|  peptidase S9                                       224   8e-66    
ref|WP_024460514.1|  peptidase                                          225   8e-66    
ref|WP_015819345.1|  peptidase, S9 family, catalytic domain-conta...    225   8e-66    
ref|WP_012590598.1|  peptidase S9                                       224   9e-66    
ref|WP_020083487.1|  hypothetical protein                               224   9e-66    
ref|WP_018277797.1|  hypothetical protein                               224   1e-65    
gb|EGE47637.1|  Putative peptidase YuxL                                 225   1e-65    
ref|WP_018417122.1|  hypothetical protein                               224   1e-65    
ref|WP_035374643.1|  peptidase                                          224   1e-65    
gb|KJE77176.1|  prolyl tripeptidyl peptidase precursor                  219   3e-65    
ref|WP_034780920.1|  peptidase                                          223   3e-65    
ref|WP_036233591.1|  peptidase                                          223   3e-65    
ref|WP_011996583.1|  peptidase                                          223   4e-65    
ref|WP_012800714.1|  peptidase S9 prolyl oligopeptidase active si...    223   4e-65    
gb|KFH69244.1|  hypothetical protein MVEG_04059                         223   4e-65    
ref|WP_010513626.1|  peptidase S9                                       223   4e-65    
ref|XP_011451674.1|  PREDICTED: uncharacterized protein LOC105345263    223   5e-65    
ref|WP_010958281.1|  peptidase                                          223   5e-65    
ref|WP_010402105.1|  peptidase                                          223   5e-65    
ref|WP_017253419.1|  peptidase                                          223   5e-65    
ref|WP_039669577.1|  peptidase                                          223   5e-65    
ref|WP_032075174.1|  peptidase                                          222   5e-65    
ref|WP_005772059.1|  peptidase                                          222   6e-65    
ref|WP_012220696.1|  peptidase                                          222   6e-65    
ref|WP_025439850.1|  peptidase S9                                       223   6e-65    
gb|AHF64680.1|  putative peptidase                                      222   6e-65    
ref|WP_019085607.1|  peptidase S9                                       223   7e-65    
ref|WP_019092415.1|  peptidase S9                                       223   7e-65    
ref|WP_034251915.1|  peptidase S9                                       223   7e-65    
ref|WP_019604706.1|  hypothetical protein                               222   8e-65    
ref|WP_020174107.1|  hypothetical protein                               222   9e-65    
ref|WP_035823086.1|  peptidase                                          222   9e-65    
ref|WP_012569784.1|  peptidase                                          222   9e-65    
gb|EGG77841.1|  Dipeptidyl peptidase family member 6                    222   1e-64    
ref|WP_028877176.1|  peptidase S9                                       222   1e-64    
ref|WP_034930222.1|  peptidase S9                                       222   1e-64    
ref|WP_039998536.1|  peptidase S9                                       222   1e-64    
ref|WP_010151902.1|  peptidase                                          221   2e-64    
ref|WP_008443035.1|  peptidase S9 prolyl oligopeptidase active si...    221   2e-64    
ref|WP_039703718.1|  hypothetical protein                               213   2e-64    
ref|WP_034992033.1|  peptidase S9                                       221   2e-64    
ref|XP_001702750.1|  predicted protein                                  218   2e-64    
ref|WP_040709474.1|  peptidase S9                                       218   2e-64    
gb|KCW66199.1|  hypothetical protein EUGRSUZ_F00026                     220   2e-64    
dbj|GAC21034.1|  hypothetical protein GARC_4092                         221   3e-64    
ref|WP_019126059.1|  hypothetical protein                               221   3e-64    
ref|WP_012258483.1|  MULTISPECIES: peptidase                            220   3e-64    
ref|WP_006854481.1|  peptidase S9                                       220   3e-64    
ref|WP_039734040.1|  peptidase S9                                       221   4e-64    
ref|XP_005764237.1|  hypothetical protein EMIHUDRAFT_427966             221   4e-64    
ref|WP_040070905.1|  peptidase                                          220   4e-64    
ref|WP_039990107.1|  hypothetical protein                               221   4e-64    
ref|WP_012616615.1|  peptidase                                          219   6e-64    
ref|WP_037336417.1|  hypothetical protein                               219   7e-64    
ref|WP_035376466.1|  peptidase S9                                       219   8e-64    
ref|WP_026928129.1|  hypothetical protein                               219   9e-64    
ref|WP_011057522.1|  peptidase                                          219   1e-63    
ref|WP_016389226.1|  prolyl oligopeptidase family protein               219   1e-63    
ref|WP_020555395.1|  hypothetical protein                               219   1e-63    
ref|WP_022921953.1|  peptidase                                          219   2e-63    
ref|WP_020703799.1|  hypothetical protein                               219   2e-63    
gb|KCW66195.1|  hypothetical protein EUGRSUZ_F00026                     219   2e-63    
ref|WP_007636955.1|  hypothetical protein                               219   2e-63    
ref|WP_005664412.1|  hypothetical protein                               218   2e-63    
ref|WP_035362427.1|  peptidase                                          218   3e-63    
ref|WP_008854561.1|  hypothetical protein                               218   4e-63    
ref|WP_006681132.1|  peptidase S9                                       218   4e-63    
ref|WP_007739971.1|  peptidase S9 prolyl oligopeptidase active si...    207   4e-63    
ref|WP_037497408.1|  peptidase                                          216   5e-63    
ref|WP_013987792.1|  peptidase                                          217   5e-63    
ref|WP_034503197.1|  peptidase S9                                       217   7e-63    
ref|WP_034339799.1|  hypothetical protein                               216   9e-63    
ref|WP_014105761.1|  peptidase S9                                       217   1e-62    
ref|WP_006546217.1|  peptidase S9                                       217   1e-62    
ref|WP_018057914.1|  hypothetical protein                               216   1e-62    
ref|WP_037441405.1|  peptidase S9                                       217   1e-62    
ref|WP_024124733.1|  prolyl oligopeptidase family protein               216   2e-62    
ref|WP_036211743.1|  peptidase                                          216   2e-62    
ref|WP_027866469.1|  peptidase                                          216   2e-62    
ref|WP_020375422.1|  hypothetical protein                               216   2e-62    
ref|WP_038040855.1|  peptidase                                          215   3e-62    
ref|WP_011563597.1|  peptidase                                          215   3e-62    
ref|WP_028962110.1|  peptidase                                          215   4e-62    
ref|WP_013676650.1|  peptidase S9                                       215   4e-62    
ref|WP_026430688.1|  peptidase S9                                       215   5e-62    
ref|WP_005867813.1|  peptidase S9                                       215   5e-62    
ref|WP_035933918.1|  peptidase                                          215   5e-62    
ref|WP_037052571.1|  peptidase S9                                       214   5e-62    
ref|WP_039701990.1|  hypothetical protein                               214   5e-62    
ref|WP_029337403.1|  peptidase S9                                       214   6e-62    
ref|WP_010147469.1|  peptidase S9 prolyl oligopeptidase active si...    214   8e-62    
ref|XP_004359792.1|  hypothetical protein DFA_01827                     216   8e-62    
ref|WP_020655449.1|  hypothetical protein                               214   9e-62    
gb|KDO84314.1|  hypothetical protein CISIN_1g004756mg                   214   9e-62    
ref|WP_043660958.1|  peptidase S9                                       213   2e-61    
ref|WP_020647640.1|  hypothetical protein                               213   2e-61    
ref|WP_036171120.1|  peptidase                                          213   3e-61    
ref|WP_011934030.1|  peptidase S9                                       212   3e-61    
ref|WP_034255130.1|  peptidase S9                                       213   3e-61    
gb|EFW10758.1|  peptidase S9 prolyl oligopeptidase                      213   4e-61    
ref|XP_002674819.1|  predicted protein                                  213   4e-61    
ref|WP_011620376.1|  peptidase S9                                       212   4e-61    
ref|WP_034219068.1|  peptidase S9                                       213   4e-61    
gb|ERH33167.1|  peptidase, S9A/B/C family, catalytic domain protein     213   4e-61    
ref|XP_004173146.1|  PREDICTED: uncharacterized protein LOC101224519    205   5e-61    
ref|WP_006043138.1|  peptidase S9                                       211   7e-61    
ref|WP_040438279.1|  hypothetical protein                               211   7e-61    
ref|WP_019876596.1|  hypothetical protein                               211   9e-61    
ref|WP_040511235.1|  peptidase S9                                       211   1e-60    
gb|EFG85796.1|  peptidase S9 prolyl oligopeptidase active site do...    211   1e-60    
emb|CBH37567.1|  conserved hypothetical protein, prolyl oligopept...    211   1e-60    
ref|WP_036253431.1|  peptidase                                          210   2e-60    
ref|WP_019633980.1|  hypothetical protein                               210   2e-60    
ref|WP_039032882.1|  peptidase S9                                       211   2e-60    
ref|WP_034846284.1|  peptidase                                          210   3e-60    
ref|WP_036911605.1|  MULTISPECIES: peptidase S9                         210   3e-60    
ref|WP_044735744.1|  peptidase S9                                       210   3e-60    
ref|WP_041522727.1|  peptidase                                          210   3e-60    
ref|WP_037436642.1|  MULTISPECIES: peptidase S9                         210   4e-60    
emb|CDW59710.1|  Dipeptidyl peptidase family member 6                   206   4e-60    
ref|WP_020489126.1|  hypothetical protein                               209   4e-60    
ref|WP_010313029.1|  peptidase S9                                       209   4e-60    
ref|WP_043276815.1|  peptidase S9                                       210   4e-60    
ref|XP_002736640.1|  PREDICTED: uncharacterized protein LOC100367529    209   5e-60    
ref|WP_009749651.1|  peptidase S9                                       209   5e-60    
ref|WP_007098973.1|  peptidase S9                                       209   5e-60    
ref|WP_026869274.1|  peptidase                                          209   5e-60    
ref|WP_041778264.1|  peptidase S9                                       209   6e-60    
ref|WP_021611307.1|  peptidase, S9A/B/C family, catalytic domain ...    209   8e-60    
ref|WP_018308223.1|  hypothetical protein                               209   9e-60    
ref|WP_009058978.1|  peptidase S9                                       209   9e-60    
ref|WP_027286264.1|  hypothetical protein                               208   1e-59    
gb|ACB93803.1|  peptidase S9 prolyl oligopeptidase active site do...    209   1e-59    
ref|WP_026286861.1|  peptidase                                          208   1e-59    
dbj|GAL95958.1|  peptidase S9                                           208   1e-59    
ref|WP_027860568.1|  hypothetical protein                               208   1e-59    
ref|WP_011824986.1|  peptidase S9                                       208   1e-59    
ref|XP_007017352.1|  Acylamino-acid-releasing enzyme, putative is...    208   1e-59    
ref|WP_040809253.1|  peptidase S9                                       208   2e-59    
gb|EED33415.1|  peptidase S9, prolyl oligopeptidase active site r...    208   2e-59    
dbj|GAA07394.1|  peptidase S9                                           208   2e-59    
gb|KGB22599.1|  prolyl oligopeptidase family protein                    208   2e-59    
ref|WP_035380628.1|  peptidase S9                                       208   2e-59    
ref|WP_039903339.1|  peptidase S9                                       207   3e-59    
ref|WP_003785782.1|  peptidase S9                                       207   3e-59    
ref|WP_028253659.1|  peptidase                                          207   4e-59    
ref|WP_025861414.1|  peptidase S9                                       207   4e-59    
ref|WP_040363235.1|  peptidase S9                                       207   4e-59    
ref|WP_009648863.1|  peptidase S9                                       207   4e-59    
ref|WP_011130969.1|  peptidase S9                                       206   5e-59    
ref|WP_038001837.1|  peptidase S9                                       206   5e-59    
ref|WP_038487506.1|  peptidase                                          206   5e-59    
gb|EAQ96026.2|  Dipeptidyl aminopeptidases/acylaminoacyl-peptidase      207   6e-59    
ref|WP_026407215.1|  peptidase S9                                       206   7e-59    
ref|WP_009403509.1|  peptidase S9                                       206   8e-59    
gb|EAQ68329.1|  Dienelactone hydrolase                                  206   1e-58    
ref|WP_040314293.1|  peptidase S9                                       206   2e-58    
ref|WP_043149946.1|  hypothetical protein                               205   2e-58    
ref|WP_024934623.1|  peptidase S9                                       205   2e-58    
ref|WP_044441580.1|  peptidase S9                                       205   2e-58    
ref|WP_039967388.1|  hypothetical protein                               205   2e-58    
gb|ENO17615.1|  peptidase S9 prolyl oligopeptidase                      206   2e-58    
gb|EAS47325.1|  hypothetical protein GB2207_11928                       204   2e-58    
ref|WP_042527891.1|  peptidase                                          203   2e-58    
ref|XP_009414033.1|  PREDICTED: uncharacterized protein LOC103995...    205   3e-58    
ref|WP_011846386.1|  peptidase S9                                       205   3e-58    
ref|WP_008734274.1|  peptidase S9                                       205   3e-58    
ref|WP_028760559.1|  peptidase S9                                       205   3e-58    
ref|WP_014620680.1|  peptidase S9                                       205   3e-58    
ref|XP_010042314.1|  PREDICTED: uncharacterized protein LOC104431368    191   3e-58    
ref|WP_026846854.1|  peptidase S9                                       204   3e-58    
ref|WP_035489204.1|  hypothetical protein                               204   3e-58    
ref|WP_043549267.1|  peptidase S9                                       204   4e-58    
ref|WP_035373579.1|  peptidase S9                                       204   4e-58    
ref|WP_042452248.1|  peptidase S9                                       204   4e-58    
ref|WP_006591101.1|  putative peptidase S9 family protein               205   4e-58    
ref|WP_007726670.1|  hydrolase                                          204   4e-58    
ref|WP_026856020.1|  peptidase S9                                       204   4e-58    
ref|WP_003943688.1|  peptidase S9                                       204   5e-58    
ref|WP_012224381.1|  peptidase S9                                       204   5e-58    
ref|WP_011717643.1|  peptidase S9                                       204   6e-58    
ref|WP_024803817.1|  peptidase S9                                       204   6e-58    
ref|WP_043561974.1|  peptidase S9                                       204   6e-58    
ref|WP_037429211.1|  peptidase S9                                       204   7e-58    
ref|WP_012088748.1|  peptidase S9                                       204   8e-58    
ref|WP_006081034.1|  peptidase S9                                       204   8e-58    



>ref|XP_002284254.1| PREDICTED: uncharacterized protein LOC100267853 [Vitis vinifera]
 emb|CBI19573.3| unnamed protein product [Vitis vinifera]
Length=677

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA QDEKPPLLL+SHGGPT EA  SLNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  433  QASQDEKPPLLLESHGGPTDEAHQSLNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  492

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCAKFLVDSG+VDG+RLC TG SAGG+TTLAALAFK++FKAG SLYGI
Sbjct  493  GRWGIVDVNDCCSCAKFLVDSGKVDGKRLCATGGSAGGFTTLAALAFKEIFKAGASLYGI  552

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L  GMPKFESHYIDNLVG ++AYFERSPINFVDKFSCPIILFQGL+DKVVPPEQA
Sbjct  553  ADLSMLRAGMPKFESHYIDNLVGSESAYFERSPINFVDKFSCPIILFQGLEDKVVPPEQA  612

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALV+YE
Sbjct  613  RKIYLALKKKGLPVALVQYE  632



>ref|XP_009790912.1| PREDICTED: uncharacterized protein LOC104238289 [Nicotiana sylvestris]
Length=730

 Score =   359 bits (921),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA   EKPPLL++SHGGPTAEARG LNLS+QYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  486  QASHGEKPPLLMRSHGGPTAEARGCLNLSVQYWTSRGWAYVDVNYGGSTGYGREYRERLL  545

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCC+CA FLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAG SLYGI
Sbjct  546  GKWGIVDVNDCCNCAMFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGASLYGI  605

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL+LL     KFESHYIDNLVGD+ AYFERSPINFV+ FSCPIILFQGL+DKVV P+QA
Sbjct  606  GDLQLLRAETHKFESHYIDNLVGDEKAYFERSPINFVNHFSCPIILFQGLEDKVVSPDQA  665

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVALVEYE
Sbjct  666  RKIYQALKEKGLPVALVEYE  685



>ref|XP_004237535.1| PREDICTED: dipeptidyl-peptidase 5-like [Solanum lycopersicum]
Length=722

 Score =   357 bits (916),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA   E PPLLL+SHGGPTAEARG LNL+IQYWTSRGWA VDVNYGGSTGYGR +RERLL
Sbjct  478  QASHGETPPLLLRSHGGPTAEARGCLNLTIQYWTSRGWAYVDVNYGGSTGYGRGYRERLL  537

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
             NWGIVDVNDCC+CAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAG SLYGI
Sbjct  538  GNWGIVDVNDCCNCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGASLYGI  597

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL+LL     KFESHY DNLVGD+ AYFERSPINFVD FSCPIILFQGL+DKVV P+QA
Sbjct  598  GDLQLLRAETHKFESHYTDNLVGDEKAYFERSPINFVDHFSCPIILFQGLEDKVVSPDQA  657

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVALVEYE
Sbjct  658  RKIYQALKEKGLPVALVEYE  677



>ref|XP_006340554.1| PREDICTED: uncharacterized protein LOC102583576 [Solanum tuberosum]
Length=722

 Score =   357 bits (916),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA   E PPLLL+SHGGPTAEARG LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  478  QASHGETPPLLLRSHGGPTAEARGCLNLSIQYWTSRGWAYVDVNYGGSTGYGREYRERLL  537

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
             +WGIVDVNDCC+CAKFLVDSGRVD ERLCITGSSAGGYTTLAALAFKDVFKAG SLYGI
Sbjct  538  GSWGIVDVNDCCNCAKFLVDSGRVDSERLCITGSSAGGYTTLAALAFKDVFKAGASLYGI  597

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL+LL     KFESHY DNLVGD+ AYFERSPINFVD FSCPIILFQGL+DKVV P+QA
Sbjct  598  GDLQLLRAETHKFESHYTDNLVGDEKAYFERSPINFVDHFSCPIILFQGLEDKVVSPDQA  657

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVALVEYE
Sbjct  658  RKIYQALKEKGLPVALVEYE  677



>ref|XP_009626968.1| PREDICTED: dipeptidyl-peptidase 5-like [Nicotiana tomentosiformis]
Length=723

 Score =   357 bits (916),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA   EKPPLL++SHGGPTAEARG LNLS+QYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  479  QASHGEKPPLLMRSHGGPTAEARGCLNLSVQYWTSRGWAYVDVNYGGSTGYGREYRERLL  538

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCC+C KFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAG SLYGI
Sbjct  539  GKWGIVDVNDCCNCTKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGASLYGI  598

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL+LL     KFESHYIDNLVGD+ AYFERSPINFV++FS PIILFQGL+DKVV P+QA
Sbjct  599  GDLQLLRAETHKFESHYIDNLVGDEKAYFERSPINFVNRFSSPIILFQGLEDKVVSPDQA  658

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVALVEYE
Sbjct  659  RKIYQALKEKGLPVALVEYE  678



>emb|CBI19572.3| unnamed protein product [Vitis vinifera]
Length=675

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QAGQ+E+PPLLLKSHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  431  QAGQEERPPLLLKSHGGPTSETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  490

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA+FLV+SG+VDG+RLCITG SAGGYTTLAALAF++ FKAG SLYG+
Sbjct  491  GRWGIVDVNDCCSCARFLVESGKVDGDRLCITGGSAGGYTTLAALAFRETFKAGASLYGV  550

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL LL     KFESHYIDNLVG ++ YFERSPINFVDKFSCPIILFQGL+DKVVPP QA
Sbjct  551  ADLSLLRAETHKFESHYIDNLVGGESDYFERSPINFVDKFSCPIILFQGLEDKVVPPVQA  610

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVALVEYE
Sbjct  611  RKIYQALKEKGLPVALVEYE  630



>gb|KDP38395.1| hypothetical protein JCGZ_04320 [Jatropha curcas]
Length=681

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPP++LKSHGGPT+E RGSLNLSIQYWTSRGW  VDVNYGGSTGYGRE+RERLL
Sbjct  437  QASAEEKPPIVLKSHGGPTSETRGSLNLSIQYWTSRGWGFVDVNYGGSTGYGREYRERLL  496

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
             NWGIVDVNDCCSCAKFLVDSG+ DG+RLCITG SAGGYTTLAALAFK+ FKAG SLYG+
Sbjct  497  GNWGIVDVNDCCSCAKFLVDSGKADGKRLCITGGSAGGYTTLAALAFKETFKAGASLYGV  556

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHY+DNLVGD+ AYFERSPINFV +FSCPIILFQGL+DKVVPP+QA
Sbjct  557  ADLSMLRAETHKFESHYLDNLVGDEKAYFERSPINFVVRFSCPIILFQGLEDKVVPPDQA  616

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVALVEYE
Sbjct  617  RKIYQALKKKGLPVALVEYE  636



>ref|XP_011083811.1| PREDICTED: LOW QUALITY PROTEIN: acylamino-acid-releasing enzyme 
[Sesamum indicum]
Length=731

 Score =   353 bits (907),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLLLKSHGGPTAE RG LNLS+QYWTSRGWA VDVNYGGSTGYGRE+R+RLL
Sbjct  487  QASAEEKPPLLLKSHGGPTAETRGILNLSVQYWTSRGWAFVDVNYGGSTGYGREYRDRLL  546

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCAKFLVDSG+VDGERLCITG SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  547  GRWGIVDVNDCCSCAKFLVDSGKVDGERLCITGGSAGGYTTLAALAFRDTFKAGASLYGV  606

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK L D   KFESHYIDNLVGD++ YF+RSPINFVDKFSCP+ILFQGL+DKVVPP+Q+
Sbjct  607  ADLKSLRDDTHKFESHYIDNLVGDESEYFKRSPINFVDKFSCPLILFQGLEDKVVPPDQS  666

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  667  RKIYHALKDKGLPVALVEYE  686



>ref|XP_002284264.2| PREDICTED: dipeptidyl-peptidase 5 [Vitis vinifera]
Length=730

 Score =   353 bits (906),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QAGQ+E+PPLLLKSHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  486  QAGQEERPPLLLKSHGGPTSETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  545

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA+FLV+SG+VDG+RLCITG SAGGYTTLAALAF++ FKAG SLYG+
Sbjct  546  GRWGIVDVNDCCSCARFLVESGKVDGDRLCITGGSAGGYTTLAALAFRETFKAGASLYGV  605

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL LL     KFESHYIDNLVG ++ YFERSPINFVDKFSCPIILFQGL+DKVVPP QA
Sbjct  606  ADLSLLRAETHKFESHYIDNLVGGESDYFERSPINFVDKFSCPIILFQGLEDKVVPPVQA  665

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVALVEYE
Sbjct  666  RKIYQALKEKGLPVALVEYE  685



>gb|AEQ94129.1| C-terminal domain-containing protein [Elaeis guineensis]
Length=267

 Score =   338 bits (867),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  DEKPPLL+KSHGGPT+E RG L+L+IQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  24   QAPPDEKPPLLVKSHGGPTSETRGVLDLNIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  83

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCS AKFL +SG+VD +RLCITG SAGGYTTLA LAF+D FKAG SLYG+
Sbjct  84   GQWGIVDVNDCCSSAKFLAESGKVDAQRLCITGRSAGGYTTLACLAFRDTFKAGASLYGV  143

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL  L     KFESHYIDNLVG +NAY+ER+PINFVDKF+CP+ILFQGL+DKVVPP+QA
Sbjct  144  ADLSALKAETHKFESHYIDNLVGSENAYYERAPINFVDKFTCPVILFQGLEDKVVPPDQA  203

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  204  RKIYKALKEKGLPVALVEYE  223



>ref|XP_011017235.1| PREDICTED: uncharacterized protein LOC105120651 isoform X2 [Populus 
euphratica]
Length=682

 Score =   350 bits (897),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  438  QASQEEKPPLLLKSHGGPTSETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  497

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCAKFLVD+G+VD ERLCITG SAGGYTTLAALAFK+ FKAG SLYG+
Sbjct  498  DKWGIVDVNDCCSCAKFLVDNGKVDRERLCITGGSAGGYTTLAALAFKETFKAGASLYGV  557

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHYIDNLVG +  YFERSPINFVD+FSCPIILFQGL+DKVVPP+QA
Sbjct  558  ADLSMLRAETHKFESHYIDNLVGTEEDYFERSPINFVDRFSCPIILFQGLEDKVVPPDQA  617

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  618  RKIYLALKKKGLPVALVEYE  637



>ref|XP_002302446.2| hypothetical protein POPTR_0002s13010g [Populus trichocarpa]
 gb|EEE81719.2| hypothetical protein POPTR_0002s13010g [Populus trichocarpa]
Length=712

 Score =   350 bits (898),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  468  QASQEEKPPLLLKSHGGPTSETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  527

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSC KFLVD+G+VD ERLCITG SAGGYTTLAALAFK+ FKAG SLYG+
Sbjct  528  NKWGIVDVNDCCSCGKFLVDNGKVDSERLCITGGSAGGYTTLAALAFKETFKAGASLYGV  587

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHYIDNLVG +  YFERSPINFVD+FSCPIILFQGL+DKVVPP+QA
Sbjct  588  ADLSMLRAETHKFESHYIDNLVGTEEDYFERSPINFVDRFSCPIILFQGLEDKVVPPDQA  647

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  648  RKIYLALKKKGLPVALVEYE  667



>ref|XP_011017233.1| PREDICTED: uncharacterized protein LOC105120651 isoform X1 [Populus 
euphratica]
 ref|XP_011017234.1| PREDICTED: uncharacterized protein LOC105120651 isoform X1 [Populus 
euphratica]
 ref|XP_011017238.1| PREDICTED: uncharacterized protein LOC105120651 isoform X1 [Populus 
euphratica]
 ref|XP_011017239.1| PREDICTED: uncharacterized protein LOC105120651 isoform X1 [Populus 
euphratica]
Length=685

 Score =   350 bits (897),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  441  QASQEEKPPLLLKSHGGPTSETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  500

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCAKFLVD+G+VD ERLCITG SAGGYTTLAALAFK+ FKAG SLYG+
Sbjct  501  DKWGIVDVNDCCSCAKFLVDNGKVDRERLCITGGSAGGYTTLAALAFKETFKAGASLYGV  560

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHYIDNLVG +  YFERSPINFVD+FSCPIILFQGL+DKVVPP+QA
Sbjct  561  ADLSMLRAETHKFESHYIDNLVGTEEDYFERSPINFVDRFSCPIILFQGLEDKVVPPDQA  620

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  621  RKIYLALKKKGLPVALVEYE  640



>ref|XP_011013049.1| PREDICTED: uncharacterized protein LOC105117173 isoform X4 [Populus 
euphratica]
 ref|XP_011013050.1| PREDICTED: uncharacterized protein LOC105117173 isoform X4 [Populus 
euphratica]
Length=685

 Score =   349 bits (896),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  441  QASQEEKPPLLLKSHGGPTSETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  500

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCAKFLVD+G+VD ERLCITG SAGGYTTLAALAFK+ FKAG SLYG+
Sbjct  501  DKWGIVDVNDCCSCAKFLVDNGKVDRERLCITGGSAGGYTTLAALAFKETFKAGASLYGV  560

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHYIDNLVG +  YFERSPINFVD+FSCPIILFQGL+DKVVPP+QA
Sbjct  561  ADLSMLRAETHKFESHYIDNLVGTEEDYFERSPINFVDRFSCPIILFQGLEDKVVPPDQA  620

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  621  RKIYLALKKKGLPVALVEYE  640



>ref|XP_011017237.1| PREDICTED: uncharacterized protein LOC105120651 isoform X3 [Populus 
euphratica]
Length=739

 Score =   350 bits (898),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  495  QASQEEKPPLLLKSHGGPTSETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  554

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCAKFLVD+G+VD ERLCITG SAGGYTTLAALAFK+ FKAG SLYG+
Sbjct  555  DKWGIVDVNDCCSCAKFLVDNGKVDRERLCITGGSAGGYTTLAALAFKETFKAGASLYGV  614

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHYIDNLVG +  YFERSPINFVD+FSCPIILFQGL+DKVVPP+QA
Sbjct  615  ADLSMLRAETHKFESHYIDNLVGTEEDYFERSPINFVDRFSCPIILFQGLEDKVVPPDQA  674

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  675  RKIYLALKKKGLPVALVEYE  694



>ref|XP_011013048.1| PREDICTED: uncharacterized protein LOC105117173 isoform X3 [Populus 
euphratica]
Length=739

 Score =   350 bits (898),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  495  QASQEEKPPLLLKSHGGPTSETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  554

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCAKFLVD+G+VD ERLCITG SAGGYTTLAALAFK+ FKAG SLYG+
Sbjct  555  DKWGIVDVNDCCSCAKFLVDNGKVDRERLCITGGSAGGYTTLAALAFKETFKAGASLYGV  614

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHYIDNLVG +  YFERSPINFVD+FSCPIILFQGL+DKVVPP+QA
Sbjct  615  ADLSMLRAETHKFESHYIDNLVGTEEDYFERSPINFVDRFSCPIILFQGLEDKVVPPDQA  674

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  675  RKIYLALKKKGLPVALVEYE  694



>ref|XP_011013047.1| PREDICTED: uncharacterized protein LOC105117173 isoform X2 [Populus 
euphratica]
Length=740

 Score =   350 bits (898),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  496  QASQEEKPPLLLKSHGGPTSETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  555

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCAKFLVD+G+VD ERLCITG SAGGYTTLAALAFK+ FKAG SLYG+
Sbjct  556  DKWGIVDVNDCCSCAKFLVDNGKVDRERLCITGGSAGGYTTLAALAFKETFKAGASLYGV  615

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHYIDNLVG +  YFERSPINFVD+FSCPIILFQGL+DKVVPP+QA
Sbjct  616  ADLSMLRAETHKFESHYIDNLVGTEEDYFERSPINFVDRFSCPIILFQGLEDKVVPPDQA  675

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  676  RKIYLALKKKGLPVALVEYE  695



>ref|XP_011013046.1| PREDICTED: uncharacterized protein LOC105117173 isoform X1 [Populus 
euphratica]
Length=743

 Score =   350 bits (897),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  499  QASQEEKPPLLLKSHGGPTSETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  558

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCAKFLVD+G+VD ERLCITG SAGGYTTLAALAFK+ FKAG SLYG+
Sbjct  559  DKWGIVDVNDCCSCAKFLVDNGKVDRERLCITGGSAGGYTTLAALAFKETFKAGASLYGV  618

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHYIDNLVG +  YFERSPINFVD+FSCPIILFQGL+DKVVPP+QA
Sbjct  619  ADLSMLRAETHKFESHYIDNLVGTEEDYFERSPINFVDRFSCPIILFQGLEDKVVPPDQA  678

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  679  RKIYLALKKKGLPVALVEYE  698



>ref|XP_010684446.1| PREDICTED: uncharacterized protein LOC104899002 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=607

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q G  EKPPLLLKSHGGPTAE R  LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  363  QGGLGEKPPLLLKSHGGPTAETRAILNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  422

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
             NWGI+DVNDCCSCAKFLVD+G+VDG+RLCITG SAGGYTTLAALAFK+ F+AG SLYG+
Sbjct  423  GNWGIIDVNDCCSCAKFLVDNGKVDGDRLCITGGSAGGYTTLAALAFKETFRAGASLYGV  482

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL LL     KFESHYIDNLVG++ AYFERSPINF +KFSCPIILFQGL+DKVVPP+QA
Sbjct  483  ADLNLLRAETHKFESHYIDNLVGNEKAYFERSPINFANKFSCPIILFQGLEDKVVPPDQA  542

Query  543  RKIYQALKAKGLPVALVEYE  602
            R IY+ALK KGLPVALVEYE
Sbjct  543  RAIYKALKEKGLPVALVEYE  562



>emb|CDP07619.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   347 bits (889),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   +EKPPLLLKSHGGPTAE R  LNLS+QYWTSRGWA VDVNYGGS GYGR +R+RLL
Sbjct  431  QGYPEEKPPLLLKSHGGPTAETRAVLNLSVQYWTSRGWAFVDVNYGGSAGYGRGYRDRLL  490

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCAKFLVDSG+VDGERLCITG SAGGYTTLAALAFKD FKAG SLYG+
Sbjct  491  GQWGIVDVNDCCSCAKFLVDSGKVDGERLCITGGSAGGYTTLAALAFKDTFKAGASLYGV  550

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLKLL     KFESHYIDNLVG + AYFERSPINFV+KFSCPIILFQGL+DKVVPPEQA
Sbjct  551  ADLKLLRLETHKFESHYIDNLVGSERAYFERSPINFVEKFSCPIILFQGLEDKVVPPEQA  610

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  611  RKIYHALKEKGLPVALVEYE  630



>gb|EYU25389.1| hypothetical protein MIMGU_mgv1a002403mg [Erythranthe guttata]
Length=679

 Score =   347 bits (889),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            ++  +EKPPLLLKSHGGPTAE R SLN SIQYWTSRGWA VDVNYGGSTGYGR++R+RLL
Sbjct  435  RSSPEEKPPLLLKSHGGPTAETRSSLNFSIQYWTSRGWAFVDVNYGGSTGYGRKYRDRLL  494

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCAKFLVDSG+VDGERLCITG SAGGYTTLAALAF+DVFKAG SLYG+
Sbjct  495  GQWGIVDVNDCCSCAKFLVDSGKVDGERLCITGGSAGGYTTLAALAFRDVFKAGASLYGV  554

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK L     KFES YIDNLVGD+N +F+RSPINFVDKFSCPIILFQGL+DKVV P+QA
Sbjct  555  ADLKSLAADSHKFESRYIDNLVGDENEFFQRSPINFVDKFSCPIILFQGLEDKVVLPDQA  614

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALKAKGLPVALVEYE
Sbjct  615  RKIYHALKAKGLPVALVEYE  634



>gb|KJB63798.1| hypothetical protein B456_010G016900 [Gossypium raimondii]
Length=718

 Score =   347 bits (891),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPTAE RG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  474  QASQEEKPPLLLKSHGGPTAETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  533

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCAKFL+++G+ D ERLCITG SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  534  DRWGIVDVDDCCSCAKFLLENGKADKERLCITGGSAGGYTTLAALAFRDTFKAGASLYGV  593

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL LL     KFESHY+D LVGD  A+F+RSPINFVDKFSCPIILFQGL+DKVVPP+QA
Sbjct  594  ADLNLLKAETHKFESHYLDKLVGDDKAFFDRSPINFVDKFSCPIILFQGLEDKVVPPDQA  653

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  654  RKIYKALKEKGLPVALVEYE  673



>gb|KHM99572.1| Dipeptidyl peptidase family member 6 [Glycine soja]
Length=476

 Score =   340 bits (871),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA ++EKPPLLLKSHGGPTAE RG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  232  QASEEEKPPLLLKSHGGPTAETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  291

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA +LV+SG+VDGERLCITG SAGGYTTLAALAFK+ FKAG SLYG+
Sbjct  292  GRWGIVDVNDCCSCATYLVNSGKVDGERLCITGGSAGGYTTLAALAFKETFKAGASLYGV  351

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             D+ +L     KFESHYID L G +   +ERSPIN VDKFSCPIILFQGLDDKVVPPEQA
Sbjct  352  ADVNMLRAETHKFESHYIDRLGGGEKGCYERSPINHVDKFSCPIILFQGLDDKVVPPEQA  411

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KG+PVALVEYE
Sbjct  412  RKIYQALKEKGVPVALVEYE  431



>ref|XP_010684445.1| PREDICTED: uncharacterized protein LOC104899002 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=728

 Score =   347 bits (891),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q G  EKPPLLLKSHGGPTAE R  LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  484  QGGLGEKPPLLLKSHGGPTAETRAILNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  543

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
             NWGI+DVNDCCSCAKFLVD+G+VDG+RLCITG SAGGYTTLAALAFK+ F+AG SLYG+
Sbjct  544  GNWGIIDVNDCCSCAKFLVDNGKVDGDRLCITGGSAGGYTTLAALAFKETFRAGASLYGV  603

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL LL     KFESHYIDNLVG++ AYFERSPINF +KFSCPIILFQGL+DKVVPP+QA
Sbjct  604  ADLNLLRAETHKFESHYIDNLVGNEKAYFERSPINFANKFSCPIILFQGLEDKVVPPDQA  663

Query  543  RKIYQALKAKGLPVALVEYE  602
            R IY+ALK KGLPVALVEYE
Sbjct  664  RAIYKALKEKGLPVALVEYE  683



>ref|XP_008220188.1| PREDICTED: uncharacterized protein LOC103320302 [Prunus mume]
Length=709

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  DEKPPLLLKSHGGPTAE+RG LNLS+QYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  465  QATHDEKPPLLLKSHGGPTAESRGILNLSVQYWTSRGWAFVDVNYGGSTGYGREYRERLL  524

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            + WGIVDV+DCCSCAK+LV SG+ DGERLCITG SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  525  KKWGIVDVDDCCSCAKYLVGSGKADGERLCITGGSAGGYTTLAALAFRDTFKAGASLYGV  584

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHYIDNLVG +  Y++RSPINF DKFSCPIILFQGL+DKVVPP+QA
Sbjct  585  ADLNMLRAETHKFESHYIDNLVGSEKDYYDRSPINFADKFSCPIILFQGLEDKVVPPDQA  644

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  645  RKIYKALKEKGLPVALVEYE  664



>ref|XP_007225164.1| hypothetical protein PRUPE_ppa002365mg [Prunus persica]
 gb|EMJ26363.1| hypothetical protein PRUPE_ppa002365mg [Prunus persica]
Length=681

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  DEKPP+LLKSHGGPTAE+RG LNLS+QYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  437  QATHDEKPPMLLKSHGGPTAESRGILNLSVQYWTSRGWAYVDVNYGGSTGYGREYRERLL  496

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            + WGIVDV+DCCSCAK+LV SG+ DGERLCITG SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  497  KKWGIVDVDDCCSCAKYLVGSGKADGERLCITGGSAGGYTTLAALAFRDTFKAGASLYGV  556

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHYIDNLVG +  Y++RSPINF DKFSCPIILFQGL+DKVVPP+QA
Sbjct  557  ADLNMLRAETHKFESHYIDNLVGSEKDYYDRSPINFADKFSCPIILFQGLEDKVVPPDQA  616

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  617  RKIYKALKEKGLPVALVEYE  636



>ref|XP_003600065.1| Acyl-peptide hydrolase-like protein [Medicago truncatula]
 gb|AES70316.1| acyl-peptide hydrolase-like protein [Medicago truncatula]
Length=732

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            +A + EKPPLLLKSHGGPTAE  G LNLSIQYWTSRGWA  DVNYGGSTGYGRE+R+RLL
Sbjct  488  RAIEGEKPPLLLKSHGGPTAETHGILNLSIQYWTSRGWAFADVNYGGSTGYGREYRDRLL  547

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA +LVDSG+VDGERLCITG SAGGYTTLAALAFKD FKAG SLYG+
Sbjct  548  GRWGIVDVNDCCSCATYLVDSGKVDGERLCITGGSAGGYTTLAALAFKDTFKAGASLYGV  607

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLKLLV+   KFESHYIDNLVG + A+FERSPIN VDKFSCPIILFQGL+DKVVPP QA
Sbjct  608  ADLKLLVEETHKFESHYIDNLVGGEKAWFERSPINHVDKFSCPIILFQGLEDKVVPPSQA  667

Query  543  RKIYQALKAKGLPVALVEYE  602
            R+IYQALK KG+PVAL+EYE
Sbjct  668  REIYQALKKKGVPVALIEYE  687



>gb|KHG27260.1| Dipeptidyl peptidase family member 6 [Gossypium arboreum]
Length=718

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPTAE RG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  474  QASQEEKPPLLLKSHGGPTAETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  533

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCAKFL+++G+ D +RLCITG SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  534  DRWGIVDVDDCCSCAKFLLENGKADKDRLCITGGSAGGYTTLAALAFRDTFKAGASLYGV  593

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL LL     KFESHY+D LVGD  A+F+RSPINFVDKFSCPIILFQGL+DKVVPP+QA
Sbjct  594  ADLNLLKAETHKFESHYLDKLVGDDKAFFDRSPINFVDKFSCPIILFQGLEDKVVPPDQA  653

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  654  RKIYKALKEKGLPVALVEYE  673



>ref|XP_004291139.2| PREDICTED: uncharacterized protein LOC101314718 [Fragaria vesca 
subsp. vesca]
Length=721

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q  QDEKPPLLLKSHGGPTAEARG LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  477  QGTQDEKPPLLLKSHGGPTAEARGVLNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  536

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            + WGIVDVNDCCSCA +LV+SG+VDG+RLCITG SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  537  KKWGIVDVNDCCSCASYLVESGKVDGKRLCITGGSAGGYTTLAALAFRDTFKAGASLYGV  596

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFES Y+DNLVG    YF+RSPINFVDKFSCPIILFQGL+DKVVPP+QA
Sbjct  597  ADLNMLRAETHKFESRYLDNLVGSDQDYFDRSPINFVDKFSCPIILFQGLEDKVVPPDQA  656

Query  543  RKIYQALKAKGLPVALVEYE  602
            R IY+ALK KGLPVALVEYE
Sbjct  657  RTIYRALKEKGLPVALVEYE  676



>ref|XP_004141243.1| PREDICTED: uncharacterized protein LOC101211004 [Cucumis sativus]
 ref|XP_004160606.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226296 
[Cucumis sativus]
 gb|KGN55167.1| hypothetical protein Csa_4G639060 [Cucumis sativus]
Length=734

 Score =   345 bits (884),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLLLKSHGGPTAE RG+LN SIQYWTSRGW  VDVNYGGSTGYGRE+RERLL
Sbjct  490  QASPNEKPPLLLKSHGGPTAETRGNLNPSIQYWTSRGWGYVDVNYGGSTGYGREYRERLL  549

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDVNDCCSCA+FLV+SG+VDGE+LCITG SAGGYTTLAALAF+D FKAG SLYGI
Sbjct  550  RQWGIVDVNDCCSCARFLVESGKVDGEQLCITGGSAGGYTTLAALAFRDTFKAGASLYGI  609

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL+LL     KFESHYIDNLVG++  YF+RSPINFVDKFSCPIILFQGL+DKVV P Q+
Sbjct  610  ADLRLLRADTHKFESHYIDNLVGNEKDYFDRSPINFVDKFSCPIILFQGLEDKVVLPNQS  669

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  670  RKIYNALKEKGLPVALVEYE  689



>ref|XP_006656768.1| PREDICTED: acylamino-acid-releasing enzyme-like, partial [Oryza 
brachyantha]
Length=624

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HGGPTAE RG L+LS+QYWTSRGWA +DVNYGGSTG+GRE+RERLL
Sbjct  380  QGLPDEKPPLLVKTHGGPTAETRGILDLSVQYWTSRGWAYLDVNYGGSTGFGREYRERLL  439

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCA+FLV+SG+VD +RLCITG SAGGYTTLA+LAF+D FKAG SLYGI
Sbjct  440  GKWGIVDVDDCCSCARFLVESGQVDEQRLCITGRSAGGYTTLASLAFRDTFKAGASLYGI  499

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL LL     KFESHY+DNLVGD+ AY+ERSPINFVDKF+CP+ILFQGLDDKVVPP+QA
Sbjct  500  GDLSLLRAETHKFESHYMDNLVGDERAYYERSPINFVDKFTCPVILFQGLDDKVVPPDQA  559

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  560  RKIYKALKEKGLPVALVEYE  579



>ref|XP_009367400.1| PREDICTED: uncharacterized protein LOC103957051 [Pyrus x bretschneideri]
Length=717

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q EKPPLLLKSHGGPTAE+ G LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RE+LL
Sbjct  473  QAPQGEKPPLLLKSHGGPTAESHGILNLSIQYWTSRGWAFVDVNYGGSTGYGREYREQLL  532

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA++LVDSG+VDGERLCITG SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  533  NKWGIVDVNDCCSCARYLVDSGKVDGERLCITGGSAGGYTTLAALAFRDTFKAGSSLYGV  592

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHYIDNLVG +  Y +RSPINF DKFSCPIILFQGL+DKVVPP+QA
Sbjct  593  ADLNMLRAETHKFESHYIDNLVGSEKDYHDRSPINFDDKFSCPIILFQGLEDKVVPPDQA  652

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVA VEYE
Sbjct  653  RKIYQALKEKGLPVAHVEYE  672



>ref|XP_008393841.1| PREDICTED: uncharacterized protein LOC103455998 [Malus domestica]
 ref|XP_008367675.1| PREDICTED: uncharacterized protein LOC103431309 [Malus domestica]
Length=717

 Score =   342 bits (878),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q EKPPLLLKSHGGPTAE+ G LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  473  QAPQGEKPPLLLKSHGGPTAESHGILNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  532

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA++LVDSG+VDGERLCITG SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  533  NKWGIVDVNDCCSCARYLVDSGKVDGERLCITGGSAGGYTTLAALAFRDTFKAGSSLYGV  592

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHYIDNLVG +  Y +RSPINF DKFSCPIILFQGL+DKVV P+QA
Sbjct  593  ADLNMLRAETHKFESHYIDNLVGSEKDYHDRSPINFADKFSCPIILFQGLEDKVVAPDQA  652

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVA VEYE
Sbjct  653  RKIYQALKEKGLPVAHVEYE  672



>gb|ACN28162.1| unknown [Zea mays]
Length=500

 Score =   335 bits (860),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HGGPTAE R  L+LS+QYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  256  QGLPDEKPPLLVKTHGGPTAETRAILDLSVQYWTSRGWAYVDVNYGGSTGYGREYRERLL  315

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCC CA+FLV+SG+VDG+RLCITG SAGGYTTLA+LAF+D FKAG SLYG+
Sbjct  316  NKWGIVDVDDCCGCARFLVESGKVDGQRLCITGRSAGGYTTLASLAFRDTFKAGASLYGV  375

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL LL     KFESHY+DNLVG++ AY+ERSPINFV++F+CP+ILFQGL+DKVVPP+QA
Sbjct  376  GDLTLLRAETHKFESHYMDNLVGNERAYYERSPINFVNQFTCPVILFQGLEDKVVPPDQA  435

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  436  RKIYSALKEKGLPVALVEYE  455



>ref|XP_007017350.1| Acylamino-acid-releasing enzyme, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007017351.1| Acylamino-acid-releasing enzyme, putative isoform 1 [Theobroma 
cacao]
 gb|EOY14575.1| Acylamino-acid-releasing enzyme, putative isoform 1 [Theobroma 
cacao]
 gb|EOY14576.1| Acylamino-acid-releasing enzyme, putative isoform 1 [Theobroma 
cacao]
Length=726

 Score =   342 bits (877),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGR++RERLL
Sbjct  482  QAIQEEKPPLLLKSHGGPTSETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGRQYRERLL  541

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCA+FLV+ G+ D ERL ITG SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  542  GQWGIVDVDDCCSCARFLVEKGKADEERLFITGGSAGGYTTLAALAFRDTFKAGASLYGV  601

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL LL     KFESHYIDNLVG +  YFERSPINFVDKFSCPIILFQGL+DKVVPP+QA
Sbjct  602  ADLSLLRAETHKFESHYIDNLVGSETDYFERSPINFVDKFSCPIILFQGLEDKVVPPDQA  661

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVALVEYE
Sbjct  662  RKIYQALKEKGLPVALVEYE  681



>ref|XP_004500056.1| PREDICTED: uncharacterized protein LOC101508559 isoform X1 [Cicer 
arietinum]
 ref|XP_004500057.1| PREDICTED: uncharacterized protein LOC101508559 isoform X2 [Cicer 
arietinum]
Length=726

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPLLLKSHGGPTAE RG LNLSIQYWTSRGWA  DVNYGGSTGYGRE+R+RLL  WGI
Sbjct  487  EKPPLLLKSHGGPTAETRGVLNLSIQYWTSRGWAFADVNYGGSTGYGREYRDRLLGRWGI  546

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DCCSCAK+LVDSG+VD ERLCITG SAGGYTTLAALAFK+ FKAG SLYG+ DLKL
Sbjct  547  VDVDDCCSCAKYLVDSGKVDAERLCITGGSAGGYTTLAALAFKETFKAGASLYGVADLKL  606

Query  378  LVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKIYQ  557
            L++   KFESHYI NLVG +  +FERSPIN VDKFSCPIILFQGL+DKVVPP QARKIYQ
Sbjct  607  LIEETHKFESHYISNLVGGEKEWFERSPINHVDKFSCPIILFQGLEDKVVPPAQARKIYQ  666

Query  558  ALKAKGLPVALVEYE  602
            ALK KG+PVALVEYE
Sbjct  667  ALKEKGVPVALVEYE  681



>ref|XP_004500058.1| PREDICTED: uncharacterized protein LOC101508559 isoform X3 [Cicer 
arietinum]
Length=725

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPLLLKSHGGPTAE RG LNLSIQYWTSRGWA  DVNYGGSTGYGRE+R+RLL  WGI
Sbjct  486  EKPPLLLKSHGGPTAETRGVLNLSIQYWTSRGWAFADVNYGGSTGYGREYRDRLLGRWGI  545

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DCCSCAK+LVDSG+VD ERLCITG SAGGYTTLAALAFK+ FKAG SLYG+ DLKL
Sbjct  546  VDVDDCCSCAKYLVDSGKVDAERLCITGGSAGGYTTLAALAFKETFKAGASLYGVADLKL  605

Query  378  LVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKIYQ  557
            L++   KFESHYI NLVG +  +FERSPIN VDKFSCPIILFQGL+DKVVPP QARKIYQ
Sbjct  606  LIEETHKFESHYISNLVGGEKEWFERSPINHVDKFSCPIILFQGLEDKVVPPAQARKIYQ  665

Query  558  ALKAKGLPVALVEYE  602
            ALK KG+PVALVEYE
Sbjct  666  ALKEKGVPVALVEYE  680



>ref|XP_002510270.1| acylamino-acid-releasing enzyme, putative [Ricinus communis]
 gb|EEF52457.1| acylamino-acid-releasing enzyme, putative [Ricinus communis]
Length=731

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLLLKSHGGPT + RG LN SIQYWTSRGWA VDVNYGGSTGYGRE+RERL+
Sbjct  487  QASPEEKPPLLLKSHGGPTGDTRGILNPSIQYWTSRGWAFVDVNYGGSTGYGREYRERLI  546

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            +NWGI DVNDCCSCAKFLVD+G+ DGERLCITG SAGGYTTLAALAFK+ FKAG SLYG+
Sbjct  547  KNWGITDVNDCCSCAKFLVDTGKADGERLCITGGSAGGYTTLAALAFKETFKAGASLYGV  606

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHYIDNLVGD+  YFERSPINFVD FSCPIILFQGL+DKVV P+QA
Sbjct  607  ADLSMLRAETHKFESHYIDNLVGDEKDYFERSPINFVDGFSCPIILFQGLEDKVVAPDQA  666

Query  543  RKIYQALKAKGLPVALVEYE  602
            R IY ALK KG+PVALVEYE
Sbjct  667  RTIYNALKKKGVPVALVEYE  686



>ref|XP_010939403.1| PREDICTED: uncharacterized protein LOC105058230 isoform X2 [Elaeis 
guineensis]
Length=640

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  DEKPPLL+KSHGGPT+E RG L+L+IQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  396  QAPPDEKPPLLVKSHGGPTSETRGVLDLNIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  455

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCS AKFL +SG+VD +RLCITG SAGGYTTLA LAF+D FKAG SLYG+
Sbjct  456  GQWGIVDVNDCCSSAKFLAESGKVDAQRLCITGRSAGGYTTLACLAFRDTFKAGASLYGV  515

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL  L     KFESHYIDNLVG +NAY+ER+PINFVDKF+CP+ILFQGL+DKVVPP+QA
Sbjct  516  ADLSALKAETHKFESHYIDNLVGSENAYYERAPINFVDKFTCPVILFQGLEDKVVPPDQA  575

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  576  RKIYKALKEKGLPVALVEYE  595



>ref|XP_003532124.2| PREDICTED: probable dipeptidyl-peptidase 5-like [Glycine max]
Length=740

 Score =   341 bits (874),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA ++EKPPLLLKSHGGPTAE RG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  496  QASEEEKPPLLLKSHGGPTAETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  555

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA +LV+SG+VDGERLCITG SAGGYTTLAALAFK+ FKAG SLYG+
Sbjct  556  GRWGIVDVNDCCSCATYLVNSGKVDGERLCITGGSAGGYTTLAALAFKETFKAGASLYGV  615

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             D+ +L     KFESHYID L G +   +ERSPIN VDKFSCPIILFQGLDDKVVPPEQA
Sbjct  616  ADVNMLRAETHKFESHYIDRLGGGEKGCYERSPINHVDKFSCPIILFQGLDDKVVPPEQA  675

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KG+PVALVEYE
Sbjct  676  RKIYQALKEKGVPVALVEYE  695



>gb|KCW44332.1| hypothetical protein EUGRSUZ_L02208 [Eucalyptus grandis]
Length=511

 Score =   334 bits (857),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT+E RG LNLS+QYWTSRGWA VDVNYGGSTGYGREFRERL 
Sbjct  267  QASQEEKPPLLLKSHGGPTSETRGVLNLSVQYWTSRGWAFVDVNYGGSTGYGREFRERLS  326

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCAKFLV+SG+VDG RLCITGSSAGGYTTLAALAF++ FKAG SLYG+
Sbjct  327  GRWGIVDVDDCCSCAKFLVESGKVDGNRLCITGSSAGGYTTLAALAFRETFKAGASLYGV  386

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L+    KFESH ++ LVG +  Y+ERSPIN V+KFSCPIILFQGL+DKVVPP+QA
Sbjct  387  ADLNMLIAETHKFESHDLEKLVGSEKDYYERSPINSVEKFSCPIILFQGLEDKVVPPDQA  446

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLP+ALVEYE
Sbjct  447  RKIYAALKQKGLPIALVEYE  466



>ref|XP_007146464.1| hypothetical protein PHAVU_006G042600g [Phaseolus vulgaris]
 gb|ESW18458.1| hypothetical protein PHAVU_006G042600g [Phaseolus vulgaris]
Length=736

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA ++EKPPLLLKSHGGPTAEARG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  492  QASEEEKPPLLLKSHGGPTAEARGILNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  551

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA +LV+SG+VDGERLCITG SAGGYTTLAALAFK+ FKAG SLYG+
Sbjct  552  GRWGIVDVNDCCSCATYLVNSGKVDGERLCITGGSAGGYTTLAALAFKETFKAGASLYGV  611

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             D+ +L     KFESHYID L G +   +ERSPIN VDKFSCPIILFQGL+DKVVPPEQA
Sbjct  612  ADVNMLRAETHKFESHYIDRLGGGEKGCYERSPINHVDKFSCPIILFQGLEDKVVPPEQA  671

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KG+PVALVEYE
Sbjct  672  RKIYQALKEKGVPVALVEYE  691



>ref|XP_010268630.1| PREDICTED: uncharacterized protein LOC104605524 [Nelumbo nucifera]
 ref|XP_010268639.1| PREDICTED: uncharacterized protein LOC104605524 [Nelumbo nucifera]
Length=732

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPTAE+RG L+LS+QYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  488  QASQEEKPPLLLKSHGGPTAESRGILDLSVQYWTSRGWAFVDVNYGGSTGYGREYRERLL  547

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCA+FLVDSGRVDGERLCITG SAGGYTTLAALAFK VFKAG SLYG+
Sbjct  548  GRWGIVDVDDCCSCARFLVDSGRVDGERLCITGRSAGGYTTLAALAFKKVFKAGASLYGV  607

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL  L     KFE HYI+NLVG + A+ ERSPINFVD F+CP+ILFQGLDDKVVPP+QA
Sbjct  608  ADLTSLKAETHKFEFHYINNLVGSEGAFIERSPINFVDNFACPVILFQGLDDKVVPPDQA  667

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KG+PV LVEYE
Sbjct  668  RKIYMALKEKGVPVVLVEYE  687



>ref|XP_010059764.1| PREDICTED: uncharacterized protein LOC104447755 [Eucalyptus grandis]
 ref|XP_010059765.1| PREDICTED: uncharacterized protein LOC104447755 [Eucalyptus grandis]
 ref|XP_010059766.1| PREDICTED: uncharacterized protein LOC104447755 [Eucalyptus grandis]
 gb|KCW66191.1| hypothetical protein EUGRSUZ_F00026 [Eucalyptus grandis]
 gb|KCW66192.1| hypothetical protein EUGRSUZ_F00026 [Eucalyptus grandis]
 gb|KCW66193.1| hypothetical protein EUGRSUZ_F00026 [Eucalyptus grandis]
 gb|KCW66194.1| hypothetical protein EUGRSUZ_F00026 [Eucalyptus grandis]
Length=727

 Score =   340 bits (871),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  483  QASQEEKPPLLLKSHGGPTSETRGVLNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  542

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCAKFLV+SG+ DG RLCITG SAGGYTTLAALAF++ FKAG SLYG+
Sbjct  543  GRWGIVDVDDCCSCAKFLVESGKADGNRLCITGGSAGGYTTLAALAFRETFKAGASLYGV  602

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHY+D LVG +  Y+ERSPIN V+KFSCPIILFQGL+DKVVPP+QA
Sbjct  603  ADLNMLRAETHKFESHYLDKLVGSEKDYYERSPINSVEKFSCPIILFQGLEDKVVPPDQA  662

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  663  RKIYEALKQKGLPVALVEYE  682



>gb|KCW66196.1| hypothetical protein EUGRSUZ_F00026 [Eucalyptus grandis]
Length=724

 Score =   339 bits (870),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  480  QASQEEKPPLLLKSHGGPTSETRGVLNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  539

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCAKFLV+SG+ DG RLCITG SAGGYTTLAALAF++ FKAG SLYG+
Sbjct  540  GRWGIVDVDDCCSCAKFLVESGKADGNRLCITGGSAGGYTTLAALAFRETFKAGASLYGV  599

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHY+D LVG +  Y+ERSPIN V+KFSCPIILFQGL+DKVVPP+QA
Sbjct  600  ADLNMLRAETHKFESHYLDKLVGSEKDYYERSPINSVEKFSCPIILFQGLEDKVVPPDQA  659

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  660  RKIYEALKQKGLPVALVEYE  679



>gb|EPS72679.1| hypothetical protein M569_02077 [Genlisea aurea]
Length=685

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 179/201 (89%), Gaps = 2/201 (1%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A  +EKPPLLLKSHGGPTAEARG LNL +Q+WTSRGWA VDVNYGGSTGYGRE+R RLL 
Sbjct  440  ASPEEKPPLLLKSHGGPTAEARGILNLGVQFWTSRGWAFVDVNYGGSTGYGREYRNRLLG  499

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
             WG+VDV+DCCSCAKFL DSG+VDGERLCITG SAGGYTTLAALAF+D FKAG SLYG+ 
Sbjct  500  KWGVVDVDDCCSCAKFLADSGKVDGERLCITGGSAGGYTTLAALAFRDTFKAGASLYGVA  559

Query  366  DLKLLVDGMPKFESHYIDNLVGD--KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQ  539
            DL+LL + M KFESHY+DNLVG+  +  YFERSPINFVD+FSCP+ILFQGL+D VVPP+Q
Sbjct  560  DLRLLSEEMHKFESHYLDNLVGNGSEKEYFERSPINFVDRFSCPVILFQGLEDAVVPPDQ  619

Query  540  ARKIYQALKAKGLPVALVEYE  602
            ARKIY+ALK KGLPVAL+EYE
Sbjct  620  ARKIYRALKEKGLPVALIEYE  640



>ref|XP_010939401.1| PREDICTED: uncharacterized protein LOC105058230 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939402.1| PREDICTED: uncharacterized protein LOC105058230 isoform X1 [Elaeis 
guineensis]
Length=716

 Score =   338 bits (868),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  DEKPPLL+KSHGGPT+E RG L+L+IQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  472  QAPPDEKPPLLVKSHGGPTSETRGVLDLNIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  531

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCS AKFL +SG+VD +RLCITG SAGGYTTLA LAF+D FKAG SLYG+
Sbjct  532  GQWGIVDVNDCCSSAKFLAESGKVDAQRLCITGRSAGGYTTLACLAFRDTFKAGASLYGV  591

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL  L     KFESHYIDNLVG +NAY+ER+PINFVDKF+CP+ILFQGL+DKVVPP+QA
Sbjct  592  ADLSALKAETHKFESHYIDNLVGSENAYYERAPINFVDKFTCPVILFQGLEDKVVPPDQA  651

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  652  RKIYKALKEKGLPVALVEYE  671



>gb|EEC80224.1| hypothetical protein OsI_22153 [Oryza sativa Indica Group]
Length=683

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HGGPTAE RG L+LS+QYWTSRGWA +DVNYGGSTG+GRE+RERLL
Sbjct  439  QGLPDEKPPLLVKTHGGPTAETRGILDLSVQYWTSRGWAYLDVNYGGSTGFGREYRERLL  498

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCA+ LV+SG+VD  RLCITG SAGGYTTLA+LAF+D FKAG SLYGI
Sbjct  499  GKWGIVDVDDCCSCARVLVESGKVDERRLCITGRSAGGYTTLASLAFRDTFKAGASLYGI  558

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL LL     KFESHY DNLVG++NAY+ERSPINFVDKF+CP+ILFQGLDDKVVPP+QA
Sbjct  559  GDLSLLRAETHKFESHYTDNLVGNENAYYERSPINFVDKFTCPVILFQGLDDKVVPPDQA  618

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  619  RKIYKALKEKGLPVALVEYE  638



>ref|NP_001057137.1| Os06g0215300 [Oryza sativa Japonica Group]
 dbj|BAD35315.1| putative aminopeptidase C [Oryza sativa Japonica Group]
 dbj|BAF19051.1| Os06g0215300 [Oryza sativa Japonica Group]
 dbj|BAG89801.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65328.1| hypothetical protein OsJ_20588 [Oryza sativa Japonica Group]
Length=683

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HGGPTAE RG L+LS+QYWTSRGWA +DVNYGGSTG+GRE+RERLL
Sbjct  439  QGLPDEKPPLLVKTHGGPTAETRGILDLSVQYWTSRGWAYLDVNYGGSTGFGREYRERLL  498

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCA+ LV+SG+VD  RLCITG SAGGYTTLA+LAF+D FKAG SLYGI
Sbjct  499  GKWGIVDVDDCCSCARVLVESGKVDERRLCITGRSAGGYTTLASLAFRDTFKAGASLYGI  558

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL LL     KFESHY DNLVG++NAY+ERSPINFVDKF+CP+ILFQGLDDKVVPP+QA
Sbjct  559  GDLSLLRAETHKFESHYTDNLVGNENAYYERSPINFVDKFTCPVILFQGLDDKVVPPDQA  618

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  619  RKIYKALKEKGLPVALVEYE  638



>emb|CDP07620.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   337 bits (864),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLLLKSHGGPT E R  LNL +QYWTSRGWA+VDVNYGGS+GYGR +RER+L
Sbjct  431  QANPEEKPPLLLKSHGGPTLETRAILNLGVQYWTSRGWAIVDVNYGGSSGYGRRYRERIL  490

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCAKFLVDSG+VDGERLCITG SAGGYTTLAALAF + FKAG SL+GI
Sbjct  491  GQWGIVDVNDCCSCAKFLVDSGKVDGERLCITGESAGGYTTLAALAFTETFKAGASLFGI  550

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL LL + M KFESHY DNLVG  +AYFERSPINFVD+FSCP+ILFQGL+D+VVPP+QA
Sbjct  551  ADLNLLKEEMHKFESHYTDNLVGSGSAYFERSPINFVDQFSCPVILFQGLEDEVVPPDQA  610

Query  543  RKIYQALKAKGLPVALVEYE  602
            R+IY AL  KGLPVALVEY+
Sbjct  611  RRIYTALTEKGLPVALVEYQ  630



>dbj|BAK04728.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=716

 Score =   338 bits (866),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HGGPTAE RG L+LS+QYWTSRGWA +DVNYGGSTGYGRE+RERLL
Sbjct  472  QGLPDEKPPLLVKTHGGPTAETRGVLDLSVQYWTSRGWAFLDVNYGGSTGYGREYRERLL  531

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            + WGIVDV+DCCSCA+FLV++G+VD +RLCITG SAGGYTTLA+LAF+D FKAG SLYGI
Sbjct  532  KKWGIVDVDDCCSCARFLVENGKVDEQRLCITGRSAGGYTTLASLAFRDTFKAGASLYGI  591

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GD+ LL     KFESHY+DNLVG+++AY+ERSPINFV+KF+CP+ILFQGLDDKVVPP+QA
Sbjct  592  GDITLLRAETHKFESHYMDNLVGNESAYYERSPINFVNKFTCPVILFQGLDDKVVPPDQA  651

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK  GLPVALVEYE
Sbjct  652  RKIYKALKESGLPVALVEYE  671



>ref|XP_008220187.1| PREDICTED: uncharacterized protein LOC103320301 [Prunus mume]
Length=532

 Score =   332 bits (852),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  DEKPPLLL SHGGPT E+RG LNLS+QYWTSRGWA V+VNYGGSTGYGRE+RERLL
Sbjct  288  QATHDEKPPLLLNSHGGPTDESRGILNLSVQYWTSRGWAYVNVNYGGSTGYGREYRERLL  347

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            + WGIVDV+DCCSCAK+LV SG+ DGERLCITG SAGGYTTLAALAF+D FKAG SL G+
Sbjct  348  KKWGIVDVDDCCSCAKYLVGSGKADGERLCITGGSAGGYTTLAALAFRDTFKAGASLCGV  407

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHYIDNLVG +  Y++RSPINF DKFSCPIILFQGL+DKVVPP+QA
Sbjct  408  ADLNMLRAETHKFESHYIDNLVGSEKDYYDRSPINFADKFSCPIILFQGLEDKVVPPDQA  467

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKI++ALK KGLPVALVEYE
Sbjct  468  RKIHKALKEKGLPVALVEYE  487



>ref|XP_008797283.1| PREDICTED: uncharacterized protein LOC103712518 isoform X2 [Phoenix 
dactylifera]
Length=718

 Score =   337 bits (865),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+KSHGGPTAE RG L+L+IQYWTSRGWA  DVNYGGSTGYGRE+RERLL
Sbjct  474  QPPPDEKPPLLVKSHGGPTAETRGVLDLNIQYWTSRGWAFADVNYGGSTGYGREYRERLL  533

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCS AKFL +SG+VD +RLCITG SAGGYTTLA LAF+D FKAG SLYG+
Sbjct  534  GQWGIVDVNDCCSSAKFLAESGKVDAQRLCITGRSAGGYTTLACLAFRDTFKAGASLYGV  593

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL  L     KFESHYIDNLVG +NAY+ER+PINFVDKF+CP+ILFQGL+DK+VPPEQA
Sbjct  594  ADLSSLKAETHKFESHYIDNLVGSENAYYERAPINFVDKFTCPVILFQGLEDKIVPPEQA  653

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  654  RKIYKALKEKGLPVALVEYE  673



>ref|XP_002438048.1| hypothetical protein SORBIDRAFT_10g007270 [Sorghum bicolor]
 gb|EER89415.1| hypothetical protein SORBIDRAFT_10g007270 [Sorghum bicolor]
Length=721

 Score =   337 bits (864),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HGGPTAE R  L+L++QYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  477  QGLADEKPPLLVKTHGGPTAETRAILDLNVQYWTSRGWAYVDVNYGGSTGYGREYRERLL  536

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCA+FLV+SG+VDG+RLCITG SAGGYTTLA+LAF+D+FKAG SLYG+
Sbjct  537  DKWGIVDVDDCCSCARFLVESGKVDGQRLCITGRSAGGYTTLASLAFRDMFKAGASLYGV  596

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL LL     KFESHY+DNLVG++ AY+ERSPINFV++F+CP+ILFQGL+DKVVPP+QA
Sbjct  597  GDLTLLRAETHKFESHYMDNLVGNERAYYERSPINFVNQFTCPVILFQGLEDKVVPPDQA  656

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  657  RKIYNALKEKGLPVALVEYE  676



>ref|XP_008378199.1| PREDICTED: uncharacterized protein LOC103441288 [Malus domestica]
Length=735

 Score =   337 bits (865),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q EKPPLLL+SHGGPT+E+ G LNLSIQYWTSRGWA V+VNYGGSTGYGRE+RERLL
Sbjct  491  QAPQGEKPPLLLESHGGPTSESHGILNLSIQYWTSRGWAYVNVNYGGSTGYGREYRERLL  550

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA++LVDSG+VDGERLCITG SAGGYTTLAALAF+D FKAG SL G+
Sbjct  551  NRWGIVDVNDCCSCARYLVDSGKVDGERLCITGGSAGGYTTLAALAFRDTFKAGSSLCGV  610

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHY+DNLVG +  Y++RSPINFVDKFSCPIILFQGL+DKVVPP+QA
Sbjct  611  ADLNMLRAETHKFESHYLDNLVGSERDYYDRSPINFVDKFSCPIILFQGLEDKVVPPDQA  670

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVA VEYE
Sbjct  671  RKIYHALKEKGLPVAHVEYE  690



>ref|XP_008658746.1| PREDICTED: acylaminoacyl-peptidase1 isoform X3 [Zea mays]
Length=716

 Score =   337 bits (864),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HGGPTAE R  L+LS+QYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  472  QGLPDEKPPLLVKTHGGPTAETRAILDLSVQYWTSRGWAYVDVNYGGSTGYGREYRERLL  531

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCC CA+FLV+SG+VDG+RLCITG SAGGYTTLA+LAF+D FKAG SLYG+
Sbjct  532  NKWGIVDVDDCCGCARFLVESGKVDGQRLCITGRSAGGYTTLASLAFRDTFKAGASLYGV  591

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL LL     KFESHY+DNLVG++ AY+ERSPINFV++F+CP+ILFQGL+DKVVPP+QA
Sbjct  592  GDLTLLRAETHKFESHYMDNLVGNERAYYERSPINFVNQFTCPVILFQGLEDKVVPPDQA  651

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  652  RKIYSALKEKGLPVALVEYE  671



>ref|NP_001152650.1| acylaminoacyl-peptidase1 [Zea mays]
 gb|ACG48753.1| acyl-peptide hydrolase-like [Zea mays]
 gb|ACR36308.1| unknown [Zea mays]
Length=674

 Score =   335 bits (860),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HGGPTAE R  L+LS+QYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  430  QGLPDEKPPLLVKTHGGPTAETRAILDLSVQYWTSRGWAYVDVNYGGSTGYGREYRERLL  489

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCC CA+FLV+SG+VDG+RLCITG SAGGYTTLA+LAF+D FKAG SLYG+
Sbjct  490  NKWGIVDVDDCCGCARFLVESGKVDGQRLCITGRSAGGYTTLASLAFRDTFKAGASLYGV  549

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL LL     KFESHY+DNLVG++ AY+ERSPINFV++F+CP+ILFQGL+DKVVPP+QA
Sbjct  550  GDLTLLRAETHKFESHYMDNLVGNERAYYERSPINFVNQFTCPVILFQGLEDKVVPPDQA  609

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  610  RKIYSALKEKGLPVALVEYE  629



>gb|AFW85329.1| putative acyl-peptide hydrolase [Zea mays]
Length=715

 Score =   337 bits (863),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HGGPTAE R  L+LS+QYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  471  QGLPDEKPPLLVKTHGGPTAETRAILDLSVQYWTSRGWAYVDVNYGGSTGYGREYRERLL  530

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCC CA+FLV+SG+VDG+RLCITG SAGGYTTLA+LAF+D FKAG SLYG+
Sbjct  531  NKWGIVDVDDCCGCARFLVESGKVDGQRLCITGRSAGGYTTLASLAFRDTFKAGASLYGV  590

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL LL     KFESHY+DNLVG++ AY+ERSPINFV++F+CP+ILFQGL+DKVVPP+QA
Sbjct  591  GDLTLLRAETHKFESHYMDNLVGNERAYYERSPINFVNQFTCPVILFQGLEDKVVPPDQA  650

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  651  RKIYSALKEKGLPVALVEYE  670



>ref|XP_010059767.1| PREDICTED: uncharacterized protein LOC104447756 [Eucalyptus grandis]
 ref|XP_010059768.1| PREDICTED: uncharacterized protein LOC104447756 [Eucalyptus grandis]
 gb|KCW66203.1| hypothetical protein EUGRSUZ_F00027 [Eucalyptus grandis]
Length=681

 Score =   335 bits (860),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLLL+SHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  437  QASAEEKPPLLLESHGGPTSETRGVLNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  496

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCAKFLV+SG+VDG RLCITG SAGGYTTLAALAF++ FKAG SLYGI
Sbjct  497  GRWGIVDVDDCCSCAKFLVESGKVDGTRLCITGGSAGGYTTLAALAFRETFKAGASLYGI  556

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L   M KFESHYIDNLVG +   +ERSPINFV+KFSCPIILFQGL+D+VVPP QA
Sbjct  557  ADLNMLRAEMHKFESHYIDNLVGSEKDCYERSPINFVEKFSCPIILFQGLEDQVVPPGQA  616

Query  543  RKIYQALKAKGLPVALVEYE  602
             KIY ALK KGLPVALVEYE
Sbjct  617  HKIYAALKQKGLPVALVEYE  636



>ref|XP_009370189.1| PREDICTED: uncharacterized protein LOC103959562 [Pyrus x bretschneideri]
Length=713

 Score =   336 bits (862),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q EKPPLLL SHGGPT+E+ G LNLSIQY TSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  469  QAPQGEKPPLLLNSHGGPTSESHGILNLSIQYLTSRGWAYVDVNYGGSTGYGREYRERLL  528

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA++LVDSG+VDGERLCITG SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  529  NKWGIVDVNDCCSCARYLVDSGKVDGERLCITGGSAGGYTTLAALAFRDTFKAGSSLYGV  588

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHY+DNLVG +  +++RSPINFVDKFSCPIILFQGL+DKVVPP+QA
Sbjct  589  ADLNMLRAETHKFESHYLDNLVGSEKDFYDRSPINFVDKFSCPIILFQGLEDKVVPPDQA  648

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVA VEYE
Sbjct  649  RKIYHALKEKGLPVAHVEYE  668



>gb|KCW66202.1| hypothetical protein EUGRSUZ_F00027 [Eucalyptus grandis]
Length=681

 Score =   335 bits (860),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLLL+SHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  437  QASAEEKPPLLLESHGGPTSETRGVLNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  496

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCAKFLV+SG+VDG RLCITG SAGGYTTLAALAF++ FKAG SLYGI
Sbjct  497  GRWGIVDVDDCCSCAKFLVESGKVDGTRLCITGGSAGGYTTLAALAFRETFKAGASLYGI  556

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L   M KFESHYIDNLVG +   +ERSPINFV+KFSCPIILFQGL+D+VVPP QA
Sbjct  557  ADLNMLRAEMHKFESHYIDNLVGSEKDCYERSPINFVEKFSCPIILFQGLEDQVVPPGQA  616

Query  543  RKIYQALKAKGLPVALVEYE  602
             KIY ALK KGLPVALVEYE
Sbjct  617  HKIYAALKQKGLPVALVEYE  636



>ref|XP_010059769.1| PREDICTED: uncharacterized protein LOC104447758 [Eucalyptus grandis]
 gb|KCW66204.1| hypothetical protein EUGRSUZ_F00028 [Eucalyptus grandis]
Length=681

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLLL+SHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  437  QASAEEKPPLLLESHGGPTSETRGVLNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  496

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCAKFLV+SG+VDG RLCITG SAGGYTTLAALAF++ FKAG SLYG+
Sbjct  497  GRWGIVDVDDCCSCAKFLVESGKVDGTRLCITGGSAGGYTTLAALAFRETFKAGASLYGV  556

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L   M KFESHYID LVG +  Y+ERSPINFV+KFSCPIILFQGL+D+VV P QA
Sbjct  557  ADLNMLRAEMHKFESHYIDKLVGSEKDYYERSPINFVEKFSCPIILFQGLEDQVVSPGQA  616

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  617  RKIYAALKQKGLPVALVEYE  636



>dbj|BAB09360.1| acyl-peptide hydrolase-like [Arabidopsis thaliana]
Length=678

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             A  +EKPPLL+KSHGGPTAE+RGSLNL+IQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  433  NASMEEKPPLLVKSHGGPTAESRGSLNLNIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  492

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDV+DCC CAK+LV SG+ D +RLCI+G SAGGYTTLA+LAF+DVFKAG SLYG+
Sbjct  493  RQWGIVDVDDCCGCAKYLVSSGKADVKRLCISGGSAGGYTTLASLAFRDVFKAGASLYGV  552

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK+L +   KFES YIDNLVGD+  ++ERSPINFVDKFSCPIILFQGL+DKVV P+Q+
Sbjct  553  ADLKMLKEEGHKFESRYIDNLVGDEKDFYERSPINFVDKFSCPIILFQGLEDKVVTPDQS  612

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  613  RKIYEALKKKGLPVALVEYE  632



>gb|KDO84310.1| hypothetical protein CISIN_1g004756mg [Citrus sinensis]
Length=729

 Score =   337 bits (863),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLL+KSHGGPT+EARG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  485  QASPEEKPPLLVKSHGGPTSEARGILNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  544

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA FLV SG+ D +RLCITG SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  545  GRWGIVDVNDCCSCATFLVGSGKADEKRLCITGGSAGGYTTLAALAFRDTFKAGASLYGV  604

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFES YIDNLVG +  Y+E+SPINFVDKFSCPIILFQGL+DKVVPP+QA
Sbjct  605  ADLSMLRAETHKFESRYIDNLVGSEKDYYEKSPINFVDKFSCPIILFQGLEDKVVPPDQA  664

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK  GLPVALVEYE
Sbjct  665  RKIYKALKENGLPVALVEYE  684



>gb|KDO84311.1| hypothetical protein CISIN_1g004756mg [Citrus sinensis]
 gb|KDO84312.1| hypothetical protein CISIN_1g004756mg [Citrus sinensis]
 gb|KDO84313.1| hypothetical protein CISIN_1g004756mg [Citrus sinensis]
Length=732

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLL+KSHGGPT+EARG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  488  QASPEEKPPLLVKSHGGPTSEARGILNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  547

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA FLV SG+ D +RLCITG SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  548  GRWGIVDVNDCCSCATFLVGSGKADEKRLCITGGSAGGYTTLAALAFRDTFKAGASLYGV  607

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFES YIDNLVG +  Y+E+SPINFVDKFSCPIILFQGL+DKVVPP+QA
Sbjct  608  ADLSMLRAETHKFESRYIDNLVGSEKDYYEKSPINFVDKFSCPIILFQGLEDKVVPPDQA  667

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK  GLPVALVEYE
Sbjct  668  RKIYKALKENGLPVALVEYE  687



>ref|XP_006473373.1| PREDICTED: dipeptidyl-peptidase 5-like [Citrus sinensis]
Length=732

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLL+KSHGGPT+EARG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  488  QASPEEKPPLLVKSHGGPTSEARGILNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  547

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA FLV SG+ D +RLCITG SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  548  GRWGIVDVNDCCSCATFLVGSGKADEKRLCITGGSAGGYTTLAALAFRDTFKAGASLYGV  607

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFES YIDNLVG +  Y+E+SPINFVDKFSCPIILFQGL+DKVVPP+QA
Sbjct  608  ADLSMLRAETHKFESRYIDNLVGSEKDYYEKSPINFVDKFSCPIILFQGLEDKVVPPDQA  667

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK  GLPVALVEYE
Sbjct  668  RKIYKALKENGLPVALVEYE  687



>ref|XP_006434840.1| hypothetical protein CICLE_v10003676mg [Citrus clementina]
 gb|ESR48080.1| hypothetical protein CICLE_v10003676mg [Citrus clementina]
Length=732

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLL+KSHGGPT+EARG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  488  QASPEEKPPLLVKSHGGPTSEARGILNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  547

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA FLV SG+ D +RLCITG SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  548  GRWGIVDVNDCCSCATFLVGSGKADEKRLCITGGSAGGYTTLAALAFRDTFKAGASLYGV  607

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFES YIDNLVG +  Y+E+SPINFVDKFSCPIILFQGL+DKVVPP+QA
Sbjct  608  ADLSMLRAETHKFESRYIDNLVGSEKDYYEKSPINFVDKFSCPIILFQGLEDKVVPPDQA  667

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK  GLPVALVEYE
Sbjct  668  RKIYKALKENGLPVALVEYE  687



>gb|KCW66201.1| hypothetical protein EUGRSUZ_F00027 [Eucalyptus grandis]
Length=759

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLLL+SHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  515  QASAEEKPPLLLESHGGPTSETRGVLNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  574

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCAKFLV+SG+VDG RLCITG SAGGYTTLAALAF++ FKAG SLYGI
Sbjct  575  GRWGIVDVDDCCSCAKFLVESGKVDGTRLCITGGSAGGYTTLAALAFRETFKAGASLYGI  634

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L   M KFESHYIDNLVG +   +ERSPINFV+KFSCPIILFQGL+D+VVPP QA
Sbjct  635  ADLNMLRAEMHKFESHYIDNLVGSEKDCYERSPINFVEKFSCPIILFQGLEDQVVPPGQA  694

Query  543  RKIYQALKAKGLPVALVEYE  602
             KIY ALK KGLPVALVEYE
Sbjct  695  HKIYAALKQKGLPVALVEYE  714



>ref|XP_008658745.1| PREDICTED: acylaminoacyl-peptidase1 isoform X2 [Zea mays]
Length=747

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HGGPTAE R  L+LS+QYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  471  QGLPDEKPPLLVKTHGGPTAETRAILDLSVQYWTSRGWAYVDVNYGGSTGYGREYRERLL  530

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCC CA+FLV+SG+VDG+RLCITG SAGGYTTLA+LAF+D FKAG SLYG+
Sbjct  531  NKWGIVDVDDCCGCARFLVESGKVDGQRLCITGRSAGGYTTLASLAFRDTFKAGASLYGV  590

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL LL     KFESHY+DNLVG++ AY+ERSPINFV++F+CP+ILFQGL+DKVVPP+QA
Sbjct  591  GDLTLLRAETHKFESHYMDNLVGNERAYYERSPINFVNQFTCPVILFQGLEDKVVPPDQA  650

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  651  RKIYSALKEKGLPVALVEYE  670



>ref|XP_008658744.1| PREDICTED: acylaminoacyl-peptidase1 isoform X1 [Zea mays]
Length=748

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HGGPTAE R  L+LS+QYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  472  QGLPDEKPPLLVKTHGGPTAETRAILDLSVQYWTSRGWAYVDVNYGGSTGYGREYRERLL  531

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCC CA+FLV+SG+VDG+RLCITG SAGGYTTLA+LAF+D FKAG SLYG+
Sbjct  532  NKWGIVDVDDCCGCARFLVESGKVDGQRLCITGRSAGGYTTLASLAFRDTFKAGASLYGV  591

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL LL     KFESHY+DNLVG++ AY+ERSPINFV++F+CP+ILFQGL+DKVVPP+QA
Sbjct  592  GDLTLLRAETHKFESHYMDNLVGNERAYYERSPINFVNQFTCPVILFQGLEDKVVPPDQA  651

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  652  RKIYSALKEKGLPVALVEYE  671



>ref|XP_010041478.1| PREDICTED: uncharacterized protein LOC104430423 [Eucalyptus grandis]
Length=673

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT+E RG LNLS+QYWTSRGWA VDVNYGGSTGYGREFRERL 
Sbjct  429  QASQEEKPPLLLKSHGGPTSETRGVLNLSVQYWTSRGWAFVDVNYGGSTGYGREFRERLS  488

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCAKFLV+SG+VDG RLCITGSSAGGYTTLAALAF++ FKAG SLYG+
Sbjct  489  GRWGIVDVDDCCSCAKFLVESGKVDGNRLCITGSSAGGYTTLAALAFRETFKAGASLYGV  548

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L+    KFESH ++ LVG +  Y+ERSPIN V+KFSCPIILFQGL+DKVVPP+QA
Sbjct  549  ADLNMLIAETHKFESHDLEKLVGSEKDYYERSPINSVEKFSCPIILFQGLEDKVVPPDQA  608

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLP+ALVEYE
Sbjct  609  RKIYAALKQKGLPIALVEYE  628



>ref|XP_010435497.1| PREDICTED: uncharacterized protein LOC104719302 isoform X2 [Camelina 
sativa]
Length=729

 Score =   336 bits (861),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             A  +EKPPLL+KSHGGPTAE+RGSLNL+IQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  484  NASMEEKPPLLVKSHGGPTAESRGSLNLNIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  543

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDV+DCC CAK+LV SG+ D  RLCI+G SAGGYTTLAALAF+DVFKAG SLYG+
Sbjct  544  RQWGIVDVDDCCGCAKYLVSSGKADVNRLCISGGSAGGYTTLAALAFRDVFKAGASLYGV  603

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK+L +   KFES YIDNLVGD+  ++ERSPINFVDKFSCPIILFQGL+DKVV P+Q+
Sbjct  604  ADLKMLKEEGHKFESRYIDNLVGDEKDFYERSPINFVDKFSCPIILFQGLEDKVVTPDQS  663

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  664  RKIYKALKEKGLPVALVEYE  683



>ref|NP_198470.3| putative S9 Tyrosyl aminopeptidase [Arabidopsis thaliana]
 gb|AED94057.1| putative S9 Tyrosyl aminopeptidase [Arabidopsis thaliana]
Length=730

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             A  +EKPPLL+KSHGGPTAE+RGSLNL+IQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  485  NASMEEKPPLLVKSHGGPTAESRGSLNLNIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  544

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDV+DCC CAK+LV SG+ D +RLCI+G SAGGYTTLA+LAF+DVFKAG SLYG+
Sbjct  545  RQWGIVDVDDCCGCAKYLVSSGKADVKRLCISGGSAGGYTTLASLAFRDVFKAGASLYGV  604

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK+L +   KFES YIDNLVGD+  ++ERSPINFVDKFSCPIILFQGL+DKVV P+Q+
Sbjct  605  ADLKMLKEEGHKFESRYIDNLVGDEKDFYERSPINFVDKFSCPIILFQGLEDKVVTPDQS  664

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  665  RKIYEALKKKGLPVALVEYE  684



>ref|XP_010435496.1| PREDICTED: uncharacterized protein LOC104719302 isoform X1 [Camelina 
sativa]
Length=731

 Score =   336 bits (861),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             A  +EKPPLL+KSHGGPTAE+RGSLNL+IQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  486  NASMEEKPPLLVKSHGGPTAESRGSLNLNIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  545

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDV+DCC CAK+LV SG+ D  RLCI+G SAGGYTTLAALAF+DVFKAG SLYG+
Sbjct  546  RQWGIVDVDDCCGCAKYLVSSGKADVNRLCISGGSAGGYTTLAALAFRDVFKAGASLYGV  605

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK+L +   KFES YIDNLVGD+  ++ERSPINFVDKFSCPIILFQGL+DKVV P+Q+
Sbjct  606  ADLKMLKEEGHKFESRYIDNLVGDEKDFYERSPINFVDKFSCPIILFQGLEDKVVTPDQS  665

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  666  RKIYKALKEKGLPVALVEYE  685



>ref|XP_004248740.1| PREDICTED: uncharacterized protein LOC101248248 [Solanum lycopersicum]
Length=665

 Score =   334 bits (856),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = +3

Query  12   QDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNW  191
            Q+EKPPLLL+SHGGPT EARG+LNLSIQYWTSRGWA VDVNYGGSTGYGR +RERLL  W
Sbjct  424  QEEKPPLLLESHGGPTDEARGTLNLSIQYWTSRGWAFVDVNYGGSTGYGRAYRERLLGKW  483

Query  192  GIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDL  371
            GIVD+NDCCSCAK+LVD G+VDG+RLCITG SAGGYTTLA+LAF+D F+AG SL+GI DL
Sbjct  484  GIVDINDCCSCAKYLVDEGKVDGKRLCITGCSAGGYTTLASLAFRDTFRAGASLFGIADL  543

Query  372  KLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKI  551
            K L D M KFESHYI NL G++ A  ERSPINFVD+FSCPII+FQGL+D VV PEQARKI
Sbjct  544  KSLSDHMHKFESHYIINLAGNEIALNERSPINFVDRFSCPIIVFQGLEDTVVQPEQARKI  603

Query  552  YQALKAKGLPVALVEYE  602
            YQALK KGLPVALVEYE
Sbjct  604  YQALKKKGLPVALVEYE  620



>ref|XP_010450432.1| PREDICTED: uncharacterized protein LOC104732567 [Camelina sativa]
Length=729

 Score =   335 bits (860),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             A  +EKPPLL+KSHGGPTAE+RGSLNL++QYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  484  NASMEEKPPLLVKSHGGPTAESRGSLNLNLQYWTSRGWAFVDVNYGGSTGYGREYRERLL  543

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDV+DCC CAK+LV SG+ D +RLCI+G SAGGYTTLAALAF+DVFKAG SLYG+
Sbjct  544  RQWGIVDVDDCCGCAKYLVSSGKADVKRLCISGGSAGGYTTLAALAFRDVFKAGASLYGV  603

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK+L +   KFES YIDNLVGD+  ++ERSPINFVDKFSCPIILFQGL+DKVV P+Q+
Sbjct  604  ADLKMLKEEGHKFESRYIDNLVGDEKDFYERSPINFVDKFSCPIILFQGLEDKVVTPDQS  663

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  664  RKIYKALKEKGLPVALVEYE  683



>ref|XP_003551887.1| PREDICTED: uncharacterized protein LOC100794040 isoform X1 [Glycine 
max]
 ref|XP_006602204.1| PREDICTED: uncharacterized protein LOC100794040 isoform X2 [Glycine 
max]
 gb|KHN45223.1| Dipeptidyl peptidase family member 6 [Glycine soja]
Length=674

 Score =   333 bits (854),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA ++EKPPLLLKSHGGPT E RG LNLS+QYWTSRGWA+VDVNYGGSTGYGR +RERLL
Sbjct  429  QASKEEKPPLLLKSHGGPTQETRGILNLSVQYWTSRGWAVVDVNYGGSTGYGRVYRERLL  488

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDVNDCCSCA +LVDSG+VD ERLCI G SAGGYTTLA LAF+D F+AG SLYGI
Sbjct  489  RQWGIVDVNDCCSCATYLVDSGKVDKERLCIMGGSAGGYTTLAVLAFRDTFQAGASLYGI  548

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL LL     KFESHY++NLVGD    +ERSPIN VD FSCPII+FQGL+DKVVPP+QA
Sbjct  549  ADLNLLRAETHKFESHYVENLVGDDKDMYERSPINHVDNFSCPIIIFQGLEDKVVPPDQA  608

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQA+K KG+PVALVEYE
Sbjct  609  RKIYQAVKEKGVPVALVEYE  628



>ref|XP_004964876.1| PREDICTED: uncharacterized protein LOC101764724 isoform X2 [Setaria 
italica]
Length=721

 Score =   334 bits (857),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HGGPTAE R  L+LS+QYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  477  QGLPDEKPPLLVKTHGGPTAETRAILDLSVQYWTSRGWAYVDVNYGGSTGYGREYRERLL  536

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCC CA+FLV+SG+VDG RLCITG SAGGYTTLA+LAF+D FKAG SLYG+
Sbjct  537  EKWGIVDVDDCCGCARFLVESGKVDGRRLCITGRSAGGYTTLASLAFRDTFKAGASLYGV  596

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL LL     KFESHY+DNLVG++ AY+ERSPINFV++F+CP+ILFQGL+DKVVPP+QA
Sbjct  597  GDLTLLRAETHKFESHYLDNLVGNERAYYERSPINFVNQFTCPVILFQGLEDKVVPPDQA  656

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK +GLPVALVEYE
Sbjct  657  RKIYNALKERGLPVALVEYE  676



>ref|XP_004964875.1| PREDICTED: uncharacterized protein LOC101764724 isoform X1 [Setaria 
italica]
Length=724

 Score =   334 bits (856),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HGGPTAE R  L+LS+QYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  480  QGLPDEKPPLLVKTHGGPTAETRAILDLSVQYWTSRGWAYVDVNYGGSTGYGREYRERLL  539

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCC CA+FLV+SG+VDG RLCITG SAGGYTTLA+LAF+D FKAG SLYG+
Sbjct  540  EKWGIVDVDDCCGCARFLVESGKVDGRRLCITGRSAGGYTTLASLAFRDTFKAGASLYGV  599

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL LL     KFESHY+DNLVG++ AY+ERSPINFV++F+CP+ILFQGL+DKVVPP+QA
Sbjct  600  GDLTLLRAETHKFESHYLDNLVGNERAYYERSPINFVNQFTCPVILFQGLEDKVVPPDQA  659

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK +GLPVALVEYE
Sbjct  660  RKIYNALKERGLPVALVEYE  679



>ref|XP_008452505.1| PREDICTED: uncharacterized protein LOC103493518 [Cucumis melo]
Length=678

 Score =   333 bits (853),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             +  DEKPPLLL+SHGGPT E+RG LNL +QYWTSRGWA V+VNYGGS+GYGR +RERLL
Sbjct  445  HSSGDEKPPLLLESHGGPTDESRGILNLRVQYWTSRGWAFVNVNYGGSSGYGRAYRERLL  504

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDVNDCCSCA++LVDSG VD ERLCI G SAGGYTTLAALAF+D FKAG SLYGI
Sbjct  505  RKWGIVDVNDCCSCARYLVDSGVVDAERLCIAGESAGGYTTLAALAFRDTFKAGASLYGI  564

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL++L   M KFESHYIDNLVG +  Y+ERSPINFV+KFSCP+ILFQGLDDKVVPP QA
Sbjct  565  ADLRMLRAEMHKFESHYIDNLVGVERDYYERSPINFVEKFSCPLILFQGLDDKVVPPSQA  624

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KG+ VAL+EYE
Sbjct  625  RKIYQALKEKGVHVALIEYE  644



>ref|XP_004292827.1| PREDICTED: uncharacterized protein LOC101295106 [Fragaria vesca 
subsp. vesca]
Length=676

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 173/201 (86%), Gaps = 1/201 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  DEKPPLLL SHGGPT E+RG LNLSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  431  QATIDEKPPLLLGSHGGPTFESRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  490

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA++LVDSG VDGERLC TG SAGGYTTLAALAF+D FKAG SLYGI
Sbjct  491  GKWGIVDVNDCCSCARYLVDSGMVDGERLCATGESAGGYTTLAALAFRDTFKAGASLYGI  550

Query  363  GDLKLL-VDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQ  539
             DL++L  +   KFES YIDNLVG +  YF+RSPINFVDKFSCPIILFQGL+D  VPP+Q
Sbjct  551  ADLRMLKAEETHKFESRYIDNLVGTEKEYFDRSPINFVDKFSCPIILFQGLEDMSVPPKQ  610

Query  540  ARKIYQALKAKGLPVALVEYE  602
            AR IY ALK KGLPVALVEYE
Sbjct  611  ARTIYHALKEKGLPVALVEYE  631



>ref|XP_003564098.1| PREDICTED: uncharacterized protein LOC100823141 [Brachypodium 
distachyon]
Length=716

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DE+PPLL+K+HGGPTAEA+G L+LS+QYWTSRGWA +DVNYGGSTGYGRE+RERLL
Sbjct  472  QGLPDERPPLLVKTHGGPTAEAQGILDLSVQYWTSRGWAFLDVNYGGSTGYGREYRERLL  531

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCA+FLV++G+VD +RLCITG SAGGYTTLA+LAF+D FKAG SLYG+
Sbjct  532  EKWGIVDVDDCCSCARFLVENGKVDDQRLCITGRSAGGYTTLASLAFRDTFKAGASLYGV  591

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            GDL LL     KFESHY+D+LVG++ AY+ERSPINFV+KF+CP+ILFQGLDDKVVPP+QA
Sbjct  592  GDLSLLRAETHKFESHYMDSLVGNERAYYERSPINFVNKFTCPVILFQGLDDKVVPPDQA  651

Query  543  RKIYQALKAKGLPVALVEYE  602
            R IY+ALK KGLPVALVEYE
Sbjct  652  RAIYKALKEKGLPVALVEYE  671



>ref|XP_010551210.1| PREDICTED: uncharacterized protein LOC104821889 isoform X2 [Tarenaya 
hassleriana]
Length=727

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLL+KSHGGPTAE R SLNLSIQYWTSRGWA +DVNYGGSTGYGRE+RERLL
Sbjct  483  QASSEEKPPLLVKSHGGPTAETRASLNLSIQYWTSRGWAFLDVNYGGSTGYGREYRERLL  542

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            + WGIVDV+DCC+CAK+L+D G++D +RLCI+G SAGGYTTLAALAF+D+FKAG SLYG+
Sbjct  543  KKWGIVDVDDCCNCAKYLIDIGKIDEKRLCISGGSAGGYTTLAALAFRDIFKAGASLYGV  602

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK L +   KFES+YIDNLVGD+  Y+ERSPINFVD+FSCPIILFQGL+DKVV P+Q+
Sbjct  603  VDLKKLREDGHKFESYYIDNLVGDEKDYYERSPINFVDRFSCPIILFQGLEDKVVFPDQS  662

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KG+PVALVEYE
Sbjct  663  RKIYQALKEKGVPVALVEYE  682



>gb|KGN55166.1| hypothetical protein Csa_4G639050 [Cucumis sativus]
Length=669

 Score =   332 bits (850),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             +  DEKPPLLL+SHGGPT E+RG LNL +QYWTSRGWA V+VNYGGS+GYGR +RERLL
Sbjct  436  HSSGDEKPPLLLESHGGPTDESRGILNLRVQYWTSRGWAFVNVNYGGSSGYGRPYRERLL  495

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDVNDCCSCAK+LVDSG VD ERLCI G SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  496  RKWGIVDVNDCCSCAKYLVDSGVVDAERLCIAGESAGGYTTLAALAFRDTFKAGASLYGV  555

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L   M KFESHYI NLVGD+  ++ERSPINFV+KFSCP+ILFQGLDDKVVPP QA
Sbjct  556  ADLHMLNAEMHKFESHYIGNLVGDERDFYERSPINFVEKFSCPLILFQGLDDKVVPPVQA  615

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGL VAL+EYE
Sbjct  616  RKIYQALKEKGLHVALIEYE  635



>ref|XP_010551206.1| PREDICTED: uncharacterized protein LOC104821889 isoform X1 [Tarenaya 
hassleriana]
Length=729

 Score =   333 bits (853),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLL+KSHGGPTAE R SLNLSIQYWTSRGWA +DVNYGGSTGYGRE+RERLL
Sbjct  485  QASSEEKPPLLVKSHGGPTAETRASLNLSIQYWTSRGWAFLDVNYGGSTGYGREYRERLL  544

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            + WGIVDV+DCC+CAK+L+D G++D +RLCI+G SAGGYTTLAALAF+D+FKAG SLYG+
Sbjct  545  KKWGIVDVDDCCNCAKYLIDIGKIDEKRLCISGGSAGGYTTLAALAFRDIFKAGASLYGV  604

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK L +   KFES+YIDNLVGD+  Y+ERSPINFVD+FSCPIILFQGL+DKVV P+Q+
Sbjct  605  VDLKKLREDGHKFESYYIDNLVGDEKDYYERSPINFVDRFSCPIILFQGLEDKVVFPDQS  664

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KG+PVALVEYE
Sbjct  665  RKIYQALKEKGVPVALVEYE  684



>ref|XP_009628457.1| PREDICTED: uncharacterized protein LOC104118801 [Nicotiana tomentosiformis]
Length=659

 Score =   330 bits (847),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 174/200 (87%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            + G+DEKPPLLL+SHGGPT EA G+LNLSIQYWTSRGWA VDVNYGGS+GYGR +RERLL
Sbjct  415  KGGEDEKPPLLLESHGGPTDEAHGTLNLSIQYWTSRGWAFVDVNYGGSSGYGRAYRERLL  474

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCAK+LVD G+VDG+RLCITG SAGGYTTLA+LAF+D F+AG SL+GI
Sbjct  475  GEWGIVDVNDCCSCAKYLVDEGKVDGKRLCITGCSAGGYTTLASLAFRDTFRAGASLFGI  534

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK L D M KFES YI NL G++ A +ERSPINFVD FSCPIILFQGL+D VV PEQA
Sbjct  535  ADLKSLSDKMHKFESRYILNLAGNETALYERSPINFVDHFSCPIILFQGLEDTVVQPEQA  594

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVA VEYE
Sbjct  595  RKIYQALKKKGLPVAHVEYE  614



>ref|XP_006349631.1| PREDICTED: probable dipeptidyl-peptidase 5-like [Solanum tuberosum]
Length=665

 Score =   330 bits (846),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = +3

Query  12   QDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNW  191
            Q+EKPPLLL+SHGGPT EA G+LNLSIQYWTSRGWA VDVNYGGSTGYGR +RERLL  W
Sbjct  424  QEEKPPLLLESHGGPTDEAHGTLNLSIQYWTSRGWAFVDVNYGGSTGYGRAYRERLLGKW  483

Query  192  GIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDL  371
            GIVD+NDCCSCA++LVD G+VDG+RLCITG SAGGYTTLA LAF+D F+AG SL+GIGDL
Sbjct  484  GIVDINDCCSCAEYLVDEGKVDGKRLCITGCSAGGYTTLATLAFRDTFRAGASLFGIGDL  543

Query  372  KLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKI  551
            K L D M KFESHYI NL G++ A  ERSPINFVD+FSCPII+FQGL+D VV PEQARKI
Sbjct  544  KSLSDHMHKFESHYIINLAGNEIALNERSPINFVDRFSCPIIVFQGLEDTVVQPEQARKI  603

Query  552  YQALKAKGLPVALVEYE  602
            Y+ALK KGLPVALVEYE
Sbjct  604  YEALKKKGLPVALVEYE  620



>ref|XP_008797282.1| PREDICTED: uncharacterized protein LOC103712518 isoform X1 [Phoenix 
dactylifera]
Length=722

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 174/204 (85%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+KSHGGPTAE RG L+L+IQYWTSRGWA  DVNYGGSTGYGRE+RERLL
Sbjct  474  QPPPDEKPPLLVKSHGGPTAETRGVLDLNIQYWTSRGWAFADVNYGGSTGYGREYRERLL  533

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCS AKFL +SG+VD +RLCITG SAGGYTTLA LAF+D FKAG SLYG+
Sbjct  534  GQWGIVDVNDCCSSAKFLAESGKVDAQRLCITGRSAGGYTTLACLAFRDTFKAGASLYGV  593

Query  363  GDLKLLVDGMPKFESHYIDNLV----GDKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL  L     KFESHYIDNLV    G +NAY+ER+PINFVDKF+CP+ILFQGL+DK+VP
Sbjct  594  ADLSSLKAETHKFESHYIDNLVVFILGSENAYYERAPINFVDKFTCPVILFQGLEDKIVP  653

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            PEQARKIY+ALK KGLPVALVEYE
Sbjct  654  PEQARKIYKALKEKGLPVALVEYE  677



>ref|XP_004964874.1| PREDICTED: uncharacterized protein LOC101764319 [Setaria italica]
Length=674

 Score =   328 bits (842),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   +EKPPL++++HGGPTAEA+G L+LS+QYWTSRGWA VDVNYGGS+GYGREFRERLL
Sbjct  430  QGSSEEKPPLVVRTHGGPTAEAQGVLDLSVQYWTSRGWAFVDVNYGGSSGYGREFRERLL  489

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WG+VDVNDCCSCA FLV++GRVDG+RLC+TG SAGG+TTLA LAF+  FKAG SLYGI
Sbjct  490  GQWGVVDVNDCCSCATFLVETGRVDGQRLCVTGESAGGFTTLACLAFRQTFKAGSSLYGI  549

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL  L  GM KFE++YIDNLVG+K AYFERSPINFV+ FSCP+ILFQGL+D VV P+QA
Sbjct  550  ADLAALRAGMNKFEAYYIDNLVGNKQAYFERSPINFVNNFSCPVILFQGLEDTVVSPDQA  609

Query  543  RKIYQALKAKGLPVALVEYE  602
             KIY+A+K KGLPVALVEYE
Sbjct  610  TKIYKAIKDKGLPVALVEYE  629



>ref|XP_009783554.1| PREDICTED: uncharacterized protein LOC104232138 [Nicotiana sylvestris]
Length=659

 Score =   328 bits (840),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            +   DEKPPLLL+SHGGPT EA G+LNLSIQYWTSRGWA VDVNYGGS+GYGR +RERLL
Sbjct  415  KGSADEKPPLLLESHGGPTDEAHGTLNLSIQYWTSRGWAFVDVNYGGSSGYGRAYRERLL  474

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCAK+LVD G+VD +RLCITG SAGGYTTLA+LAF+D F+ G SL+GI
Sbjct  475  GKWGIVDVNDCCSCAKYLVDEGKVDEKRLCITGCSAGGYTTLASLAFRDTFRTGASLFGI  534

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK L D M KFESHYI NL GD+ A +ERSPINFVD FSCPIILFQGL+D VV PEQA
Sbjct  535  ADLKSLSDKMHKFESHYILNLAGDETALYERSPINFVDHFSCPIILFQGLEDTVVQPEQA  594

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVA VEYE
Sbjct  595  RKIYQALKKKGLPVAHVEYE  614



>ref|XP_009414032.1| PREDICTED: uncharacterized protein LOC103995219 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=734

 Score =   329 bits (843),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  DEKPPLL+KSHGGPT+E+   L+L+IQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  490  QACSDEKPPLLVKSHGGPTSESHCILDLNIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  549

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WG VDVNDCCSCA+FLV+ G+VDGERLCITG SAGGYTTLA LAF++ FKAG SLYG+
Sbjct  550  GQWGTVDVNDCCSCARFLVECGKVDGERLCITGRSAGGYTTLACLAFRETFKAGASLYGV  609

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL LL     KFES+Y+DNLVG +NAYFERSPINFVDKF+CP+ILFQGL+DKVVPP QA
Sbjct  610  ADLTLLRAETHKFESYYLDNLVGSENAYFERSPINFVDKFTCPVILFQGLEDKVVPPVQA  669

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+AL  KGLPVAL+EYE
Sbjct  670  RKIYKALIDKGLPVALIEYE  689



>gb|EEC80225.1| hypothetical protein OsI_22154 [Oryza sativa Indica Group]
Length=679

 Score =   326 bits (835),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+++HGGPT EARG L+L +QYWTSRGWA VDVNYGGSTGYGR+FRERLL
Sbjct  431  QGSSDEKPPLLVRTHGGPTDEARGVLDLGVQYWTSRGWAFVDVNYGGSTGYGRKFRERLL  490

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WG+VDVNDCCSCA FLV++GRVD +RLC+TG SAGG+TTLA LAF+ +FKAG SLYGI
Sbjct  491  GQWGVVDVNDCCSCATFLVETGRVDAQRLCVTGESAGGFTTLACLAFRQIFKAGSSLYGI  550

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL  L  GM KFE++YIDNLVG++ AYFERSPINFVD+FSCPIILFQGL+D VV P QA
Sbjct  551  ADLASLRAGMHKFEAYYIDNLVGNRKAYFERSPINFVDRFSCPIILFQGLEDTVVSPVQA  610

Query  543  RKIYQALKAKGLPVALVEYE  602
              IY+A+K KGLPVALVEYE
Sbjct  611  TTIYKAIKDKGLPVALVEYE  630



>ref|NP_001057138.1| Os06g0215400 [Oryza sativa Japonica Group]
 dbj|BAD35316.1| putative aminopeptidase C [Oryza sativa Japonica Group]
 dbj|BAD35824.1| putative aminopeptidase C [Oryza sativa Japonica Group]
 dbj|BAF19052.1| Os06g0215400 [Oryza sativa Japonica Group]
Length=679

 Score =   325 bits (834),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+++HGGPT EARG L+L +QYWTSRGWA VDVNYGGSTGYGR+FRERLL
Sbjct  431  QGSSDEKPPLLVRTHGGPTDEARGVLDLGVQYWTSRGWAFVDVNYGGSTGYGRKFRERLL  490

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WG+VDVNDCCSCA FLV++GRVD +RLC+TG SAGG+TTLA LAF+ +FKAG SLYGI
Sbjct  491  GQWGVVDVNDCCSCATFLVETGRVDAQRLCVTGESAGGFTTLACLAFRQIFKAGSSLYGI  550

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL  L  GM KFE++YIDNLVG++ AYFERSPINFVD+FSCPIILFQGL+D VV P QA
Sbjct  551  ADLASLRAGMHKFEAYYIDNLVGNRKAYFERSPINFVDRFSCPIILFQGLEDTVVSPVQA  610

Query  543  RKIYQALKAKGLPVALVEYE  602
              IY+A+K KGLPVALVEYE
Sbjct  611  TTIYKAIKDKGLPVALVEYE  630



>gb|EEE65329.1| hypothetical protein OsJ_20589 [Oryza sativa Japonica Group]
Length=679

 Score =   325 bits (833),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+++HGGPT EARG L+L +QYWTSRGWA VDVNYGGSTGYGR+FRERLL
Sbjct  431  QGSSDEKPPLLVRTHGGPTDEARGVLDLGVQYWTSRGWAFVDVNYGGSTGYGRKFRERLL  490

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WG+VDVNDCCSCA FLV++GRVD +RLC+TG SAGG+TTLA LAF+ +FKAG SLYGI
Sbjct  491  GQWGVVDVNDCCSCATFLVETGRVDAQRLCVTGESAGGFTTLACLAFRQIFKAGSSLYGI  550

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL  L  GM KFE++YIDNLVG++ AYFERSPINFVD+FSCPIILFQGL+D VV P QA
Sbjct  551  ADLASLRAGMHKFEAYYIDNLVGNRKAYFERSPINFVDRFSCPIILFQGLEDTVVSPVQA  610

Query  543  RKIYQALKAKGLPVALVEYE  602
              IY+A+K KGLPVALVEYE
Sbjct  611  TTIYKAIKDKGLPVALVEYE  630



>ref|XP_008452506.1| PREDICTED: dipeptidyl-peptidase 5-like isoform X1 [Cucumis melo]
 ref|XP_008452507.1| PREDICTED: dipeptidyl-peptidase 5-like isoform X1 [Cucumis melo]
 ref|XP_008452509.1| PREDICTED: dipeptidyl-peptidase 5-like isoform X1 [Cucumis melo]
 ref|XP_008452510.1| PREDICTED: dipeptidyl-peptidase 5-like isoform X1 [Cucumis melo]
Length=733

 Score =   327 bits (837),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  DEKPPLLLKSHGGPTAE RGSLN SIQYWTSRGW  VDVNYGGSTGYGRE+RERLL
Sbjct  489  QASPDEKPPLLLKSHGGPTAETRGSLNPSIQYWTSRGWGYVDVNYGGSTGYGREYRERLL  548

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDVNDCCSCA+FLV+SG+VDGE+LCITG SAGGYTTLAALAF+D FKAG SLYGI
Sbjct  549  RRWGIVDVNDCCSCARFLVESGKVDGEQLCITGGSAGGYTTLAALAFRDTFKAGASLYGI  608

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL+LL     KFESHYIDNLVG++  YF+RSPINFVDKFSCPIILFQGL+DKVV P Q+
Sbjct  609  ADLRLLRADTHKFESHYIDNLVGNEKDYFDRSPINFVDKFSCPIILFQGLEDKVVLPNQS  668

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  669  RKIYNALKEKGLPVALVEYE  688



>ref|XP_008452511.1| PREDICTED: dipeptidyl-peptidase 5-like isoform X2 [Cucumis melo]
Length=728

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  DEKPPLLLKSHGGPTAE RGSLN SIQYWTSRGW  VDVNYGGSTGYGRE+RERLL
Sbjct  484  QASPDEKPPLLLKSHGGPTAETRGSLNPSIQYWTSRGWGYVDVNYGGSTGYGREYRERLL  543

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDVNDCCSCA+FLV+SG+VDGE+LCITG SAGGYTTLAALAF+D FKAG SLYGI
Sbjct  544  RRWGIVDVNDCCSCARFLVESGKVDGEQLCITGGSAGGYTTLAALAFRDTFKAGASLYGI  603

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL+LL     KFESHYIDNLVG++  YF+RSPINFVDKFSCPIILFQGL+DKVV P Q+
Sbjct  604  ADLRLLRADTHKFESHYIDNLVGNEKDYFDRSPINFVDKFSCPIILFQGLEDKVVLPNQS  663

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  664  RKIYNALKEKGLPVALVEYE  683



>ref|XP_003558169.1| PREDICTED: uncharacterized protein LOC100835264 [Brachypodium 
distachyon]
Length=673

 Score =   323 bits (829),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+++HGGPT EARG L+L +QYWTSRGWALVDVNYGGS GYGRE+RERL 
Sbjct  429  QGSSDEKPPLLVRTHGGPTDEARGVLDLGVQYWTSRGWALVDVNYGGSAGYGREYRERLS  488

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDVNDCCSCA FLV++GRVDG+RLC+TG SAGG+TTLA LAF+  FKAG SLYGI
Sbjct  489  GQWGIVDVNDCCSCATFLVETGRVDGQRLCVTGESAGGFTTLACLAFRQTFKAGSSLYGI  548

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL  L  GM KFE+HYIDNLVG+K AYFERSPINFV++F+CP+ILFQGL+D VV P+QA
Sbjct  549  ADLASLRKGMHKFEAHYIDNLVGNKQAYFERSPINFVERFTCPVILFQGLEDPVVSPDQA  608

Query  543  RKIYQALKAKGLPVALVEYE  602
              I++A+K KGLPVALVEYE
Sbjct  609  TIIHRAIKDKGLPVALVEYE  628



>ref|XP_006829430.1| hypothetical protein AMTR_s00128p00114010 [Amborella trichopoda]
 gb|ERM96846.1| hypothetical protein AMTR_s00128p00114010 [Amborella trichopoda]
Length=745

 Score =   325 bits (832),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPLLLKSHGGPT+E+ G+L+LSIQYWTSRGWA VDVNYGGSTGYGRE+RERLL NWGI
Sbjct  506  EKPPLLLKSHGGPTSESHGTLDLSIQYWTSRGWAFVDVNYGGSTGYGREYRERLLGNWGI  565

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDVNDCCSCA+FLVDSG+ DGE+LCITG SAGGYTTLAALAF   FKAG SL+G+ DL+L
Sbjct  566  VDVNDCCSCAQFLVDSGKADGEQLCITGRSAGGYTTLAALAFSQTFKAGASLFGVADLRL  625

Query  378  LVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKIYQ  557
            L +   KFES Y+DNL+G +  +++RSPINFV++FSCP+ILFQGL+DKVV P+QARKIY 
Sbjct  626  LKESTHKFESRYLDNLLGAEKNFYDRSPINFVERFSCPVILFQGLEDKVVLPDQARKIYM  685

Query  558  ALKAKGLPVALVEYE  602
            AL+ KGLPVALVEYE
Sbjct  686  ALQEKGLPVALVEYE  700



>ref|XP_007146465.1| hypothetical protein PHAVU_006G042700g [Phaseolus vulgaris]
 gb|ESW18459.1| hypothetical protein PHAVU_006G042700g [Phaseolus vulgaris]
Length=672

 Score =   322 bits (825),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA ++EKPPLLLKSHGGPT E RG LNLSIQYWTSRGWA+VDVNYGGSTGYGR +RERLL
Sbjct  427  QASEEEKPPLLLKSHGGPTEETRGILNLSIQYWTSRGWAVVDVNYGGSTGYGRAYRERLL  486

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDV+DCCSCA +LVDSG+VD ERLCI G+SAGGYTTLA LAF++ F+AG SL GI
Sbjct  487  RQWGIVDVSDCCSCATYLVDSGKVDKERLCIMGASAGGYTTLAVLAFRNTFQAGASLCGI  546

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL LL     KFESHY++NL G     +ERSPIN VD FSCPII+FQGL+DKVVPP+QA
Sbjct  547  ADLNLLRAETHKFESHYVENLAGGDKQMYERSPINHVDDFSCPIIIFQGLEDKVVPPDQA  606

Query  543  RKIYQALKAKGLPVALVEYE  602
            +KIYQA+K KG+PVALVEYE
Sbjct  607  KKIYQAVKEKGVPVALVEYE  626



>ref|XP_004964878.1| PREDICTED: uncharacterized protein LOC101765802 [Setaria italica]
Length=679

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+++HGGPT EARG L+L++QYWTSRGWALVDVNYGGS+GYGRE+RERLL
Sbjct  435  QGSSDEKPPLLVRTHGGPTEEARGVLDLNVQYWTSRGWALVDVNYGGSSGYGREYRERLL  494

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WG+VDVNDCCSCA FLV++GRVDG+RLCITG SAGG+TTLA LAF+  FKAGCSLYGI
Sbjct  495  GQWGVVDVNDCCSCATFLVETGRVDGKRLCITGESAGGFTTLACLAFRQTFKAGCSLYGI  554

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL  L     KFE+ Y DNLVG+K AYFER+PINFVDKF+CP+ILF GL+D VV P+Q 
Sbjct  555  ADLTSLRASSHKFEACYTDNLVGNKQAYFERAPINFVDKFTCPLILFHGLEDTVVQPDQT  614

Query  543  RKIYQALKAKGLPVALVEYE  602
             KIY+A+K KGLPVALVEYE
Sbjct  615  TKIYRAIKDKGLPVALVEYE  634



>ref|XP_006656769.1| PREDICTED: uncharacterized protein LOC102718283 [Oryza brachyantha]
Length=656

 Score =   320 bits (821),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             +  DEKPPLL+++HGGPT EARG L+L +QYWTSRGWA VDVNYGGSTGYGR++RERLL
Sbjct  409  HSSSDEKPPLLVRTHGGPTDEARGVLDLGVQYWTSRGWAFVDVNYGGSTGYGRKYRERLL  468

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WG+VDVNDCCSCA FLV++GRVD +RLC+TG SAGG+TTLA LAF+ +FKAG SLYGI
Sbjct  469  GKWGVVDVNDCCSCATFLVETGRVDAQRLCVTGESAGGFTTLACLAFRQIFKAGSSLYGI  528

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL  L  GM KFE++YIDNLVG+K  Y+ERSPINFVD+F+CPIILFQGL+D VV P+QA
Sbjct  529  ADLASLRAGMHKFEAYYIDNLVGNKQDYYERSPINFVDRFACPIILFQGLEDTVVSPDQA  588

Query  543  RKIYQALKAKGLPVALVEYE  602
              IY+A+K KGLPVALVEYE
Sbjct  589  TTIYKAIKDKGLPVALVEYE  608



>gb|KCW66190.1| hypothetical protein EUGRSUZ_F00025 [Eucalyptus grandis]
Length=500

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 171/200 (86%), Gaps = 2/200 (1%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT + RG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  258  QASQEEKPPLLLKSHGGPTRKTRGVLNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  317

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCA+FLV+S +VDG RLCITG SAGGYTTLAALAF++ F+AG SLYG+
Sbjct  318  GCWGIVDVDDCCSCAEFLVESRKVDGNRLCITGVSAGGYTTLAALAFRETFRAGASLYGV  377

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
              + +L     KFESHY+DN V  +   +ERSPINFV+KFSCP+ILFQGL+DKVVPP+Q 
Sbjct  378  --MNMLKAEPHKFESHYLDNFVVSEKDCYERSPINFVEKFSCPMILFQGLEDKVVPPDQG  435

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY ALK KGLPVALVEYE
Sbjct  436  RKIYAALKQKGLPVALVEYE  455



>ref|XP_004964877.1| PREDICTED: probable dipeptidyl-peptidase 5-like [Setaria italica]
Length=680

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 170/200 (85%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K HGGPT+E R  L+L++QYWTSRGWA VDVNYGGSTGYGRE+RERL 
Sbjct  436  QGLPDEKPPLLVKVHGGPTSETRAILDLNVQYWTSRGWAYVDVNYGGSTGYGREYRERLF  495

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCC CA FLV+SG+VDGERLCITG SAGGYT LA+LAF++ FKAG S+YG+
Sbjct  496  EKWGIVDVDDCCRCAIFLVESGKVDGERLCITGRSAGGYTILASLAFRNTFKAGASVYGV  555

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             D  LL +   KFE H +D+ VGD+ A +ERSPINFVDKF+CP+ILFQGL+DKVVPP+QA
Sbjct  556  ADFSLLKEETHKFEKHDLDHFVGDEKACYERSPINFVDKFTCPVILFQGLEDKVVPPDQA  615

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  616  RKIYKALKEKGLPVALVEYE  635



>ref|XP_010098716.1| Dipeptidyl peptidase family member 6 [Morus notabilis]
 gb|EXB75619.1| Dipeptidyl peptidase family member 6 [Morus notabilis]
Length=387

 Score =   308 bits (789),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 166/200 (83%), Gaps = 16/200 (8%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QAGQ EKPPLLLKSHGGPTAE R +LNL+IQYWTSRGW  VDVNYGGSTGYGRE+R+RLL
Sbjct  159  QAGQGEKPPLLLKSHGGPTAETRAALNLNIQYWTSRGWGFVDVNYGGSTGYGREYRDRLL  218

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCAKFLVDSG+ DGERLCITG SAGGYTTLAALAF++ FKAG SLYG 
Sbjct  219  GKWGIVDVDDCCSCAKFLVDSGKADGERLCITGGSAGGYTTLAALAFRNTFKAGASLYG-  277

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
                         E +++    G +  YFERSPINFVDKFSCPIILFQGL+DKVVPP+QA
Sbjct  278  -------------EKNWLS--AGSEKDYFERSPINFVDKFSCPIILFQGLEDKVVPPDQA  322

Query  543  RKIYQALKAKGLPVALVEYE  602
            +KIYQALK KGLPVALVEYE
Sbjct  323  KKIYQALKEKGLPVALVEYE  342



>ref|XP_002870472.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46731.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=676

 Score =   316 bits (809),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             A  +EKPPLL+KSHGGPTAE+RGSLNL+IQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  431  NASMEEKPPLLVKSHGGPTAESRGSLNLNIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  490

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDV+DCC CAK+LV SG+ D +RLCI+G SAGGYTTLAALAF+DVFKAG SLYG+
Sbjct  491  RRWGIVDVDDCCGCAKYLVSSGKADVKRLCISGGSAGGYTTLAALAFRDVFKAGASLYGV  550

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK+L +   KFES YIDNLVGDK  ++ERSPINFVDKFSCPIILFQGL+DKVV P+Q+
Sbjct  551  ADLKMLKEEGHKFESRYIDNLVGDKKDFYERSPINFVDKFSCPIILFQGLEDKVVTPDQS  610

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  611  RKIYKALKEKGLPVALVEYE  630



>gb|ABK25153.1| unknown [Picea sitchensis]
Length=721

 Score =   316 bits (810),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 174/201 (87%), Gaps = 1/201 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            +A + EKPPLL+KSHGGPT+E+  +L+LSIQYWTSRGWA  DVNYGGSTGYGRE+RERL 
Sbjct  476  EAPEGEKPPLLVKSHGGPTSESHSALDLSIQYWTSRGWAFADVNYGGSTGYGREYRERLN  535

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
             +WGIVDVNDCCSCA+FLV +GRVDGERLCITG SAGGYTTLAAL F++ FKAG SL+G+
Sbjct  536  GSWGIVDVNDCCSCAEFLVTTGRVDGERLCITGRSAGGYTTLAALVFRETFKAGASLFGV  595

Query  363  GDLKLLVDGMPKFESHYIDNLVG-DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQ  539
             D+ LL     KFES+Y D+LVG D++  +ERSPINFVD+ SCP+ILFQGL+DKVVPPEQ
Sbjct  596  ADVSLLKADTHKFESYYTDSLVGKDESLLYERSPINFVDRLSCPMILFQGLEDKVVPPEQ  655

Query  540  ARKIYQALKAKGLPVALVEYE  602
            ARKIY A+K KGLPVALVEYE
Sbjct  656  ARKIYAAVKEKGLPVALVEYE  676



>ref|XP_006283199.1| hypothetical protein CARUB_v10004231mg [Capsella rubella]
 gb|EOA16097.1| hypothetical protein CARUB_v10004231mg [Capsella rubella]
Length=736

 Score =   316 bits (809),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             A  +EKPPLL+KSHGGPTAE+RGSLNL+IQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  491  NASMEEKPPLLVKSHGGPTAESRGSLNLNIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  550

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDV+DCC CAK+LV SG+ D +RLCI+G SAGGYTTLA+LAF+DVFKAG SLYG+
Sbjct  551  RRWGIVDVDDCCGCAKYLVSSGKADVKRLCISGGSAGGYTTLASLAFRDVFKAGASLYGV  610

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK+L D   KFES YIDNLVGD+  ++ERSPINFVDKFSCPIILFQGL+DKVV P+Q+
Sbjct  611  ADLKMLKDEGQKFESRYIDNLVGDEKDFYERSPINFVDKFSCPIILFQGLEDKVVTPDQS  670

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIY+ALK KGLPVALVEYE
Sbjct  671  RKIYKALKEKGLPVALVEYE  690



>ref|XP_006395913.1| hypothetical protein EUTSA_v10003712mg [Eutrema salsugineum]
 gb|ESQ33199.1| hypothetical protein EUTSA_v10003712mg [Eutrema salsugineum]
Length=734

 Score =   315 bits (806),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             A  DEKPPLL+KSHGGPTAE+RGSLNL+IQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  485  NASLDEKPPLLVKSHGGPTAESRGSLNLNIQYWTSRGWAYVDVNYGGSTGYGREYRERLL  544

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDV+DCC CAK+LV SG+ D +RLCI+G SAGGYTTLAALAF+DVFKAG SLYG+
Sbjct  545  RRWGIVDVDDCCGCAKYLVSSGKADVKRLCISGGSAGGYTTLAALAFRDVFKAGASLYGV  604

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK+L +   KFES YIDNLVGD+  ++ERSPINFVDKFSCPIILFQGL+DKVV P+Q+
Sbjct  605  ADLKMLKEEGHKFESRYIDNLVGDEKDFYERSPINFVDKFSCPIILFQGLEDKVVTPDQS  664

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVALVEY+
Sbjct  665  RKIYQALKGKGLPVALVEYK  684



>emb|CDY42399.1| BnaA08g00150D [Brassica napus]
Length=730

 Score =   315 bits (806),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             A  +EKPPLL+KSHGGPTAE+RGSLNL+IQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  481  NASMEEKPPLLVKSHGGPTAESRGSLNLNIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  540

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDV+DCC CAK+LV SG+ D +RLCI+G SAGGYTTLAALAF+DVFKAG SLYG+
Sbjct  541  RRWGIVDVDDCCGCAKYLVSSGKADVKRLCISGGSAGGYTTLAALAFRDVFKAGASLYGV  600

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK+L +   KFES YIDNLVG++  ++ERSPINFVD+FSCPIILFQGL+DKVV P+Q+
Sbjct  601  ADLKMLKEEGHKFESRYIDNLVGEEKDFYERSPINFVDRFSCPIILFQGLEDKVVTPDQS  660

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVALVEYE
Sbjct  661  RKIYQALKEKGLPVALVEYE  680



>ref|XP_009106816.1| PREDICTED: uncharacterized protein LOC103832547 [Brassica rapa]
Length=736

 Score =   314 bits (804),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             A  +EKPPLL+KSHGGPTAE+RGSLNL+IQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  487  NASMEEKPPLLVKSHGGPTAESRGSLNLNIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  546

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDV+DCC CAK+LV SG+ D +RLCI+G SAGGYTTLAALAF+DVFKAG SLYG+
Sbjct  547  RRWGIVDVDDCCGCAKYLVSSGKADVKRLCISGGSAGGYTTLAALAFRDVFKAGASLYGV  606

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK+L +   KFES YIDNLVG++  ++ERSPINFVD+FSCPIILFQGL+DKVV P+Q+
Sbjct  607  ADLKMLKEEGHKFESRYIDNLVGEEKDFYERSPINFVDRFSCPIILFQGLEDKVVTPDQS  666

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVALVEYE
Sbjct  667  RKIYQALKEKGLPVALVEYE  686



>emb|CDY10518.1| BnaC03g70960D [Brassica napus]
Length=734

 Score =   313 bits (803),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             A  +EKPPLL+KSHGGPTAE+RGSLNL+IQYWTSRGWA VDVNYGGSTGYGRE+RERLL
Sbjct  485  NASMEEKPPLLVKSHGGPTAESRGSLNLNIQYWTSRGWAFVDVNYGGSTGYGREYRERLL  544

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDV+DCC CAK+LV SG+ D +RLCI+G SAGGYTTLAALAF+DVFKAG SLYG+
Sbjct  545  RRWGIVDVDDCCGCAKYLVSSGKADVKRLCISGGSAGGYTTLAALAFRDVFKAGASLYGV  604

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK+L +   KFES YIDNLVG++  ++ERSPINFVD+FSCPIILFQGL+DKVV P+Q+
Sbjct  605  ADLKMLKEEGHKFESRYIDNLVGEEKYFYERSPINFVDRFSCPIILFQGLEDKVVTPDQS  664

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KGLPVALVEYE
Sbjct  665  RKIYQALKEKGLPVALVEYE  684



>ref|XP_010553846.1| PREDICTED: uncharacterized protein LOC104823807 [Tarenaya hassleriana]
Length=674

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLL++SHGGPT EA GSL+LSIQY TSRGWA +DVNYGGS GYGRE+RERL 
Sbjct  429  QASSEEKPPLLVRSHGGPTEEAHGSLDLSIQYLTSRGWAFLDVNYGGSAGYGREYRERLY  488

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV DCCSCA +LV  G+ D +RLCI G SAGGYTTLA LAF+DVFKAG SLYGI
Sbjct  489  GKWGIVDVGDCCSCANYLVAKGKADEKRLCINGGSAGGYTTLATLAFRDVFKAGASLYGI  548

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL++L D   KFES Y+DNLVGD+  ++ERSPIN VD+FSCP+ILFQGLDDKVVPP+Q+
Sbjct  549  ADLQMLRDETHKFESRYVDNLVGDEKDFYERSPINSVDRFSCPLILFQGLDDKVVPPDQS  608

Query  543  RKIYQALKAKGLPVALVEYE  602
            R+IY+A+K KGLPVALV YE
Sbjct  609  RRIYEAVKKKGLPVALVLYE  628



>dbj|BAK52341.1| S9 Tyrosyl aminopeptidase [Raphanus sativus]
Length=685

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 172/200 (86%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             A  +EKPPL++KSHGGP+AE+RGSLNL IQYWTSRGWA VDVNYGGSTGYGRE+RER+L
Sbjct  437  NASIEEKPPLIVKSHGGPSAESRGSLNLIIQYWTSRGWAFVDVNYGGSTGYGREYRERVL  496

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDV+DCC CAK+LV  G+ D +RL I+G SAGGYT L ALA +DVFKAG SLYG+
Sbjct  497  RRWGIVDVDDCCGCAKYLVSPGKADVKRLFISGGSAGGYTALTALALRDVFKAGASLYGV  556

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DLK+L +G  KFES YID+LV ++  ++ERSPINFVD+FSCPIILFQGL+DK+V P+Q 
Sbjct  557  ADLKMLKEGH-KFESRYIDSLVEEEKDFYERSPINFVDRFSCPIILFQGLEDKIVNPDQT  615

Query  543  RKIYQALKAKGLPVALVEYE  602
            RKIYQALK KG+PVALVEYE
Sbjct  616  RKIYQALKEKGVPVALVEYE  635



>ref|XP_007227267.1| hypothetical protein PRUPE_ppa017763mg [Prunus persica]
 gb|EMJ28466.1| hypothetical protein PRUPE_ppa017763mg [Prunus persica]
Length=500

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 164/200 (82%), Gaps = 15/200 (8%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLL++HGGPT E+ G LNLSIQYWTSRGWA V V+YGGS+GYGRE+RERLL
Sbjct  271  QATQEEKPPLLLQAHGGPTFESHGILNLSIQYWTSRGWAFVAVHYGGSSGYGREYRERLL  330

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVDVNDCCSCA++LVDSG+VDG+RLCITG SAGGYTTLAALAF+D FKAG SLYGI
Sbjct  331  RKWGIVDVNDCCSCARYLVDSGKVDGKRLCITGDSAGGYTTLAALAFRDTFKAGASLYGI  390

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHYID+LVG +  YFERSPINFVD+FSCPIILFQGL+D        
Sbjct  391  ADLTMLRAETQKFESHYIDSLVGSEKDYFERSPINFVDRFSCPIILFQGLED--------  442

Query  543  RKIYQALKAKGLPVALVEYE  602
                   K KGLPVALVEYE
Sbjct  443  -------KDKGLPVALVEYE  455



>ref|XP_002992791.1| hypothetical protein SELMODRAFT_135896 [Selaginella moellendorffii]
 gb|EFJ06177.1| hypothetical protein SELMODRAFT_135896 [Selaginella moellendorffii]
Length=666

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            +A  +EKPPLL++SHGGPTAE+  +L L+IQ+WTSRGWA  DVNYGGSTGYGR++RERL 
Sbjct  420  EAPPEEKPPLLVRSHGGPTAESDTTLQLAIQFWTSRGWAFADVNYGGSTGYGRQYRERLN  479

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV DCCSCA  LV SG VD  RLCI G SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  480  GKWGIVDVGDCCSCASHLVASGEVDESRLCIDGRSAGGYTTLAALAFRDTFKAGASLYGV  539

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL+ L+    KFES Y+ +L+GD  A+ +RSPI++ ++FSCP+ILFQGLDDKVVPP QA
Sbjct  540  SDLESLMTDTHKFESRYLTSLIGDSKAFHDRSPIHYPERFSCPLILFQGLDDKVVPPNQA  599

Query  543  RKIYQALKAKGLPVALVEYE  602
            R IY+A+K+KG+PVALVEYE
Sbjct  600  RMIYEAVKSKGIPVALVEYE  619



>ref|XP_002962962.1| hypothetical protein SELMODRAFT_78836 [Selaginella moellendorffii]
 gb|EFJ36425.1| hypothetical protein SELMODRAFT_78836 [Selaginella moellendorffii]
Length=666

 Score =   293 bits (751),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 164/200 (82%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            +A  +EKPPLL++SHGGPTAE+  +L L IQ+WTSRGWA  DVNYGGSTGYGR++RERL 
Sbjct  420  EAPPEEKPPLLVRSHGGPTAESDTTLQLGIQFWTSRGWAFADVNYGGSTGYGRQYRERLN  479

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV DCCSCA  LV SG VD  RLCI G SAGGYTTLAALAF+D FKAG SLYG+
Sbjct  480  GKWGIVDVGDCCSCASHLVASGEVDESRLCIDGRSAGGYTTLAALAFRDTFKAGASLYGV  539

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL+ L+    KFES Y+ +L+GD  A+ +RSPI++ ++FSCP+ILFQGLDDKVVPP QA
Sbjct  540  SDLESLMTDTHKFESRYLTSLIGDSKAFHDRSPIHYPERFSCPLILFQGLDDKVVPPNQA  599

Query  543  RKIYQALKAKGLPVALVEYE  602
            R IY+A+K+KG+PVALVEYE
Sbjct  600  RMIYEAVKSKGIPVALVEYE  619



>gb|KCW66198.1| hypothetical protein EUGRSUZ_F00026 [Eucalyptus grandis]
Length=681

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  483  QASQEEKPPLLLKSHGGPTSETRGVLNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  542

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCAKFLV+SG+ DG RLCITG SAGGYTTLAALAF++ FKAG SLYG+
Sbjct  543  GRWGIVDVDDCCSCAKFLVESGKADGNRLCITGGSAGGYTTLAALAFRETFKAGASLYGV  602

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKV  524
             DL +L     KFESHY+D LVG +  Y+ERSPIN V+KFSCPIILFQGL+DKV
Sbjct  603  ADLNMLRAETHKFESHYLDKLVGSEKDYYERSPINSVEKFSCPIILFQGLEDKV  656



>ref|XP_004141371.1| PREDICTED: uncharacterized protein LOC101221766 [Cucumis sativus]
Length=616

 Score =   288 bits (736),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 158/193 (82%), Gaps = 4/193 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
             +  DEKPPLLL+SHGGPT EARG LNL IQYWTSRGWA V+VNYGGS+GYGR +RERLL
Sbjct  426  HSSGDEKPPLLLESHGGPTDEARGILNLRIQYWTSRGWAFVNVNYGGSSGYGRAYRERLL  485

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            R WGIVD+NDCCSCA++LVDSG VD ERLCI G SAGGYTTLAALAF+D FKAG SLYGI
Sbjct  486  RKWGIVDINDCCSCARYLVDSGLVDAERLCIDGESAGGYTTLAALAFRDTFKAGASLYGI  545

Query  363  GDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             DL +L     KFESHY+DNLVGD+  ++ERSPINFV+KFSCP+ILFQGLDDK+     +
Sbjct  546  SDLSMLKAETHKFESHYLDNLVGDEIDFYERSPINFVEKFSCPLILFQGLDDKI----WS  601

Query  543  RKIYQALKAKGLP  581
            RK+  +++    P
Sbjct  602  RKLEFSMEEHDRP  614



>ref|XP_001771588.1| predicted protein [Physcomitrella patens]
 gb|EDQ63618.1| predicted protein [Physcomitrella patens]
Length=672

 Score =   279 bits (713),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 159/204 (78%), Gaps = 6/204 (3%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E+PPLL++SHGGPT EA  +L+ +IQYWTSRGWA  DVNYGGSTGYGR +RERL  
Sbjct  424  APSRERPPLLVRSHGGPTLEASTTLDPAIQYWTSRGWAFADVNYGGSTGYGRAYRERLNG  483

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
             WGIVDVNDCCSCA+ L   G VD +RLCI G SAGGYTT+A L FKD F AG SLYG+ 
Sbjct  484  QWGIVDVNDCCSCAEHLAKIGEVDPKRLCIDGRSAGGYTTMATLVFKDTFSAGASLYGVS  543

Query  366  DLKLLVDGMPKFESHYIDNLVG-----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
            DLK L+    KFES Y+DNL+G     +KN Y +RSPI+F++K SCP+ILFQGL+DK+VP
Sbjct  544  DLKCLISDTHKFESRYLDNLLGPEDVLEKNTY-DRSPIHFLEKLSCPMILFQGLEDKIVP  602

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P QAR IY+A + KG+P+ALVEYE
Sbjct  603  PNQARMIYEAARMKGVPIALVEYE  626



>ref|WP_006101118.1| peptidase [Coleofasciculus chthonoplastes]
 gb|EDX75408.1| peptidase, S9A/B/C family, catalytic domain protein [Coleofasciculus 
chthonoplastes PCC 7420]
Length=645

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 154/203 (76%), Gaps = 4/203 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA + EKPPL++KSHGGPTA    + NL IQYWTSRG+A +DVNYGGSTGYGRE+R+RL 
Sbjct  399  QAPETEKPPLIVKSHGGPTASTSSTFNLKIQYWTSRGFAFLDVNYGGSTGYGREYRQRLQ  458

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DC + AK+L + G VDGERL I G SAGGYTTLAAL F+DVFKAG S YG+
Sbjct  459  NQWGIVDVDDCANGAKYLAEQGFVDGERLAIAGGSAGGYTTLAALTFRDVFKAGASYYGV  518

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL+ L     KFES Y+D L+G     ++ Y  RSPI+F DK SCP+I FQGL+DKVVP
Sbjct  519  SDLETLATDTHKFESRYLDGLIGAYPERQDLYKARSPIHFTDKLSCPVIFFQGLEDKVVP  578

Query  531  PEQARKIYQALKAKGLPVALVEY  599
            P QA  + +ALKAKGLPVA + Y
Sbjct  579  PNQAETMVEALKAKGLPVAYITY  601



>ref|WP_015195487.1| WD40-like beta Propeller containing protein [Stanieria cyanosphaera]
 gb|AFZ37833.1| WD40-like beta Propeller containing protein [Stanieria cyanosphaera 
PCC 7437]
Length=642

 Score =   270 bits (690),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 156/203 (77%), Gaps = 4/203 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPL++KSHGGPTA A  SL+L IQYWTSRG+  +DVNYGGS GYGR++R+RL +
Sbjct  396  APATELPPLIVKSHGGPTASASVSLSLRIQYWTSRGFGYLDVNYGGSIGYGRQYRQRLTK  455

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVD++DC + AK+LV  G+VDG RL I+GSSAGGYTTLAAL F+D FKAG S YG+ 
Sbjct  456  NWGIVDIDDCVNAAKYLVQQGKVDGNRLVISGSSAGGYTTLAALTFRDTFKAGASYYGVS  515

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D L+G    +KN Y ERSPI+F ++ + P+I FQGL DKVVPP
Sbjct  516  DLEILAQDTHKFESRYLDGLIGAYPAEKNLYVERSPIHFTEQLTTPVIFFQGLQDKVVPP  575

Query  534  EQARKIYQALKAKGLPVALVEYE  602
             QA  ++QA+KAKGLP A V +E
Sbjct  576  NQAEMMFQAIKAKGLPTAYVTFE  598



>ref|WP_012308329.1| peptidase [Synechococcus sp. PCC 7002]
 gb|ACB00711.1| prolyl oligopeptidase family [Synechococcus sp. PCC 7002]
Length=643

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 152/204 (75%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  D  PPLL+KSHGGPTA A  SLNL IQYWTSRG+A VDVNYGGSTGYGRE+ +RL 
Sbjct  397  QAPADTAPPLLVKSHGGPTAMAAASLNLRIQYWTSRGFAFVDVNYGGSTGYGREYHQRLD  456

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
             NWGIVDV DC + AK+LV  G  DGE+L I G SAGGYTTLAAL F DVFKAG S YGI
Sbjct  457  GNWGIVDVQDCVNVAKYLVAKGLADGEKLAIAGGSAGGYTTLAALTFHDVFKAGASYYGI  516

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL++L     KFE+ Y+D L+G    +K  Y  RSPI+F +K +CP+I FQGL+DKVVP
Sbjct  517  SDLEVLATDTHKFEARYLDRLIGKYPAEKEKYIRRSPIHFTEKLACPVIFFQGLEDKVVP  576

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P QA  + +A+K KGLPVA V +E
Sbjct  577  PNQAEMMVEAIKTKGLPVAYVPFE  600



>ref|WP_008181699.1| peptidase [Moorea producens]
 gb|EGJ33766.1| dipeptidyl aminopeptidase/acylaminoacyl-peptidase [Moorea producens 
3L]
Length=645

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 155/203 (76%), Gaps = 4/203 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   EKPPL++KSHGGPTA    + NL IQYWTSRG+A++DVNYGGSTGYGR++R+RL  
Sbjct  400  APTSEKPPLIVKSHGGPTAATSSAFNLKIQYWTSRGFAILDVNYGGSTGYGRDYRQRLKN  459

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV+DC + A++L   G VDGERL I G SAGGYTTLAAL F++VFKAG S YGI 
Sbjct  460  NWGIVDVDDCTNGAQYLAKQGLVDGERLAIAGGSAGGYTTLAALTFRNVFKAGASYYGIS  519

Query  366  DLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D L+G     K+ Y +RSPI+F D+ SCP+I FQGL+DKVVPP
Sbjct  520  DLEVLAKDTHKFESRYLDGLIGPYPERKDLYQQRSPIHFTDQLSCPVIFFQGLEDKVVPP  579

Query  534  EQARKIYQALKAKGLPVALVEYE  602
             QA  +  ALKAKGLPVA V YE
Sbjct  580  SQAEMMVAALKAKGLPVAYVTYE  602



>ref|WP_018397687.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=641

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 152/204 (75%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            +A + E PPLL+KSHGGPTA A  + NL IQYWTSRG+  VDVNYGGSTGYGRE+R+RL 
Sbjct  395  KAPEGELPPLLVKSHGGPTAAASATFNLRIQYWTSRGFGFVDVNYGGSTGYGREYRQRLN  454

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            + WGIVDV DC   A++L    RVDG+RL I G SAGGYTTLAAL F+DVFKAG S YG+
Sbjct  455  QKWGIVDVEDCTQAAQYLAQQKRVDGDRLAIAGGSAGGYTTLAALTFRDVFKAGASYYGV  514

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL+ L     KFES Y+D L+G    DK  Y  RSPI++ D+ SCP+I FQGL+DKVVP
Sbjct  515  SDLEALAQDTHKFESRYLDGLIGAYPEDKEIYVARSPIHYTDRLSCPVIFFQGLEDKVVP  574

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P QA  + +ALKAKGLPVA V +E
Sbjct  575  PNQAEAMVEALKAKGLPVAYVPFE  598



>ref|WP_002759042.1| peptidase [Microcystis aeruginosa]
 emb|CCH96767.1| Peptidase, S9C (Acylaminoacyl-peptidase) family protein [Microcystis 
aeruginosa PCC 9717]
Length=640

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RLL 
Sbjct  397  APNGELPPLLVKSHGGPTAAATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLLG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLATDTHKFESRYLDKLVGLYPEEKEIYYQRSPIHFTSQLSCPVIFFQGLEDRVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + QALKAKGLPVA V +
Sbjct  577  NQAEMMVQALKAKGLPVAYVPF  598



>ref|WP_030007736.1| peptidase [Synechococcus sp. NKBG042902]
Length=643

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 152/204 (75%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  D  PPLL+KSHGGPTA A  SLNL IQYWTSRG+A VDVNYGGSTGYGRE+ +RL 
Sbjct  397  QAPADTAPPLLVKSHGGPTAMAAASLNLRIQYWTSRGFAFVDVNYGGSTGYGREYHQRLD  456

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
             NWGIVDV DC + AK+LV  G  DGE+L I G SAGGYTTLAAL F DVFKAG S YGI
Sbjct  457  GNWGIVDVQDCVNVAKYLVAKGLADGEKLAIAGGSAGGYTTLAALTFHDVFKAGASYYGI  516

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL++L     KFE+ Y+D L+G    +K  Y  RSPI+F +K +CP+I FQGL+DKVVP
Sbjct  517  SDLEVLATDTHKFEARYLDRLIGKYPAEKEKYVGRSPIHFTEKLACPVIFFQGLEDKVVP  576

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P QA  + +A+K KGLPVA V +E
Sbjct  577  PNQAEMMVEAIKTKGLPVAYVPFE  600



>gb|EMT07228.1| Dipeptidyl peptidase family member 6 [Aegilops tauschii]
Length=626

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 154/204 (75%), Gaps = 25/204 (12%)
 Frame = +3

Query  15   DEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWG  194
            DEKPPLL+K+HGGPTAE RG L+LS+QYWTSRGWA +DVNYGGST               
Sbjct  395  DEKPPLLVKTHGGPTAETRGVLDLSVQYWTSRGWAFLDVNYGGSTA--------------  440

Query  195  IVDVNDCCSCAKFL--------VDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCS  350
               V D CS    L        V++G+VD +RLCITG SAGGYTTLA+LAF+D FKAG S
Sbjct  441  ---VQDSCSIYSNLQATLLYCKVENGKVDEQRLCITGRSAGGYTTLASLAFRDTFKAGAS  497

Query  351  LYGIGDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
            LYGIGD+ LL     KFES Y+DNLVG + AY+ERSPINFV+KF+CP+ILFQGLDDKVVP
Sbjct  498  LYGIGDITLLRAETHKFESRYMDNLVGSEGAYYERSPINFVNKFTCPVILFQGLDDKVVP  557

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P+QARKIY+ALK  GLPVALVEYE
Sbjct  558  PDQARKIYKALKESGLPVALVEYE  581



>ref|WP_015143569.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Pleurocapsa 
minor]
 gb|AFY77265.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Pleurocapsa 
sp. PCC 7327]
Length=643

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 154/203 (76%), Gaps = 4/203 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A + E PPLL+KSHGGPTA A  SLNL +QYWTSRG+A +DVNYGGSTGYGRE+R+RL R
Sbjct  398  APEGELPPLLVKSHGGPTAAASASLNLRVQYWTSRGFAYLDVNYGGSTGYGREYRQRLDR  457

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV+DC + AK+LV  G+ DG R+ I+G SAGGYTTLAAL FKD FKAG S YG+ 
Sbjct  458  NWGIVDVDDCVNAAKYLVRQGKADGNRMAISGGSAGGYTTLAALTFKDTFKAGASYYGVS  517

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++LV    KFESHY+D LVG     K  Y  RSPI  +++ SCP+I FQGL+D+VVPP
Sbjct  518  DLEVLVRDTHKFESHYLDRLVGKYPEQKAIYETRSPIYHINRLSCPVIFFQGLEDRVVPP  577

Query  534  EQARKIYQALKAKGLPVALVEYE  602
             QA  +   LK KGLPVA V +E
Sbjct  578  NQAEMMVDVLKKKGLPVAYVPFE  600



>ref|WP_015181252.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Microcoleus 
sp. PCC 7113]
 gb|AFZ17092.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Microcoleus 
sp. PCC 7113]
Length=658

 Score =   268 bits (684),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 153/199 (77%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPL++KSHGGPTA    + NL IQYWTSRG+A VDVNYGGSTGYGR++ +RL  NWGI
Sbjct  413  EKPPLIVKSHGGPTASTSSAFNLKIQYWTSRGFAFVDVNYGGSTGYGRDYHQRLRDNWGI  472

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DC + AK+L + G VDGERL I G SAGGYTTLAAL F+D+FKAG S YG+ DL++
Sbjct  473  VDVDDCANAAKYLAEQGLVDGERLAIAGGSAGGYTTLAALTFRDIFKAGASYYGVSDLEV  532

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFE+ Y+D L+G     K+ Y +RSPI+F  + SCP+I FQGL+DKVVPP QA 
Sbjct  533  LAKDTHKFEARYLDGLIGPYPERKDLYEKRSPIHFTAQLSCPVIFFQGLEDKVVPPNQAE  592

Query  546  KIYQALKAKGLPVALVEYE  602
             + +ALKAKGLPVA V YE
Sbjct  593  MMVEALKAKGLPVAYVAYE  611



>ref|WP_002774643.1| peptidase [Microcystis aeruginosa]
 emb|CCI09902.1| Similar to tr|Q4C513|Q4C513_CROWT Peptidase S9 [Microcystis aeruginosa 
PCC 7941]
Length=640

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RLL 
Sbjct  397  APNGELPPLLVKSHGGPTAAATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLLG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLATDTHKFESRYLDKLVGRYPEEKEIYYQRSPIHFTSQLSCPVIFFQGLEDRVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +ALKAKGLPVA V +
Sbjct  577  NQAEMMVEALKAKGLPVAYVPF  598



>ref|WP_002799027.1| peptidase [Microcystis aeruginosa]
 emb|CCI28730.1| Peptidase, S9C (Acylaminoacyl-peptidase) family protein [Microcystis 
aeruginosa PCC 9809]
Length=640

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RL  
Sbjct  397  APNGELPPLLVKSHGGPTAAATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLQG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L +   KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLANDTHKFESRYLDKLVGRYPEEKEIYYQRSPIHFTSQLSCPVIFFQGLEDRVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + QALKAKGLPVA V +
Sbjct  577  NQAEMMVQALKAKGLPVAYVPF  598



>ref|WP_002742297.1| prolyl oligopeptidase family protein [Microcystis aeruginosa]
 emb|CAO90508.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS49043.1| prolyl oligopeptidase family protein [Microcystis aeruginosa 
DIANCHI905]
Length=640

 Score =   267 bits (682),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RLL 
Sbjct  397  APNGELPPLLVKSHGGPTAAATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLLG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLATDTHKFESRYLDKLVGRYPEEKEIYYQRSPIHFTSQLSCPVIFFQGLEDQVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +ALKAKGLPVA V +
Sbjct  577  NQAEMMVEALKAKGLPVAYVPF  598



>ref|WP_016516700.1| esterase [Microcystis aeruginosa]
 gb|EPF19059.1| esterase [Microcystis aeruginosa SPC777]
Length=640

 Score =   267 bits (682),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RLL 
Sbjct  397  APNGELPPLLVKSHGGPTAAATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLLG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLATDTHKFESRYLDKLVGRYPEEKEIYYQRSPIHFTSQLSCPVIFFQGLEDRVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +ALKAKGLPVA V +
Sbjct  577  NQAEMMVEALKAKGLPVAYVPF  598



>ref|WP_002738220.1| prolyl oligopeptidase family protein [Microcystis aeruginosa]
 gb|ELP55364.1| prolyl oligopeptidase family protein [Microcystis aeruginosa 
TAIHU98]
Length=640

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RLL 
Sbjct  397  APNGELPPLLVKSHGGPTAAATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLLG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLATDTHKFESRYLDKLVGRYPEEKEIYYQRSPIHFTSQLSCPVIFFQGLEDQVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +ALKAKGLPVA V +
Sbjct  577  NQAEMMVEALKAKGLPVAYVPF  598



>ref|WP_002803183.1| peptidase [Microcystis aeruginosa]
 emb|CCI37545.1| Peptidase, S9C (Acylaminoacyl-peptidase) family protein [Microcystis 
aeruginosa PCC 9701]
Length=640

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RLL 
Sbjct  397  APNGELPPLLVKSHGGPTAAATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLLG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLATDTHKFESRYLDKLVGRYPEEKEIYYQRSPIHFTAQLSCPVIFFQGLEDRVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +ALKAKGLPVA V +
Sbjct  577  NQAEMMVEALKAKGLPVAYVPF  598



>ref|WP_002771736.1| peptidase [Microcystis aeruginosa]
 emb|CCI04746.1| Similar to tr|Q4C513|Q4C513_CROWT Peptidase S9 [Microcystis aeruginosa 
PCC 9443]
Length=640

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RLL 
Sbjct  397  APNGELPPLLVKSHGGPTAAATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLLG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLATDTHKFESRYLDKLVGLYPQEKEIYYQRSPIHFTAQLSCPVIFFQGLEDRVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +ALKAKGLPVA V +
Sbjct  577  NQAEMMVEALKAKGLPVAYVPF  598



>dbj|GAL92519.1| prolyl oligopeptidase family protein [Microcystis aeruginosa 
NIES-44]
Length=640

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RLL 
Sbjct  397  APNGELPPLLVKSHGGPTAAATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLLG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLATDTHKFESRYLDKLVGRYPEEKEIYYQRSPIHFTAQLSCPVIFFQGLEDRVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +ALKAKGLPVA V +
Sbjct  577  NQAEMMVEALKAKGLPVAYVPF  598



>ref|WP_002791076.1| peptidase [Microcystis aeruginosa]
 emb|CCI28754.1| Similar to tr|Q4C513|Q4C513_CROWT Peptidase S9 [Microcystis aeruginosa 
PCC 9808]
Length=640

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RLL 
Sbjct  397  APNGELPPLLVKSHGGPTAPATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLLG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLATDTHKFESRYLDKLVGLYPQEKEIYYQRSPIHFTTQLSCPVIFFQGLEDQVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +ALKAKGLPVA V +
Sbjct  577  NQAEMMVEALKAKGLPVAYVPF  598



>ref|WP_012265590.1| peptidase [Microcystis aeruginosa]
 dbj|BAG02282.1| peptidase, S9C (acylaminoacyl-peptidase) family protein [Microcystis 
aeruginosa NIES-843]
Length=640

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RL  
Sbjct  397  APNGELPPLLVKSHGGPTAAATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLQG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L +   KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLANDTHKFESRYLDKLVGLYPQEKEIYYQRSPIHFTAQLSCPVIFFQGLEDRVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + QALKAKGLPVA V +
Sbjct  577  NQAEMMVQALKAKGLPVAYVPF  598



>ref|WP_002780300.1| Similar to tr|Q4C513|Q4C513_CROWT Peptidase S9 [Microcystis aeruginosa]
 emb|CCI14042.1| Similar to tr|Q4C513|Q4C513_CROWT Peptidase S9 [Microcystis aeruginosa 
PCC 9806]
Length=640

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RLL 
Sbjct  397  APNGELPPLLVKSHGGPTAAATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLLG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLATDTHKFESRYLDKLVGLYPEEKEIYYQRSPIHFTAQLSCPVIFFQGLEDRVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +ALKAKGLPVA V +
Sbjct  577  NQAEMMVEALKAKGLPVAYVPF  598



>ref|WP_019506979.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=645

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 155/199 (78%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E PPL++KSHGGPTA A   LNL IQYWTSRG+  +DVNYGGS GYGRE+R RL   WGI
Sbjct  403  ELPPLIVKSHGGPTAAASVDLNLRIQYWTSRGFGYLDVNYGGSIGYGREYRRRLDGKWGI  462

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DC + AK+LV+ G+VDGERL ITGSSAGGYTTLAAL F+++FKAG S YG+ DL++
Sbjct  463  VDVDDCVNGAKYLVNQGKVDGERLVITGSSAGGYTTLAALTFRNIFKAGASYYGVSDLEI  522

Query  378  LVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D LVG    ++  Y ERSPI+F ++ +CP+I FQGL+DKVVPP QA 
Sbjct  523  LAKDTHKFESRYLDRLVGKYPEEREIYQERSPIHFTEQLNCPVIFFQGLEDKVVPPNQAE  582

Query  546  KIYQALKAKGLPVALVEYE  602
             ++ A+KAKGLPVA V +E
Sbjct  583  MMFNAIKAKGLPVAYVAFE  601



>ref|WP_024970511.1| peptidase [Microcystis aeruginosa]
Length=640

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RLL 
Sbjct  397  APNGELPPLLAKSHGGPTAAATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLLG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLATDTHKFESRYLDKLVGRYPQEKEIYYQRSPIHFTSQLSCPVIFFQGLEDRVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +ALKAKGLPVA V +
Sbjct  577  NQAEMMVEALKAKGLPVAYVPF  598



>ref|WP_002754761.1| peptidase [Microcystis aeruginosa]
 emb|CCH93136.1| Similar to tr|Q4C513|Q4C513_CROWT Peptidase S9 [Microcystis aeruginosa 
PCC 9432]
Length=640

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RLL 
Sbjct  397  APNGELPPLLVKSHGGPTAAATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLLG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLATDTHKFESRYLDKLVGRYPQEKEIYYQRSPIHFTSQLSCPVIFFQGLEDRVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +ALK KGLPVA V +
Sbjct  577  NQAEMMVEALKVKGLPVAYVPF  598



>ref|WP_002789187.1| peptidase [Microcystis aeruginosa]
 emb|CCI19156.1| Similar to tr|Q4C513|Q4C513_CROWT Peptidase S9 [Microcystis aeruginosa 
PCC 9807]
Length=640

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RLL 
Sbjct  397  APNGELPPLLVKSHGGPTAAATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLLG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLATDTHKFESRYLDKLVGLYPQEKEIYYQRSPIHFTAQLSCPVIFFQGLEDRVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +ALKAKGLPVA + +
Sbjct  577  NQAEMMVEALKAKGLPVAYLPF  598



>ref|WP_009626599.1| peptidase S9, prolyl oligopeptidase active site region [Pseudanabaena 
biceps]
 gb|ELS33264.1| peptidase S9, prolyl oligopeptidase active site region [Pseudanabaena 
biceps PCC 7429]
Length=646

 Score =   265 bits (676),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 154/204 (75%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA   EKPPLL+KSHGGPTA   GSL+L IQYWTSRG+A++DVNYGGSTGYGRE+R+RL 
Sbjct  399  QAEASEKPPLLVKSHGGPTASTSGSLSLGIQYWTSRGFAVLDVNYGGSTGYGREYRDRLK  458

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
             NWGIVDV+DC + AKFL D G VDG+RL I+G SAGGYTTL AL F+D FKAG S YGI
Sbjct  459  GNWGIVDVDDCANGAKFLADKGLVDGDRLAISGGSAGGYTTLCALTFRDAFKAGASHYGI  518

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL+ L     KFES Y+D+L+G     K  Y +RSPI+F +K SC I  FQGL+DKVVP
Sbjct  519  CDLEALATDTHKFESRYLDSLIGKYPEQKEIYIQRSPIHFTEKLSCAIAFFQGLEDKVVP  578

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P QA  +  AL+ KGLPVA V +E
Sbjct  579  PNQAEMMVDALRQKGLPVAYVPFE  602



>ref|WP_015204399.1| peptidase S9, prolyl oligopeptidase active site region [Crinalium 
epipsammum]
 gb|AFZ14294.1| peptidase S9, prolyl oligopeptidase active site region [Crinalium 
epipsammum PCC 9333]
Length=646

 Score =   265 bits (676),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 151/199 (76%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPP+L+KSHGGPTA     LNL IQYWTSRG+A +DVNYGGSTGYGRE+ +RL   WGI
Sbjct  403  EKPPVLVKSHGGPTAATSSQLNLKIQYWTSRGFAFLDVNYGGSTGYGREYHQRLDGKWGI  462

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DC + A++L + G VDGER+ I G SAGGYTTL AL F+DVFKAG S YG+ DL+ 
Sbjct  463  VDVDDCANAARYLANQGLVDGERMAIAGGSAGGYTTLCALTFRDVFKAGASYYGVSDLEA  522

Query  378  LVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFE+ Y+D L+G     ++ Y ERSPI+F DK SCP+I FQGL+DKVVPP QA 
Sbjct  523  LAKDTHKFEARYLDRLIGAYPERQDIYIERSPIHFTDKLSCPVIFFQGLEDKVVPPNQAE  582

Query  546  KIYQALKAKGLPVALVEYE  602
             + +ALKAKGLPVA V +E
Sbjct  583  MMVEALKAKGLPVAYVPFE  601



>ref|WP_024546571.1| peptidase [Synechococcus sp. NKBG15041c]
Length=643

 Score =   265 bits (676),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 151/203 (74%), Gaps = 4/203 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  D  PPLL+KSHGGPTA A  SLNL IQYWTSRG+A VDVNYGGSTGYGR + +RL 
Sbjct  397  QAPGDTAPPLLVKSHGGPTAMASASLNLRIQYWTSRGFAFVDVNYGGSTGYGRAYHQRLD  456

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
             NWGIVDV DC + AK+LV+ G  DGE+L I G SAGGYTTLAAL F DVFKAG S YGI
Sbjct  457  GNWGIVDVQDCVNVAKYLVEKGLADGEKLAIAGGSAGGYTTLAALTFHDVFKAGASYYGI  516

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL++L     KFE+ Y+D L+G    +K+ Y  RSPI+F +K +CP+I FQGL+DKVVP
Sbjct  517  SDLEVLATDTHKFEARYLDRLIGKYPEEKDKYVARSPIHFPEKLACPVIFFQGLEDKVVP  576

Query  531  PEQARKIYQALKAKGLPVALVEY  599
            P QA  +  ALK KGLPVA V +
Sbjct  577  PNQAEMMVDALKTKGLPVAYVPF  599



>ref|WP_012598726.1| peptidase [Cyanothece sp. PCC 7424]
 gb|ACK69780.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Cyanothece sp. PCC 7424]
Length=643

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 156/204 (76%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+A +DVNYGGSTG+GRE+R+RL 
Sbjct  397  QAPDGELPPLLVKSHGGPTACASASLSLRVQYWTSRGFAYLDVNYGGSTGFGREYRQRLE  456

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            + WGIVDV+DC + AK+LVD G+VDG+RL I+G SAGGYTTLAAL F+D FKAG S YG+
Sbjct  457  KKWGIVDVDDCVNGAKYLVDQGKVDGDRLAISGGSAGGYTTLAALTFRDTFKAGASYYGV  516

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL+ L     KFES Y+D L+G    +K  Y +RSPI F D+ SCP+I FQGL+DKVVP
Sbjct  517  SDLEALARDTHKFESRYLDRLIGKYPEEKELYQQRSPIMFTDRLSCPVIFFQGLEDKVVP  576

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P Q   + +A+K KGLPVA V +E
Sbjct  577  PNQTELMVEAIKNKGLPVAYVPFE  600



>ref|WP_008206656.1| peptidase [Microcystis sp. T1-4]
 emb|CCI34337.1| Peptidase, S9C (Acylaminoacyl-peptidase) family protein [Microcystis 
sp. T1-4]
Length=640

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E PPLL+KSHGGPTA A  SL+L +QYWTSRG+  +DVNYGGSTGYGR++R+RL  
Sbjct  397  APNGELPPLLVKSHGGPTAAATSSLSLRVQYWTSRGFGYLDVNYGGSTGYGRQYRQRLQG  456

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G VDGERL I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  457  NWGIVDVEDCINGAKYLVNQGLVDGERLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS  516

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D LVG    +K  Y++RSPI+F  + SCP+I FQGL+D+VVPP
Sbjct  517  DLEVLATDTHKFESRYLDKLVGRYPEEKEIYYQRSPIHFTAQLSCPVIFFQGLEDRVVPP  576

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +ALKAKGLPVA V +
Sbjct  577  NQAEMMVEALKAKGLPVAYVPF  598



>ref|WP_017304979.1| hypothetical protein [Spirulina subsalsa]
Length=645

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 153/203 (75%), Gaps = 4/203 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            +A Q E PPLL++SHGGPTA A  + NL  QYWTSRG+ALVDVNYGGSTGYGRE+R+RL 
Sbjct  399  KAPQGELPPLLVRSHGGPTAAANPTFNLRYQYWTSRGFALVDVNYGGSTGYGREYRQRLN  458

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV DC + A++LV  G+VDG+RL I G SAGGYTTLAAL F DVFKAG S YGI
Sbjct  459  GKWGIVDVADCVNAARYLVQEGKVDGQRLAIAGGSAGGYTTLAALTFHDVFKAGASYYGI  518

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL+ L     KFES Y+D L+G    +K  Y++RSPI+F +  SCP+I FQGL+DKVVP
Sbjct  519  SDLEALAQDTHKFESRYLDGLIGKYPEEKEIYYQRSPIHFTEGLSCPVIFFQGLEDKVVP  578

Query  531  PEQARKIYQALKAKGLPVALVEY  599
            P QA  + +ALK KGLPVA V +
Sbjct  579  PNQAEMMVEALKKKGLPVAYVPF  601



>gb|EMS46912.1| Dipeptidyl peptidase family member 6 [Triticum urartu]
Length=768

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 155/204 (76%), Gaps = 25/204 (12%)
 Frame = +3

Query  15   DEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWG  194
            DEKPPLL+K+HGGPTAE RG L+LS+QYWTSRGWA +DVNYGGST               
Sbjct  412  DEKPPLLVKTHGGPTAETRGVLDLSVQYWTSRGWAFLDVNYGGSTA--------------  457

Query  195  IVDVNDCCSC-----AKFL---VDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCS  350
               V D CS      A  L   V++G+VD +RLCITG SAGGYTTLA+LAF+D FKAG S
Sbjct  458  ---VQDSCSIYGNLQATLLYCKVENGKVDEQRLCITGRSAGGYTTLASLAFRDTFKAGAS  514

Query  351  LYGIGDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
            LYGIGD+ LL     KFES Y+DNLVG + AY+ERSPINFV+KF+CP+ILFQGLDDKVVP
Sbjct  515  LYGIGDITLLRAETHKFESRYMDNLVGSEGAYYERSPINFVNKFTCPVILFQGLDDKVVP  574

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P+QARKIY+ALK  GLPVALVEYE
Sbjct  575  PDQARKIYKALKESGLPVALVEYE  598



>ref|WP_011611061.1| peptidase [Trichodesmium erythraeum]
 gb|ABG50682.1| peptidase S9, prolyl oligopeptidase active site region [Trichodesmium 
erythraeum IMS101]
Length=644

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 151/199 (76%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPLL+KSHGGPTA   GSL+L IQYWTSRG+AL+DVNYGGSTGYGRE+R+RL  +WGI
Sbjct  403  EKPPLLVKSHGGPTAATSGSLSLKIQYWTSRGFALLDVNYGGSTGYGREYRQRLKNSWGI  462

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DC + A++L   G VD  R+ I+G SAGGYTTL AL FKDVFKAG S YG+ DL+ 
Sbjct  463  VDVDDCVNGAQYLAKQGLVDSNRMAISGGSAGGYTTLCALTFKDVFKAGASYYGVSDLEA  522

Query  378  LVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D L+G     K  Y +RSPINF +  SCP+I FQGL+DK+VPP QA 
Sbjct  523  LATDTHKFESRYLDGLIGPYPEKKEIYKQRSPINFTESLSCPVIFFQGLEDKIVPPNQAE  582

Query  546  KIYQALKAKGLPVALVEYE  602
            K+ + L+ KGLPVA V +E
Sbjct  583  KMVEVLQKKGLPVAYVAFE  601



>ref|WP_015176530.1| peptidase S9, prolyl oligopeptidase active site region [Oscillatoria 
nigro-viridis]
 gb|AFZ07247.1| peptidase S9, prolyl oligopeptidase active site region [Oscillatoria 
nigro-viridis PCC 7112]
Length=653

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 153/199 (77%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPL++KSHGGPTA    S+NL IQYWTSRG+A++DVNYGGSTGYGRE+R+RL  +WGI
Sbjct  412  EKPPLVVKSHGGPTAATSSSMNLKIQYWTSRGFAVLDVNYGGSTGYGREYRKRLQDSWGI  471

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DC + AK+L + G VDGER+ I G SAGGYTTL AL F+DVFKAG S YG+ D++ 
Sbjct  472  VDVDDCANGAKYLAEKGLVDGERMAIAGGSAGGYTTLCALTFRDVFKAGASYYGVSDVEA  531

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFE+HY+D L+G     K+ Y  RSPI+  ++ SCP+I FQGL+DKVVPP QA 
Sbjct  532  LTTETHKFEAHYLDGLIGPYPERKDLYVARSPIHSAERLSCPVIFFQGLEDKVVPPNQAE  591

Query  546  KIYQALKAKGLPVALVEYE  602
             + + LKAKGLPVA V YE
Sbjct  592  MMVEILKAKGLPVAYVAYE  610



>ref|WP_015224372.1| WD40-like beta Propeller containing protein [Halothece sp. PCC 
7418]
 gb|AFZ42494.1| WD40-like beta Propeller containing protein [Halothece sp. PCC 
7418]
Length=643

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 151/202 (75%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A + E PPL++KSHGGPTA      NL IQYWTSRG+  VDVNYGGSTGYGRE+R+RLL+
Sbjct  398  APEGELPPLIVKSHGGPTAATSPRFNLKIQYWTSRGFGFVDVNYGGSTGYGREYRKRLLK  457

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV+DC + A++L + G+VDG RL ITG SAGGYTTLAAL F+D F+AG S YG+ 
Sbjct  458  NWGIVDVDDCANAARYLAEMGKVDGNRLAITGGSAGGYTTLAALTFRDTFQAGASHYGVS  517

Query  366  DLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL+ L     KFES Y+D LVGD    K  Y  RSPI   ++ SCP+I FQGL+DKVVPP
Sbjct  518  DLEALAQETHKFESRYLDRLVGDYPKEKAIYDARSPIYHTEQLSCPVIFFQGLEDKVVPP  577

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA K+ +A+K KGLPVA V +
Sbjct  578  NQAEKMVEAIKQKGLPVAYVPF  599



>ref|WP_036480343.1| peptidase [Myxosarcina sp. GI1]
Length=639

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 151/202 (75%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A + E PPL++KSHGGPTA A  +L+L IQYWTSRG+  +DVNYGGS GYGRE+R+RL  
Sbjct  394  ALEGELPPLVVKSHGGPTAAASVTLSLKIQYWTSRGFGYLDVNYGGSIGYGREYRQRLEN  453

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
             WGIVDV+DC + AK+LVD GRVDGERL ITG SAGGYTTLA L F+D FKAG S YG+ 
Sbjct  454  KWGIVDVDDCVNAAKYLVDKGRVDGERLVITGGSAGGYTTLAVLTFRDTFKAGASHYGVS  513

Query  366  DLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D LVGD    K  Y  RSPI   +  +CP+I FQGL+DKVVPP
Sbjct  514  DLEILAKDTHKFESRYLDRLVGDYPQQKEIYQARSPIYHTESLNCPVIFFQGLEDKVVPP  573

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  ++ A+KAKGLPVA V +
Sbjct  574  NQAEMMFDAIKAKGLPVAYVTF  595



>ref|WP_019495729.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=640

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 153/202 (76%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A + EKPPLL+KSHGGPTA    SL+LSIQYWTSRG A++DVNYGGSTGYGRE+R+RL  
Sbjct  395  APEGEKPPLLVKSHGGPTAATSTSLSLSIQYWTSRGIAVLDVNYGGSTGYGREYRQRLEG  454

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV+DC + AK+LV+ G VDG RL I G SAGGYTTL AL F+D FKAG S YG+ 
Sbjct  455  NWGIVDVDDCEAGAKYLVEQGLVDGNRLAIAGGSAGGYTTLCALTFRDTFKAGASYYGVS  514

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL+ L     KFES Y+D L+G     K+ Y ERSP+ F +K +CP+I FQGL+DK+VPP
Sbjct  515  DLEALARDTHKFESRYLDGLIGAYPERKDLYIERSPVYFTEKLACPVIFFQGLEDKIVPP  574

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +AL+ KGLPVA V +
Sbjct  575  NQAEIMVEALQQKGLPVAYVAF  596



>ref|WP_006632460.1| peptidase [Microcoleus vaginatus]
 gb|EGK88653.1| peptidase S9, prolyl oligopeptidase active site region [Microcoleus 
vaginatus FGP-2]
Length=653

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 151/199 (76%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPL++KSHGGPTA    S+NL IQYWTSRG+A++DVNYGGSTGYGRE+R+RL  +WGI
Sbjct  412  EKPPLVVKSHGGPTAATSSSMNLKIQYWTSRGFAVLDVNYGGSTGYGREYRKRLQDSWGI  471

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DC + AK+L   G VDGER+ I G SAGGYTTL AL F+DVFKAG S YG+ DL+ 
Sbjct  472  VDVDDCANGAKYLAQKGLVDGERMAIAGGSAGGYTTLCALTFRDVFKAGASYYGVSDLEA  531

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFE+ Y+D L+G     K+ Y  RSPI+  ++ SCP+I FQGL+DKVVPP QA 
Sbjct  532  LATDTHKFEARYLDGLIGPYPERKDLYVARSPIHSAERLSCPVIFFQGLEDKVVPPNQAE  591

Query  546  KIYQALKAKGLPVALVEYE  602
             + + LKAKGLPVA V YE
Sbjct  592  MMVEILKAKGLPVAYVAYE  610



>ref|WP_015223610.1| peptidase S9 prolyl oligopeptidase active site domain-containing 
protein [Cyanobacterium stanieri]
 gb|AFZ48295.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Cyanobacterium stanieri PCC 7202]
Length=632

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 152/203 (75%), Gaps = 4/203 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA   E PPLL+KSHGGPTA    S NL IQYWTSRG+A VDVNYGGSTGYGR++R+RL 
Sbjct  396  QAPDGELPPLLVKSHGGPTAMTTASYNLRIQYWTSRGFAFVDVNYGGSTGYGRDYRQRLA  455

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            +NWGIVDV DC + AK+LV++ +V+ E+L I+G SAGGYTTLAAL F DVFKAG S YGI
Sbjct  456  KNWGIVDVEDCINVAKYLVEAQKVNQEKLAISGGSAGGYTTLAALTFHDVFKAGASYYGI  515

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
            GDL++L     KFES Y+DNL+G    +K  Y  RSP+N ++K SCP+  FQGL+DKVVP
Sbjct  516  GDLEILATDTHKFESRYLDNLIGKYPEEKEIYKVRSPLNHIEKLSCPVAFFQGLEDKVVP  575

Query  531  PEQARKIYQALKAKGLPVALVEY  599
            P QA  + +ALK KG+    V +
Sbjct  576  PNQAEMMVKALKEKGITTTYVTF  598



>ref|WP_019499637.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=651

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   EKPPLL+KSHGGPTA A  S +L  QYWTSRG+A++DVNYGGSTGYGR +R+RL  
Sbjct  405  APNHEKPPLLVKSHGGPTAAASSSFSLRTQYWTSRGFAILDVNYGGSTGYGRAYRQRLHN  464

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV+DC + AK+L D G VDG RL I+G SAGGYTTL AL FKD+FKAG S YG+ 
Sbjct  465  NWGIVDVDDCANGAKYLADRGLVDGNRLAISGGSAGGYTTLCALTFKDIFKAGASYYGVS  524

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL+ L     KFE+ Y+D L+G     K+ Y  RSPI+F ++ SCP+I FQGL+D+VVPP
Sbjct  525  DLEALASDTHKFEARYLDGLIGAYPERKDLYVARSPIHFTEQLSCPVIFFQGLEDRVVPP  584

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  +  AL+ KGLPVA V +
Sbjct  585  NQAEMMVDALRTKGLPVAYVAF  606



>ref|WP_021298368.1| hypothetical protein [Alicyclobacillus acidoterrestris]
 gb|EPZ42135.1| hypothetical protein N007_01885 [Alicyclobacillus acidoterrestris 
ATCC 49025]
Length=646

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 150/204 (74%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA  +EKPPLL+  HGGPT+ +   L+LS QYWTSRG+A+VDVNYGGSTGYGRE+R+RL 
Sbjct  400  QAPVNEKPPLLVHVHGGPTSASSPVLDLSTQYWTSRGFAVVDVNYGGSTGYGREYRDRLK  459

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
             NWGIVDV D  S  ++L+D G VD +R+ I G SAGGYTTLA+L F DV+ AG S +G+
Sbjct  460  GNWGIVDVQDAVSAVRYLIDKGEVDPQRVAIAGGSAGGYTTLASLVFTDVYAAGASHFGL  519

Query  363  GDLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             +L++      KFES Y+D L+G     K+ Y+ RSPINF DK SCP+I FQGLDDK+VP
Sbjct  520  SELEIFAQETHKFESRYMDGLIGPYPEAKDVYYNRSPINFTDKLSCPVIFFQGLDDKIVP  579

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P QA  +  ALK KGLPVA V +E
Sbjct  580  PNQAELMVDALKKKGLPVAYVAFE  603



>ref|WP_011244350.1| peptidase [Synechococcus elongatus]
 dbj|BAD80230.1| probable peptidase [Synechococcus elongatus PCC 6301]
Length=643

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 150/196 (77%), Gaps = 4/196 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPLL+KSHGGPTA+ R SL+L IQYWTSRG A++DV+YGGSTGYGR +R+ L   WGI
Sbjct  399  EKPPLLVKSHGGPTAQTRSSLSLGIQYWTSRGIAVLDVDYGGSTGYGRPYRDALQGQWGI  458

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV DC + A++L D G VDG+RLCI G SAGGYTTL AL F DVFKAG S YGIGDLK 
Sbjct  459  VDVEDCAAGAQWLADQGLVDGDRLCIDGGSAGGYTTLCALTFTDVFKAGASRYGIGDLKA  518

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L +   KFES Y+D L+G      + Y ERSPI+ V++ +CP+I FQGL+DKVVPP QA 
Sbjct  519  LAEDTHKFESRYLDGLIGPWPEAADLYRERSPIHHVEQLNCPVIFFQGLEDKVVPPAQAE  578

Query  546  KIYQALKAKGLPVALV  593
             +  ALKAKGLPVA V
Sbjct  579  TMVAALKAKGLPVAYV  594



>ref|WP_011378291.1| MULTISPECIES: peptidase [Synechococcus]
 gb|ABB58083.1| probable peptidase [Synechococcus elongatus PCC 7942]
 gb|AJD57440.1| peptidase [Synechococcus sp. UTEX 2973]
Length=643

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 150/196 (77%), Gaps = 4/196 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPLL+KSHGGPTA+ R SL+L IQYWTSRG A++DV+YGGSTGYGR +R+ L   WGI
Sbjct  399  EKPPLLVKSHGGPTAQTRSSLSLGIQYWTSRGIAVLDVDYGGSTGYGRPYRDALQGQWGI  458

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV DC + A++L D G VDG+RLCI G SAGGYTTL AL F DVFKAG S YGIGDLK 
Sbjct  459  VDVEDCAAGAQWLADQGLVDGDRLCIDGGSAGGYTTLCALTFTDVFKAGASRYGIGDLKA  518

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L +   KFES Y+D L+G      + Y ERSPI+ V++ +CP+I FQGL+DKVVPP QA 
Sbjct  519  LAEDTHKFESRYLDGLIGPWPEAADLYRERSPIHHVEQLNCPVIFFQGLEDKVVPPAQAE  578

Query  546  KIYQALKAKGLPVALV  593
             +  ALKAKGLPVA V
Sbjct  579  TMVAALKAKGLPVAYV  594



>gb|AFW85320.1| hypothetical protein ZEAMMB73_272531 [Zea mays]
Length=550

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 141/186 (76%), Gaps = 29/186 (16%)
 Frame = +3

Query  45   HGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGIVDVNDCCSC  224
            +GGPT EARG L+LS+QYWTSRGWA VDVNYGGS+GYGREFRERLL  WG+VDVNDCCSC
Sbjct  349  NGGPTDEARGVLDLSVQYWTSRGWAFVDVNYGGSSGYGREFRERLLAQWGVVDVNDCCSC  408

Query  225  AKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKLLVDGMPKFE  404
            A FLV++GRVDG+RLC+TG SAGG+TTLA LAF+  FKA                     
Sbjct  409  AAFLVETGRVDGQRLCVTGESAGGFTTLACLAFRQTFKA---------------------  447

Query  405  SHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKIYQALKAKGLPV  584
                    G+K AYFERSPINFV+ FSCP+ILFQGL+D VV P+QA KIY+A+K KGLPV
Sbjct  448  --------GNKQAYFERSPINFVENFSCPVILFQGLEDTVVSPDQATKIYKAIKDKGLPV  499

Query  585  ALVEYE  602
            ALVEYE
Sbjct  500  ALVEYE  505



>ref|WP_013320415.1| peptidase [Cyanothece sp. PCC 7822]
 gb|ADN12305.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Cyanothece sp. PCC 7822]
Length=643

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 153/199 (77%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E PPLL+KSHGGPTA A  + +L +QYWTSRG+A +DVNYGGSTG+GRE+R+RL +NWGI
Sbjct  401  ELPPLLVKSHGGPTACATANFSLRVQYWTSRGFAYLDVNYGGSTGFGREYRQRLDKNWGI  460

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DC + AK+LV  G+ DG+RL I+G SAGGYTTLAAL F++VF+AG S YG+ DL+ 
Sbjct  461  VDVDDCINAAKYLVQQGKADGKRLAISGGSAGGYTTLAALTFRNVFQAGASYYGVSDLEA  520

Query  378  LVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D L+G    +K+ Y +RSPI F D+  CP+I FQGL+DKVVPP QA 
Sbjct  521  LAKDTHKFESRYLDRLIGQYPQEKDLYQQRSPIMFTDRLDCPVIFFQGLEDKVVPPNQAE  580

Query  546  KIYQALKAKGLPVALVEYE  602
             +  A+K KGLPVA V +E
Sbjct  581  MMVAAIKTKGLPVAYVPFE  599



>ref|WP_015228967.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Dactylococcopsis 
salina]
 gb|AFZ49961.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Dactylococcopsis 
salina PCC 8305]
Length=646

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 148/203 (73%), Gaps = 4/203 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A Q E PPL++KSHGGPTA      NL IQYWTSRG+  VDVNYGGSTGYGRE+R+RL  
Sbjct  399  APQGELPPLVVKSHGGPTAATSPRFNLKIQYWTSRGFGFVDVNYGGSTGYGREYRQRLKD  458

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV+DC + A++L   G+VDG RL ITG SAGGYTTLAAL F+D F+AG S YG+ 
Sbjct  459  NWGIVDVDDCVNVAQYLAQLGKVDGNRLAITGGSAGGYTTLAALTFRDTFQAGASHYGVS  518

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL+ L     KFES Y+D LVG     +  Y  RSPI   ++ SCP+I FQGL+DKVVPP
Sbjct  519  DLEALAQETHKFESRYLDGLVGQYPRQQELYHARSPIYHTEQLSCPVIFFQGLEDKVVPP  578

Query  534  EQARKIYQALKAKGLPVALVEYE  602
             QA K+ +A+K KGLPVA V +E
Sbjct  579  NQAEKMVEAIKEKGLPVAYVPFE  601



>ref|WP_034419566.1| peptidase, partial [Candidatus Entotheonella sp. TSY1]
 gb|ETW97812.1| peptidase, partial [Candidatus Entotheonella sp. TSY1]
Length=611

 Score =   256 bits (654),  Expect = 6e-78, Method: Composition-based stats.
 Identities = 123/203 (61%), Positives = 151/203 (74%), Gaps = 4/203 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A    +PPL++KSHGGPT+ A  +LNL IQYWTSRG+A++DVNYGGSTGYGR +R+RL  
Sbjct  363  ASAGARPPLIVKSHGGPTSAALTTLNLGIQYWTSRGFAVLDVNYGGSTGYGRAYRQRLNG  422

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
             WGIVDV DC + A++LV+ G VDG RL ITG SAGGYTTL AL F D F AG S YGI 
Sbjct  423  QWGIVDVEDCANGARYLVERGDVDGHRLAITGGSAGGYTTLCALTFHDTFSAGASHYGIS  482

Query  366  DLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL+ L     KFES Y+D+L+G     ++ Y  RSPI+F D+ SCP+ILFQGL+D+VVPP
Sbjct  483  DLEALAGETHKFESRYLDSLIGPYPEREDLYKARSPIHFTDRLSCPLILFQGLEDQVVPP  542

Query  534  EQARKIYQALKAKGLPVALVEYE  602
             QA  + QAL+ KGLPVA V +E
Sbjct  543  NQAEMMAQALRDKGLPVAYVPFE  565



>ref|WP_007354878.1| MULTISPECIES: peptidase [Kamptonema]
 emb|CBN55655.1| Peptidase, S9A/B/C family, catalytic domain protein [ [[Oscillatoria] 
sp. PCC 6506]
Length=654

 Score =   257 bits (656),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 153/203 (75%), Gaps = 4/203 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A  +EKPPL++KSHGGPTA    S NL IQYWTSRG+A++DVNYGGSTGYGRE+R+RL  
Sbjct  409  APAEEKPPLVVKSHGGPTAATSSSFNLKIQYWTSRGFAVLDVNYGGSTGYGREYRQRLKD  468

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
             WGIVDV+DC + AK+L + G VD +++ I G SAGGYTTL AL F+DVFKAG S YG+ 
Sbjct  469  RWGIVDVDDCTNGAKYLAEKGLVDSQKMAIAGGSAGGYTTLCALTFRDVFKAGASYYGVS  528

Query  366  DLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL+ L     KFES Y+D L+G     ++ Y +RSPI+F ++ SCP+I FQGL+D+VVPP
Sbjct  529  DLEALATDTHKFESRYLDELIGPYPERQDLYKQRSPIHFTERLSCPVIFFQGLEDRVVPP  588

Query  534  EQARKIYQALKAKGLPVALVEYE  602
             QA  +  A+KAKGLPVA + +E
Sbjct  589  NQAEMMVAAIKAKGLPVAYITFE  611



>ref|WP_026794723.1| MULTISPECIES: peptidase [Planktothrix]
Length=633

 Score =   256 bits (654),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 152/204 (75%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q  + EKPPL++KSHGGPTA    SL+L  QYWTSRG+A++DVNYGGSTGYGRE+R+RL 
Sbjct  401  QVSEGEKPPLVVKSHGGPTAATSSSLSLKNQYWTSRGFAVLDVNYGGSTGYGREYRQRLN  460

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            ++WGIVDV+DCC+ AK+L + G VDG R+ I G SAGGYTTL AL FKDVFKAG S YG+
Sbjct  461  KSWGIVDVDDCCNGAKYLAEQGLVDGNRMAIAGGSAGGYTTLCALTFKDVFKAGASYYGV  520

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL  L     KFES Y+D L+G    +K  Y +RSPI  VDK SCP+I FQG +DK+VP
Sbjct  521  SDLAALATDTHKFESRYLDGLIGVYPEEKAIYQQRSPIYSVDKLSCPVIFFQGSEDKIVP  580

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P QA  + +ALKAKG+ V  V +E
Sbjct  581  PNQAEMMVEALKAKGVTVDYVLFE  604



>ref|WP_007305110.1| peptidase [Crocosphaera watsonii]
 gb|EAM51299.1| Peptidase S9, prolyl oligopeptidase active site region [Crocosphaera 
watsonii WH 8501]
Length=645

 Score =   256 bits (655),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 149/199 (75%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E PPLL+KSHGGPTA A  S +L IQYWTSRG+  +DVNYGGSTG+G+ +R+RL +NWG+
Sbjct  402  ELPPLLVKSHGGPTAAATPSFSLKIQYWTSRGFGYLDVNYGGSTGFGKAYRQRLDKNWGV  461

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDVNDC + AK+L   G+VDG+RL I+G SAGGYTTLAAL F D FKAG S YG+ DL+ 
Sbjct  462  VDVNDCINGAKYLAAQGKVDGDRLAISGGSAGGYTTLAALTFDDTFKAGASYYGVSDLES  521

Query  378  LVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D L+G    +K  Y +RSPIN+ DK SCP+I FQGL+DKVVPP QA 
Sbjct  522  LAKDTHKFESRYLDRLIGKYPEEKEIYEQRSPINYTDKLSCPVIFFQGLEDKVVPPNQAE  581

Query  546  KIYQALKAKGLPVALVEYE  602
             +   LK KG+PVA V +E
Sbjct  582  MMLYTLKNKGIPVAYVPFE  600



>ref|WP_008278845.1| peptidase [Cyanothece sp. CCY0110]
 gb|EAZ88066.1| hypothetical protein CY0110_29019 [Cyanothece sp. CCY0110]
Length=645

 Score =   256 bits (655),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 152/199 (76%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E PPLL+KSHGGPTA A  S +L IQYWTSRG+  +DVNYGGSTG+G+ +R+RL +NWG+
Sbjct  402  ELPPLLVKSHGGPTAAATPSFSLKIQYWTSRGFGYLDVNYGGSTGFGKAYRQRLEKNWGL  461

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDVNDC + A +LV+ G+VDG+RL I+G SAGGYTTLAAL F D FKAG S YG+ DL+ 
Sbjct  462  VDVNDCINGANYLVEQGKVDGDRLAISGGSAGGYTTLAALTFHDTFKAGASYYGVSDLES  521

Query  378  LVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFE+ Y+D L+G    +K  Y +RSPINF D+ +CP+I FQGL+DKVVPP QA 
Sbjct  522  LAKDTHKFEARYLDKLIGQYPEEKEIYEQRSPINFTDQLNCPVIFFQGLEDKVVPPSQAE  581

Query  546  KIYQALKAKGLPVALVEYE  602
             + ++LK KG+PVA + +E
Sbjct  582  MMVESLKNKGIPVAYIPFE  600



>emb|CCQ61597.1| prolyl oligopeptidase family protein [Crocosphaera watsonii WH 
0401]
Length=645

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 149/199 (75%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E PPLL+KSHGGPTA A  S +L IQYWTSRG+  +DVNYGGSTG+G+ +R+RL +NWG+
Sbjct  402  ELPPLLVKSHGGPTAAATPSFSLKIQYWTSRGFGYLDVNYGGSTGFGKAYRQRLDKNWGV  461

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDVNDC + AK+L   G+VDG+RL I+G SAGGYTTLAAL F D FKAG S YG+ DL+ 
Sbjct  462  VDVNDCINGAKYLAAQGKVDGDRLAISGGSAGGYTTLAALTFDDTFKAGASYYGVSDLES  521

Query  378  LVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D L+G    +K  Y +RSPIN+ DK SCP+I FQGL+DKVVPP QA 
Sbjct  522  LAKDTHKFESRYLDRLIGKYPEEKEIYEQRSPINYTDKLSCPVIFFQGLEDKVVPPNQAE  581

Query  546  KIYQALKAKGLPVALVEYE  602
             +   LK KG+PVA V +E
Sbjct  582  MMLYTLKNKGIPVAYVPFE  600



>ref|WP_023067141.1| dienelactone hydrolase family protein [Lyngbya aestuarii]
 gb|ERT06634.1| dienelactone hydrolase family protein [Lyngbya aestuarii BL J]
Length=640

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 148/198 (75%), Gaps = 4/198 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPLL+KSHGGPTA    SL+L IQYWTSRG+A++DVNYGGSTGYGRE+R+RL  NWGI
Sbjct  408  EKPPLLVKSHGGPTAATSSSLSLKIQYWTSRGFAVLDVNYGGSTGYGREYRQRLKDNWGI  467

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDVNDC + AK+L   G VD +R+ ITG SAGGYTTL AL F DVFKAG S YG+ DL+ 
Sbjct  468  VDVNDCANGAKYLAQKGLVDRDRMAITGGSAGGYTTLCALTFTDVFKAGASYYGVSDLEA  527

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            LV    KFES Y+DNL+G     +  Y +RSPI+  +  SCP+I FQGL+DKVVPP QA 
Sbjct  528  LVRDTHKFESRYLDNLIGPYPECQEIYIQRSPIHHTEGLSCPVIFFQGLEDKVVPPNQAE  587

Query  546  KIYQALKAKGLPVALVEY  599
             + + LKAKGL V  V +
Sbjct  588  TMVEVLKAKGLTVEYVVF  605



>gb|ELR99405.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Gloeocapsa 
sp. PCC 73106]
Length=624

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 152/203 (75%), Gaps = 4/203 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA     PPL++KSHGGPTA A  SL+L  QYWTSRG+A++DVNYGGSTGYGR++R+RL+
Sbjct  393  QAPSGSLPPLIVKSHGGPTAPASASLSLKTQYWTSRGFAVLDVNYGGSTGYGRDYRQRLV  452

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            + WG+VDV+DC + AK+LV   +VD +RL ITG SAGGYTTLAAL F+D FKAG S YG+
Sbjct  453  QQWGVVDVDDCVNGAKYLVQQQKVDPQRLAITGGSAGGYTTLAALTFRDTFKAGASYYGV  512

Query  363  GDLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL+ L     KFES Y+D L+G     K  Y ERSPINF ++ +CP+I  QGL+D+VVP
Sbjct  513  SDLEALAQDTHKFESRYLDGLIGPYPEAKAIYVERSPINFTEQLNCPVIFLQGLEDRVVP  572

Query  531  PEQARKIYQALKAKGLPVALVEY  599
            P Q  K+ +AL+AKG+PV  + +
Sbjct  573  PNQTEKMVKALEAKGIPVTYIAF  595



>ref|WP_021830089.1| prolyl oligopeptidase family protein [Crocosphaera watsonii]
 emb|CCQ50423.1| prolyl oligopeptidase family protein [Crocosphaera watsonii WH 
8502]
Length=645

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 149/199 (75%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E PPLL+KSHGGPTA A  S +L IQYWTSRG+  +DVNYGGSTG+G+ +R+RL +NWG+
Sbjct  402  ELPPLLVKSHGGPTAAATPSFSLKIQYWTSRGFGYLDVNYGGSTGFGKAYRQRLDKNWGV  461

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDVNDC + AK+L   G+VDG+RL I+G SAGGYTTLAAL F D FKAG S YG+ DL+ 
Sbjct  462  VDVNDCINGAKYLAAQGKVDGDRLAISGGSAGGYTTLAALTFDDTFKAGASYYGVSDLES  521

Query  378  LVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D L+G    +K  Y +RSPIN+ DK SCP+I FQGL+DKVVPP QA 
Sbjct  522  LAKDTHKFESRYLDRLIGKYPEEKEIYEQRSPINYTDKLSCPVIFFQGLEDKVVPPNQAE  581

Query  546  KIYQALKAKGLPVALVEYE  602
             +   LK KG+PVA V +E
Sbjct  582  MMLYTLKNKGIPVAYVPFE  600



>ref|WP_034935407.1| peptidase, partial [Gloeocapsa sp. PCC 73106]
Length=623

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 152/203 (75%), Gaps = 4/203 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA     PPL++KSHGGPTA A  SL+L  QYWTSRG+A++DVNYGGSTGYGR++R+RL+
Sbjct  393  QAPSGSLPPLIVKSHGGPTAPASASLSLKTQYWTSRGFAVLDVNYGGSTGYGRDYRQRLV  452

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            + WG+VDV+DC + AK+LV   +VD +RL ITG SAGGYTTLAAL F+D FKAG S YG+
Sbjct  453  QQWGVVDVDDCVNGAKYLVQQQKVDPQRLAITGGSAGGYTTLAALTFRDTFKAGASYYGV  512

Query  363  GDLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL+ L     KFES Y+D L+G     K  Y ERSPINF ++ +CP+I  QGL+D+VVP
Sbjct  513  SDLEALAQDTHKFESRYLDGLIGPYPEAKAIYVERSPINFTEQLNCPVIFLQGLEDRVVP  572

Query  531  PEQARKIYQALKAKGLPVALVEY  599
            P Q  K+ +AL+AKG+PV  + +
Sbjct  573  PNQTEKMVKALEAKGIPVTYIAF  595



>ref|WP_027249662.1| peptidase [Planktothrix agardhii]
Length=633

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 152/204 (75%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q  + EKPPL++KSHGGPTA    SL+L  QYWTSRG+A++DVNYGGSTGYGRE+R+RL 
Sbjct  401  QVSEGEKPPLVVKSHGGPTAATSSSLSLKNQYWTSRGFAVLDVNYGGSTGYGREYRQRLN  460

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            ++WGIVDV+DCC+ AK+L + G VDG R+ I G SAGGYTTL AL FKDVFKAG S YG+
Sbjct  461  KSWGIVDVDDCCNGAKYLAEQGLVDGNRMAIAGGSAGGYTTLCALTFKDVFKAGASYYGV  520

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL  L     KFES Y+D L+G    +K  Y +RSPI  VDK SCP+I FQG +DK+VP
Sbjct  521  SDLAALATDTHKFESRYLDGLIGVYPEEKAIYQQRSPIYSVDKLSCPVIFFQGSEDKIVP  580

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P QA  + +ALKAKG+ V  V +E
Sbjct  581  PNQAEMMVEALKAKGVTVDYVLFE  604



>ref|WP_026786106.1| peptidase [Planktothrix rubescens]
Length=637

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 152/204 (75%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q  + EKPPL++KSHGGPTA    SL+L  QYWTSRG+A++DVNYGGSTGYGRE+R+RL 
Sbjct  401  QVSEGEKPPLVVKSHGGPTAATSSSLSLKNQYWTSRGFAVLDVNYGGSTGYGREYRQRLN  460

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            ++WGIVDV+DCC+ AK+L + G VDG R+ I G SAGGYTTL AL FKDVFKAG S YG+
Sbjct  461  KSWGIVDVDDCCNGAKYLAEQGFVDGNRMAIAGGSAGGYTTLCALTFKDVFKAGASYYGV  520

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL  L     KFES Y+D L+G    +K  Y +RSPI  VD+ SCP+I FQG +DK+VP
Sbjct  521  SDLAALATDTHKFESRYLDGLIGIYPEEKAIYQQRSPIYHVDQLSCPVIFFQGSEDKIVP  580

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P QA  + +ALKAKG+ V  V +E
Sbjct  581  PNQAEMMVEALKAKGVTVEYVLFE  604



>ref|WP_017285954.1| hypothetical protein [Leptolyngbya boryana]
Length=640

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 150/204 (74%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA + E PP+L+KSHGGPTA    S NL IQYWTSRG+A++DVNYGGSTGYGR +RERL 
Sbjct  394  QAPEGELPPMLVKSHGGPTAATSASFNLGIQYWTSRGFAVLDVNYGGSTGYGRAYRERLK  453

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV DC + AK+L + G+VDG+RL I G SAGGYTTL AL F++ FKAG S YG+
Sbjct  454  GTWGIVDVADCANGAKYLAEQGKVDGDRLVIAGGSAGGYTTLCALTFRNTFKAGASYYGV  513

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DLK L +   KFES Y+D L+G      + Y +RSPI  VD+ SCP+I FQG +D++VP
Sbjct  514  SDLKALAEDTHKFESRYLDGLIGAYPERADLYHDRSPITAVDRLSCPVIFFQGDEDRIVP  573

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P QA  +  ALKAKGLPVA V +E
Sbjct  574  PNQAEMMVDALKAKGLPVAYVLFE  597



>ref|WP_026798064.1| peptidase [Planktothrix prolifica]
Length=637

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 152/204 (75%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q  + EKPPL++KSHGGPTA    SL+L  QYWTSRG+A++DVNYGGSTGYGRE+R+RL 
Sbjct  401  QVSEGEKPPLVVKSHGGPTAATSSSLSLKNQYWTSRGFAVLDVNYGGSTGYGREYRQRLN  460

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            ++WGIVDV+DCC+ AK+L + G VDG R+ I G SAGGYTTL AL FKDVFKAG S YG+
Sbjct  461  KSWGIVDVDDCCNGAKYLAEQGFVDGNRMAIAGGSAGGYTTLCALTFKDVFKAGASYYGV  520

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL  L     KFES Y+D L+G    +K  Y +RSPI  VD+ SCP+I FQG +DK+VP
Sbjct  521  SDLAALATDTHKFESRYLDGLIGIYPEEKAIYQQRSPIYHVDQLSCPVIFFQGSEDKIVP  580

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P QA  + +ALKAKG+ V  V +E
Sbjct  581  PNQAEMMVEALKAKGVTVEYVLFE  604



>ref|WP_009546699.1| MULTISPECIES: peptidase [Cyanothece]
 gb|ACB49552.1| peptidase, S9C [Cyanothece sp. ATCC 51142]
Length=645

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 151/200 (76%), Gaps = 4/200 (2%)
 Frame = +3

Query  15   DEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWG  194
            +E PPLL+KSHGGPTA A  S +L IQYWTSRG+  +DVNYGGSTG+G+ +R+RL +NWG
Sbjct  401  EELPPLLVKSHGGPTAAATPSFSLKIQYWTSRGFGYLDVNYGGSTGFGKTYRQRLEKNWG  460

Query  195  IVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLK  374
            +VDVNDC + A +LV  G+VDG+RL I+G SAGGYTTLAAL F D FKAG S YG+ DL+
Sbjct  461  LVDVNDCINGANYLVKQGKVDGDRLAISGGSAGGYTTLAALTFHDTFKAGASYYGVSDLE  520

Query  375  LLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             L     KFES Y+D L+G    +K  Y ERSPINF D+ +CP+I FQGL+DKVVPP QA
Sbjct  521  SLAKDTHKFESRYLDKLIGQYPEEKEIYEERSPINFTDQLNCPVIFFQGLEDKVVPPSQA  580

Query  543  RKIYQALKAKGLPVALVEYE  602
              + ++LK K +PVA + +E
Sbjct  581  EMMVESLKNKEIPVAYIAFE  600



>ref|WP_009782357.1| peptidase [Lyngbya sp. PCC 8106]
 gb|EAW38902.1| Peptidase S9, prolyl oligopeptidase active site region [Lyngbya 
sp. PCC 8106]
Length=640

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 148/198 (75%), Gaps = 4/198 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPLL+KSHGGPTA    +L+L IQYWTSRG+A++DVNYGGSTGYGRE+R+RL  NWGI
Sbjct  408  EKPPLLVKSHGGPTAATSSNLSLKIQYWTSRGFAVLDVNYGGSTGYGREYRQRLKDNWGI  467

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDVNDC + AK+L   G VD +R+ ITG SAGGYTTL AL F DVFKAG S YG+ DL+ 
Sbjct  468  VDVNDCANGAKYLAKKGLVDRDRMAITGGSAGGYTTLCALTFTDVFKAGASYYGVSDLEA  527

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            LV    KFES Y+DNL+G     K  Y +RSPI+  +  SCP+I FQGL+DKVVPP QA 
Sbjct  528  LVRDTHKFESRYLDNLIGPYPECKEIYIQRSPIHHTEGLSCPVIFFQGLEDKVVPPNQAE  587

Query  546  KIYQALKAKGLPVALVEY  599
             + + LKAKGL V  V +
Sbjct  588  TMVEVLKAKGLTVEYVVF  605



>ref|WP_027254922.1| peptidase [Planktothrix agardhii]
Length=637

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 152/204 (75%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q  + EKPPL++KSHGGPTA    SL+L  QYWTSRG+A++DVNYGGSTGYGRE+R+RL 
Sbjct  401  QVSEGEKPPLVVKSHGGPTAATSSSLSLKNQYWTSRGFAVLDVNYGGSTGYGREYRQRLN  460

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            ++WGIVDV+DCC+ AK+L + G VDG R+ I G SAGGYTTL AL FKDVFKAG S YG+
Sbjct  461  KSWGIVDVDDCCNGAKYLAEQGFVDGNRMAIAGGSAGGYTTLCALTFKDVFKAGASYYGV  520

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL  L     KFES Y+D L+G    +K  Y +RSPI  VD+ SCP+I FQG +DK+VP
Sbjct  521  SDLAALATDTHKFESRYLDGLIGIYPEEKAIYQQRSPIYHVDQLSCPVIFFQGSEDKIVP  580

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P QA  + +ALKAKG+ V  V +E
Sbjct  581  PNQAEMMVEALKAKGVTVEYVLFE  604



>ref|WP_007310402.1| peptidase [Crocosphaera watsonii]
 gb|EHJ13212.1| Peptidase S9, prolyl oligopeptidase active site region [Crocosphaera 
watsonii WH 0003]
 emb|CCQ57195.1| prolyl oligopeptidase family protein [Crocosphaera watsonii WH 
0005]
 emb|CCQ66299.1| prolyl oligopeptidase family protein [Crocosphaera watsonii WH 
0402]
Length=645

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 149/199 (75%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E PPLL+KSHGGPTA A  S +L IQYWTSRG+  +DVNYGGSTG+G+ +R+RL +NWG+
Sbjct  402  ELPPLLVKSHGGPTAAATPSFSLKIQYWTSRGFGYLDVNYGGSTGFGKAYRQRLDKNWGV  461

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDVNDC + AK+L   G+VDG+RL I+G SAGGYTTLAAL F D FKAG S YG+ DL+ 
Sbjct  462  VDVNDCINGAKYLAAQGKVDGDRLAISGGSAGGYTTLAALTFDDTFKAGASYYGVSDLES  521

Query  378  LVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D L+G    +K  Y +RSPIN+ DK SCP+I FQGL+DKVVPP QA 
Sbjct  522  LAKDNHKFESRYLDRLIGKYPEEKEIYEQRSPINYTDKLSCPVIFFQGLEDKVVPPNQAE  581

Query  546  KIYQALKAKGLPVALVEYE  602
             +   LK KG+PVA V +E
Sbjct  582  MMLYTLKNKGIPVAYVPFE  600



>ref|WP_040934755.1| peptidase [Prochloron didemni]
Length=634

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 149/196 (76%), Gaps = 4/196 (2%)
 Frame = +3

Query  24   PPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGIVD  203
            PPLL+KSHGGPTA A  +LNL IQYWTSRG+ ++DVNYGGS+GYGR++R+RL  NWGIVD
Sbjct  404  PPLLVKSHGGPTAAASVNLNLKIQYWTSRGFGVLDVNYGGSSGYGRQYRQRLEGNWGIVD  463

Query  204  VNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKLLV  383
            V+DC + AK+LV+ G+VDG RL ITGSSAGGYT LAAL F+DVF AG S YGI D+  LV
Sbjct  464  VDDCVNGAKYLVEQGKVDGTRLAITGSSAGGYTALAALTFRDVFHAGASYYGISDIFALV  523

Query  384  DGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKI  551
                KFES Y+D LVG     K  Y  RSPI+F D+ SCPII FQGL+DKVVPP QA  +
Sbjct  524  RDTHKFESRYLDRLVGPYPEAKEVYEARSPIHFSDRLSCPIIFFQGLEDKVVPPNQAEMM  583

Query  552  YQALKAKGLPVALVEY  599
             + L +KGL VA V +
Sbjct  584  VEQLASKGLKVAYVAF  599



>ref|WP_040939364.1| peptidase [Prochloron didemni]
Length=630

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 149/196 (76%), Gaps = 4/196 (2%)
 Frame = +3

Query  24   PPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGIVD  203
            PPLL+KSHGGPTA A  +LNL IQYWTSRG+ ++DVNYGGS+GYGR++R+RL  NWGIVD
Sbjct  404  PPLLVKSHGGPTAAASVNLNLKIQYWTSRGFGVLDVNYGGSSGYGRQYRQRLEGNWGIVD  463

Query  204  VNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKLLV  383
            V+DC + AK+LV+ G+VDG RL ITGSSAGGYT LAAL F+DVF AG S YGI D+  LV
Sbjct  464  VDDCVNGAKYLVEQGKVDGTRLAITGSSAGGYTALAALTFRDVFHAGASYYGISDIFALV  523

Query  384  DGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKI  551
                KFES Y+D LVG     K  Y  RSPI+F D+ SCPII FQGL+DKVVPP QA  +
Sbjct  524  RDTHKFESRYLDRLVGPYPEAKEVYEARSPIHFSDRLSCPIIFFQGLEDKVVPPNQAEMM  583

Query  552  YQALKAKGLPVALVEY  599
             + L+ KGL VA V +
Sbjct  584  VEQLQKKGLKVAYVAF  599



>ref|WP_006619107.1| peptidase S9, prolyl oligopeptidase active site region [Arthrospira 
platensis]
 dbj|BAI92246.1| probable peptidase [Arthrospira platensis NIES-39]
 gb|KDR54154.1| peptidase [Arthrospira platensis str. Paraca]
Length=636

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 148/202 (73%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A + EKPPLL+KSHGGPTA    SLNL IQYWTSRG+A++DVNYGGSTGYGR++R+RL  
Sbjct  403  ASETEKPPLLVKSHGGPTAATSSSLNLKIQYWTSRGFAVLDVNYGGSTGYGRDYRQRLQG  462

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AKFL   G VDG+R+ I G SAGGYTTL AL F DVFKAG S YG+ 
Sbjct  463  NWGIVDVADCVNGAKFLAAQGLVDGDRMAIAGGSAGGYTTLCALTFHDVFKAGASYYGVS  522

Query  366  DLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL+ L     KFES Y+D L+      ++ Y  RSPI+  D+ +CPII FQGL+DKVVPP
Sbjct  523  DLEALATDTHKFESRYLDGLIAPYPEGRDLYIARSPIHHSDRLNCPIIFFQGLEDKVVPP  582

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA K+ Q L+AKGL V  V +
Sbjct  583  NQAEKMVQVLQAKGLTVEYVTF  604



>ref|WP_042155696.1| peptidase [Planktothrix agardhii]
 gb|KEI68329.1| peptidase [Planktothrix agardhii NIVA-CYA 126/8]
Length=637

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 152/204 (75%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q  + EKPPL++KSHGGPTA    SL+L  QYWTSRG+A++DVNYGGSTGYGRE+R+RL 
Sbjct  401  QVSEGEKPPLVVKSHGGPTAATSSSLSLKNQYWTSRGFAVLDVNYGGSTGYGREYRQRLN  460

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            ++WGIVDV+DCC+ AK+L + G VDG R+ I G SAGGYTTL AL FKD+FKAG S YG+
Sbjct  461  KSWGIVDVDDCCNGAKYLAEQGFVDGNRMAIAGGSAGGYTTLCALTFKDLFKAGASYYGV  520

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL  L     KFES Y+D L+G    +K  Y +RSPI  VDK SCP+I FQG +DK+VP
Sbjct  521  SDLAALATDTHKFESRYLDGLIGIYPEEKAIYQQRSPIYHVDKLSCPVIFFQGSEDKIVP  580

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P QA  + +ALKAKG+ V  V +E
Sbjct  581  PNQAEIMVEALKAKGVTVEYVLFE  604



>ref|WP_017660033.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=644

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 150/204 (74%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA   EKPPLL+KSH GPTA A   L LSIQYWTSRG+  ++VNYGGSTGYGR++R+RL 
Sbjct  396  QAPDGEKPPLLVKSHSGPTASASTGLRLSIQYWTSRGFGFLEVNYGGSTGYGRDYRQRLD  455

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
             NWG+VDV+DC + AK+LVD G VDG+RL ITGSSAGGYT L AL F+D FKAG S YG+
Sbjct  456  GNWGVVDVDDCANGAKYLVDRGLVDGDRLAITGSSAGGYTVLCALTFRDTFKAGASYYGV  515

Query  363  GDLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             +L+       KFE  YID LVG     K+ Y  RSPI+FVD+ SCP I F GL+D VVP
Sbjct  516  SNLETWAADTHKFELRYIDRLVGPYPERKDVYEARSPIHFVDRLSCPTIFFHGLEDTVVP  575

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P QA ++ +AL+ KGLPVA V +E
Sbjct  576  PSQAEQMVEALRKKGLPVAYVPFE  599



>ref|WP_041764852.1| peptidase [Leptolyngbya sp. PCC 7376]
Length=643

 Score =   254 bits (650),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 149/203 (73%), Gaps = 4/203 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A ++  PPLL+KSHGGPTA A  SL+L IQYWTSRG+A VDVNYGGSTGYG ++ +RL  
Sbjct  398  APENAVPPLLVKSHGGPTAMAGSSLSLRIQYWTSRGFAFVDVNYGGSTGYGSKYHQRLDG  457

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G  D E+L I G SAGGYTTLAAL F D F AG S YGI 
Sbjct  458  NWGIVDVQDCVNVAKYLVEKGLADSEKLAIAGGSAGGYTTLAALTFYDTFNAGASYYGIS  517

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFE+ Y+D L+G    +K+ Y  RSPI+F +K SCP I FQGL+DKVVPP
Sbjct  518  DLEVLATDTHKFEARYLDRLIGKYPEEKDKYVARSPIHFTEKLSCPAIFFQGLEDKVVPP  577

Query  534  EQARKIYQALKAKGLPVALVEYE  602
             QA  +  A+KAKGLPVA V +E
Sbjct  578  NQAEMMVDAIKAKGLPVAYVPFE  600



>ref|WP_029421055.1| peptidase [Alicyclobacillus macrosporangiidus]
Length=643

 Score =   254 bits (650),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 152/203 (75%), Gaps = 4/203 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA   EKPPLL+  HGGPT+ +   L+LS QYWTSRG+A+VDVNYGGSTGYGRE+R+RL 
Sbjct  397  QAPAGEKPPLLVHVHGGPTSASPAVLSLSTQYWTSRGFAVVDVNYGGSTGYGREYRDRLK  456

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WG+VDV+D  + A +LV  G  DGERLCI G SAGGYTTLAAL F+DVFKAG S +G+
Sbjct  457  GQWGVVDVDDAVNAALYLVRRGLADGERLCIAGGSAGGYTTLAALTFRDVFKAGASHFGL  516

Query  363  GDLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             +L++ V    KFES Y+D+L+G     K+ Y+ RSPI+F D+ SCPII FQGLDDK+VP
Sbjct  517  SELEVFVHETHKFESRYMDSLLGPYPEAKSVYYNRSPIHFTDRLSCPIIFFQGLDDKIVP  576

Query  531  PEQARKIYQALKAKGLPVALVEY  599
            P QA  +  AL+ KGLPVA V +
Sbjct  577  PNQAELMVDALRKKGLPVAYVAF  599



>ref|WP_008054063.1| peptidase [Arthrospira sp. PCC 8005]
 emb|CCE18709.1| Peptidase S9 prolyl oligopeptidase active site domain protein 
[Arthrospira sp. PCC 8005]
 emb|CDM97432.1| Peptidase S9 prolyl oligopeptidase active site domain protein 
[Arthrospira sp. PCC 8005]
Length=636

 Score =   254 bits (650),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 148/202 (73%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A + EKPPLL+KSHGGPTA    SLNL IQYWTSRG+A++DVNYGGSTGYGRE+R+RL  
Sbjct  403  APETEKPPLLVKSHGGPTAATSSSLNLKIQYWTSRGFAVLDVNYGGSTGYGREYRQRLQG  462

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AKFL   G VDG+R+ I G SAGGYTTL AL F DVFKAG S YG+ 
Sbjct  463  NWGIVDVADCVNGAKFLAAQGLVDGDRMAIAGGSAGGYTTLCALTFHDVFKAGASYYGVS  522

Query  366  DLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL+ L +   KFES Y+D L+      ++ Y  RSPI+  D+ +CPII FQGL D+VVPP
Sbjct  523  DLEALANDTHKFESRYLDGLIAPYPEGRDLYIARSPIHHSDRLNCPIIFFQGLQDQVVPP  582

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA K+ Q L+AKGL V  V +
Sbjct  583  NQAEKMVQVLQAKGLTVEYVTF  604



>gb|AFY37068.1| WD40-like beta Propeller containing protein [Leptolyngbya sp. 
PCC 7376]
Length=655

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 149/203 (73%), Gaps = 4/203 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A ++  PPLL+KSHGGPTA A  SL+L IQYWTSRG+A VDVNYGGSTGYG ++ +RL  
Sbjct  410  APENAVPPLLVKSHGGPTAMAGSSLSLRIQYWTSRGFAFVDVNYGGSTGYGSKYHQRLDG  469

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+LV+ G  D E+L I G SAGGYTTLAAL F D F AG S YGI 
Sbjct  470  NWGIVDVQDCVNVAKYLVEKGLADSEKLAIAGGSAGGYTTLAALTFYDTFNAGASYYGIS  529

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFE+ Y+D L+G    +K+ Y  RSPI+F +K SCP I FQGL+DKVVPP
Sbjct  530  DLEVLATDTHKFEARYLDRLIGKYPEEKDKYVARSPIHFTEKLSCPAIFFQGLEDKVVPP  589

Query  534  EQARKIYQALKAKGLPVALVEYE  602
             QA  +  A+KAKGLPVA V +E
Sbjct  590  NQAEMMVDAIKAKGLPVAYVPFE  612



>ref|WP_015220478.1| peptidase S9 prolyl oligopeptidase active site domain-containing 
protein [Cyanobacterium aponinum]
 gb|AFZ54755.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Cyanobacterium aponinum PCC 10605]
Length=630

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 150/202 (74%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A + E PPLL+KSHGGPTA    S NL IQYWTSRG+A VDVNYGGSTGYGR++R+RL  
Sbjct  398  APEGELPPLLVKSHGGPTAMTSASYNLRIQYWTSRGFAFVDVNYGGSTGYGRDYRQRLKG  457

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + A++LV  G+VDG++L I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  458  NWGIVDVEDCVNVAQYLVKEGKVDGDKLAISGGSAGGYTTLAALTFFDTFKAGASYYGVS  517

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL++L     KFES Y+D+L+G    +K  Y  RSP+  +DK SCP+I FQGL+DKVVPP
Sbjct  518  DLEILATDTHKFESRYLDSLIGKYPEEKEIYQMRSPLYHIDKLSCPVIFFQGLEDKVVPP  577

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  +Y ALK KG+  + + +
Sbjct  578  NQAEMMYNALKEKGIKTSYITF  599



>ref|WP_006669487.1| peptidase [Arthrospira maxima]
 gb|EDZ94240.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Arthrospira maxima CS-328]
Length=636

 Score =   254 bits (648),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 146/202 (72%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   EKPPLL+KSHGGPTA    SLNL IQYWTSRG+A++DVNYGGSTGYGRE+R+RL  
Sbjct  403  APDTEKPPLLVKSHGGPTAATSSSLNLKIQYWTSRGFAVLDVNYGGSTGYGREYRQRLQG  462

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AKFL   G VDG+R+ I G SAGGYTTL AL F DVFKAG S YG+ 
Sbjct  463  NWGIVDVADCVNGAKFLAAQGLVDGDRMAIAGGSAGGYTTLCALTFHDVFKAGASYYGVS  522

Query  366  DLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL+ L     KFES Y+D L+      ++ Y  RSPI+  D+ +CPII FQGL DKVVPP
Sbjct  523  DLEALATDTHKFESRYLDGLIAPYPEGRDLYIARSPIHHSDRLNCPIIFFQGLQDKVVPP  582

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA K+ Q L+AKGL V  V +
Sbjct  583  NQAEKMVQVLQAKGLTVEYVTF  604



>ref|WP_006623627.1| peptidase [Arthrospira platensis]
 gb|EKD08529.1| peptidase S9 [Arthrospira platensis C1]
Length=636

 Score =   254 bits (648),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 146/202 (72%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   EKPPLL+KSHGGPTA    SLNL IQYWTSRG+A++DVNYGGSTGYGRE+R+RL  
Sbjct  403  APDTEKPPLLVKSHGGPTAATSSSLNLKIQYWTSRGFAVLDVNYGGSTGYGREYRQRLQG  462

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AKFL   G VDG+R+ I G SAGGYTTL AL F DVFKAG S YG+ 
Sbjct  463  NWGIVDVADCVNGAKFLAAQGLVDGDRMAIAGGSAGGYTTLCALTFHDVFKAGASYYGVS  522

Query  366  DLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL+ L     KFES Y+D L+      ++ Y  RSPI+  D+ +CPII FQGL DKVVPP
Sbjct  523  DLEALATDTHKFESRYLDGLIAPYPEGRDLYIARSPIHHSDRLNCPIIFFQGLQDKVVPP  582

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA K+ Q L+AKGL V  V +
Sbjct  583  NQAEKMVQVLQAKGLTVEYVTF  604



>ref|WP_040942946.1| peptidase [Prochloron didemni]
Length=634

 Score =   253 bits (647),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 148/196 (76%), Gaps = 4/196 (2%)
 Frame = +3

Query  24   PPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGIVD  203
            PPLL+KSHGGPTA A  +LNL IQYWTSRG+ ++DVNYGGS+GYGR++R+RL  NWGIVD
Sbjct  404  PPLLVKSHGGPTAAASVNLNLKIQYWTSRGFGVLDVNYGGSSGYGRQYRQRLEGNWGIVD  463

Query  204  VNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKLLV  383
            V+DC + AK+LV+ G+VDG RL I GSSAGGYT LAAL F+DVF AG S YGI D+  LV
Sbjct  464  VDDCVNGAKYLVEQGKVDGTRLAIAGSSAGGYTALAALTFRDVFHAGASYYGISDIFALV  523

Query  384  DGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKI  551
                KFES Y+D LVG     K  Y  RSPI+F D+ SCPII FQGL+DKVVPP QA  +
Sbjct  524  RDTHKFESRYLDRLVGPYPEAKEVYEARSPIHFSDRLSCPIIFFQGLEDKVVPPNQAEMM  583

Query  552  YQALKAKGLPVALVEY  599
             + L+ KGL VA V +
Sbjct  584  VEQLQKKGLKVAYVAF  599



>ref|WP_026100806.1| peptidase [Synechococcus sp. PCC 7336]
Length=644

 Score =   254 bits (648),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 150/199 (75%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E+PPLL+KSHGGPTA    SL+  IQYWTSRGWA++DVNYGGSTGYG+ +RE+L   WG+
Sbjct  403  EQPPLLVKSHGGPTAATAASLDWRIQYWTSRGWAVLDVNYGGSTGYGQAYREQLKGQWGV  462

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DC + A +LV+ G  DG+RL I GSSAGGYTTLAAL F+DVFKAG S YG+ DL++
Sbjct  463  VDVDDCANGALYLVERGLADGDRLAIDGSSAGGYTTLAALTFRDVFKAGASYYGVSDLEV  522

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D+LVG     K  Y  RSPI+F D+ SCPII  QG +DK+VPP QA 
Sbjct  523  LARDTHKFESRYLDSLVGPYPEAKAVYEARSPIHFTDELSCPIIFLQGSEDKIVPPNQAE  582

Query  546  KIYQALKAKGLPVALVEYE  602
             + +AL+ KGLPVA V +E
Sbjct  583  LMVEALRVKGLPVAYVLFE  601



>ref|WP_017721873.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=644

 Score =   254 bits (648),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 150/199 (75%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPLL+KSHGGPTA A  SL+L IQYWTSRG+A++DVNYGGSTGYGR +R+RL   WG+
Sbjct  403  EKPPLLVKSHGGPTAAASSSLSLKIQYWTSRGFAVLDVNYGGSTGYGRAYRQRLDGQWGV  462

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            +DV DC S A++L + G  DG RL I+G SAGGYTTL AL F ++FKAG S YG+ DL+ 
Sbjct  463  IDVADCASGARYLAERGLADGSRLAISGGSAGGYTTLCALTFGNLFKAGASYYGVSDLEA  522

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFE+ Y+D L+G     K+ Y +RSPI+F D+ SCP+I FQGL+DKVVPP QA 
Sbjct  523  LAKDTHKFEARYLDRLIGPLPQGKDLYRQRSPIHFTDRLSCPLIFFQGLEDKVVPPSQAE  582

Query  546  KIYQALKAKGLPVALVEYE  602
             +  AL+AKGLPVA V +E
Sbjct  583  MMVAALRAKGLPVAYVAFE  601



>ref|WP_036004850.1| peptidase [Leptolyngbya sp. JSC-1]
Length=645

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 150/200 (75%), Gaps = 4/200 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A  DE+PPLL+KSHGGPTA    + + SIQYWTSRG A++DVNYGGSTGYGR +RERL +
Sbjct  398  APTDERPPLLVKSHGGPTAATSANFSPSIQYWTSRGIAVLDVNYGGSTGYGRAYRERLKK  457

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
             WGIVDV+DC + AK+LV+ G VDG RLCI G SAGGYTTLAAL F+DVF+AG S YG+ 
Sbjct  458  QWGIVDVDDCVNGAKYLVEQGLVDGNRLCIDGGSAGGYTTLAALTFRDVFRAGASYYGVS  517

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL+ L     KFES Y+D L+G    +   Y +RSPI+  D+ +CP+I FQG +DK+VPP
Sbjct  518  DLEALARDTHKFESRYLDGLIGQYPAEHQIYQQRSPIHHADQLNCPLIFFQGDEDKIVPP  577

Query  534  EQARKIYQALKAKGLPVALV  593
             QA ++ + L+ KGLPVA V
Sbjct  578  NQAERMVEILRQKGLPVAYV  597



>gb|ETX04100.1| peptidase [Candidatus Entotheonella sp. TSY2]
Length=638

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 150/199 (75%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E+PPL++KSHGGPT+ A  +LNL IQYWTSRG+A++DVNYGGSTGYGR +R+RL   WGI
Sbjct  397  ERPPLIVKSHGGPTSAAPTTLNLGIQYWTSRGFAVLDVNYGGSTGYGRAYRQRLNGQWGI  456

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV DC + A++LV+ G VDG RL ITG SAGGYTTL AL F D F  G S YGI DL+ 
Sbjct  457  VDVEDCANGARYLVERGDVDGNRLAITGGSAGGYTTLCALTFHDTFSVGASHYGISDLEA  516

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D+L+G     ++ Y  RSPI+F D+ SCP+ILFQGL+D+VVPP QA 
Sbjct  517  LAGETHKFESRYLDSLIGPYPEREDLYKARSPIHFTDRLSCPLILFQGLEDQVVPPNQAE  576

Query  546  KIYQALKAKGLPVALVEYE  602
             + QAL+ KGLPVA V +E
Sbjct  577  MMAQALRDKGLPVAYVPFE  595



>gb|ELS04882.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Xenococcus 
sp. PCC 7305]
Length=651

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 148/198 (75%), Gaps = 4/198 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E PPL +KSHGGPTA A  +L+L IQYWTSRG+  +DVNYGGS GYGR++R+RL  NWG+
Sbjct  409  ELPPLFVKSHGGPTAAASVNLSLRIQYWTSRGFGYLDVNYGGSIGYGRKYRQRLENNWGV  468

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VD++DC + A++L     VDGERL I+GSSAGGYTTLAAL F+D FKAG S YGI DL++
Sbjct  469  VDIDDCVNAAEYLAAQELVDGERLVISGSSAGGYTTLAALTFRDTFKAGASYYGISDLEI  528

Query  378  LVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D L+G    D+  Y  RSPI++ D+ SCP+I FQGL+DKVVPP QA 
Sbjct  529  LATDTHKFESRYLDRLIGKYPEDQEVYQARSPIHYTDQLSCPVIFFQGLEDKVVPPNQAE  588

Query  546  KIYQALKAKGLPVALVEY  599
             +  A+K KG+PVA + +
Sbjct  589  MMVDAIKQKGIPVAYITF  606



>ref|WP_040896678.1| peptidase [Xenococcus sp. PCC 7305]
Length=657

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 148/198 (75%), Gaps = 4/198 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E PPL +KSHGGPTA A  +L+L IQYWTSRG+  +DVNYGGS GYGR++R+RL  NWG+
Sbjct  415  ELPPLFVKSHGGPTAAASVNLSLRIQYWTSRGFGYLDVNYGGSIGYGRKYRQRLENNWGV  474

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VD++DC + A++L     VDGERL I+GSSAGGYTTLAAL F+D FKAG S YGI DL++
Sbjct  475  VDIDDCVNAAEYLAAQELVDGERLVISGSSAGGYTTLAALTFRDTFKAGASYYGISDLEI  534

Query  378  LVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D L+G    D+  Y  RSPI++ D+ SCP+I FQGL+DKVVPP QA 
Sbjct  535  LATDTHKFESRYLDRLIGKYPEDQEVYQARSPIHYTDQLSCPVIFFQGLEDKVVPPNQAE  594

Query  546  KIYQALKAKGLPVALVEY  599
             +  A+K KG+PVA + +
Sbjct  595  MMVDAIKQKGIPVAYITF  612



>ref|WP_017295790.1| hypothetical protein [Geminocystis herdmanii]
Length=629

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 146/202 (72%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A +D  PPLL+KSHGGPTA    S NL IQYWTSRG+A VDVNYGGSTGYGR++R+RL +
Sbjct  398  APEDTLPPLLVKSHGGPTAATTASYNLRIQYWTSRGFAFVDVNYGGSTGYGRDYRQRLNK  457

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVDV DC + AK+L   G VD  +L I+G SAGGYTTLAAL F D FKAG S YG+ 
Sbjct  458  NWGIVDVEDCINVAKYLAKQGEVDENKLAISGGSAGGYTTLAALTFYDTFKAGASYYGVS  517

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL+ L     KFES Y+DNL+G    +K  Y  RSPIN+++K SCP+  FQGL+DK+VPP
Sbjct  518  DLEALAKDTHKFESRYLDNLIGKYPEEKAIYQARSPINYIEKLSCPVAFFQGLEDKIVPP  577

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +AL+ KG+    V +
Sbjct  578  NQAEMMVKALEKKGIKTLYVTF  599



>gb|EMS65046.1| Dipeptidyl peptidase family member 6 [Triticum urartu]
Length=609

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 147/210 (70%), Gaps = 44/210 (21%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HG                                  YGRE+RERLL
Sbjct  389  QGLPDEKPPLLVKTHG----------------------------------YGREYRERLL  414

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYG-  359
              WGIVDV+DCCSCA+FLV+SG VD +RLCITG SAGGYTTLA+LAF+D FKAG SLYG 
Sbjct  415  GKWGIVDVDDCCSCARFLVESGSVDEQRLCITGRSAGGYTTLASLAFRDTFKAGASLYGL  474

Query  360  ---------IGDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGL  512
                     IGDL L+     K++SHYIDNLVGD+ AY+ERSPINFV+KF+CP+ILFQGL
Sbjct  475  IPNNSGMVAIGDLSLMRADSQKYDSHYIDNLVGDERAYYERSPINFVNKFTCPVILFQGL  534

Query  513  DDKVVPPEQARKIYQALKAKGLPVALVEYE  602
            DDKVVPP QARKIYQALK +GLPVALVEYE
Sbjct  535  DDKVVPPNQARKIYQALKKRGLPVALVEYE  564



>ref|WP_036802276.1| peptidase [Planomicrobium glaciei]
 gb|ETP70499.1| hypothetical protein G159_01750 [Planomicrobium glaciei CHR43]
Length=643

 Score =   251 bits (642),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 146/199 (73%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPL++  HGGPT+ A  +LNL  QYWTSRG+A+VDVNYGGSTGYGRE+RERL  NWGI
Sbjct  400  EKPPLIVTVHGGPTSAATSALNLEFQYWTSRGFAVVDVNYGGSTGYGREYRERLKGNWGI  459

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV D  +  K+LV+ G VDG R  I G SAGGYTTLA+L F DV++AG S +GI +L++
Sbjct  460  VDVEDSANAVKYLVEQGEVDGNRAVIVGGSAGGYTTLASLVFTDVYRAGASYFGISELEV  519

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
              +   KFES Y D L+G     K  Y++RSPINF D+ SCPII  QGL+DK+VPP QA 
Sbjct  520  FTNETHKFESRYADGLIGPFPEAKQVYYDRSPINFTDQLSCPIIFLQGLEDKIVPPNQAE  579

Query  546  KIYQALKAKGLPVALVEYE  602
             +  AL+ KGLPVA + +E
Sbjct  580  LMVDALRKKGLPVAYLVFE  598



>gb|EMT17749.1| Dipeptidyl peptidase family member 6 [Aegilops tauschii]
Length=646

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 147/210 (70%), Gaps = 44/210 (21%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HG                                  YGRE+RERLL
Sbjct  426  QGLPDEKPPLLVKTHG----------------------------------YGREYRERLL  451

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYG-  359
              WGIVDV+DCCSCA+FLV+SG VD +RLCITG SAGGYTTLA+LAF+D FKAG SLYG 
Sbjct  452  GKWGIVDVDDCCSCARFLVESGSVDEQRLCITGRSAGGYTTLASLAFRDTFKAGASLYGL  511

Query  360  ---------IGDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGL  512
                     IGDL L+     K++SHYIDNLVGD+ AY+ERSPINFV+KF+CP+ILFQGL
Sbjct  512  IPNNSGMVSIGDLSLMRADSQKYDSHYIDNLVGDERAYYERSPINFVNKFTCPVILFQGL  571

Query  513  DDKVVPPEQARKIYQALKAKGLPVALVEYE  602
            DDKVVPP QARKIYQALK +GLPVALVEYE
Sbjct  572  DDKVVPPNQARKIYQALKERGLPVALVEYE  601



>ref|XP_002288241.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED93677.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=662

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 149/200 (75%), Gaps = 4/200 (2%)
 Frame = +3

Query  15   DEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWG  194
            D+ PPLL+K+HGGPTA    S N  IQYWTSRG+A++DV+Y GSTGYGR++R RL ++WG
Sbjct  420  DKAPPLLVKAHGGPTACTGTSFNAGIQYWTSRGFAILDVDYSGSTGYGRDYRRRLKKSWG  479

Query  195  IVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLK  374
            +VD++D C+ A++LV  G  DGERLCI G SAGGYTTL ALAF+DVFKAGCS+YGIGDL 
Sbjct  480  VVDIDDVCAGAEYLVKEGLADGERLCIDGGSAGGYTTLGALAFRDVFKAGCSMYGIGDLT  539

Query  375  LLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             L     KFES Y+D LVG    ++  Y +RSPI  VD  SCPI+L QG++DKVVPP QA
Sbjct  540  ALAGDTHKFESRYLDGLVGAYPEEEELYKQRSPIESVDTLSCPILLLQGVEDKVVPPNQA  599

Query  543  RKIYQALKAKGLPVALVEYE  602
              ++ AL  KG+P  L  YE
Sbjct  600  EMMHHALLKKGIPTCLKMYE  619



>ref|WP_041425842.1| peptidase [Synechocystis sp. PCC 6803]
Length=634

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 146/199 (73%), Gaps = 4/199 (2%)
 Frame = +3

Query  15   DEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWG  194
            D  PPLL+KSHGGPTA A  SL+L IQYWTSRG+A VDVNYGGSTGYGR++R+RL   WG
Sbjct  401  DALPPLLVKSHGGPTAAAGNSLSLKIQYWTSRGFAYVDVNYGGSTGYGRDYRQRLNGQWG  460

Query  195  IVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLK  374
            IVDV DC + A++L D G VDGE+L I+G SAGGYTTLAAL F +VFKAG S YG+ DL 
Sbjct  461  IVDVADCVNAARYLADQGLVDGEQLAISGGSAGGYTTLAALTFHNVFKAGASYYGVSDLT  520

Query  375  LLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             L     KFE+ Y+D L+G     K+ Y  RSP+N  D+ +CP+I FQGL+DKVVPP Q 
Sbjct  521  ALATDTHKFEARYLDGLIGPYPERKDLYERRSPVNHADQLTCPVIFFQGLEDKVVPPNQT  580

Query  543  RKIYQALKAKGLPVALVEY  599
              + QALKAKG+ V  V +
Sbjct  581  EMMVQALKAKGIKVEYVAF  599



>ref|WP_010873735.1| peptidase [Synechocystis sp. PCC 6803]
 ref|NP_442437.1| hypothetical protein slr0825 [Synechocystis sp. PCC 6803]
 dbj|BAA10507.1| slr0825 [Synechocystis sp. PCC 6803]
 dbj|BAK51293.1| hypothetical protein SYNGTS_2545 [Synechocystis sp. PCC 6803]
 dbj|BAL30291.1| hypothetical protein SYNGTI_2544 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL33460.1| hypothetical protein SYNPCCN_2543 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL36629.1| hypothetical protein SYNPCCP_2543 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM53897.1| hypothetical protein BEST7613_4966 [Bacillus subtilis BEST7613]
 gb|AGF52799.1| hypothetical protein MYO_125700 [Synechocystis sp. PCC 6803]
Length=637

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 146/199 (73%), Gaps = 4/199 (2%)
 Frame = +3

Query  15   DEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWG  194
            D  PPLL+KSHGGPTA A  SL+L IQYWTSRG+A VDVNYGGSTGYGR++R+RL   WG
Sbjct  404  DALPPLLVKSHGGPTAAAGNSLSLKIQYWTSRGFAYVDVNYGGSTGYGRDYRQRLNGQWG  463

Query  195  IVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLK  374
            IVDV DC + A++L D G VDGE+L I+G SAGGYTTLAAL F +VFKAG S YG+ DL 
Sbjct  464  IVDVADCVNAARYLADQGLVDGEQLAISGGSAGGYTTLAALTFHNVFKAGASYYGVSDLT  523

Query  375  LLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             L     KFE+ Y+D L+G     K+ Y  RSP+N  D+ +CP+I FQGL+DKVVPP Q 
Sbjct  524  ALATDTHKFEARYLDGLIGPYPERKDLYERRSPVNHADQLTCPVIFFQGLEDKVVPPNQT  583

Query  543  RKIYQALKAKGLPVALVEY  599
              + QALKAKG+ V  V +
Sbjct  584  EMMVQALKAKGIKVEYVAF  602



>ref|WP_012594079.1| peptidase [Cyanothece sp. PCC 8801]
 gb|ACK64803.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Cyanothece sp. PCC 8801]
Length=644

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 151/198 (76%), Gaps = 4/198 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E PPLL+KSHGGPTA A  S NL +QYWTSRG+  +DVNYGGSTG+GRE+R+RL   WG+
Sbjct  402  ELPPLLVKSHGGPTACASPSFNLRLQYWTSRGFGYLDVNYGGSTGFGREYRQRLDGKWGL  461

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DC + AK+LV+ G VDG+RL I+G SAGGYTTLAAL F+D FKAG S YGI DL+ 
Sbjct  462  VDVDDCINGAKYLVEHGLVDGDRLAISGGSAGGYTTLAALTFRDTFKAGASYYGISDLEA  521

Query  378  LVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y++ L+G    +K  Y +RSPI+F ++ +CP+I FQGL+DKVVPP QA 
Sbjct  522  LAKDTHKFESRYLERLIGKYPEEKEIYQQRSPIHFTEQLTCPVIFFQGLEDKVVPPSQAC  581

Query  546  KIYQALKAKGLPVALVEY  599
            ++ + LK KGLPVA V +
Sbjct  582  QMVEILKKKGLPVAYVPF  599



>ref|WP_041419291.1| peptidase [Simkania negevensis]
Length=646

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 150/201 (75%), Gaps = 4/201 (2%)
 Frame = +3

Query  12   QDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNW  191
            Q+EKPPL++KSHGGP+A +  SL+L IQ+WTSRG+A +DVNYGGSTGYGR +RERL  NW
Sbjct  401  QNEKPPLIVKSHGGPSAHSTASLSLEIQFWTSRGFAFLDVNYGGSTGYGRAYRERLKSNW  460

Query  192  GIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDL  371
            G+VDV+DC + A +LV  G+VD +RL I G SAGGYTTLAAL F+DVFKAG S YG+ DL
Sbjct  461  GVVDVDDCTNGALYLVKLGKVDPKRLAIRGGSAGGYTTLAALTFRDVFKAGASYYGVSDL  520

Query  372  KLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQ  539
              + D   KFES Y+D LVG     K  Y + SPI  ++  SCP+IL QG +DK+VPP Q
Sbjct  521  IAMTDDTHKFESRYLDGLVGKYPEQKKRYIQYSPIYHIENLSCPVILLQGAEDKIVPPNQ  580

Query  540  ARKIYQALKAKGLPVALVEYE  602
            +  +++ALK KG+P + + +E
Sbjct  581  SEMMFEALKKKGIPTSYLLFE  601



>ref|WP_015783291.1| peptidase [Cyanothece sp. PCC 8802]
 gb|ACU99686.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Cyanothece sp. PCC 8802]
Length=644

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 151/198 (76%), Gaps = 4/198 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E PPLL+KSHGGPTA A  S NL +QYWTSRG+  +DVNYGGSTG+GRE+R+RL   WG+
Sbjct  402  ELPPLLVKSHGGPTACASPSFNLRLQYWTSRGFGYLDVNYGGSTGFGREYRQRLDGKWGL  461

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DC + AK+LV+ G VDG+RL I+G SAGGYTTLAAL F+D FKAG S YGI DL+ 
Sbjct  462  VDVDDCINGAKYLVEHGLVDGDRLAISGGSAGGYTTLAALTFRDTFKAGASYYGISDLEA  521

Query  378  LVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y++ L+G    +K  Y +RSPI+F ++ +CP+I FQGL+DKVVPP QA 
Sbjct  522  LAKDTHKFESRYLERLIGKYPEEKEIYQQRSPIHFTEQLTCPVIFFQGLEDKVVPPSQAC  581

Query  546  KIYQALKAKGLPVALVEY  599
            ++ + LK KGLPVA V +
Sbjct  582  QMVEILKKKGLPVAYVPF  599



>emb|CCB88935.1| peptidase S9, prolyl oligopeptidase active site region [Simkania 
negevensis Z]
Length=663

 Score =   249 bits (637),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 150/201 (75%), Gaps = 4/201 (2%)
 Frame = +3

Query  12   QDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNW  191
            Q+EKPPL++KSHGGP+A +  SL+L IQ+WTSRG+A +DVNYGGSTGYGR +RERL  NW
Sbjct  418  QNEKPPLIVKSHGGPSAHSTASLSLEIQFWTSRGFAFLDVNYGGSTGYGRAYRERLKSNW  477

Query  192  GIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDL  371
            G+VDV+DC + A +LV  G+VD +RL I G SAGGYTTLAAL F+DVFKAG S YG+ DL
Sbjct  478  GVVDVDDCTNGALYLVKLGKVDPKRLAIRGGSAGGYTTLAALTFRDVFKAGASYYGVSDL  537

Query  372  KLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQ  539
              + D   KFES Y+D LVG     K  Y + SPI  ++  SCP+IL QG +DK+VPP Q
Sbjct  538  IAMTDDTHKFESRYLDGLVGKYPEQKKRYIQYSPIYHIENLSCPVILLQGAEDKIVPPNQ  597

Query  540  ARKIYQALKAKGLPVALVEYE  602
            +  +++ALK KG+P + + +E
Sbjct  598  SEMMFEALKKKGIPTSYLLFE  618



>ref|WP_006457709.1| peptidase [Synechococcus sp. PCC 7335]
 gb|EDX87880.1| peptidase, S9A/B/C family, catalytic domain protein [Synechococcus 
sp. PCC 7335]
Length=651

 Score =   249 bits (635),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 151/204 (74%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            +A   E+PPLL+K+HGGPTA A  +LN SIQYWTSRG+A++DVNYGGS+GYGR +R RL 
Sbjct  400  EASVTERPPLLVKTHGGPTASASSALNPSIQYWTSRGFAVLDVNYGGSSGYGRAYRNRLQ  459

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            + WGIVDV+D  + A +LV+ G+ D +RL I G SAGGYTTLA L F+DVFKAG S YG+
Sbjct  460  KRWGIVDVDDAVNGALYLVEQGKADRDRLAIDGGSAGGYTTLATLTFRDVFKAGASYYGV  519

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             D+  L     KFES Y+D+LVG    +K+ Y  RSPIN VD+ SCPII FQG +D++VP
Sbjct  520  SDMSSLAAETHKFESRYLDSLVGPYPAEKSVYEARSPINAVDQLSCPIIFFQGSEDRIVP  579

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P QA  +  ALK KG+PVA + +E
Sbjct  580  PNQAETMVNALKQKGIPVAYLLFE  603



>gb|EJK62844.1| hypothetical protein THAOC_16526 [Thalassiosira oceanica]
Length=675

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 148/203 (73%), Gaps = 6/203 (3%)
 Frame = +3

Query  12   QDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNW  191
             D  PPLL+K+HGGPTA    S N  +Q+WTSRG+A++DV+YGGSTGYGR++R RL  +W
Sbjct  430  SDGAPPLLVKAHGGPTACTGTSFNAGLQFWTSRGYAILDVDYGGSTGYGRDYRRRLRGSW  489

Query  192  GIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDL  371
            GIVD++D C+ A++LV+ G  DG+RLCI G SAGGYTTL ALAFKDVFKAGCSLYG+ DL
Sbjct  490  GIVDIDDVCAGARYLVEKGLADGDRLCIDGGSAGGYTTLGALAFKDVFKAGCSLYGVADL  549

Query  372  KLLVDGMPKFESHYIDNLVG------DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
              L     KFES Y+D LVG      DK  Y +RSPI  VD  +CPI+L QG +DK+VPP
Sbjct  550  SALAADTHKFESRYLDGLVGPYKTDEDKELYKKRSPIESVDTLNCPILLLQGAEDKIVPP  609

Query  534  EQARKIYQALKAKGLPVALVEYE  602
             QA  ++ AL  KG+P AL  YE
Sbjct  610  NQAELMHDALLKKGIPTALKMYE  632



>ref|WP_015165554.1| peptidase S9, prolyl oligopeptidase active site region [Pseudanabaena 
sp. PCC 7367]
 gb|AFY70598.1| peptidase S9, prolyl oligopeptidase active site region [Pseudanabaena 
sp. PCC 7367]
Length=653

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 149/204 (73%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA   EKPPL+++SHGGPTA    +L+L IQYWTSRG+A++DVNYGGSTGYGR++R+RL 
Sbjct  407  QAPATEKPPLIVRSHGGPTAATSNALSLKIQYWTSRGFAVLDVNYGGSTGYGRKYRQRLN  466

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVD++DC + AK+L D   VD ER+ I G S+GGYTTLAAL F+DVFKAG   YG+
Sbjct  467  GKWGIVDIDDCINGAKYLADRQLVDPERMAIVGGSSGGYTTLAALTFRDVFKAGAVYYGV  526

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL++L     KFES Y+D++VG     K  Y  RSPI+ VD+ +CP+I FQG +DK+ P
Sbjct  527  SDLEILAKETHKFESRYLDSIVGAYPEQKAIYEARSPIHHVDQLACPVIFFQGAEDKITP  586

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P Q   +  A+K KG+PVA V YE
Sbjct  587  PNQTEMMVTAIKQKGIPVAYVLYE  610



>dbj|BAL52988.1| peptidase, S9A/B/C family, catalytic domain protein [uncultured 
Acetothermia bacterium]
 dbj|BAL60160.1| peptidase S9A/B/C family, catalytic domain protein [Candidatus 
Acetothermus autotrophicum]
Length=647

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 149/204 (73%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA   EKPPLL+ SHGGPT+    +L L IQ+WTSRG+A+VDVNYGGSTGYGRE+RERL 
Sbjct  401  QAPPGEKPPLLVFSHGGPTSATTSTLKLEIQFWTSRGFAVVDVNYGGSTGYGREYRERLK  460

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WG+VDV DC + AK+LV  G VDGER+ I G SAGGYTTL AL F+  FKAG S +G+
Sbjct  461  GQWGVVDVADCVNAAKYLVQQGLVDGERVAIRGGSAGGYTTLCALTFRKFFKAGASYFGV  520

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL+ L     KFES Y  +L+G     ++ Y+ RSPI+F D+ SCP+I FQGL+D+VVP
Sbjct  521  SDLEALDKDTHKFESRYNRSLIGPYPEQRDLYYARSPIHFADRISCPVIFFQGLEDRVVP  580

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P Q+  + +AL+ KG+PVA + +E
Sbjct  581  PSQSEMMVEALRKKGIPVAYIAFE  604



>dbj|BAL56300.1| peptidase, S9A/B/C family, catalytic domain protein [uncultured 
Acetothermia bacterium]
Length=647

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 149/204 (73%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA   EKPPLL+ SHGGPT+    +L L IQ+WTSRG+A+VDVNYGGSTGYGRE+RERL 
Sbjct  401  QAPPGEKPPLLVFSHGGPTSATTSTLKLEIQFWTSRGFAVVDVNYGGSTGYGREYRERLK  460

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WG+VDV DC + AK+LV  G VDGER+ I G SAGGYTTL AL F+  FKAG S +G+
Sbjct  461  GQWGVVDVADCVNAAKYLVQQGLVDGERVAIRGGSAGGYTTLCALTFRKFFKAGASYFGV  520

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             DL+ L     KFES Y  +L+G     ++ Y+ RSPI+F D+ SCP+I FQGL+D+VVP
Sbjct  521  SDLEALDKDTHKFESRYNRSLIGPYPEQRDLYYARSPIHFADRISCPVIFFQGLEDRVVP  580

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P Q+  + +AL+ KG+PVA + +E
Sbjct  581  PSQSEMMVEALRKKGIPVAYIAFE  604



>ref|WP_040289833.1| peptidase [Alicyclobacillus hesperidum]
Length=643

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 148/200 (74%), Gaps = 4/200 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E+PPLL+ SHGGPT+ AR    LSIQYWT+RG+ ++DVNYGGSTGYGR++RERL  
Sbjct  396  APASERPPLLVMSHGGPTSAARPVYKLSIQYWTTRGFGVLDVNYGGSTGYGRKYRERLAG  455

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
             WGIVD++DCC  A +LV+ G VD +RLCITG SAGGYTTLA LAF+D+F+ G S YG+ 
Sbjct  456  QWGIVDLDDCCQGALYLVERGDVDRDRLCITGGSAGGYTTLAVLAFRDLFRVGASHYGVS  515

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL LL     KFES YI+ LVG    ++  +  RSP+  VD+F+CP I FQG DDKVVPP
Sbjct  516  DLALLAKETHKFESRYIEQLVGRYPEERERFVARSPLQHVDQFACPAIFFQGEDDKVVPP  575

Query  534  EQARKIYQALKAKGLPVALV  593
             QA  + +ALK KG+PVA +
Sbjct  576  NQAELMVEALKRKGVPVAYL  595



>gb|EJY55338.1| peptidase S9 prolyl oligopeptidase active site domain-containing 
protein [Alicyclobacillus hesperidum URH17-3-68]
Length=648

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 148/200 (74%), Gaps = 4/200 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A   E+PPLL+ SHGGPT+ AR    LSIQYWT+RG+ ++DVNYGGSTGYGR++RERL  
Sbjct  401  APASERPPLLVMSHGGPTSAARPVYKLSIQYWTTRGFGVLDVNYGGSTGYGRKYRERLAG  460

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
             WGIVD++DCC  A +LV+ G VD +RLCITG SAGGYTTLA LAF+D+F+ G S YG+ 
Sbjct  461  QWGIVDLDDCCQGALYLVERGDVDRDRLCITGGSAGGYTTLAVLAFRDLFRVGASHYGVS  520

Query  366  DLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL LL     KFES YI+ LVG    ++  +  RSP+  VD+F+CP I FQG DDKVVPP
Sbjct  521  DLALLAKETHKFESRYIEQLVGRYPEERERFVARSPLQHVDQFACPAIFFQGEDDKVVPP  580

Query  534  EQARKIYQALKAKGLPVALV  593
             QA  + +ALK KG+PVA +
Sbjct  581  NQAELMVEALKRKGVPVAYL  600



>ref|WP_012629326.1| peptidase [Cyanothece sp. PCC 7425]
 gb|ACL46274.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Cyanothece sp. PCC 7425]
Length=646

 Score =   246 bits (628),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 146/198 (74%), Gaps = 4/198 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E PPL++KSHGGPTA +    NLSIQYWTSRG+ALVDVNY GSTGYGR +R+ L   WGI
Sbjct  404  ELPPLIVKSHGGPTAASSTVFNLSIQYWTSRGFALVDVNYRGSTGYGRAYRQSLQGQWGI  463

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV DC   A++LV+ G VDG+RL I GSSAGGYTTLAAL F D FKAG S YG+ DL+ 
Sbjct  464  VDVADCVKAAEYLVEQGWVDGDRLIIRGSSAGGYTTLAALTFTDRFKAGASYYGVSDLEA  523

Query  378  LVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFE+ Y+D L+     ++  Y +RSP++F+D+ +CP+I FQGL+DKVVPP QA 
Sbjct  524  LARDTHKFEARYLDGLIAPYPQERAIYQQRSPLHFIDQLNCPVIFFQGLEDKVVPPNQAE  583

Query  546  KIYQALKAKGLPVALVEY  599
             +  AL AKG+PVA V +
Sbjct  584  VMVNALAAKGIPVAYVPF  601



>gb|EIE90466.1| hypothetical protein RO3G_15177 [Rhizopus delemar RA 99-880]
Length=660

 Score =   246 bits (628),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 145/197 (74%), Gaps = 4/197 (2%)
 Frame = +3

Query  24   PPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGIVD  203
            PP+ + SHGGPTA+A    + S QYWTSRG+AL DVNYGGS+GYGR++R RL++ WGIVD
Sbjct  419  PPVRVLSHGGPTAQATNEYSRSYQYWTSRGFALADVNYGGSSGYGRKYRNRLIKQWGIVD  478

Query  204  VNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKLLV  383
            V+DCC+ A +L + G VD E+L I G SAGG+TTLA++AF+DVFKAGC  YGI D+ LL 
Sbjct  479  VDDCCNAALYLAEQGLVDREKLAIEGGSAGGFTTLASVAFRDVFKAGCCKYGISDITLLA  538

Query  384  DGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKI  551
                KFES Y D L+G    DK  Y ERSP+   DK +CP+I FQG DDKVVPP Q+  +
Sbjct  539  KETHKFESRYPDRLIGEYPKDKAVYEERSPLFSADKITCPVIFFQGADDKVVPPSQSEIM  598

Query  552  YQALKAKGLPVALVEYE  602
             QALK KG+PVA V YE
Sbjct  599  VQALKKKGIPVAYVLYE  615



>emb|CEI99384.1| hypothetical protein RMCBS344292_13474 [Rhizopus microsporus]
Length=656

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 142/197 (72%), Gaps = 4/197 (2%)
 Frame = +3

Query  24   PPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGIVD  203
            PPL + SHGGPT  A  + N S QYWTSRG+ALVDVNYGGSTGYGRE+R RL + WG+VD
Sbjct  414  PPLRVVSHGGPTTRATNAFNRSYQYWTSRGFALVDVNYGGSTGYGREYRNRLQKRWGVVD  473

Query  204  VNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKLLV  383
            V+DCC+ A +L D G VD  +L I G SAGG+TTLA+LAF+DVFKAGC  YGI D+ LL 
Sbjct  474  VDDCCNAALYLADQGLVDRNKLSIVGGSAGGFTTLASLAFRDVFKAGCCKYGISDITLLA  533

Query  384  DGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKI  551
                KFES Y D L+G    D+  Y ERSP+   DK  CP+I FQG +DKVVPP Q+  +
Sbjct  534  KETHKFESRYPDRLIGEYPKDEEIYKERSPLFSADKIDCPVIFFQGSEDKVVPPSQSEIM  593

Query  552  YQALKAKGLPVALVEYE  602
             +ALK KGLPVA V YE
Sbjct  594  VKALKEKGLPVAYVLYE  610



>emb|CEG83092.1| hypothetical protein RMATCC62417_17066 [Rhizopus microsporus]
Length=617

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 143/197 (73%), Gaps = 4/197 (2%)
 Frame = +3

Query  24   PPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGIVD  203
            PPL + SHGGPT++   + N S QYWTSRG+ALVDVNYGGS+GYGRE+R RL + WGIVD
Sbjct  414  PPLRVVSHGGPTSQTTNAFNRSYQYWTSRGFALVDVNYGGSSGYGREYRNRLQKKWGIVD  473

Query  204  VNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKLLV  383
            V+DCC+ A +L D G VD  +L I G SAGG+TTLA+LAF+DVFKAGC  YGI D+ LL 
Sbjct  474  VDDCCNAALYLADQGLVDRNKLSIVGGSAGGFTTLASLAFRDVFKAGCCKYGISDITLLA  533

Query  384  DGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKI  551
                KFES Y D L+G    D+  Y ERSP+   DK  CP+I FQG +DKVVPP Q+  +
Sbjct  534  KETHKFESRYPDRLIGEYPKDEEIYKERSPLFSADKIDCPVIFFQGSEDKVVPPSQSEIM  593

Query  552  YQALKAKGLPVALVEYE  602
             +ALK KGLPVA V YE
Sbjct  594  VKALKEKGLPVAYVLYE  610



>emb|CEI94449.1| hypothetical protein RMCBS344292_08659 [Rhizopus microsporus]
Length=617

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 142/197 (72%), Gaps = 4/197 (2%)
 Frame = +3

Query  24   PPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGIVD  203
            PPL + SHGGPT  A  + N S QYWTSRG+ALVDVNYGGSTGYGRE+R RL + WGIVD
Sbjct  414  PPLRVVSHGGPTTRATNAFNRSYQYWTSRGFALVDVNYGGSTGYGREYRNRLQKKWGIVD  473

Query  204  VNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKLLV  383
            V+DCC+ A +L D G VD  +L I G SAGG+TTLA+LAF++VFKAGC  YGI D+ LL 
Sbjct  474  VDDCCNAALYLADQGLVDRNKLSIVGGSAGGFTTLASLAFRNVFKAGCCKYGISDITLLA  533

Query  384  DGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKI  551
                KFES Y D L+G    D+  Y ERSP+   DK  CP+I FQG +DKVVPP Q+  +
Sbjct  534  KETHKFESRYPDRLIGEYPKDEEIYKERSPLFSADKIDCPVIFFQGSEDKVVPPSQSEIM  593

Query  552  YQALKAKGLPVALVEYE  602
             +ALK KGLPVA V YE
Sbjct  594  VKALKEKGLPVAYVLYE  610



>ref|WP_040629387.1| peptidase [Microbulbifer variabilis]
Length=643

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 146/202 (72%), Gaps = 4/202 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A + +KPPL++ SHGGPT      LNL +QYWTSRG+A++DVNY GSTGYGRE+R+RL  
Sbjct  398  APEGDKPPLIVFSHGGPTGATSAGLNLKVQYWTSRGFAILDVNYSGSTGYGREYRDRLTD  457

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
             WGI DV D C+ A++LVD G  D ERL I G SAGGYT LAAL + D FKAG S YGIG
Sbjct  458  KWGIYDVEDVCAGAEYLVDRGLADPERLLIKGGSAGGYTVLAALTYHDTFKAGASHYGIG  517

Query  366  DLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            +L  L     KFES Y+D LVG     ++ Y+ERSPIN V++ SCP+I FQG++DKVVPP
Sbjct  518  ELSSLAKDTHKFESRYLDKLVGPWPSAEHIYYERSPINHVEQLSCPVIFFQGMEDKVVPP  577

Query  534  EQARKIYQALKAKGLPVALVEY  599
             QA  + +ALK +G+PV+ + +
Sbjct  578  NQAETMVKALKERGIPVSYITF  599



>gb|EMS57875.1| Acylamino-acid-releasing enzyme [Triticum urartu]
Length=697

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 146/210 (70%), Gaps = 44/210 (21%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q   DEKPPLL+K+HG                                  YGRE+RERLL
Sbjct  458  QGLPDEKPPLLVKTHG----------------------------------YGREYRERLL  483

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYG-  359
               GIVDV+DCCSCA+FLV+SG VD +RLCITG SAGGYTTLA+LAF+D FKAG SLYG 
Sbjct  484  GKSGIVDVDDCCSCARFLVESGSVDEQRLCITGRSAGGYTTLASLAFRDTFKAGASLYGL  543

Query  360  ---------IGDLKLLVDGMPKFESHYIDNLVGDKNAYFERSPINFVDKFSCPIILFQGL  512
                     IGDL L+     K++SHYIDNLVGD+ AY+ERSPINFV+KF+CP+ILFQGL
Sbjct  544  IPNNSGMVAIGDLSLMRADSQKYDSHYIDNLVGDERAYYERSPINFVNKFTCPVILFQGL  603

Query  513  DDKVVPPEQARKIYQALKAKGLPVALVEYE  602
            DDKVVPP QARKIYQALK +GLPVALVEYE
Sbjct  604  DDKVVPPNQARKIYQALKERGLPVALVEYE  633



>ref|WP_044076218.1| peptidase [Prochlorothrix hollandica]
Length=675

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 145/199 (73%), Gaps = 4/199 (2%)
 Frame = +3

Query  15   DEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWG  194
            DEKPPLL+KSHGGPTA  + SLNLSIQYWTSRG+ ++DVNYGGSTGYGR +RERL   WG
Sbjct  418  DEKPPLLVKSHGGPTAATKVSLNLSIQYWTSRGFGVLDVNYGGSTGYGRAYRERLKGQWG  477

Query  195  IVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLK  374
            IVDV DC + A ++V  G  DG+RL I G SAGGYTTL AL F DVF+AG S YG+ DL 
Sbjct  478  IVDVADCANGALYMVQRGDADGDRLAIDGGSAGGYTTLCALTFTDVFQAGASHYGVSDLT  537

Query  375  LLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             L +   KFES Y+D+LVG    +K  Y  RSP+    + +CP+I FQGL+DK+VPP Q 
Sbjct  538  ALAEDTHKFESRYLDSLVGPYPAEKALYEARSPLQKTQQLNCPVIFFQGLEDKIVPPNQT  597

Query  543  RKIYQALKAKGLPVALVEY  599
              +  ALKAKG+PVA V +
Sbjct  598  EMMVDALKAKGIPVAYVPF  616



>emb|CEG83091.1| hypothetical protein RMATCC62417_17066 [Rhizopus microsporus]
Length=656

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 143/197 (73%), Gaps = 4/197 (2%)
 Frame = +3

Query  24   PPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGIVD  203
            PPL + SHGGPT++   + N S QYWTSRG+ALVDVNYGGS+GYGRE+R RL + WGIVD
Sbjct  414  PPLRVVSHGGPTSQTTNAFNRSYQYWTSRGFALVDVNYGGSSGYGREYRNRLQKKWGIVD  473

Query  204  VNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKLLV  383
            V+DCC+ A +L D G VD  +L I G SAGG+TTLA+LAF+DVFKAGC  YGI D+ LL 
Sbjct  474  VDDCCNAALYLADQGLVDRNKLSIVGGSAGGFTTLASLAFRDVFKAGCCKYGISDITLLA  533

Query  384  DGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKI  551
                KFES Y D L+G    D+  Y ERSP+   DK  CP+I FQG +DKVVPP Q+  +
Sbjct  534  KETHKFESRYPDRLIGEYPKDEEIYKERSPLFSADKIDCPVIFFQGSEDKVVPPSQSEIM  593

Query  552  YQALKAKGLPVALVEYE  602
             +ALK KGLPVA V YE
Sbjct  594  VKALKEKGLPVAYVLYE  610



>ref|WP_028475474.1| peptidase [Nevskia ramosa]
Length=651

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 153/199 (77%), Gaps = 5/199 (3%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E+PPL++ SHGGPT++A  + N +IQ+WTSRG ++VDVNYGGS+GYGR++R RL  NWGI
Sbjct  406  ERPPLIVLSHGGPTSQATPTFNPAIQFWTSRGISVVDVNYGGSSGYGRDYRRRLNGNWGI  465

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKD-VFKAGCSLYGIGDLK  374
            VD++DC + AK+LV  G  DG+RL I G SAGGYTTL ALAF+  VFKAG S YG+GDL+
Sbjct  466  VDIDDCVNAAKYLVAQGLADGDRLAIRGGSAGGYTTLGALAFRPGVFKAGASYYGVGDLE  525

Query  375  LLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
            +L     KFES Y+D+LVG    +K  Y  RSPIN VDK +  +ILFQGLDDKVVPP Q+
Sbjct  526  VLARDTHKFESRYLDSLVGPYPAEKALYASRSPINSVDKIASALILFQGLDDKVVPPNQS  585

Query  543  RKIYQALKAKGLPVALVEY  599
            + ++ A+KAKGLPVA + +
Sbjct  586  QMMFDAVKAKGLPVAYLPF  604



>ref|WP_009556564.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ69654.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Oscillatoriales 
cyanobacterium JSC-12]
Length=642

 Score =   244 bits (622),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 146/203 (72%), Gaps = 4/203 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A  DE+PPLL+KSHGGPTA    +LNL IQYWTSRG+A++DVNY GSTGYGR +R+ L  
Sbjct  396  APADERPPLLVKSHGGPTASTSTALNLKIQYWTSRGFAVLDVNYRGSTGYGRAYRDALKG  455

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
             WGI DV+DC + A +LV+SG VDG+RL I G SAGGYTTL AL F+DVFKAG S YG+ 
Sbjct  456  QWGIADVDDCANGANYLVESGLVDGDRLVIDGGSAGGYTTLCALTFRDVFKAGASYYGVS  515

Query  366  DLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            DL+ L     KFES Y+D+L+G     K+ Y +RSPI+     +CP+I FQG +DKVVPP
Sbjct  516  DLEALATDTHKFESRYLDSLIGPYPERKDLYIQRSPIHATQLLNCPVIFFQGDEDKVVPP  575

Query  534  EQARKIYQALKAKGLPVALVEYE  602
             QA  +   L  KGLPVA V YE
Sbjct  576  NQAEMMVNVLTEKGLPVAYVLYE  598



>gb|KCW66197.1| hypothetical protein EUGRSUZ_F00026 [Eucalyptus grandis]
Length=635

 Score =   244 bits (622),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            QA Q+EKPPLLLKSHGGPT+E RG LNLSIQYWTSRGWA VDVNYGGSTGYGREFRERLL
Sbjct  483  QASQEEKPPLLLKSHGGPTSETRGVLNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLL  542

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
              WGIVDV+DCCSCAKFLV+SG+ DG RLCITG SAGGYTTLAALAF++ FKAG SLYG+
Sbjct  543  GRWGIVDVDDCCSCAKFLVESGKADGNRLCITGGSAGGYTTLAALAFRETFKAGASLYGV  602

Query  363  GDLKLLVDGMPKFESHYIDNLVG  431
             DL +L     KFESHY+D LVG
Sbjct  603  ADLNMLRAETHKFESHYLDKLVG  625



>ref|WP_012871839.1| peptidase [Sphaerobacter thermophilus]
 gb|ACZ38792.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Sphaerobacter thermophilus DSM 20745]
Length=652

 Score =   244 bits (622),  Expect = 7e-73, Method: Composition-based stats.
 Identities = 116/201 (58%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = +3

Query  12   QDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNW  191
            + E+PPLL+ SHGGPT +   +LNL IQ+WTSRG+A+VDVNYGGSTGYGRE+RERL  NW
Sbjct  405  EGERPPLLVLSHGGPTGQTTSALNLEIQFWTSRGFAVVDVNYGGSTGYGREYRERLKGNW  464

Query  192  GIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDL  371
            GIVDV DC + A++L   G VDGERL I G SAGGYTTL AL F DVF AG S +G+ D 
Sbjct  465  GIVDVADCVNAARYLAQQGEVDGERLAIEGGSAGGYTTLCALTFTDVFSAGASYFGVADA  524

Query  372  KLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQ  539
              L     KFES Y+D L+G     ++ Y ERSP+   D+ SCPIIL QGL+D VVPP Q
Sbjct  525  AALARDTHKFESRYLDGLIGPYPEAEDLYRERSPLYHADRISCPIILLQGLEDAVVPPAQ  584

Query  540  ARKIYQALKAKGLPVALVEYE  602
            A  + +AL+A  +P A + +E
Sbjct  585  AEAMVEALEANRIPHAYIPFE  605



>ref|WP_015149312.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Oscillatoria 
acuminata]
 gb|AFY82678.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Oscillatoria 
acuminata PCC 6304]
Length=644

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 149/199 (75%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E PPLL+KSHGGPT+ A  SL+LSIQYWTSRG+A++DVNYGGSTGYGRE+R+RL   WGI
Sbjct  403  ELPPLLVKSHGGPTSSAGSSLSLSIQYWTSRGFAVLDVNYGGSTGYGREYRQRLENRWGI  462

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DC + AK+L + G VD  RL I G SAGGYTTL AL ++DVFKAG S YG+ DL+ 
Sbjct  463  VDVDDCANGAKYLGEQGWVDSNRLAIAGGSAGGYTTLCALTYRDVFKAGASYYGVSDLEA  522

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D LVG     K  Y ERSPI+  D+ SCP+I FQGL+DK+VPP QA 
Sbjct  523  LAKETHKFESRYLDKLVGPYPEAKQIYIERSPIHACDRISCPVIFFQGLEDKIVPPNQAE  582

Query  546  KIYQALKAKGLPVALVEYE  602
             +  ALK KG+PVA + +E
Sbjct  583  AMVNALKQKGIPVAYLPFE  601



>ref|WP_011141470.1| peptidase [Gloeobacter violaceus]
 ref|NP_924416.1| peptidase [Gloeobacter violaceus PCC 7421]
 dbj|BAC89411.1| gll1470 [Gloeobacter violaceus PCC 7421]
Length=638

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 145/199 (73%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPLL+KSHGGPTA    +LNL IQYWTSRG+A++DVNY GSTGYGR +RE+L   WGI
Sbjct  395  EKPPLLVKSHGGPTAATSSALNLKIQYWTSRGFAVLDVNYRGSTGYGRAYREQLKGRWGI  454

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DC   A FLV  G VDG RL I G SAGGYTTL ALAF++VFKAG S YG+ DL+ 
Sbjct  455  VDVDDCVQGALFLVARGDVDGWRLAIDGGSAGGYTTLCALAFRNVFKAGASYYGVSDLES  514

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFE+ Y D L+G     +  Y  RSPI+ +D+ +CP+I  QGL+DKVVPP QA 
Sbjct  515  LARDTHKFEARYFDGLIGPYPECRALYIARSPIHSLDQLACPVIFLQGLEDKVVPPNQAE  574

Query  546  KIYQALKAKGLPVALVEYE  602
             + +AL+ KGLPVA + +E
Sbjct  575  AMVEALRVKGLPVAYLAFE  593



>emb|CDH52439.1| peptidase prolyl oligopeptidase active siteregion [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=681

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 145/204 (71%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q    EKPPL + SHGGPT+E   + N SIQYWT+RG+A+VDVNYGGSTGYGR +R RL 
Sbjct  431  QGPTGEKPPLRVLSHGGPTSETTRAYNRSIQYWTTRGFAIVDVNYGGSTGYGRAYRNRLK  490

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            + WGIVDVNDCC+ A +LV  G VDGE+L I G SAGGYTTLA++AF+DVFKA C  YG+
Sbjct  491  KKWGIVDVNDCCNAALYLVKQGWVDGEKLTIVGGSAGGYTTLASIAFRDVFKAACCKYGV  550

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             D+ LL     KFES Y D L+G    D++ Y ERSP+   D   CP+I FQG DDK+VP
Sbjct  551  SDITLLAKETHKFESRYPDELIGKYPEDEDIYKERSPLFSADLIKCPVIFFQGADDKIVP  610

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P Q+  +  ALK + +PV+ V Y+
Sbjct  611  PSQSEVMVDALKKQNVPVSYVLYQ  634



>ref|WP_023075509.1| dipeptidyl aminopeptidase acylaminoacyl peptidase [Leptolyngbya 
sp. Heron Island J]
 gb|ESA33630.1| dipeptidyl aminopeptidase acylaminoacyl peptidase [Leptolyngbya 
sp. Heron Island J]
Length=640

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 146/203 (72%), Gaps = 4/203 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A +  +PPLL+KSHGGPTA    + N +IQYWTSRG+A++DVNYGGSTGYGR +RERL  
Sbjct  395  APEGSRPPLLVKSHGGPTAATSSNFNPAIQYWTSRGFAVLDVNYGGSTGYGRAYRERLKG  454

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWGIVD++DC + A +LV  G+ D E+L I G SAGGYTTL AL F+DVFKAG S YG+ 
Sbjct  455  NWGIVDIDDCVNGANYLVAQGKADPEQLAIDGGSAGGYTTLGALTFRDVFKAGASYYGVS  514

Query  366  DLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            D+  L     KFES Y+D+LVG     K+ Y  RSPINF D+ SCP+I  QG +DK+VPP
Sbjct  515  DMAALAMDTHKFESRYLDSLVGPYPERKDLYEARSPINFADQLSCPVIFLQGDEDKIVPP  574

Query  534  EQARKIYQALKAKGLPVALVEYE  602
             QA  +  AL+ K +PVA + +E
Sbjct  575  NQAELMVNALREKTIPVAYLLFE  597



>ref|WP_011430745.1| peptidase [Synechococcus sp. JA-3-3Ab]
 gb|ABD00071.1| peptidase, S9C (acylaminoacyl-peptidase) family [Synechococcus 
sp. JA-3-3Ab]
Length=644

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPLL+KSHGGPT      LNL IQYWTSRG A++DVNY GS+GYGR +R+ L   WG+
Sbjct  399  EKPPLLVKSHGGPTGATAAVLNLGIQYWTSRGIAVLDVNYRGSSGYGRAYRDALKGRWGL  458

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV DC + A+FL   G+VDGERL I G SAGGYTTLAAL F  VFKAG S YG+ DL+ 
Sbjct  459  VDVEDCIAGAQFLAAQGKVDGERLLIRGGSAGGYTTLAALTFHTVFKAGASYYGVSDLEA  518

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFESHY+D+L+G     ++ Y ERSPI+ ++  +CP+I FQGL+D +VPP QA 
Sbjct  519  LAQETHKFESHYLDSLIGPYPERRDLYRERSPIHHLEGLNCPVIFFQGLEDAIVPPNQAE  578

Query  546  KIYQALKAKGLPVALVEY  599
            ++  AL+AKG+PVA V +
Sbjct  579  RMVAALQAKGIPVAYVPF  596



>ref|WP_041887859.1| peptidase [Candidatus Aerophobus profundus]
Length=646

 Score =   241 bits (614),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 142/199 (71%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E+PPLL+ SHGGPTA    +  L IQYWTSRG A++DVNYGGST YGR +R+RL   WG+
Sbjct  405  ERPPLLVISHGGPTASTSTTFRLDIQYWTSRGLAVLDVNYGGSTDYGRAYRQRLNGQWGV  464

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DC + A +LV  G VDG RL I G SAGGYTTL AL F   FK G S YG+ DL+ 
Sbjct  465  VDVDDCVNGANYLVKRGEVDGNRLMIKGGSAGGYTTLCALTFGHTFKTGASYYGVSDLEA  524

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFESHY+D L+       + + ERSPINFV++ SCP+I FQGL+DKVVPP+QA 
Sbjct  525  LAKDTHKFESHYLDRLIASYSEHSHLWRERSPINFVERLSCPVIFFQGLEDKVVPPKQAE  584

Query  546  KIYQALKAKGLPVALVEYE  602
             + +AL++K LPVA + +E
Sbjct  585  TMVEALRSKRLPVAYITFE  603



>ref|WP_025514862.1| peptidase [Proteobacteria bacterium JGI 0001009-D17]
Length=652

 Score =   241 bits (615),  Expect = 7e-72, Method: Composition-based stats.
 Identities = 113/199 (57%), Positives = 146/199 (73%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E+PPLL+ SHGGPT+    S   S QYWTSRG+A+VDVNY GS+GYGR +R+ L   WG+
Sbjct  406  ERPPLLVISHGGPTSATDASFKWSTQYWTSRGFAVVDVNYRGSSGYGRAYRQALNDRWGV  465

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DC + A+FL++ G VD +R+ I G+SAGGYTTLAAL F+D FKAG S YGIGDL+ 
Sbjct  466  VDVDDCIAAARFLIERGDVDPDRVAIRGASAGGYTTLAALTFRDFFKAGASHYGIGDLEA  525

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D LVG     +  Y ERSP++  D+ + P+IL QG +DK VPP QAR
Sbjct  526  LAKDTHKFESRYLDRLVGPYPQMRARYLERSPVHHTDRLASPMILLQGTEDKAVPPAQAR  585

Query  546  KIYQALKAKGLPVALVEYE  602
             ++ A+KAKGLPVAL+ ++
Sbjct  586  AMFDAVKAKGLPVALLMFD  604



>ref|WP_027323935.1| peptidase [Bacillus sp. URHB0009]
Length=641

 Score =   241 bits (614),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 151/203 (74%), Gaps = 4/203 (2%)
 Frame = +3

Query  6    AGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLR  185
            A  DEKPPLL+  HGGPT+ +  +L+LS QYWTSRG+A+VD+NYGGSTGYGRE+R+RL  
Sbjct  396  APADEKPPLLVHVHGGPTSASSSTLSLSTQYWTSRGFAVVDINYGGSTGYGREYRDRLKG  455

Query  186  NWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIG  365
            NWG+VDV D  +  ++L++ G VD  R+ I G SAGGYTTLA+L F DV+KAG S +G+ 
Sbjct  456  NWGVVDVQDSANAVRYLIEKGEVDQNRVAIAGGSAGGYTTLASLVFTDVYKAGASHFGLS  515

Query  366  DLKLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPP  533
            +L++      KFES Y+D L+G     K  Y++RSPINF ++ SCP+I FQGLDDK+VPP
Sbjct  516  ELEVFAGETHKFESRYMDGLLGSYPEAKEIYYKRSPINFTNQLSCPVIFFQGLDDKIVPP  575

Query  534  EQARKIYQALKAKGLPVALVEYE  602
             QA  + +ALK KGLPVA + +E
Sbjct  576  NQAELMVEALKNKGLPVAYIAFE  598



>ref|XP_005821627.1| hypothetical protein GUITHDRAFT_160229 [Guillardia theta CCMP2712]
 gb|EKX34647.1| hypothetical protein GUITHDRAFT_160229 [Guillardia theta CCMP2712]
Length=684

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 141/193 (73%), Gaps = 4/193 (2%)
 Frame = +3

Query  24   PPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGIVD  203
            PPLL+KSHGGPTA A  + NL IQ+WTSRG+A+ DV+Y GS+GYGR++RERL  NWGI D
Sbjct  468  PPLLVKSHGGPTAAASTAFNLGIQFWTSRGYAVADVDYSGSSGYGRKYRERLKGNWGIYD  527

Query  204  VNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKLLV  383
            V DCCS AKFL   G VDG ++ I G SAGGYTTL  L FKD FKAGCS YGIGDL+ L 
Sbjct  528  VEDCCSAAKFLEQQGLVDGSKMAIDGGSAGGYTTLCCLTFKDTFKAGCSSYGIGDLETLA  587

Query  384  DGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKI  551
                KFES Y+D+LVG     K  Y +RSPIN+V++  CPI  FQG +D+VVP  QA  +
Sbjct  588  SDTHKFESRYLDSLVGPYPEMKEEYRKRSPINYVEQLKCPIAFFQGAEDRVVPLNQAEAM  647

Query  552  YQALKAKGLPVAL  590
            ++A+KAK +  AL
Sbjct  648  HKAVKAKNIRTAL  660



>ref|WP_013034086.1| peptidase [Nitrosococcus halophilus]
 gb|ADE16236.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Nitrosococcus halophilus Nc 4]
Length=643

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 146/199 (73%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E+PPLL+ SHGGPTA    +L+L IQYWTSRG A++DVNY GST YGRE+R +L   WG+
Sbjct  402  ERPPLLVVSHGGPTAATDNTLDLKIQYWTSRGIAVLDVNYRGSTHYGREYRRQLGGQWGL  461

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV+DC + A +LV  G VD ERL I G SAGG+TTLAAL F +VFKAG S YG+ DL+ 
Sbjct  462  VDVDDCVNGALYLVQRGEVDPERLAIRGGSAGGFTTLAALTFHEVFKAGASYYGVSDLEA  521

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D+L+G      + Y  RSPI  VD+ SCP+I FQGL+DK+VPPEQA 
Sbjct  522  LAKETHKFESRYLDHLIGPYPERADLYAARSPIYAVDRLSCPVIFFQGLEDKIVPPEQAE  581

Query  546  KIYQALKAKGLPVALVEYE  602
            ++ +AL+ KGLPVA V +E
Sbjct  582  QMVEALRRKGLPVAYVPFE  600



>ref|WP_013220803.1| peptidase [Nitrosococcus watsonii]
 gb|ADJ28711.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Nitrosococcus watsonii C-113]
Length=643

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 145/199 (73%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            E+PPLL+ SHGGPTA    +L+L IQYWTSRG A++DVNY GS+ YGRE+R++L   WG 
Sbjct  402  ERPPLLVISHGGPTAATDSTLSLKIQYWTSRGIAVLDVNYRGSSHYGREYRQQLKGQWGC  461

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
             DV DC + A +L   G VDGERL I GSSAGG+TTLAAL F +VFKAG S YG+ DL+ 
Sbjct  462  ADVEDCLNGALYLAQRGEVDGERLAIRGSSAGGFTTLAALTFHEVFKAGASYYGVSDLEA  521

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D+L+G      + Y  RSPI+ VDK SCP+I FQGL+DK+VPPEQA 
Sbjct  522  LAKETHKFESRYLDHLIGPYPERADLYAARSPIHAVDKLSCPVIFFQGLEDKIVPPEQAE  581

Query  546  KIYQALKAKGLPVALVEYE  602
             + +AL+ KG+PVA V +E
Sbjct  582  GMVEALRGKGVPVAYVPFE  600



>ref|WP_027302496.1| peptidase [Rhodospirillales bacterium URHD0088]
Length=634

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 143/192 (74%), Gaps = 4/192 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPLL+KSHGGPTA    +L+L +QYWTSRG  ++DVNYGGS+GYGR +R+RL   WGI
Sbjct  402  EKPPLLVKSHGGPTAATTTTLDLRVQYWTSRGIGVLDVNYGGSSGYGRAYRDRLDGKWGI  461

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV DC + A  LV +GR D  RL I+G SAGGYTTLAALAF+DVF+AG S YG+ DL+ 
Sbjct  462  VDVEDCVNGALHLVATGRADPSRLMISGGSAGGYTTLAALAFRDVFRAGASYYGVADLEA  521

Query  378  LVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFESHY+D LVG    D+  Y ERSPI+ V++FS P+I FQG +DKVVPP QA 
Sbjct  522  LARDTHKFESHYLDRLVGPYPRDRQLYIERSPIHAVERFSVPVIFFQGEEDKVVPPNQAE  581

Query  546  KIYQALKAKGLP  581
             +  ALK KGLP
Sbjct  582  MMVGALKRKGLP  593



>emb|CDS08273.1| hypothetical protein LRAMOSA02221 [Absidia idahoensis var. thermophila]
Length=652

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 142/204 (70%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    QAGQDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLL  182
            Q    EKPPL +  HGGPTA    +   +IQYWT+RG+A+ DVNYGGSTGYGR +R RL 
Sbjct  403  QGPAGEKPPLRVLLHGGPTASTDRAYKRAIQYWTTRGFAIADVNYGGSTGYGRAYRNRLK  462

Query  183  RNWGIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGI  362
            + WGIVDVNDCC+ A +LV  G VDG++L I G SAGGYTTLA++AF+DVFKA C LYG+
Sbjct  463  KKWGIVDVNDCCNAALYLVKQGWVDGDKLTIVGGSAGGYTTLASIAFRDVFKAACCLYGV  522

Query  363  GDLKLLVDGMPKFESHYIDNLVG----DKNAYFERSPINFVDKFSCPIILFQGLDDKVVP  530
             D+ LL     KFES Y D L+G    D+  Y ERSP+   DK  CP+I FQG DDK+VP
Sbjct  523  SDITLLAKETHKFESRYPDELIGKYPEDEAIYKERSPLFSADKIKCPVIFFQGADDKIVP  582

Query  531  PEQARKIYQALKAKGLPVALVEYE  602
            P Q+  +  ALK K +PV+ V YE
Sbjct  583  PSQSEVMVDALKKKNVPVSYVLYE  606



>ref|WP_043317892.1| peptidase [Microbulbifer sp. HZ11]
Length=610

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 140/200 (70%), Gaps = 4/200 (2%)
 Frame = +3

Query  15   DEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWG  194
            DEKPPL++  HGGPT      LNL +QYWTSRG+ ++DVNY GSTGYGR +R+RL  NWG
Sbjct  364  DEKPPLIVFGHGGPTGATSAGLNLKVQYWTSRGFGILDVNYSGSTGYGRAYRDRLANNWG  423

Query  195  IVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLK  374
            ++DV D C+ A++LV+ G  D ERL I G SAGGYT LAAL F + F AG S YGIGDL 
Sbjct  424  VLDVEDVCAGAEYLVEQGLADPERLLIKGGSAGGYTVLAALTFHNTFSAGASHYGIGDLT  483

Query  375  LLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQA  542
             L     KFES Y+D LVG     +N Y +RSPIN +++  CP+I FQG++DKVVPP QA
Sbjct  484  TLAQDTHKFESRYLDKLVGPWPDAENIYRQRSPINHIEQLDCPVIFFQGMEDKVVPPNQA  543

Query  543  RKIYQALKAKGLPVALVEYE  602
              +  AL+ + +PVA + +E
Sbjct  544  ETMVTALRERHIPVAYITFE  563



>ref|WP_011433603.1| peptidase [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD02964.1| peptidase, S9C (acylaminoacyl-peptidase) family [Synechococcus 
sp. JA-2-3B'a(2-13)]
Length=642

 Score =   239 bits (609),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 146/199 (73%), Gaps = 4/199 (2%)
 Frame = +3

Query  18   EKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGI  197
            EKPPLL+KSHGGPT      LNL IQYWTSRG A++DVNY GS+GYGR +R+ L   WG+
Sbjct  399  EKPPLLVKSHGGPTGATAAVLNLGIQYWTSRGIAVLDVNYRGSSGYGRAYRDALKGRWGL  458

Query  198  VDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKL  377
            VDV DC + ++FL + G+VDGERL I G SAGGYTTLAAL F  VF+AG S YG+ DL+ 
Sbjct  459  VDVEDCIAGSQFLAEQGKVDGERLLIQGGSAGGYTTLAALTFHAVFRAGASYYGVSDLEA  518

Query  378  LVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQAR  545
            L     KFES Y+D+L+G     ++ Y ERSPI+ ++  +CP+I FQGL+D +VPP QA 
Sbjct  519  LAQETHKFESRYLDSLIGPYPERRDLYRERSPIHHLEGLNCPVIFFQGLEDAIVPPNQAE  578

Query  546  KIYQALKAKGLPVALVEYE  602
            ++  AL+AKG+PVA V +E
Sbjct  579  RMVAALRAKGIPVAYVPFE  597



>ref|WP_019588695.1| hypothetical protein [Deinococcus apachensis]
Length=650

 Score =   239 bits (609),  Expect = 5e-71, Method: Composition-based stats.
 Identities = 107/201 (53%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = +3

Query  12   QDEKPPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNW  191
            Q E+PPLL+ SHGGPT      LN  +Q+WT+RG+A++DVNYGGSTG+GR +RERL   W
Sbjct  404  QGERPPLLVISHGGPTGATFAVLNPFVQFWTTRGFAVLDVNYGGSTGFGRAYRERLRGQW  463

Query  192  GIVDVNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDL  371
            G+VDV DC + A+F+ + G VD +R+ ITG SAGGYT L AL F DVF AG S +G+ D+
Sbjct  464  GVVDVQDCVNAARFVAERGDVDAQRMAITGGSAGGYTVLCALTFHDVFTAGASHFGLSDV  523

Query  372  KLLVDGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQ  539
            +       KFES Y+D L+G     K  Y  RSPI+F ++ S P++ FQGL+DKVVPP+Q
Sbjct  524  ETFTQDTHKFESRYLDGLIGPYPEMKELYQARSPIHFTEQLSRPVVFFQGLEDKVVPPDQ  583

Query  540  ARKIYQALKAKGLPVALVEYE  602
            A+++++A++++GLP ALVE+E
Sbjct  584  AKRMFEAVRSRGLPTALVEFE  604



>ref|WP_038530538.1| peptidase [Synechocystis sp. PCC 6714]
Length=634

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 138/196 (70%), Gaps = 4/196 (2%)
 Frame = +3

Query  24   PPLLLKSHGGPTAEARGSLNLSIQYWTSRGWALVDVNYGGSTGYGREFRERLLRNWGIVD  203
            PPLL+KSHGGPTA A  SL+L IQYWTSRG+A VDVNYGGSTGYGR +R+RL   WGIVD
Sbjct  404  PPLLVKSHGGPTAAASNSLSLKIQYWTSRGFAYVDVNYGGSTGYGRNYRQRLHGQWGIVD  463

Query  204  VNDCCSCAKFLVDSGRVDGERLCITGSSAGGYTTLAALAFKDVFKAGCSLYGIGDLKLLV  383
            V DC + AK+L   G  D  +L I+G SAGGYTTLAAL F D+F+AG S YG+ DL  L 
Sbjct  464  VADCINAAKYLAAQGLADLNKLAISGGSAGGYTTLAALTFHDIFQAGASYYGVSDLTALT  523

Query  384  DGMPKFESHYIDNLVGD----KNAYFERSPINFVDKFSCPIILFQGLDDKVVPPEQARKI  551
                KFES Y D L+G     K+ Y  RSP+N  D+ +CP+I FQGL+DKVVPP Q   +
Sbjct  524  TDTHKFESRYFDGLIGPYPERKDLYERRSPVNHADQLTCPVIFFQGLEDKVVPPNQTEMM  583

Query  552  YQALKAKGLPVALVEY  599
             +ALK KG+ V  V +
Sbjct  584  VEALKTKGIKVEYVAF  599



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370