BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP001H08 470 bp,:Filtered

Length=427
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK27969.1|AF242373_1  cysteine protease                             173   2e-49   Ipomoea batatas [batate]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I     173   2e-49   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I     173   2e-49   Ipomoea batatas [batate]
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II    173   2e-49   Ipomoea batatas [batate]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...    173   3e-49   Ipomoea batatas [batate]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II    171   1e-48   Ipomoea batatas [batate]
gb|KDP41743.1|  hypothetical protein JCGZ_26761                         169   8e-48   Jatropha curcas
ref|XP_002512963.1|  cysteine protease, putative                        169   1e-47   Ricinus communis
sp|P05993.1|PAPA5_CARPA  RecName: Full=Cysteine proteinase; AltNa...    159   2e-47   Carica papaya [mamon]
gb|AIB06024.1|  CP2                                                     167   4e-47   Hevea brasiliensis [jebe]
gb|AAX19661.1|  cysteine proteinase                                     167   5e-47   Populus tomentosa [Chinese white poplar]
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a               167   6e-47   Populus euphratica
gb|ABK96252.1|  unknown                                                 160   6e-47   Populus trichocarpa x Populus deltoides
gb|ABQ10201.1|  cysteine protease Cp3                                   166   1e-46   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like          166   1e-46   Eucalyptus grandis [rose gum]
gb|KHG24064.1|  Cysteinease RD19a -like protein                         166   2e-46   Gossypium arboreum [tree cotton]
ref|XP_002313770.1|  cysteine proteinase A494 precursor                 165   2e-46   Populus trichocarpa [western balsam poplar]
gb|ABK92536.1|  unknown                                                 165   2e-46   Populus trichocarpa [western balsam poplar]
emb|CDP20652.1|  unnamed protein product                                165   2e-46   Coffea canephora [robusta coffee]
ref|NP_001267989.1|  cysteine protease precursor                        165   3e-46   Vitis vinifera
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like          162   3e-46   Pyrus x bretschneideri [bai li]
gb|KJB32561.1|  hypothetical protein B456_005G247000                    165   3e-46   Gossypium raimondii
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like          165   3e-46   Pyrus x bretschneideri [bai li]
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a               164   4e-46   Pyrus x bretschneideri [bai li]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a               164   5e-46   Malus domestica [apple tree]
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like          164   5e-46   Citrus sinensis [apfelsine]
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                   164   5e-46   Citrus sinensis [apfelsine]
gb|KJB79047.1|  hypothetical protein B456_013G033800                    164   6e-46   Gossypium raimondii
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a               164   6e-46   Prunus mume [ume]
emb|CAE54306.1|  putative papain-like cysteine proteinase               164   7e-46   Gossypium hirsutum [American cotton]
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg             164   7e-46   Prunus persica
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    164   8e-46   Sesamum indicum [beniseed]
ref|XP_007042077.1|  Papain family cysteine protease                    164   8e-46   Theobroma cacao [chocolate]
gb|KHG15253.1|  Cysteinease RD19a -like protein                         164   8e-46   Gossypium arboreum [tree cotton]
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494       164   1e-45   Fragaria vesca subsp. vesca
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg             164   1e-45   Citrus clementina
gb|KHN39817.1|  Cysteine proteinase RD19a                               162   1e-45   Glycine soja [wild soybean]
ref|XP_003606998.1|  Cysteine proteinase                                163   1e-45   Medicago truncatula
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like          163   1e-45   Glycine max [soybeans]
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like          163   1e-45   Populus euphratica
gb|ACI04578.1|  cysteine protease-like protein                          162   1e-45   Robinia pseudoacacia [black locust]
ref|XP_002305451.2|  cysteine proteinase A494 precursor                 163   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like          163   2e-45   Sesamum indicum [beniseed]
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like          164   3e-45   Pyrus x bretschneideri [bai li]
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like            162   3e-45   Populus euphratica
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like          162   3e-45   Cicer arietinum [garbanzo]
gb|ABF46642.1|  papain-like cysteine proteinase                         162   3e-45   Pachysandra terminalis
gb|AAR92156.1|  putative cysteine protease 3                            160   5e-45   Iris x hollandica [Dutch iris]
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like          163   5e-45   Pyrus x bretschneideri [bai li]
dbj|BAD94010.1|  drought-inducible cysteine proteinase RD19A prec...    153   5e-45   Arabidopsis thaliana [mouse-ear cress]
gb|ABK96580.1|  unknown                                                 162   5e-45   Populus trichocarpa x Populus deltoides
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like          162   5e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494       161   6e-45   Eucalyptus grandis [rose gum]
gb|ABK94801.1|  unknown                                                 161   6e-45   Populus trichocarpa [western balsam poplar]
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g             161   7e-45   Populus trichocarpa [western balsam poplar]
gb|AAL69389.1|AF462226_1  putative cysteine proteinase                  154   9e-45   Narcissus pseudonarcissus
gb|ABK93575.1|  unknown                                                 155   1e-44   Populus trichocarpa [western balsam poplar]
gb|AAU81591.1|  cysteine proteinase                                     155   1e-44   Petunia x hybrida [garden petunia]
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g             159   2e-44   Phaseolus vulgaris [French bean]
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like              159   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like          160   3e-44   
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I               160   3e-44   Cucumis sativus [cucumbers]
ref|XP_002510469.1|  cysteine protease, putative                        159   3e-44   Ricinus communis
gb|AAU81589.1|  cysteine proteinase                                     156   3e-44   Petunia x hybrida [garden petunia]
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    160   3e-44   
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like          159   4e-44   Eucalyptus grandis [rose gum]
gb|AJP16692.1|  cysteine protease                                       153   4e-44   Striga hermonthica [purple witchweed]
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like          159   4e-44   Glycine max [soybeans]
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like          159   6e-44   Nelumbo nucifera [Indian lotus]
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg                159   7e-44   Erythranthe guttata [common monkey flower]
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like          158   8e-44   Brassica rapa
gb|ACX54787.2|  cysteine protease                                       158   9e-44   Arachis diogoi
dbj|BAJ53178.1|  JHL18I08.12                                            158   9e-44   Jatropha curcas
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a               158   1e-43   Tarenaya hassleriana [spider flower]
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like          158   1e-43   Cucumis sativus [cucumbers]
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor     157   2e-43   Glycine max [soybeans]
gb|AAM65162.1|  cysteine proteinase RD19A                               157   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like              157   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like            157   2e-43   Glycine max [soybeans]
gb|KHN45894.1|  Cysteine proteinase RD19a                               157   2e-43   Glycine soja [wild soybean]
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494       157   2e-43   Tarenaya hassleriana [spider flower]
ref|NP_568052.1|  cysteine proteinase RD19a                             157   2e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDQ51995.1|  Cysteine proteinase                                    152   2e-43   Fagus sylvatica
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like          157   2e-43   Nicotiana tomentosiformis
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg                157   2e-43   Erythranthe guttata [common monkey flower]
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor                 157   2e-43   Sandersonia aurantiaca [Chinese-lantern lily]
gb|AAB62937.1|  stress-induced cysteine proteinase                      152   3e-43   Lavatera thuringiaca
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like              157   3e-43   Elaeis guineensis
gb|KHN25410.1|  Cysteine proteinase RD19a                               157   3e-43   Glycine soja [wild soybean]
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg             157   3e-43   Eutrema salsugineum
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like              157   4e-43   Phoenix dactylifera
emb|CDY71205.1|  BnaCnng71840D                                          157   4e-43   Brassica napus [oilseed rape]
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like            157   4e-43   Populus euphratica
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease       157   4e-43   Brassica oleracea
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                    157   4e-43   Arabis alpina [alpine rockcress]
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like          157   4e-43   Cucumis melo [Oriental melon]
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g             156   5e-43   Populus trichocarpa [western balsam poplar]
gb|KHN12668.1|  Cysteine proteinase 15A                                 150   5e-43   Glycine soja [wild soybean]
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like          156   5e-43   Solanum tuberosum [potatoes]
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a               156   5e-43   Vitis vinifera
dbj|BAC41322.1|  hypothetical protein                                   156   6e-43   Lotus japonicus
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg             156   6e-43   Capsella rubella
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1         156   6e-43   Lotus japonicus
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a               156   7e-43   Solanum lycopersicum
gb|KHN22211.1|  Cysteine proteinase 15A                                 156   7e-43   Glycine soja [wild soybean]
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like          156   7e-43   Cucumis melo [Oriental melon]
dbj|BAF98584.1|  CM0216.500.nc                                          155   9e-43   Lotus japonicus
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like            155   9e-43   Citrus sinensis [apfelsine]
ref|XP_007017672.1|  Papain family cysteine protease                    156   9e-43   Theobroma cacao [chocolate]
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677             155   1e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A                 155   1e-42   Vitis vinifera
gb|AIB06025.1|  CP3                                                     155   1e-42   Hevea brasiliensis [jebe]
ref|XP_010105270.1|  Cysteine proteinase 15A                            155   1e-42   Morus notabilis
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2         155   1e-42   Lotus japonicus
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                  155   1e-42   Phaseolus vulgaris [French bean]
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g             155   1e-42   Phaseolus vulgaris [French bean]
emb|CDY41960.1|  BnaA01g05320D                                          155   1e-42   Brassica napus [oilseed rape]
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                   155   1e-42   Citrus sinensis [apfelsine]
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like            155   1e-42   Fragaria vesca subsp. vesca
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg             155   1e-42   Citrus clementina
emb|CAA52403.1|  putative thiol protease                                154   2e-42   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF98585.1|  CM0216.510.nc                                          155   2e-42   Lotus japonicus
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a               154   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a               154   2e-42   Camelina sativa [gold-of-pleasure]
dbj|BAF46302.1|  cysteine proteinase precursor                          155   2e-42   Ipomoea nil [qian niu]
dbj|BAD43619.1|  putative cysteine proteinase                           154   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210          154   3e-42   Amborella trichopoda
ref|NP_565512.1|  Papain family cysteine protease                       154   3e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KJB07487.1|  hypothetical protein B456_001G026600                    154   3e-42   Gossypium raimondii
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a               154   3e-42   Brassica rapa
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like          154   4e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like            154   5e-42   Brassica rapa
emb|CDY34441.1|  BnaC01g21920D                                          154   5e-42   Brassica napus [oilseed rape]
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A                 153   6e-42   Malus domestica [apple tree]
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g             153   7e-42   Phaseolus vulgaris [French bean]
dbj|BAF03553.1|  cysteine proteinase CP2                                153   9e-42   Phaseolus vulgaris [French bean]
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008             153   1e-41   Arabidopsis lyrata subsp. lyrata
dbj|BAA92495.1|  cysteine protease                                      152   1e-41   Vigna mungo [urad dal]
gb|AAQ81938.1|  cysteine proteinase precursor                           152   2e-41   Ipomoea batatas [batate]
emb|CAB53397.1|  cysteine protease                                      148   2e-41   Medicago sativa [alfalfa]
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A                 153   2e-41   
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like              147   2e-41   
gb|ACM80348.1|  cysteine proteinase                                     152   2e-41   Solanum lycopersicum
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like            152   2e-41   Glycine max [soybeans]
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like              152   2e-41   Phoenix dactylifera
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like            152   2e-41   Sesamum indicum [beniseed]
gb|ACK57563.1|  cysteine protease-like protein                          152   3e-41   Arachis hypogaea [goober]
emb|CDP07452.1|  unnamed protein product                                152   3e-41   Coffea canephora [robusta coffee]
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like          151   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like            151   4e-41   Camelina sativa [gold-of-pleasure]
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor                 151   4e-41   Solanum melongena [aubergine]
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like            151   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like              151   6e-41   Elaeis guineensis
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like              150   8e-41   
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A                 150   9e-41   Pyrus x bretschneideri [bai li]
gb|KJB29611.1|  hypothetical protein B456_005G110200                    150   1e-40   Gossypium raimondii
ref|XP_003589348.1|  Cysteine proteinase                                150   1e-40   Medicago truncatula
emb|CAB17075.1|  cysteine proteinase precursor                          150   1e-40   Phaseolus vulgaris [French bean]
emb|CAD40319.2|  OSJNBb0054B09.3                                        150   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like            150   2e-40   Nicotiana tomentosiformis
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like          150   2e-40   Cucumis melo [Oriental melon]
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A                 150   2e-40   Vitis vinifera
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like            150   2e-40   Prunus mume [ume]
gb|AAK07731.1|  CPR2-like cysteine proteinase                           149   2e-40   Nicotiana tabacum [American tobacco]
gb|AGS43121.1|  cysteine protease 1                                     142   2e-40   Zea mays [maize]
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830          150   2e-40   Sorghum bicolor [broomcorn]
emb|CDY09707.1|  BnaC07g33540D                                          149   2e-40   Brassica napus [oilseed rape]
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                    149   2e-40   Nicotiana tabacum [American tobacco]
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                    149   2e-40   Nicotiana tabacum [American tobacco]
emb|CAA57675.1|  cysteine proteinase                                    144   2e-40   Zea mays [maize]
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like            149   2e-40   Nicotiana sylvestris
gb|EAY93546.1|  hypothetical protein OsI_15336                          149   2e-40   Oryza sativa Indica Group [Indian rice]
gb|EEE60725.1|  hypothetical protein OsJ_14236                          149   2e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg             149   2e-40   Eutrema salsugineum
emb|CDX99593.1|  BnaC04g33500D                                          149   2e-40   Brassica napus [oilseed rape]
gb|KJB58164.1|  hypothetical protein B456_009G197400                    149   2e-40   Gossypium raimondii
gb|KHG15062.1|  Cysteinease RD19a -like protein                         149   2e-40   Gossypium arboreum [tree cotton]
emb|CDX90537.1|  BnaA03g42440D                                          149   2e-40   Brassica napus [oilseed rape]
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like          149   3e-40   Brassica rapa
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg             149   3e-40   Eutrema salsugineum
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg             149   3e-40   Prunus persica
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494       149   3e-40   Brassica rapa
emb|CDY15894.1|  BnaA04g12170D                                          149   3e-40   Brassica napus [oilseed rape]
ref|NP_001052440.1|  Os04g0311400                                       149   3e-40   
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...    149   3e-40   Pisum sativum [garden pea]
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg             149   3e-40   Capsella rubella
gb|EMT16425.1|  Cysteine proteinase 1                                   149   4e-40   Aegilops tauschii
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like          149   4e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|AAO11786.1|  pre-pro cysteine proteinase                             148   4e-40   Vicia faba [broad bean]
gb|AAB67878.1|  pre-pro-cysteine proteinase                             148   4e-40   Vicia faba [broad bean]
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like              149   5e-40   Setaria italica
gb|AEX97108.1|  cysteine proteinase                                     142   5e-40   Malus domestica [apple tree]
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor     148   6e-40   Cicer arietinum [garbanzo]
gb|AJA74415.1|  cysteine protease                                       148   7e-40   Cicer arietinum [garbanzo]
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like              148   8e-40   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAH59428.1|  cysteine protease 2                                    145   8e-40   Plantago major [cart-track plant]
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200               148   9e-40   Arabis alpina [alpine rockcress]
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like              148   1e-39   Brachypodium distachyon [annual false brome]
gb|AAB16996.1|  thiol protease isoform B                                146   1e-39   Glycine max [soybeans]
gb|EMS53996.1|  Cysteine proteinase 1                                   148   1e-39   Triticum urartu
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like              147   2e-39   Setaria italica
gb|ACF86683.1|  unknown                                                 147   2e-39   Zea mays [maize]
ref|NP_001105685.1|  cysteine proteinase 1 precursor                    147   2e-39   Zea mays [maize]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142             147   2e-39   Arabidopsis lyrata subsp. lyrata
ref|NP_567489.1|  papain family cysteine protease                       147   2e-39   Arabidopsis thaliana [mouse-ear cress]
emb|CAA82995.1|  cysteine proteinase                                    146   2e-39   Vicia sativa [spring vetch]
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like              147   3e-39   Brachypodium distachyon [annual false brome]
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A                 146   3e-39   
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg                146   4e-39   Erythranthe guttata [common monkey flower]
ref|XP_003607110.1|  Cysteine proteinase                                145   5e-39   Medicago truncatula
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like            146   5e-39   Solanum tuberosum [potatoes]
gb|KEH30505.1|  papain family cysteine protease                         145   5e-39   Medicago truncatula
dbj|BAG16515.1|  putative cysteine proteinase                           145   5e-39   Capsicum chinense [bonnet pepper]
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like          145   7e-39   Cucumis sativus [cucumbers]
ref|NP_001046828.1|  Os02g0469600                                       145   1e-38   
gb|EMS64962.1|  Cysteine proteinase 1                                   143   1e-38   Triticum urartu
emb|CAA78403.1|  pre-pro-cysteine proteinase                            144   2e-38   Solanum lycopersicum
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like          144   3e-38   Nicotiana sylvestris
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor            144   3e-38   Hordeum vulgare subsp. vulgare [barley]
gb|ADY04293.1|  cysteine protease                                       138   3e-38   Clarkia xantiana subsp. xantiana
gb|ABK24688.1|  unknown                                                 144   3e-38   Picea sitchensis
gb|EMT10192.1|  Cysteine proteinase 1                                   144   3e-38   Aegilops tauschii
gb|ABK21238.1|  unknown                                                 144   3e-38   Picea sitchensis
gb|ADY04361.1|  cysteine protease                                       137   4e-38   Clarkia xantiana subsp. xantiana
gb|AAW21813.1|  cysteine protease                                       144   4e-38   Triticum aestivum [Canadian hard winter wheat]
gb|ACN40679.1|  unknown                                                 143   4e-38   Picea sitchensis
gb|AES89347.2|  papain family cysteine protease                         142   5e-38   Medicago truncatula
gb|ADY04342.1|  cysteine protease                                       137   5e-38   Clarkia xantiana subsp. xantiana
gb|ADY04336.1|  cysteine protease                                       137   5e-38   Clarkia xantiana subsp. xantiana
gb|AAZ32411.1|  cysteine proteinase glycinain type                      143   5e-38   Nicotiana benthamiana
ref|XP_003607150.1|  Cysteine proteinase                                142   5e-38   
gb|ADY04262.1|  cysteine protease                                       137   6e-38   Clarkia xantiana subsp. xantiana
gb|ADY04457.1|  cysteine protease                                       137   6e-38   Clarkia xantiana subsp. xantiana
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a               143   6e-38   Vitis vinifera
gb|ADY04414.1|  cysteine protease                                       137   6e-38   Clarkia xantiana subsp. xantiana
gb|ADY04359.1|  cysteine protease                                       137   7e-38   Clarkia xantiana subsp. xantiana
dbj|BAC57957.1|  thiol protease                                         138   8e-38   Tripolium pannonicum [sea starwort]
gb|ADY04482.1|  cysteine protease                                       137   8e-38   Clarkia xantiana subsp. xantiana
gb|ADY04358.1|  cysteine protease                                       136   1e-37   Clarkia xantiana subsp. xantiana
gb|ADY04368.1|  cysteine protease                                       136   1e-37   Clarkia xantiana subsp. xantiana
gb|AAB16997.1|  thiol protease isoform A                                141   1e-37   Glycine max [soybeans]
dbj|BAD10859.1|  cysteine protease                                      142   1e-37   Tripolium pannonicum [sea starwort]
gb|ADY04480.1|  cysteine protease                                       136   2e-37   Clarkia xantiana subsp. xantiana
gb|ADY04268.1|  cysteine protease                                       136   2e-37   Clarkia xantiana subsp. xantiana
gb|ABK24153.1|  unknown                                                 142   2e-37   Picea sitchensis
emb|CAQ00101.1|  papain-like cysteine proteinase                        141   3e-37   Hordeum vulgare subsp. vulgare [barley]
gb|AAB53103.1|  cysteine protease                                       133   3e-37   Brassica napus [oilseed rape]
gb|ADY04295.1|  cysteine protease                                       135   3e-37   Clarkia xantiana subsp. xantiana
gb|EPS70818.1|  cysteine proteinase                                     140   8e-37   Genlisea aurea
gb|EPS65881.1|  cysteine proteinase                                     139   1e-36   Genlisea aurea
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583             134   6e-35   Selaginella moellendorffii
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274              134   8e-35   Selaginella moellendorffii
gb|KHN00877.1|  Cysteine proteinase 15A                                 130   1e-33   Glycine soja [wild soybean]
emb|CCA95098.1|  putative responsive to dehydration 19                  126   1e-33   Liriodendron tulipifera
gb|KEH43476.1|  papain family cysteine protease                         131   2e-33   Medicago truncatula
emb|CDX98179.1|  BnaC07g09190D                                          123   2e-33   Brassica napus [oilseed rape]
gb|ADY04490.1|  cysteine protease                                       125   2e-33   Clarkia xantiana subsp. xantiana
gb|KHN37802.1|  Cysteine proteinase 1                                   129   5e-33   Glycine soja [wild soybean]
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like            129   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg             129   6e-33   Capsella rubella
emb|CAB41090.1|  cysteine proteinase precursor-like protein             129   7e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33           129   8e-33   Glycine max [soybeans]
ref|NP_001236888.1|  cysteine proteinase precursor                      129   9e-33   Glycine max [soybeans]
ref|NP_567010.5|  Papain family cysteine protease                       129   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911             129   1e-32   Arabidopsis lyrata subsp. lyrata
gb|EMS59778.1|  Cysteine proteinase 15A                                 125   1e-32   Triticum urartu
ref|XP_008776953.1|  PREDICTED: cysteine proteinase-like                123   2e-32   Phoenix dactylifera
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                    128   2e-32   Arabis alpina [alpine rockcress]
ref|NP_001059639.1|  Os07g0480900                                       128   2e-32   
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like            126   2e-32   Malus domestica [apple tree]
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270          127   4e-32   Sorghum bicolor [broomcorn]
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like            127   5e-32   Cicer arietinum [garbanzo]
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like              127   5e-32   Setaria italica
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A                 127   5e-32   Malus domestica [apple tree]
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like          124   6e-32   Phoenix dactylifera
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A                 126   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A                 125   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAB16316.1|  cysteine proteinase precursor                          125   3e-31   Vicia sativa [spring vetch]
emb|CDY56961.1|  BnaA09g55030D                                          124   4e-31   Brassica napus [oilseed rape]
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494       124   4e-31   
emb|CDX73424.1|  BnaC08g25790D                                          124   4e-31   
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg             124   5e-31   
tpg|DAA40800.1|  TPA: putative cysteine protease family protein         124   6e-31   
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A                 124   6e-31   
gb|ABO93617.1|  papain-like cysteine proteinase                         119   6e-31   
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494       124   7e-31   
gb|AEQ54770.1|  cysteine proteinase CP1                                 124   8e-31   
emb|CAQ00102.1|  papain-like cysteine proteinase                        124   8e-31   
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                   123   1e-30   
ref|XP_001781954.1|  predicted protein                                  123   1e-30   
gb|EEC82027.1|  hypothetical protein OsI_25996                          126   2e-30   
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a               123   2e-30   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg                123   2e-30   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A                 123   2e-30   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A                 122   2e-30   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A                 122   3e-30   
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g             123   3e-30   
emb|CDO99795.1|  unnamed protein product                                122   3e-30   
emb|CCA95082.1|  putative responsive to dehydration 19                  117   3e-30   
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg             122   3e-30   
ref|XP_001761980.1|  predicted protein                                  122   4e-30   
gb|KJB73490.1|  hypothetical protein B456_011G235500                    121   6e-30   
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A                 121   6e-30   
gb|KHG08355.1|  Cysteinease 1                                           121   6e-30   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A                 121   8e-30   
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494       120   1e-29   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A                 120   1e-29   
emb|CDY13816.1|  BnaA09g43180D                                          118   2e-29   
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494       120   2e-29   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like            120   3e-29   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800          119   3e-29   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A                 119   5e-29   
emb|CAN64491.1|  hypothetical protein VITISV_015725                     118   5e-29   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A                 119   6e-29   
emb|CAB17077.1|  cysteine proteinase precursor                          118   7e-29   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                   118   8e-29   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A                 118   1e-28   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                         118   1e-28   
ref|XP_010103534.1|  putative cysteine proteinase A494                  118   1e-28   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg             118   1e-28   
gb|ADE76932.1|  unknown                                                 118   1e-28   
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like            117   2e-28   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like            117   2e-28   
emb|CBI31400.3|  unnamed protein product                                115   2e-28   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g             117   2e-28   
ref|XP_007510080.1|  unknown                                            117   5e-28   
ref|XP_002533377.1|  cysteine protease, putative                        115   9e-28   
ref|XP_007010012.1|  Papain family cysteine protease                    115   1e-27   
ref|XP_008647122.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin 7-...    113   3e-27   
ref|XP_003081549.1|  Cysteine proteinase Cathepsin F (ISS)              112   6e-27   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site               113   7e-27   
ref|XP_011469621.1|  PREDICTED: cysteine proteinase 15A-like            110   1e-26   
gb|AFW72358.1|  putative cysteine protease family protein               113   4e-26   
ref|XP_001419933.1|  predicted protein                                  107   2e-25   
gb|EPS63354.1|  hypothetical protein M569_11429                         108   4e-25   
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    103   2e-23   
ref|XP_003057227.1|  predicted protein                                  101   1e-22   
ref|XP_011169692.1|  PREDICTED: putative cysteine proteinase CG12163    103   1e-22   
emb|CAN71324.1|  hypothetical protein VITISV_013970                     101   2e-22   
ref|XP_006608091.1|  PREDICTED: uncharacterized protein LOC102680728    103   2e-22   
ref|XP_003696602.1|  PREDICTED: putative cysteine proteinase CG12...    102   4e-22   
gb|EFN80374.1|  Putative cysteine proteinase CG12163                    102   7e-22   
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896    102   7e-22   
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163    101   8e-22   
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...    101   8e-22   
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163    101   8e-22   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708       100   1e-21   
emb|CAN80141.1|  hypothetical protein VITISV_038978                   98.6    1e-21   
ref|XP_392381.3|  PREDICTED: putative cysteine proteinase CG12163...    100   1e-21   
ref|XP_006567715.1|  PREDICTED: putative cysteine proteinase CG12...    100   1e-21   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...  99.8    3e-21   
ref|XP_002505924.1|  cysteine endopeptidase                           96.7    3e-21   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904  99.8    4e-21   
ref|XP_001607324.1|  PREDICTED: uncharacterized protein LOC100123649  99.4    6e-21   
ref|XP_005184487.1|  PREDICTED: putative cysteine proteinase CG12...  99.0    6e-21   
ref|XP_005184486.1|  PREDICTED: putative cysteine proteinase CG12...  99.0    7e-21   
emb|CAN81617.1|  hypothetical protein VITISV_001998                   95.9    7e-21   
dbj|BAI44279.1|  cysteine proteinase inhibitor precursor              99.8    8e-21   
ref|XP_011493714.1|  AAEL017153-PA                                    99.0    9e-21   
gb|KFB38327.1|  AGAP002879-PB-like protein                            99.0    1e-20   
ref|XP_008550537.1|  PREDICTED: uncharacterized protein LOC103573287  98.6    1e-20   
emb|CAN81619.1|  hypothetical protein VITISV_002000                   95.1    1e-20   
gb|EFN65613.1|  Putative cysteine proteinase CG12163                  98.2    1e-20   
ref|XP_001844355.1|  conserved hypothetical protein                   98.6    2e-20   
ref|XP_001994049.1|  GH22731                                          97.4    2e-20   
emb|CBI23088.3|  unnamed protein product                              92.4    2e-20   
gb|EGI66903.1|  Putative cysteine proteinase                          97.8    2e-20   
ref|XP_011260522.1|  PREDICTED: uncharacterized protein LOC105253881  98.2    2e-20   
ref|XP_002000409.1|  GI10216                                          97.1    2e-20   
ref|XP_011052455.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  97.8    2e-20   
ref|XP_002017233.1|  GL22196                                          97.1    2e-20   
ref|XP_002056575.1|  GJ11017                                          96.7    3e-20   
ref|XP_002137768.1|  GA27408, isoform A                               96.7    3e-20   
ref|XP_002096026.1|  GE25302                                          96.3    3e-20   
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620  97.1    3e-20   
gb|AJF94882.1|  C1 family cathepsin F10                               97.4    4e-20   
ref|NP_730901.1|  CG12163, isoform A                                  96.3    4e-20   
ref|XP_002038380.1|  GM10654                                          95.9    5e-20   
ref|XP_001978897.1|  GG11133                                          95.9    5e-20   
ref|XP_001955780.1|  GF16067                                          95.9    5e-20   
gb|ETN61472.1|  hypothetical protein AND_006867                       96.7    6e-20   
ref|XP_003736743.1|  GA27408, isoform B                               94.7    6e-20   
gb|AFQ01139.1|  cathepsin F-like protease                             95.1    8e-20   
ref|NP_649521.1|  CG12163, isoform B                                  94.4    8e-20   
ref|XP_312034.5|  AGAP002879-PA                                       95.9    1e-19   
ref|XP_003436277.1|  AGAP002879-PB                                    95.9    1e-19   
gb|ACR08662.1|  cathepsin F                                           90.9    1e-19   
ref|XP_008195657.1|  PREDICTED: uncharacterized protein LOC662417...  95.9    1e-19   
ref|XP_008195656.1|  PREDICTED: uncharacterized protein LOC662417...  95.9    1e-19   
gb|EZA58965.1|  Putative cysteine proteinase                          95.1    2e-19   
ref|XP_002073772.1|  GK14287                                          94.4    2e-19   
ref|XP_011331416.1|  PREDICTED: uncharacterized protein LOC105275911  95.1    2e-19   
gb|ABE72973.1|  cathepsin L                                           90.9    3e-19   
gb|EHJ64782.1|  cysteine proteinase inhibitor precursor               89.0    3e-19   
ref|XP_003436276.1|  AGAP002879-PC                                    93.6    6e-19   
ref|XP_011309436.1|  PREDICTED: uncharacterized protein LOC105270293  92.8    1e-18   
emb|CDX82031.1|  BnaC08g35700D                                        89.4    1e-18   
ref|XP_002988513.1|  hypothetical protein SELMODRAFT_128220           86.7    1e-18   
emb|CBY11269.1|  unnamed protein product                              89.4    3e-18   
ref|XP_005184488.1|  PREDICTED: putative cysteine proteinase CG12...  90.5    3e-18   
gb|KDR17524.1|  Putative cysteine proteinase                          91.3    5e-18   
gb|ENN81374.1|  hypothetical protein YQE_02191                        91.3    5e-18   
emb|CBY31096.1|  unnamed protein product                              88.2    6e-18   
ref|XP_002979143.1|  hypothetical protein SELMODRAFT_110288           86.7    7e-18   
ref|XP_002427787.1|  Cathepsin F precursor, putative                  88.2    1e-17   
ref|XP_011434326.1|  PREDICTED: uncharacterized protein LOC105333...  89.4    1e-17   
ref|XP_011434325.1|  PREDICTED: uncharacterized protein LOC105333...  89.4    1e-17   
gb|KHN72698.1|  Putative cysteine proteinase                          83.6    1e-17   
gb|EKC42097.1|  Cathepsin F                                           89.4    1e-17   
gb|ABC48936.1|  cathepsin F like protease                             88.2    1e-17   
gb|ERL92611.1|  hypothetical protein D910_09924                       87.8    2e-17   
ref|XP_009047014.1|  hypothetical protein LOTGIDRAFT_172186           85.9    2e-17   
gb|AII16490.1|  cathepsin F                                           85.5    3e-17   
gb|ERG79645.1|  cysteine proteinase                                   82.0    4e-17   
emb|CAC94443.1|  cysteine proteinase                                  82.8    4e-17   
emb|CDJ26737.1|  cathepsin F-like cysteine peptidase protein          86.7    5e-17   
gb|AEW08440.1|  hypothetical protein 2_9845_02                        80.5    6e-17   
ref|NP_001156454.1|  cathepsin F isoform 2 precursor                  87.0    6e-17   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956           84.0    1e-16   
gb|KFM67613.1|  putative cysteine proteinase                          85.1    2e-16   
gb|ELT97360.1|  hypothetical protein CAPTEDRAFT_147978                82.8    2e-16   
gb|AFM37363.1|  cathepsin F1                                          84.3    3e-16   
ref|NP_001156453.1|  cathepsin F isoform 1 precursor                  84.7    4e-16   
gb|EYC18288.1|  hypothetical protein Y032_0028g1777                   78.6    7e-16   
dbj|BAN20819.1|  cysteine-type endopeptidase                          83.6    1e-15   
ref|XP_002682087.1|  predicted protein                                81.3    2e-15   
emb|CAC94444.1|  cysteine proteinase                                  78.6    2e-15   
gb|ABY75169.1|  cysteine protease                                     76.3    2e-15   
ref|XP_003115597.1|  CRE-TAG-196 protein                              82.0    2e-15   
ref|XP_009161938.1|  hypothetical protein T265_00017                  79.3    2e-15   
ref|XP_003389037.1|  PREDICTED: cathepsin L1-like                     80.5    3e-15   
dbj|GAA47436.1|  cathepsin L                                          79.7    3e-15   
ref|XP_002610214.1|  hypothetical protein BRAFLDRAFT_216923           79.7    3e-15   
ref|NP_505215.2|  Protein TAG-196                                     81.6    3e-15   
gb|EGT34543.1|  hypothetical protein CAEBREN_26318                    81.6    3e-15   
gb|AAF21461.1|U69120_1  cysteine proteinase PWCP1                     81.3    4e-15   
gb|EGT34572.1|  hypothetical protein CAEBREN_13324                    81.3    4e-15   
ref|XP_002119872.3|  PREDICTED: cathepsin L-like                      81.3    5e-15   
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...  80.9    5e-15   
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...  80.9    5e-15   
gb|AAR27011.1|  cysteine protease                                     78.2    1e-14   
ref|XP_002681317.1|  cysteine protease                                79.0    1e-14   
gb|EFX71333.1|  hypothetical protein DAPPUDRAFT_189155                78.2    1e-14   
gb|KIH48456.1|  cysteine proteinase family protein                    74.3    1e-14   
ref|XP_008472006.1|  PREDICTED: putative cysteine proteinase CG12163  76.3    2e-14   
ref|XP_001029851.1|  Papain family cysteine protease containing p...  77.4    3e-14   
ref|XP_635374.1|  cysteine protease                                   77.4    4e-14   
ref|XP_006121731.1|  PREDICTED: cathepsin W-like                      75.9    5e-14   
gb|AAT09103.1|  digestive cysteine proteinase                         77.0    5e-14   
ref|XP_009034680.1|  hypothetical protein AURANDRAFT_22129            76.6    6e-14   
ref|XP_006268168.1|  PREDICTED: cathepsin F-like                      77.8    7e-14   
dbj|BAF94154.1|  cathepsin F-like cysteine protease                   78.6    7e-14   
ref|XP_003148243.1|  hypothetical protein LOAG_12683                  75.1    9e-14   
gb|EFO15826.2|  hypothetical protein LOAG_12683                       74.7    1e-13   
dbj|GAM23991.1|  hypothetical protein SAMD00019534_071660             75.9    1e-13   
ref|XP_006007112.1|  PREDICTED: cathepsin F-like                      76.6    1e-13   
ref|XP_002635317.1|  C. briggsae CBR-TAG-196 protein                  77.0    2e-13   
ref|XP_003284553.1|  hypothetical protein DICPUDRAFT_96752            75.9    2e-13   
ref|XP_009035714.1|  hypothetical protein AURANDRAFT_53321            75.5    2e-13   
emb|CAX69889.1|  Temporarily Assigned Gene name                       76.6    2e-13   
gb|AAW25775.1|  SJCHGC00511 protein                                   76.6    2e-13   
ref|XP_003375070.1|  viral cathepsin                                  76.6    2e-13   
ref|XP_008177856.1|  PREDICTED: cathepsin W-like                      72.0    2e-13   
ref|XP_635417.1|  cysteine proteinase 1                               75.5    2e-13   
emb|CAA26255.1|  cysteine proteinase I precursor                      75.1    2e-13   
ref|XP_007438969.1|  PREDICTED: cathepsin F-like                      73.6    3e-13   
ref|XP_009064230.1|  hypothetical protein LOTGIDRAFT_204652           74.7    3e-13   
gb|AAB01769.1|  cysteine proteinase homolog                           75.1    3e-13   
ref|XP_004351999.1|  cysteine protease                                75.1    3e-13   
ref|XP_003747496.1|  PREDICTED: cathepsin L-like                      74.7    3e-13   
gb|KGB33519.1|  Cathepsin L                                           74.3    4e-13   
ref|XP_002734978.1|  PREDICTED: cathepsin F-like                      74.7    4e-13   
ref|XP_007056266.1|  PREDICTED: cathepsin F-like                      75.5    5e-13   
ref|XP_005351748.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      75.5    5e-13   
gb|EFB26202.1|  hypothetical protein PANDA_004780                     74.7    6e-13   
ref|XP_002916735.1|  PREDICTED: cathepsin W isoform X2                74.7    6e-13   
ref|XP_002970484.1|  hypothetical protein SELMODRAFT_93661            73.9    6e-13   
gb|ELV09527.1|  Cathepsin F                                           75.5    6e-13   
emb|CEF63690.1|  Cathepsin F                                          74.3    6e-13   
ref|XP_003777749.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      75.1    6e-13   
ref|XP_006980634.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      75.1    6e-13   
gb|AAV38405.1|  cathepsin F                                           75.1    6e-13   
ref|NP_003784.2|  cathepsin F precursor                               75.1    7e-13   
ref|XP_005305646.1|  PREDICTED: cathepsin W-like                      73.9    7e-13   
ref|XP_002755611.1|  PREDICTED: cathepsin F                           75.1    7e-13   
ref|XP_004051670.1|  PREDICTED: cathepsin F                           75.1    7e-13   
ref|XP_004437686.1|  PREDICTED: cathepsin W                           74.3    7e-13   
gb|AAF13146.1|AF136279_1  cathepsin F precursor                       75.1    7e-13   
ref|XP_008479908.1|  PREDICTED: putative cysteine proteinase CG12163  73.6    8e-13   
ref|XP_002978562.1|  hypothetical protein SELMODRAFT_109056           73.9    8e-13   
ref|XP_010364711.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      74.7    8e-13   
ref|XP_007972284.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      74.7    8e-13   
ref|XP_008479905.1|  PREDICTED: cathepsin L-like                      73.9    8e-13   
ref|XP_007648967.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      74.7    8e-13   
ref|XP_008577225.1|  PREDICTED: cathepsin F                           75.1    8e-13   
gb|EGW06365.1|  Cathepsin F                                           74.7    8e-13   
ref|NP_001133678.1|  Cathepsin F precursor                            74.7    9e-13   
ref|XP_009183845.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      74.7    9e-13   
ref|XP_005577203.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      74.7    9e-13   
ref|XP_010765827.1|  PREDICTED: cathepsin W                           74.7    9e-13   



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYK
Sbjct  281  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYK  340

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRN+CGVDSMVS VAAV+T TS+
Sbjct  341  ICRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYK
Sbjct  283  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRN+CGVDSMVS VAAV+T TS+
Sbjct  343  ICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYK
Sbjct  283  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRN+CGVDSMVS VAAV+T TS+
Sbjct  343  ICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYK
Sbjct  283  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRN+CGVDSMVS VAAV+T TS+
Sbjct  343  ICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYK
Sbjct  281  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYK  340

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRN+CGVDSMVS VAAV+T TS+
Sbjct  341  ICRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            +QTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYK
Sbjct  281  VQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYK  340

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRN+CGVDSMVS VAAV+T TS+
Sbjct  341  ICRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score =   169 bits (428),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYK
Sbjct  286  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGESGYYK  345

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRN+CGVDSMVS VAAV T +
Sbjct  346  ICRGRNVCGVDSMVSTVAAVQTSS  369



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGE+WGE GYYK
Sbjct  289  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGENWGESGYYK  348

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRGRNICGVDSMVS VAAV T + 
Sbjct  349  ICRGRNICGVDSMVSTVAAVQTASE  373



>sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, 
partial [Carica papaya]
 emb|CAA27609.1| pot. cysteine proteinase [Carica papaya]
Length=96

 Score =   159 bits (403),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RL+HGVLLVGYGSAGYAPIRLKEKPYW+IKNSWGE+WGE GYYK
Sbjct  12   MQTYIGGVSCPYICSRRLNHGVLLVGYGSAGYAPIRLKEKPYWVIKNSWGENWGENGYYK  71

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRGRNICGVDSMVS VAAV T + 
Sbjct  72   ICRGRNICGVDSMVSTVAAVHTTSQ  96



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 81/86 (94%), Gaps = 1/86 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+RLKEKPYWIIKNSWGE+WGE GYYK
Sbjct  287  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRLKEKPYWIIKNSWGENWGESGYYK  346

Query  183  ICRGRNICGVDSMVSLVAA-VTTPTS  257
            ICRGRNICGVDSMVS VAA V TP+ 
Sbjct  347  ICRGRNICGVDSMVSTVAAVVQTPSQ  372



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YK
Sbjct  290  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYK  349

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRNICGVDSMVS VAAV T +
Sbjct  350  ICRGRNICGVDSMVSTVAAVQTSS  373



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score =   167 bits (422),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YK
Sbjct  284  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYK  343

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAAV T
Sbjct  344  ICRGRNICGVDSMVSTVAAVQT  365



>gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides]
Length=156

 Score =   160 bits (406),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YK
Sbjct  73   MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYK  132

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRN+CGVDSMVS VAAV T +
Sbjct  133  ICRGRNVCGVDSMVSTVAAVQTSS  156



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 1/86 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE G+YK
Sbjct  281  MQTYVGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGFYK  340

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            IC+GRN+CGVDSMVS VAAV T TSN
Sbjct  341  ICQGRNVCGVDSMVSTVAAVHT-TSN  365



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 82/88 (93%), Gaps = 2/88 (2%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE GYYK
Sbjct  283  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGETWGENGYYK  342

Query  183  ICRGRNICGVDSMVSLVAAV--TTPTSN  260
            ICRGRNICGVDSMVS VAA   TTP S+
Sbjct  343  ICRGRNICGVDSMVSTVAAAVHTTPGSH  370



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE GYYK
Sbjct  290  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGYYK  349

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRN+CGVDS+VS VAAV T
Sbjct  350  ICRGRNVCGVDSLVSTVAAVNT  371



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YK
Sbjct  284  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYK  343

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAAV T
Sbjct  344  ICRGRNICGVDSMVSTVAAVQT  365



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YK
Sbjct  284  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYK  343

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAAV T
Sbjct  344  ICRGRNICGVDSMVSTVAAVQT  365



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGS+GYAPIR+KEKPYWIIKNSWGE WGE GYYK
Sbjct  289  MQTYIGGVSCPYICSKRLDHGVLLVGYGSSGYAPIRMKEKPYWIIKNSWGEHWGENGYYK  348

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRG NICGVDSMVS VAAV T T
Sbjct  349  ICRGHNICGVDSMVSTVAAVHTST  372



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 82/86 (95%), Gaps = 1/86 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE G+YK
Sbjct  293  MQTYVGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGENWGENGFYK  352

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRN+CGVDSMVS VAAV T TSN
Sbjct  353  ICRGRNVCGVDSMVSTVAAVHT-TSN  377



>ref|XP_009351218.1| PREDICTED: cysteine proteinase RD19a-like, partial [Pyrus x bretschneideri]
Length=282

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YK
Sbjct  196  MQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYK  255

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRNICGVDSMVS VAA +  T++
Sbjct  256  ICRGRNICGVDSMVSTVAAASVKTNS  281



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE G+YK
Sbjct  290  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGFYK  349

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRN+CGVDS+VS VAAV T
Sbjct  350  ICRGRNVCGVDSLVSTVAAVNT  371



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YK
Sbjct  285  MQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYK  344

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRNICGVDSMVS VAA +  T++
Sbjct  345  ICRGRNICGVDSMVSTVAAASVKTNS  370



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YK
Sbjct  285  MQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYK  344

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRNICGVDSMVS VAA +  T++
Sbjct  345  ICRGRNICGVDSMVSTVAAASVKTNS  370



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YK
Sbjct  285  MQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYK  344

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRNICGVDSMVS VAA +  T++
Sbjct  345  ICRGRNICGVDSMVSTVAAASVKTNS  370



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYK
Sbjct  293  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYK  352

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRN+CGVDSMVS VAA 
Sbjct  353  ICRGRNVCGVDSMVSTVAAA  372



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYK
Sbjct  293  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYK  352

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRN+CGVDSMVS VAA 
Sbjct  353  ICRGRNVCGVDSMVSTVAAA  372



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score =   164 bits (415),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+
Sbjct  289  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYR  348

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAAV T
Sbjct  349  ICRGRNICGVDSMVSTVAAVNT  370



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score =   164 bits (415),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YK
Sbjct  281  MQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYK  340

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            IC+GRNICGVDSMVS VAA +  T+
Sbjct  341  ICKGRNICGVDSMVSTVAAASVETN  365



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+
Sbjct  289  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYR  348

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAAV T
Sbjct  349  ICRGRNICGVDSMVSTVAAVNT  370



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score =   164 bits (414),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YK
Sbjct  281  MQTYVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYK  340

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            IC+GRNICGVDSMVS VAA +  T+
Sbjct  341  ICKGRNICGVDSMVSTVAAASVETN  365



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score =   164 bits (415),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCP ICSKRLDHGVLLVGYG AGYAPIR KEKPYWIIKNSWGE WGEKGYYK
Sbjct  296  MQTYIGGVSCPLICSKRLDHGVLLVGYGEAGYAPIRRKEKPYWIIKNSWGEKWGEKGYYK  355

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAAV+T
Sbjct  356  ICRGRNICGVDSMVSTVAAVST  377



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score =   164 bits (416),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYI GVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGESWGE G+YK
Sbjct  311  MQTYIKGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGESWGEDGFYK  370

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAAV T
Sbjct  371  ICRGRNICGVDSMVSTVAAVDT  392



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score =   164 bits (414),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+
Sbjct  289  MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYR  348

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAAV T
Sbjct  349  ICRGRNICGVDSMVSTVAAVNT  370



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGSAGY+P+R+KEKPYWIIKNSWGE+WGEKG+YK
Sbjct  291  MQTYVGGVSCPYICSKRLDHGVLLVGYGSAGYSPVRMKEKPYWIIKNSWGENWGEKGFYK  350

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRNICGVDSMVS VAAV
Sbjct  351  ICRGRNICGVDSMVSTVAAV  370



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYK
Sbjct  293  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYK  352

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRN+CGVDSMVS +AA 
Sbjct  353  ICRGRNVCGVDSMVSTIAAA  372



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYK
Sbjct  248  MQTYIGGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYK  307

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRGRNICGVDSMVS VAAV T T 
Sbjct  308  ICRGRNICGVDSMVSTVAAVHTTTQ  332



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS  Y+PIRLKEKPYWIIKNSWGE+WGE GYYK
Sbjct  279  MQTYVGGVSCPYICSKRLDHGVLLVGYGSGAYSPIRLKEKPYWIIKNSWGETWGENGYYK  338

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRNICGVDSMVS VAAV T T
Sbjct  339  ICRGRNICGVDSMVSTVAAVHTTT  362



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYK
Sbjct  279  MQTYIGGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYK  338

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRNICGVDSMVS VAAV T T
Sbjct  339  ICRGRNICGVDSMVSTVAAVHTTT  362



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAGY+PIR+K+KPYWIIKNSWGE WGE G+YK
Sbjct  284  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYSPIRMKDKPYWIIKNSWGEKWGENGFYK  343

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRN+CGVDSMVS VAAV T +
Sbjct  344  ICRGRNVCGVDSMVSTVAAVQTTS  367



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVLLVGYG AGYAPIRLKEKPYWIIKNSWGESWGE GYYK
Sbjct  251  MQTYIGGVSCPYICGKNLDHGVLLVGYGKAGYAPIRLKEKPYWIIKNSWGESWGENGYYK  310

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRN+CGVDSMVS VAAV T
Sbjct  311  ICRGRNVCGVDSMVSTVAAVHT  332



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RLDHGVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YK
Sbjct  284  MQTYIGGVSCPYICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYK  343

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRN+CGVDSMVS VAAV T +
Sbjct  344  ICRGRNVCGVDSMVSTVAAVQTSS  367



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCP+ICSKRLDHGVLLVGYG+A YAPIRLKEKPYWIIKNSWGE+WGE GYYK
Sbjct  295  MQTYIGGVSCPFICSKRLDHGVLLVGYGAASYAPIRLKEKPYWIIKNSWGENWGENGYYK  354

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRG N+CGVDSMVS VAAV+T
Sbjct  355  ICRGHNVCGVDSMVSTVAAVST  376



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score =   164 bits (415),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 71/86 (83%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVS PYICS+RLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YK
Sbjct  359  MQTYVGGVSYPYICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYK  418

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRNICGVDSMVS VAA +  T++
Sbjct  419  ICRGRNICGVDSMVSTVAAASVKTNS  444



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWGE+WGE GYYK
Sbjct  283  MQTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGENWGENGYYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAA+ T
Sbjct  343  ICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE G+YK
Sbjct  279  MQTYVGGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGFYK  338

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRGRNICGVDSMVS VAAV T T 
Sbjct  339  ICRGRNICGVDSMVSTVAAVHTTTQ  363



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 80/87 (92%), Gaps = 2/87 (2%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRL-DHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTYIGGVSCPYICSKRL DHGVLLVGYGSAG+APIR KEKPYWIIKNSWGESWGEKGYY
Sbjct  289  MQTYIGGVSCPYICSKRLLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGESWGEKGYY  348

Query  180  KICRGRNICGVDSMVSLVAAVTTPTSN  260
            KICRGRNICG+DSMVS VAA   PT N
Sbjct  349  KICRGRNICGMDSMVSAVAAA-VPTVN  374



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score =   160 bits (404),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYK
Sbjct  206  MQTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGENGYYK  265

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRN+CGVDSMVS V A+ T
Sbjct  266  ICRGRNVCGVDSMVSTVTAIHT  287



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score =   163 bits (413),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 71/86 (83%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVS PYICS+RLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YK
Sbjct  361  MQTYVGGVSYPYICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYK  420

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRNICGVDSMVS VAA +  T++
Sbjct  421  ICRGRNICGVDSMVSTVAAASVKTNS  446



>dbj|BAD94010.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
Length=86

 Score =   153 bits (387),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  1    MQTYIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYK  60

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            IC+GRNICGVDSMVS VAA  + T++
Sbjct  61   ICKGRNICGVDSMVSTVAATVSTTAH  86



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYK
Sbjct  283  MQTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAA+ T
Sbjct  343  ICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKRLDHGVLLVGYGS GYAPIRLK+KPYWIIKNSWGE WGE GYYK
Sbjct  286  MQTYIGGVSCPYICSKRLDHGVLLVGYGSEGYAPIRLKDKPYWIIKNSWGEGWGENGYYK  345

Query  183  ICRGRNICGVDSMVSLVAAVT  245
            ICRGRN+CGVDSMVS VAAV 
Sbjct  346  ICRGRNVCGVDSMVSTVAAVN  366



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGSA Y+PIR+KEKPYWIIKNSWGE+WGE G+YK
Sbjct  292  MQTYVGGVSCPYICSKRLDHGVLLVGYGSAAYSPIRMKEKPYWIIKNSWGENWGENGFYK  351

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAA+ T
Sbjct  352  ICRGRNICGVDSMVSTVAAIHT  373



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYK
Sbjct  283  MQTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAA+ T
Sbjct  343  ICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYK
Sbjct  283  MQTYVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAA+ T
Sbjct  343  ICRGRNICGVDSMVSTVAAIHT  364



>gb|AAL69389.1|AF462226_1 putative cysteine proteinase [Narcissus pseudonarcissus]
Length=136

 Score =   154 bits (389),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVLLVGYGS+G+APIR KEKPYWIIKNSWGE+WGEKGYYK
Sbjct  51   MQTYIGGVSCPYICGKHLDHGVLLVGYGSSGWAPIRFKEKPYWIIKNSWGENWGEKGYYK  110

Query  183  ICRGRNICGVDSMVSLVAAV-TTP  251
            IC+GRN+CGVDSMVS V A+ TTP
Sbjct  111  ICKGRNVCGVDSMVSTVTAIHTTP  134



>gb|ABK93575.1| unknown [Populus trichocarpa]
Length=157

 Score =   155 bits (391),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYK
Sbjct  73   MQTYIGGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYK  132

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICR RNICGVDSMVS VAA+
Sbjct  133  ICRARNICGVDSMVSTVAAI  152



>gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida]
Length=190

 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKR DHGVLLVGYGS G+APIR+KEKPYWIIKNSWGE WGE GYYK
Sbjct  108  MQTYVGGVSCPYICSKRQDHGVLLVGYGS-GFAPIRMKEKPYWIIKNSWGEKWGESGYYK  166

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRN+CGVDSMVS VAAV+T +
Sbjct  167  ICRGRNVCGVDSMVSTVAAVSTSS  190



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+ GVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE GYYK
Sbjct  277  MQTYMHGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGYYK  336

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRNICGVDSMVS VAAV T T
Sbjct  337  ICRGRNICGVDSMVSTVAAVHTTT  360



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGEKGYYK
Sbjct  287  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYSPIRLKQKPFWIIKNSWGETWGEKGYYK  346

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRN+CGVDSMVS V A+ T
Sbjct  347  ICRGRNVCGVDSMVSTVTAINT  368



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYK
Sbjct  293  MQTYIGGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYK  352

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRNICGVDS+VS VAAV
Sbjct  353  ICRGRNICGVDSLVSTVAAV  372



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYK
Sbjct  293  MQTYIGGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYK  352

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRNICGVDS+VS VAAV
Sbjct  353  ICRGRNICGVDSLVSTVAAV  372



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKR DHGV+LVGYGSAGYAP+RLK+KP+WIIKNSWGE+WGE GYYK
Sbjct  282  MQTYIGGVSCPYICSKRQDHGVVLVGYGSAGYAPVRLKDKPFWIIKNSWGENWGENGYYK  341

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRN+CGVD+MVS VAA+ T
Sbjct  342  ICRGRNVCGVDAMVSTVAAIHT  363



>gb|AAU81589.1| cysteine proteinase [Petunia x hybrida]
Length=257

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCP IC KR DHGVLLVGYGSAG+APIRLKEKPYWIIKNSWGESWGE+GYYK
Sbjct  171  MQTYVGGVSCPLICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGESWGEQGYYK  230

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRNICGVD+MVS V A  T   N
Sbjct  231  ICRGRNICGVDAMVSTVTAAHTTNPN  256



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYK
Sbjct  287  MQTYIGGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYK  346

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRNICGVDS+VS VAAV
Sbjct  347  ICRGRNICGVDSLVSTVAAV  366



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYK
Sbjct  285  MQTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYK  344

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGR+ICGVDSMVS VAA+ T
Sbjct  345  ICRGRDICGVDSMVSTVAAIHT  366



>gb|AJP16692.1| cysteine protease, partial [Striga hermonthica]
Length=148

 Score =   153 bits (386),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+ GVSCPYICSKRLDHGVLLVGYG +GYAPIR+K+KPYWIIKNSWGE+WGE GYYK
Sbjct  70   MQTYMKGVSCPYICSKRLDHGVLLVGYGESGYAPIRMKDKPYWIIKNSWGENWGENGYYK  129

Query  183  ICRGRNICGVDSMVSLVAA  239
            ICRGRN+CGVDSMVS VAA
Sbjct  130  ICRGRNVCGVDSMVSTVAA  148



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPY+CS+RL+HGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYK
Sbjct  281  MQTYIGGVSCPYVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYK  340

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRNICGVDSMVS VA+V T T
Sbjct  341  ICRGRNICGVDSMVSTVASVHTTT  364



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 80/84 (95%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RL+HGVLLVGYGS GY+PIR+K+KPYWIIKNSWGESWGE GYYK
Sbjct  285  MQTYIGGVSCPYICSRRLNHGVLLVGYGSEGYSPIRMKDKPYWIIKNSWGESWGENGYYK  344

Query  183  ICRGRNICGVDSMVSLVAAV-TTP  251
            ICRGR++CGVDSMVS VAA+ TTP
Sbjct  345  ICRGRDVCGVDSMVSTVAAIHTTP  368



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCP+IC+KRLDHGVLLVGYG+  +APIR+KEKPYWIIKNSWG +WGEKGYYK
Sbjct  295  MQTYVGGVSCPFICAKRLDHGVLLVGYGAGAFAPIRMKEKPYWIIKNSWGPNWGEKGYYK  354

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            IC+GRN+CGVDSMVS VAAVTT
Sbjct  355  ICQGRNLCGVDSMVSTVAAVTT  376



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score =   158 bits (400),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  284  MQTYIGGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYK  343

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRN+CGVDS+VS V A  +PT++
Sbjct  344  ICRGRNVCGVDSLVSTVTAAVSPTAH  369



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVLLVGYG+AGYAPIR K+KP+WIIKNSWGESWGE GYYK
Sbjct  274  MQTYIGGVSCPYICGKNLDHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGESWGEDGYYK  333

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRG+N+CGVDSMVS V A T  +SN
Sbjct  334  ICRGKNVCGVDSMVSSVVATTFTSSN  359



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKR DHGVLLVGYGSAGYAPIRLK+KP+WIIKNSWGESWGE GYY+
Sbjct  283  MQTYMGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRLKDKPFWIIKNSWGESWGENGYYR  342

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRNICGVD+MVS VAA+
Sbjct  343  ICRGRNICGVDAMVSSVAAI  362



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSKR DHGVLLVGYGSAGY+PIRLKEKPYWIIKNSWG +WGE+GYYK
Sbjct  286  MQTYIGGVSCPYICSKRQDHGVLLVGYGSAGYSPIRLKEKPYWIIKNSWGANWGEEGYYK  345

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            IC GRN+CG+D+MVS VAAV T T 
Sbjct  346  ICHGRNLCGMDTMVSSVAAVHTSTQ  370



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYI GVSCPYICSK LDHGVLLVGYGS GYAPIRLK+KPYWIIKNSWG +WGE GYYK
Sbjct  293  MQTYIKGVSCPYICSKHLDHGVLLVGYGSDGYAPIRLKDKPYWIIKNSWGANWGENGYYK  352

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRGRNICGVDSMVS VAAV T  +
Sbjct  353  ICRGRNICGVDSMVSTVAAVHTAAN  377



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYK
Sbjct  282  MQTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYK  341

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRN+CGVDSMVS VAA+
Sbjct  342  ICRGRNVCGVDSMVSTVAAI  361



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  283  MQTYIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            IC+GRNICGVDSMVS VAA  + T++
Sbjct  343  ICKGRNICGVDSMVSTVAATVSTTAH  368



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGE GYYK
Sbjct  284  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYSPIRLKDKPFWIIKNSWGENWGEHGYYK  343

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS V+A+ T
Sbjct  344  ICRGRNICGVDSMVSSVSAIHT  365



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYK
Sbjct  282  MQTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYK  341

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRN+CGVDSMVS VAA+
Sbjct  342  ICRGRNVCGVDSMVSTVAAI  361



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYK
Sbjct  282  MQTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYK  341

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRN+CGVDSMVS VAA+
Sbjct  342  ICRGRNVCGVDSMVSTVAAI  361



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RL+HGVLLVGYGSAGYAP R+KEKP+WIIKNSWGE+WGEKG+YK
Sbjct  282  MQTYIGGVSCPYICSRRLNHGVLLVGYGSAGYAPARMKEKPFWIIKNSWGENWGEKGFYK  341

Query  183  ICRGRNICGVDSMVSLVAA  239
            ICRGRNICGVDS+VS VAA
Sbjct  342  ICRGRNICGVDSLVSTVAA  360



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  283  MQTYIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            IC+GRNICGVDSMVS VAA  + T++
Sbjct  343  ICKGRNICGVDSMVSTVAATVSTTAH  368



>emb|CDQ51995.1| Cysteine proteinase, partial [Fagus sylvatica]
Length=165

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+ GVSCPYIC + LDHGVLLVG+GSAGYAPIRLKEKP+WIIKNSWGE+WGE GYYK
Sbjct  84   MQTYMKGVSCPYICGRHLDHGVLLVGFGSAGYAPIRLKEKPFWIIKNSWGENWGENGYYK  143

Query  183  ICRGRNICGVDSMVSLVAAVT  245
            ICRGRN+CGVDSMVS VAA+ 
Sbjct  144  ICRGRNVCGVDSMVSTVAAIN  164



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 79/84 (94%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYK
Sbjct  286  MQTYVGGVSCPYICSKRLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYK  344

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRN+CGVDSMVS VAAV+T +
Sbjct  345  ICRGRNVCGVDSMVSTVAAVSTSS  368



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+ GVSCPYIC+KRLDHGVLLVGYG  GY+PIR+KEKPYWIIKNSWG +WGE GYYK
Sbjct  296  MQTYMKGVSCPYICTKRLDHGVLLVGYGETGYSPIRMKEKPYWIIKNSWGPNWGEDGYYK  355

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRNICGVDSMVS VAAV+T +
Sbjct  356  ICRGRNICGVDSMVSTVAAVSTTS  379



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYIC K LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYYK
Sbjct  277  MQTYVGGVSCPYICGKHLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYYK  336

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRN+CGVDSMVS V+A  T
Sbjct  337  ICRGRNVCGVDSMVSSVSAFHT  358



>gb|AAB62937.1| stress-induced cysteine proteinase [Lavatera thuringiaca]
Length=175

 Score =   152 bits (383),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYG+AGYAP+R KEKP+WIIKNSWG +WGE GYYK
Sbjct  91   MQTYIGGVSCPYICFRSLDHGVLLVGYGAAGYAPVRFKEKPFWIIKNSWGANWGEDGYYK  150

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRGRN+CGVDSMVS VAA+ T + 
Sbjct  151  ICRGRNVCGVDSMVSSVAALQTKSQ  175



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYK
Sbjct  292  MQTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEDGYYK  351

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            IC+GRN+CGVDSMVS V AV +
Sbjct  352  ICKGRNVCGVDSMVSTVTAVRS  373



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPY+CS+RL+HGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYK
Sbjct  281  MQTYIGGVSCPYVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYK  340

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGR+ICGVDSMVS VA+V T T
Sbjct  341  ICRGRSICGVDSMVSTVASVHTTT  364



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGESWGE G+YK
Sbjct  288  MQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGESWGENGFYK  347

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            IC+GRNICGVDS+VS V+A  + T++
Sbjct  348  ICKGRNICGVDSLVSTVSATVSTTAH  373



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYGSA YAPIR KEKPYWIIKNSWGE WGE GYYK
Sbjct  289  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAAYAPIRFKEKPYWIIKNSWGEKWGENGYYK  348

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRN+CGVDSMVS VAAV +
Sbjct  349  ICRGRNVCGVDSMVSTVAAVRS  370



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  283  MQTYIGGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRN+CGVDS+VS V A  +P ++
Sbjct  343  ICRGRNVCGVDSLVSTVTATVSPAAH  368



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYK
Sbjct  283  MQTYIGGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYK  342

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICR RNICGVDSMVS VAA+
Sbjct  343  ICRARNICGVDSMVSTVAAI  362



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  283  MQTYIGGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRGRN+CGVDS+VS V A  +P ++
Sbjct  343  ICRGRNVCGVDSLVSTVTATVSPAAH  368



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  282  MQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYK  341

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            IC+GRNICGVDS+VS VAA  + T++
Sbjct  342  ICKGRNICGVDSLVSTVAATVSTTAH  367



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCP+ICS RLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGE+WGE GYYK
Sbjct  291  MQTYIGGVSCPFICSNRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGENWGENGYYK  350

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRNICGVDS+VS VAAV
Sbjct  351  ICRGRNICGVDSLVSTVAAV  370



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYK
Sbjct  283  MQTYIGGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYK  342

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICR RNICGVDSMVS VAA+
Sbjct  343  ICRARNICGVDSMVSTVAAI  362



>gb|KHN12668.1| Cysteine proteinase 15A [Glycine soja]
Length=156

 Score =   150 bits (380),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYK
Sbjct  72   MQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYK  131

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRN+CGVDSMVS VAA+
Sbjct  132  ICRGRNVCGVDSMVSTVAAI  151



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 79/84 (94%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYK
Sbjct  286  MQTYVGGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYK  344

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRN+CGVDSMVS VAAV+T +
Sbjct  345  ICRGRNVCGVDSMVSTVAAVSTSS  368



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+ GVSCPYICS+ LDHGV+LVGYGSAGYAPIR KEKPYWIIKNSWGESWGE GYYK
Sbjct  283  MQTYMKGVSCPYICSRNLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGESWGEDGYYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRG N CGVDSMVS VAA+ T T 
Sbjct  343  ICRGHNACGVDSMVSTVAAIQTTTQ  367



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYK
Sbjct  276  MQTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYK  335

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAA+ T
Sbjct  336  ICRGRNICGVDSMVSTVAALHT  357



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  283  MQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            IC+GRNICGVDS+VS V+A  + T++
Sbjct  343  ICKGRNICGVDSLVSTVSATVSTTAH  368



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYK
Sbjct  277  MQTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYK  336

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAA+ T
Sbjct  337  ICRGRNICGVDSMVSTVAALHT  358



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 79/84 (94%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYK
Sbjct  286  MQTYVGGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYK  344

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRN+CGVDSMVS VAAV+T +
Sbjct  345  ICRGRNVCGVDSMVSTVAAVSTSS  368



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYY 
Sbjct  282  MQTYIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYN  341

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRN+CGVDSMVS VAA+
Sbjct  342  ICRGRNVCGVDSMVSTVAAI  361



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYI GVSCPYICS+ LDHGVLLVGYGS GYAPIR+K+KPYWIIKNSWG +WGE GYYK
Sbjct  293  MQTYIRGVSCPYICSRHLDHGVLLVGYGSEGYAPIRMKDKPYWIIKNSWGANWGENGYYK  352

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRGRNICGVDSMVS VAAV T  +
Sbjct  353  ICRGRNICGVDSMVSTVAAVHTAAN  377



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYK
Sbjct  276  MQTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYK  335

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICGVDSMVS VAA+ T
Sbjct  336  ICRGRNICGVDSMVSTVAALHT  357



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYK
Sbjct  285  MQTYIGGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYK  344

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            IC GRN+CGVDSMVS VAAV T +S
Sbjct  345  ICMGRNVCGVDSMVSSVAAVHTTSS  369



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score =   156 bits (395),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+ GVSCPYIC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE+GYYK
Sbjct  317  MQTYMKGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEEGYYK  376

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRN+CGVDSMVS VAA+ T
Sbjct  377  ICRGRNVCGVDSMVSSVAALQT  398



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  283  MQTYIGGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            IC+GRNICGVDS+VS V A  + T++
Sbjct  343  ICKGRNICGVDSLVSTVTAAVSTTAH  368



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY  GVSCPYICS  LDHGVLLVGYGSAGY+PIR KEKPYWIIKNSWGESWGE+GYYK
Sbjct  287  MQTYKSGVSCPYICSSTLDHGVLLVGYGSAGYSPIRFKEKPYWIIKNSWGESWGEQGYYK  346

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRG NICGVDSMVS VAA+ T
Sbjct  347  ICRGHNICGVDSMVSTVAAIHT  368



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR K+KP+WIIKNSWGE+WGE GYYK
Sbjct  282  MQTYIGGVSCPYICSKSQDHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGENWGENGYYK  341

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRNICG+D+MVS VAA+ T
Sbjct  342  ICRGRNICGMDAMVSSVAAIHT  363



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 77/81 (95%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTYIGGVSCPYICSK  LDHGVLLVGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYY
Sbjct  282  MQTYIGGVSCPYICSKHMLDHGVLLVGYGTAGYAPIRFKDKPYWIIKNSWGENWGEQGYY  341

Query  180  KICRGRNICGVDSMVSLVAAV  242
            KICRGRN+CGVDSMVS VAA+
Sbjct  342  KICRGRNVCGVDSMVSTVAAL  362



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYK
Sbjct  277  MQTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYK  336

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRN+CGVDSMVS VAA+ T
Sbjct  337  ICRGRNVCGVDSMVSTVAALHT  358



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYK
Sbjct  282  MQTYIGGVSCPYICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYK  341

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRG N+CGVDSMVS VAA+ T +
Sbjct  342  ICRGHNVCGVDSMVSTVAAIHTSS  365



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYK
Sbjct  282  MQTYIGGVSCPYICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYK  341

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRG N+CGVDSMVS VAA+ T +
Sbjct  342  ICRGHNVCGVDSMVSTVAAIHTSS  365



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  282  MQTYIGGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYK  341

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            IC+GRNICGVDS+VS V A  + T++
Sbjct  342  ICKGRNICGVDSLVSTVTAAVSTTAH  367



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYK
Sbjct  285  MQTYIGGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYK  344

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            IC GRN+CGVDSMVS VAA+ T +S
Sbjct  345  ICMGRNVCGVDSMVSSVAAIHTTSS  369



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 77/83 (93%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTYIGGVSCPYIC K  LDHGVLLVGYGS+GYAPIR KEKPYWIIKNSWG+SWGE+GYY
Sbjct  283  MQTYIGGVSCPYICGKNHLDHGVLLVGYGSSGYAPIRFKEKPYWIIKNSWGQSWGEEGYY  342

Query  180  KICRGRNICGVDSMVSLVAAVTT  248
            KICRGRN+CGVDSMVS VAA+ T
Sbjct  343  KICRGRNVCGVDSMVSTVAAMHT  365



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYK
Sbjct  285  MQTYIGGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYK  344

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            IC GRN+CGVDSMVS VAA+ T +S
Sbjct  345  ICMGRNVCGVDSMVSSVAAIHTTSS  369



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YK
Sbjct  232  MQTYIGGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYK  291

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            IC+GRNICGVDS+VS VAA T+
Sbjct  292  ICKGRNICGVDSLVSTVAATTS  313



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYK
Sbjct  276  MQTYVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYK  335

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRGRN+CGVDSMVS VAA+ T
Sbjct  336  ICRGRNVCGVDSMVSTVAALHT  357



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  282  MQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYK  341

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            IC+GRNICGVDS+VS V+A  +  ++
Sbjct  342  ICKGRNICGVDSLVSTVSATVSANAH  367



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  282  MQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYK  341

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            IC+GRNICGVDS+VS V+A  +  ++
Sbjct  342  ICKGRNICGVDSLVSTVSATVSANAH  367



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 77/83 (93%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTYIGGVSCPYICSKR LDHGVLLVGYG+AGYAPIR K+KPYWI+KNSWGE+WGE+GYY
Sbjct  284  MQTYIGGVSCPYICSKRNLDHGVLLVGYGAAGYAPIRFKDKPYWIVKNSWGENWGEEGYY  343

Query  180  KICRGRNICGVDSMVSLVAAVTT  248
            KICRG NICG+DSMVS V A +T
Sbjct  344  KICRGNNICGIDSMVSTVTAAST  366



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YK
Sbjct  280  MQTYIGGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYK  339

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            IC+GRNICGVDS+VS VAA T+
Sbjct  340  ICKGRNICGVDSLVSTVAATTS  361



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 78/83 (94%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTYIGGVSCPYICSKR LDHGVL+VGYGSAGYAPIRLK+K YWIIKNSWGE+WGEKGYY
Sbjct  283  MQTYIGGVSCPYICSKRNLDHGVLIVGYGSAGYAPIRLKDKAYWIIKNSWGETWGEKGYY  342

Query  180  KICRGRNICGVDSMVSLVAAVTT  248
            KICRG NICGVDSMVS VA++ +
Sbjct  343  KICRGHNICGVDSMVSTVASIQS  365



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YK
Sbjct  280  MQTYIGGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYK  339

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            IC+GRNICGVDS+VS VAA T+
Sbjct  340  ICKGRNICGVDSLVSTVAATTS  361



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCP+ICSK LDHGVLLVGYGSAGY+PI LK+KPYWIIKNSWGE+WGE GYYK
Sbjct  293  MQTYIGGVSCPFICSKHLDHGVLLVGYGSAGYSPIHLKDKPYWIIKNSWGENWGENGYYK  352

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRG N+CGVDS+VS V A+ T + 
Sbjct  353  ICRGSNVCGVDSLVSTVVALNTKSQ  377



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KE+PYWIIKNSWGE+WGE G+YK
Sbjct  282  MQTYIGGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKERPYWIIKNSWGETWGENGFYK  341

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            IC+GRNICGVDS+VS V A  + T++
Sbjct  342  ICKGRNICGVDSLVSTVTAAVSTTAH  367



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  283  MQTYIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            IC+GRNICGVDS+VS V+A  +  ++
Sbjct  343  ICKGRNICGVDSLVSTVSATVSAKAH  368



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 77/86 (90%), Gaps = 1/86 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYK
Sbjct  283  MQTYIGGVSCPYICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYK  342

Query  183  ICRGR-NICGVDSMVSLVAAVTTPTS  257
            ICRGR NICG+D+MVS VAAV T T 
Sbjct  343  ICRGRHNICGMDTMVSTVAAVHTSTQ  368



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 77/85 (91%), Gaps = 1/85 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYK
Sbjct  283  MQTYIGGVSCPYICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYK  342

Query  183  ICRGR-NICGVDSMVSLVAAVTTPT  254
            ICRGR NICG+D+MVS VAAV T T
Sbjct  343  ICRGRHNICGMDTMVSTVAAVHTST  367



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYIC KR+DHGVLLVGYGS+G+APIRLKEKPYWI+KNSWG+SWGE+GYYK
Sbjct  281  MQTYVGGVSCPYICGKRIDHGVLLVGYGSSGFAPIRLKEKPYWILKNSWGQSWGEQGYYK  340

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRG N CGVDS+VS VAA+ T
Sbjct  341  ICRGYNSCGVDSLVSTVAALHT  362



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score =   153 bits (387),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYK
Sbjct  281  MQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYK  340

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRGRN+CGVDSMVS V A+   T 
Sbjct  341  ICRGRNVCGVDSMVSTVGAIHASTQ  365



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYK
Sbjct  281  MQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYK  340

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRGRN+CGVDSMVS V A+   T 
Sbjct  341  ICRGRNVCGVDSMVSTVGAIHASTQ  365



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RL+HGVLL+GYGS+GY+  RLKEKPYWIIKNSWGESWGE G+YK
Sbjct  279  MQTYIGGVSCPYICSRRLNHGVLLMGYGSSGYSQARLKEKPYWIIKNSWGESWGENGFYK  338

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            IC+GRNICGVDS+VS VAA T+
Sbjct  339  ICKGRNICGVDSLVSTVAAATS  360



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC+KRLDHGV +VGYG +GYAPIR KEKPYWIIKNSWGESWGE GYYK
Sbjct  280  MQTYIGGVSCPYICAKRLDHGVQIVGYGESGYAPIRFKEKPYWIIKNSWGESWGENGYYK  339

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRG+N CGVDSMVS V A+
Sbjct  340  ICRGQNACGVDSMVSTVGAI  359



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 77/83 (93%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTYIGGVSCPYICSK+ LDHGVL+VGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYY
Sbjct  286  MQTYIGGVSCPYICSKKNLDHGVLIVGYGAAGYAPIRFKDKPYWIIKNSWGENWGEEGYY  345

Query  180  KICRGRNICGVDSMVSLVAAVTT  248
            KICRG NICGVDSMVS V A +T
Sbjct  346  KICRGNNICGVDSMVSSVTAAST  368



>emb|CAB53397.1| cysteine protease [Medicago sativa]
Length=209

 Score =   148 bits (374),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 77/83 (93%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTY+ GVSCP+IC+K RLDHGVLLVG+GS GYAPIRLKEKPYWIIKNSWG++WGE+GYY
Sbjct  127  MQTYMSGVSCPHICAKARLDHGVLLVGFGSGGYAPIRLKEKPYWIIKNSWGQNWGEEGYY  186

Query  180  KICRGRNICGVDSMVSLVAAVTT  248
            KICRGRN+CGVDSMVS VAA  +
Sbjct  187  KICRGRNVCGVDSMVSTVAAAQS  209



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYK
Sbjct  308  MQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYK  367

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRN+CGVDSMVS VAA+
Sbjct  368  ICRGRNVCGVDSMVSTVAAI  387



>ref|XP_006665032.1| PREDICTED: cysteine proteinase 1-like [Oryza brachyantha]
Length=191

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 75/85 (88%), Gaps = 3/85 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVLLVGYGS+G+APIRLK+KPYWIIKNSWGE+WGE GYYK
Sbjct  104  MQTYIGGVSCPYICGKHLDHGVLLVGYGSSGFAPIRLKDKPYWIIKNSWGENWGEHGYYK  163

Query  183  ICRGRNI---CGVDSMVSLVAAVTT  248
            ICRG N+   CGVDSMVS V A+ T
Sbjct  164  ICRGSNVRDKCGVDSMVSTVTAIHT  188



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 78/84 (93%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYK
Sbjct  286  MQTYVGGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYK  344

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            I RGRN+CGVDSMVS VAAV+T +
Sbjct  345  IRRGRNVCGVDSMVSTVAAVSTSS  368



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVL+VGYG   YAPIR K KPYWIIKNSWGESWGE GYYK
Sbjct  283  MQTYIGGVSCPYICGKHLDHGVLIVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYK  342

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRN+CGVDSMVS VAA+
Sbjct  343  ICRGRNVCGVDSMVSTVAAI  362



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYGSAGYAPIR K+KPYWIIKNSWGE+WGE GYYK
Sbjct  287  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGENWGEDGYYK  346

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRG NICGV+SMVS V A+
Sbjct  347  ICRGHNICGVESMVSTVTAI  366



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 75/84 (89%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVLLVGYG+AGYAPIRLKEKPYWIIKNSWGE+WGE GYYK
Sbjct  287  MQTYIGGVSCPYICGKHLDHGVLLVGYGAAGYAPIRLKEKPYWIIKNSWGENWGENGYYK  346

Query  183  ICRGRNICGVDSMVSLV-AAVTTP  251
            ICRG N+CGV SMVS V AA  TP
Sbjct  347  ICRGHNVCGVASMVSTVTAAHVTP  370



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCP+IC K LDHGVLLVGYG+ GYAPIR KEKPYWIIKNSWGE+WGE GYYK
Sbjct  280  MQTYIGGVSCPFICGKHLDHGVLLVGYGAGGYAPIRFKEKPYWIIKNSWGENWGENGYYK  339

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRG N+CGVDSMVS V A+ T
Sbjct  340  ICRGPNMCGVDSMVSTVIAIHT  361



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICSK  DHGVLLVGYG+AGYAPIRLK+KPYWIIKNSWGE+WGE GYYK
Sbjct  294  MQTYIGGVSCPYICSKSQDHGVLLVGYGAAGYAPIRLKDKPYWIIKNSWGENWGENGYYK  353

Query  183  ICRG-RNICGVDSMVSLVAAVTT  248
             CR  RN+CGVDSMVS VAAV T
Sbjct  354  FCRADRNLCGVDSMVSSVAAVHT  376



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYK
Sbjct  280  MQTYIGGVSCPYVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYK  339

Query  183  ICRG-RNICGVDSMVSLVAAVTTPT  254
            ICRG  N+CG+DSMVS VAAV T T
Sbjct  340  ICRGPHNVCGMDSMVSTVAAVHTTT  364



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYK
Sbjct  280  MQTYIGGVSCPYVCSKNQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYK  339

Query  183  ICRG-RNICGVDSMVSLVAAVTTPT  254
            ICRG  N+CG+DSMVS VAAV T T
Sbjct  340  ICRGPHNMCGMDSMVSTVAAVHTTT  364



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+ GVSCP IC KR DHGVLLVGYGSAG+APIRLKEKPYWIIKNSWGE+WGE GYYK
Sbjct  277  MQTYMRGVSCPLICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGENWGEHGYYK  336

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRG NICGVD+MVS V A  T   N
Sbjct  337  ICRGHNICGVDAMVSTVTATHTTNPN  362



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   151 bits (381),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYK
Sbjct  280  MQTYIGGVSCPYVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYK  339

Query  183  ICRG-RNICGVDSMVSLVAAVTTPT  254
            ICRG  N+CG+DSMVS VAAV T T
Sbjct  340  ICRGPHNMCGMDSMVSTVAAVHTTT  364



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYGSAGYAPIR K+KPYWIIKNSWG +WGE GYYK
Sbjct  289  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGGNWGEDGYYK  348

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRG+NICGV+SMVS V AV T
Sbjct  349  ICRGQNICGVESMVSTVTAVRT  370



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score =   150 bits (380),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 74/85 (87%), Gaps = 3/85 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYK
Sbjct  278  MQTYIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYK  337

Query  183  ICRG---RNICGVDSMVSLVAAVTT  248
            ICRG   +N CGVDSMVS V A+ T
Sbjct  338  ICRGPHVQNKCGVDSMVSTVTAIHT  362



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score =   150 bits (379),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYK
Sbjct  282  MQTYVGGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEQGYYK  341

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRG N CGVDS+VS VAA+
Sbjct  342  ICRGYNSCGVDSLVSTVAAL  361



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYIC + LDHGVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYYK
Sbjct  286  MQTYMGGVSCPYICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYK  345

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRGRN+CGVDSMVS VAA+ T + 
Sbjct  346  ICRGRNVCGVDSMVSSVAALHTKSQ  370



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 76/83 (92%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTY+ GVSCPYIC+K RLDHGVLL+G+G  GYAPIRLKEKPYWIIKNSWG++WGE+GYY
Sbjct  282  MQTYMSGVSCPYICAKARLDHGVLLLGFGQGGYAPIRLKEKPYWIIKNSWGQNWGEEGYY  341

Query  180  KICRGRNICGVDSMVSLVAAVTT  248
            KICRGRN+CGVDSMVS VAA  +
Sbjct  342  KICRGRNVCGVDSMVSTVAAAQS  364



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WG  GYYK
Sbjct  281  MQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGGNGYYK  340

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRGRN+CGVDSMVS V A+   T 
Sbjct  341  ICRGRNVCGVDSMVSTVGAIHASTQ  365



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 75/85 (88%), Gaps = 3/85 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYK
Sbjct  292  MQTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYK  351

Query  183  ICRG---RNICGVDSMVSLVAAVTT  248
            ICRG   +N CGVDSMVS V A+ T
Sbjct  352  ICRGPHDKNKCGVDSMVSSVTAIHT  376



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYK
Sbjct  277  MQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYK  336

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRG NICGVD+MVS V A  T   N
Sbjct  337  ICRGHNICGVDAMVSTVTAAHTTNPN  362



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTY+ GVSCPYICSKR LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYY
Sbjct  289  MQTYMKGVSCPYICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYY  348

Query  180  KICRGRNICGVDSMVSLVAAVTTPT  254
             IC+G+N+CG +SMVS VAA  TP 
Sbjct  349  FICKGKNVCGSESMVSSVAAAATPN  373



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQ+Y GGVSCP+ICS  L+HGVLLVGYGSAGY+PIR KEKPYW++KNSWG++WGE GYYK
Sbjct  282  MQSYAGGVSCPFICSTSLNHGVLLVGYGSAGYSPIRFKEKPYWLLKNSWGQNWGEHGYYK  341

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRG NICGVDSMVS VAA+ + T
Sbjct  342  ICRGHNICGVDSMVSTVAAIQSAT  365



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+ GVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYK
Sbjct  282  MQTYVKGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGYYK  341

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRG N CGVDS+VS VA++ T
Sbjct  342  ICRGHNPCGVDSLVSTVASLHT  363



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYK
Sbjct  277  MQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYK  336

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRG NICGVD+MVS V A  T   N
Sbjct  337  ICRGHNICGVDAMVSTVTAAHTTNPN  362



>gb|AGS43121.1| cysteine protease 1, partial [Zea mays]
Length=90

 Score =   142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 75/83 (90%), Gaps = 3/83 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYK
Sbjct  3    MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYK  62

Query  183  ICRG---RNICGVDSMVSLVAAV  242
            ICRG   RN CGVDSMVS V+AV
Sbjct  63   ICRGSNVRNKCGVDSMVSTVSAV  85



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 3/85 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYG+AG+APIRLK+KPYWIIKNSWGE+WGE GYYK
Sbjct  284  MQTYIGGVSCPYICGRTLDHGVLLVGYGAAGFAPIRLKDKPYWIIKNSWGENWGENGYYK  343

Query  183  ICRG---RNICGVDSMVSLVAAVTT  248
            ICRG   RN CGVDSMVS V+AV T
Sbjct  344  ICRGSNVRNKCGVDSMVSTVSAVRT  368



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 76/85 (89%), Gaps = 2/85 (2%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYI GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYK
Sbjct  281  MQTYIAGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYK  340

Query  183  ICRGR-NICGVDSMVSLVAAV-TTP  251
            ICRG  NICGVD+MVS VAAV TTP
Sbjct  341  ICRGTPNICGVDTMVSTVAAVNTTP  365



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYK
Sbjct  277  MQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYK  336

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRG NICGVD+MVS V A  T   N
Sbjct  337  ICRGHNICGVDAMVSTVTAAHTTNPN  362



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYK
Sbjct  279  MQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYK  338

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRG NICGVD+MVS V A  T   N
Sbjct  339  ICRGHNICGVDAMVSTVTAAHTTNPN  364



>emb|CAA57675.1| cysteine proteinase [Zea mays]
Length=145

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 75/83 (90%), Gaps = 3/83 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G+AP+RLK+KPYWIIKNSWGE+WGE GYYK
Sbjct  58   MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPMRLKDKPYWIIKNSWGENWGENGYYK  117

Query  183  ICRG---RNICGVDSMVSLVAAV  242
            ICRG   RN CGVDSMVS V+AV
Sbjct  118  ICRGSNVRNKCGVDSMVSTVSAV  140



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYK
Sbjct  279  MQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYK  338

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRG NICGVD+MVS V A  T   N
Sbjct  339  ICRGHNICGVDAMVSTVTAAHTTNPN  364



>gb|EAY93546.1| hypothetical protein OsI_15336 [Oryza sativa Indica Group]
Length=348

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 75/85 (88%), Gaps = 3/85 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYK
Sbjct  259  MQTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYK  318

Query  183  ICRG---RNICGVDSMVSLVAAVTT  248
            ICRG   +N CGVDSMVS V A+ T
Sbjct  319  ICRGPHDKNKCGVDSMVSSVTAIHT  343



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 75/85 (88%), Gaps = 3/85 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYK
Sbjct  275  MQTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYK  334

Query  183  ICRG---RNICGVDSMVSLVAAVTT  248
            ICRG   +N CGVDSMVS V A+ T
Sbjct  335  ICRGPHDKNKCGVDSMVSSVTAIHT  359



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYICS+RL+HGVLLVGYGSAG+A  RLK+KPYWIIKNSWGE+WGE GYYK
Sbjct  283  MQTYIGGVSCPYICSRRLNHGVLLVGYGSAGFAQARLKKKPYWIIKNSWGETWGENGYYK  342

Query  183  ICRGRNICGVDSMVSLVA  236
            +CRGRNICGVDS+VS VA
Sbjct  343  LCRGRNICGVDSLVSTVA  360



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  263  MQTYMGGVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYK  322

Query  183  ICRGRNICGVDSMVSLVAAV  242
            +C+GRN+CGVDSMVS VAA 
Sbjct  323  LCKGRNVCGVDSMVSTVAAA  342



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYI GVSCPYIC K LDHGVLLVGYGSAGYAP+R K KPYWIIKNSWGE+WGE GYYK
Sbjct  286  MQTYIHGVSCPYICGKHLDHGVLLVGYGSAGYAPVRFKNKPYWIIKNSWGENWGENGYYK  345

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRG N+CGVDSMVS V+A+
Sbjct  346  ICRGNNVCGVDSMVSSVSAL  365



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYIC + LDHGVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYY+
Sbjct  286  MQTYMGGVSCPYICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYR  345

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRGRN+CGVDSMVS VAA+ T + 
Sbjct  346  ICRGRNVCGVDSMVSSVAALHTKSQ  370



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 76/85 (89%), Gaps = 2/85 (2%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYI GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYK
Sbjct  281  MQTYIAGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYK  340

Query  183  ICRGR-NICGVDSMVSLVAAV-TTP  251
            ICRG  NICGVD+MVS VAAV TTP
Sbjct  341  ICRGTPNICGVDTMVSTVAAVHTTP  365



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 76/85 (89%), Gaps = 2/85 (2%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYI GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYK
Sbjct  283  MQTYIAGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYK  342

Query  183  ICRGR-NICGVDSMVSLVAAV-TTP  251
            ICRG  NICGVD+MVS VAAV TTP
Sbjct  343  ICRGTPNICGVDTMVSTVAAVHTTP  367



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPY+CSK  DHGVLLVG+GS+GY+PIRLKEKPYWIIKNSWG  WGE GYYK
Sbjct  282  MQTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYSPIRLKEKPYWIIKNSWGSMWGEHGYYK  341

Query  183  ICRG-RNICGVDSMVSLVAAVTTPTS  257
            ICRG  NICG+D+MVS VAAV T T 
Sbjct  342  ICRGSHNICGMDTMVSTVAAVQTSTQ  367



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+ GVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+G+YK
Sbjct  283  MQTYVKGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGFYK  342

Query  183  ICRGRNICGVDSMVSLVAAVTT  248
            ICRG N CGVDS+VS VA++ T
Sbjct  343  ICRGHNSCGVDSLVSTVASLHT  364



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  282  MQTYMGGVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYK  341

Query  183  ICRGRNICGVDSMVSLVAAV  242
            +C+GRN+CG+DSMVS VAA 
Sbjct  342  LCKGRNVCGIDSMVSTVAAA  361



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK
Sbjct  282  MQTYMGGVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYK  341

Query  183  ICRGRNICGVDSMVSLVAAV  242
            +C+GRN+CG+DSMVS VAA 
Sbjct  342  LCKGRNVCGIDSMVSTVAAA  361



>ref|NP_001052440.1| Os04g0311400 [Oryza sativa Japonica Group]
 dbj|BAF14354.1| Os04g0311400, partial [Oryza sativa Japonica Group]
Length=384

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 75/85 (88%), Gaps = 3/85 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYK
Sbjct  295  MQTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYK  354

Query  183  ICRG---RNICGVDSMVSLVAAVTT  248
            ICRG   +N CGVDSMVS V A+ T
Sbjct  355  ICRGPHDKNKCGVDSMVSSVTAIHT  379



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTY+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYY
Sbjct  279  MQTYMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYY  338

Query  180  KICRGRNICGVDSMVSLVAAVTT  248
            KICRGRN+CGVDSMVS VAA  +
Sbjct  339  KICRGRNVCGVDSMVSTVAAAQS  361



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYK
Sbjct  280  MQTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSMWGEHGYYK  339

Query  183  ICRG-RNICGVDSMVSLVAAVTTPT  254
            ICRG  N+CG+D+MVS VAAV T T
Sbjct  340  ICRGPHNMCGMDTMVSTVAAVHTTT  364



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 3/85 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYK
Sbjct  291  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYK  350

Query  183  ICRG---RNICGVDSMVSLVAAVTT  248
            ICRG   +N CGVDSMVS V A+ T
Sbjct  351  ICRGPHVKNKCGVDSMVSTVTAIHT  375



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCP +C + LDHGV+LVGYGSAGYAPIR KEKPYWIIKNSWG +WG++GYYK
Sbjct  290  MQTYIGGVSCPLVCLRSLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGPNWGDQGYYK  349

Query  183  ICRGRNICGVDSMVSLVAAVT  245
            ICRG N+CGVDSMVS VAAV 
Sbjct  350  ICRGHNVCGVDSMVSTVAAVN  370



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTY+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYY
Sbjct  279  MQTYMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYY  338

Query  180  KICRGRNICGVDSMVSLVAAVTT  248
            KICRGRN+CGVDSMVS VAA  +
Sbjct  339  KICRGRNVCGVDSMVSTVAAAQS  361



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTY+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYY
Sbjct  279  MQTYMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYY  338

Query  180  KICRGRNICGVDSMVSLVAAVTT  248
            KICRGRN+CGVDSMVS VAA  +
Sbjct  339  KICRGRNVCGVDSMVSTVAAAQS  361



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 3/83 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYYK
Sbjct  286  MQTYIGGVSCPYICGRHLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYK  345

Query  183  ICRG---RNICGVDSMVSLVAAV  242
            ICRG   RN CGVDSMVS V+A+
Sbjct  346  ICRGSNVRNKCGVDSMVSTVSAI  368



>gb|AEX97108.1| cysteine proteinase, partial [Malus domestica]
Length=128

 Score =   142 bits (357),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 73/81 (90%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTYI GVSCPYICSKR LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWG++WGE GYY
Sbjct  8    MQTYIKGVSCPYICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGQNWGENGYY  67

Query  180  KICRGRNICGVDSMVSLVAAV  242
             IC+GRNICG +SMVS VAA 
Sbjct  68   LICKGRNICGSESMVSSVAAT  88



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 77/81 (95%), Gaps = 2/81 (2%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTY+ GVSCPYIC+K RLDHGVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYY
Sbjct  278  MQTYMSGVSCPYICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYY  336

Query  180  KICRGRNICGVDSMVSLVAAV  242
            KICRGRNICGVDSMVS VAAV
Sbjct  337  KICRGRNICGVDSMVSTVAAV  357



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 77/81 (95%), Gaps = 2/81 (2%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTY+ GVSCPYIC+K RLDHGVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYY
Sbjct  274  MQTYMSGVSCPYICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYY  332

Query  180  KICRGRNICGVDSMVSLVAAV  242
            KICRGRNICGVDSMVS VAAV
Sbjct  333  KICRGRNICGVDSMVSTVAAV  353



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+ GVSCPYIC K L+HGVLLVGYGSAGYAP R KEK YWIIKNSWGE+WGE GYYK
Sbjct  285  MQTYVHGVSCPYICGKHLNHGVLLVGYGSAGYAPARFKEKSYWIIKNSWGENWGENGYYK  344

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRNICGVDSMVS V A+
Sbjct  345  ICRGRNICGVDSMVSSVTAI  364



>emb|CAH59428.1| cysteine protease 2 [Plantago major]
Length=245

 Score =   145 bits (365),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC K LDHGVL+VGYG+ GYAP+RLK KPYWIIKNSWGESWGE GYYK
Sbjct  162  MQTYIGGVSCPYICGKSLDHGVLIVGYGT-GYAPVRLKNKPYWIIKNSWGESWGESGYYK  220

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRGRN+CGV+SMVS V A    T+
Sbjct  221  ICRGRNVCGVESMVSSVTAAHFTTT  245



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score =   148 bits (373),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 2/85 (2%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPY+CSK  DHGVLLVG+G +GYAPIRLKEKPYWIIKNSWG+ WGE GYYK
Sbjct  287  MQTYIGGVSCPYVCSKSQDHGVLLVGFGESGYAPIRLKEKPYWIIKNSWGKMWGEHGYYK  346

Query  183  ICRGR-NICGVDSMVSLVAAVT-TP  251
            ICRGR NICG+D+MVS VAAV  TP
Sbjct  347  ICRGRHNICGMDTMVSTVAAVQITP  371



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 3/85 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCP+IC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYK
Sbjct  311  MQTYIGGVSCPFICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYK  370

Query  183  ICRG---RNICGVDSMVSLVAAVTT  248
            ICRG   +N CGVDSMVS V A+ T
Sbjct  371  ICRGAHVKNKCGVDSMVSTVTAIHT  395



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GY +
Sbjct  235  MQTYVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYDE  294

Query  183  ICRGRNICGVDSMVSLVAAV  242
            ICRGRN+CGVDSMVS VAA+
Sbjct  295  ICRGRNVCGVDSMVSTVAAI  314



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 3/85 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYK
Sbjct  317  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYK  376

Query  183  ICRG---RNICGVDSMVSLVAAVTT  248
            ICRG   +N CGVDSMVS V A+ T
Sbjct  377  ICRGPHVKNKCGVDSMVSTVTAIHT  401



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 73/83 (88%), Gaps = 3/83 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYK
Sbjct  300  MQTYIGGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYK  359

Query  183  ICRG---RNICGVDSMVSLVAAV  242
            +CRG   +N CGVDSMVS V A+
Sbjct  360  LCRGPFVKNKCGVDSMVSTVTAI  382



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 75/83 (90%), Gaps = 3/83 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYK
Sbjct  284  MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYK  343

Query  183  ICRG---RNICGVDSMVSLVAAV  242
            ICRG   RN CGVDSMVS V+AV
Sbjct  344  ICRGSNVRNKCGVDSMVSTVSAV  366



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 75/83 (90%), Gaps = 3/83 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYK
Sbjct  284  MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYK  343

Query  183  ICRG---RNICGVDSMVSLVAAV  242
            ICRG   RN CGVDSMVS V+AV
Sbjct  344  ICRGSNVRNKCGVDSMVSTVSAV  366



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYK
Sbjct  288  MQTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYK  347

Query  183  ICRG-RNICGVDSMVSLVAAVTT  248
            ICRG  N+CG+D+MVS VAAV T
Sbjct  348  ICRGPHNMCGMDTMVSTVAAVHT  370



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYK
Sbjct  288  MQTYIGGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYK  347

Query  183  ICRG-RNICGVDSMVSLVAAVTT  248
            ICRG  N+CG+D+MVS VAAV T
Sbjct  348  ICRGPHNMCGMDTMVSTVAAVHT  370



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQ Y+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYY
Sbjct  274  MQAYMSGVSCPYVCAKARLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYY  333

Query  180  KICRGRNICGVDSMVSLVAAVTT  248
            KICRGRN+CGVDSMVS VAA  +
Sbjct  334  KICRGRNVCGVDSMVSTVAAAQS  356



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 3/85 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G+AP RLK KPYW+IKNSWGE+WGEKGYYK
Sbjct  289  MQTYIGGVSCPYICGRSLDHGVLLVGYGASGFAPSRLKNKPYWVIKNSWGENWGEKGYYK  348

Query  183  ICRG---RNICGVDSMVSLVAAVTT  248
            ICRG   RN CGVDSMVS VAA  T
Sbjct  349  ICRGSNVRNKCGVDSMVSTVAAAHT  373



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+ GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYK
Sbjct  277  MQTYVRGVSCPLICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYK  336

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRG NICGVD+MVS V A  T   N
Sbjct  337  ICRGHNICGVDAMVSTVTATHTTNPN  362



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 77/86 (90%), Gaps = 1/86 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTYIGGVSCPY+C KR LDHGVLLVGYG+AGY+ IRLK KPYWI+KNSWGESWGE+GYY
Sbjct  288  MQTYIGGVSCPYVCGKRNLDHGVLLVGYGAAGYSTIRLKNKPYWIVKNSWGESWGEEGYY  347

Query  180  KICRGRNICGVDSMVSLVAAVTTPTS  257
            KIC+G N+CGV+SMVS V A+ T ++
Sbjct  348  KICKGHNVCGVESMVSSVNAIHTTSA  373



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GG+SCPYIC++RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYK
Sbjct  247  MQTYVGGISCPYICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYK  306

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRGRNICGVDSMVS VAA  T T 
Sbjct  307  ICRGRNICGVDSMVSTVAAAHTTTQ  331



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+ GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYK
Sbjct  290  MQTYVRGVSCPLICLKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYK  349

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRG NICGVD+MVS V A  T   N
Sbjct  350  ICRGHNICGVDAMVSTVTATHTTNPN  375



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score =   145 bits (365),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GG+SCPYIC++RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYK
Sbjct  246  MQTYVGGISCPYICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYK  305

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRGRNICGVDSMVS VAA  T T 
Sbjct  306  ICRGRNICGVDSMVSTVAAAHTNTQ  330



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCP +C K  DHGVLLVGYGSAG+APIRLK KPYWIIKNSWGE WGE GYYK
Sbjct  280  MQTYIGGVSCPLVCFKHQDHGVLLVGYGSAGFAPIRLKAKPYWIIKNSWGEHWGEHGYYK  339

Query  183  ICRGR-NICGVDSMVSLVAAVTTPTSN  260
            ICRG+ NICGVD+MVS V A  T   N
Sbjct  340  ICRGQHNICGVDAMVSTVTAAHTTNPN  366



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTY+ G+SCPYICSKR LDHGVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYY
Sbjct  289  MQTYMKGISCPYICSKRNLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYY  348

Query  180  KICRGRNICGVDSMVSLVAAV  242
             IC+G+NICG +SMVS VAA+
Sbjct  349  FICKGKNICGSESMVSSVAAI  369



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 3/85 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+K YWIIKNSWGE+WGE GYYK
Sbjct  286  MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKAYWIIKNSWGENWGEHGYYK  345

Query  183  ICRG---RNICGVDSMVSLVAAVTT  248
            ICRG   RN CGVDSMVS V+A+ T
Sbjct  346  ICRGSNVRNKCGVDSMVSTVSAIHT  370



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 3/83 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYK
Sbjct  214  MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYK  273

Query  183  ICRG---RNICGVDSMVSLVAAV  242
            ICRG   RN CGVDSMVS V+A 
Sbjct  274  ICRGSNVRNKCGVDSMVSTVSAT  296



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+ GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYK
Sbjct  275  MQTYVRGVSCPLICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYK  334

Query  183  ICRGRNICGVDSMVSLVAAVTTPTSN  260
            ICRG +ICGVD+MVS V A  T   N
Sbjct  335  ICRGHHICGVDAMVSTVTATHTTNPN  360



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 70/73 (96%), Gaps = 1/73 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYK
Sbjct  287  MQTYVGGVSCPYICSKKLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYK  345

Query  183  ICRGRNICGVDSM  221
            ICRGRN+CGVDSM
Sbjct  346  ICRGRNVCGVDSM  358



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 74/85 (87%), Gaps = 3/85 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYK
Sbjct  289  MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYK  348

Query  183  ICRG---RNICGVDSMVSLVAAVTT  248
            ICRG   RN CGVDSMVS V+A  +
Sbjct  349  ICRGSNVRNKCGVDSMVSTVSATHS  373



>gb|ADY04293.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04297.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+RLKEKPYWIIKNSWG+ WGE+G+YK
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRLKEKPYWIIKNSWGDKWGEEGFYK  135

Query  183  ICRGRNICG  209
            ICRGRNICG
Sbjct  136  ICRGRNICG  144



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 75/81 (93%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTY+GGVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYY
Sbjct  286  MQTYVGGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYY  345

Query  180  KICRGRNICGVDSMVSLVAAV  242
            K+CRG N+CG+++MVS VAA+
Sbjct  346  KLCRGHNVCGINNMVSTVAAI  366



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 3/83 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYK
Sbjct  281  MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYK  340

Query  183  ICRG---RNICGVDSMVSLVAAV  242
            ICRG   RN CGVDSMVS V+A 
Sbjct  341  ICRGSNVRNKCGVDSMVSTVSAT  363



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 75/81 (93%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTY+GGVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYY
Sbjct  286  MQTYVGGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYY  345

Query  180  KICRGRNICGVDSMVSLVAAV  242
            K+CRG N+CG+++MVS VAA+
Sbjct  346  KLCRGHNVCGINNMVSTVAAI  366



>gb|ADY04361.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YK
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYK  135

Query  183  ICRGRNICG  209
            ICRGRNICG
Sbjct  136  ICRGRNICG  144



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 3/83 (4%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYK
Sbjct  289  MQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYK  348

Query  183  ICRG---RNICGVDSMVSLVAAV  242
            ICRG   RN CGVDSMVS V+A 
Sbjct  349  ICRGSNVRNKCGVDSMVSTVSAT  371



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 75/81 (93%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTY+GGVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYY
Sbjct  286  MQTYVGGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYY  345

Query  180  KICRGRNICGVDSMVSLVAAV  242
            K+CRG N+CG+++MVS VAA+
Sbjct  346  KLCRGHNVCGINNMVSTVAAI  366



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score =   142 bits (358),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 71/84 (85%), Gaps = 4/84 (5%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPY C++RLDHGVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYK
Sbjct  247  MQTYVGGVSCPYTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYK  302

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRNICGVDSMVS VAA  T T
Sbjct  303  ICRGRNICGVDSMVSTVAAAQTTT  326



>gb|ADY04342.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   137 bits (345),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YK
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYK  135

Query  183  ICRGRNICG  209
            ICRGRNICG
Sbjct  136  ICRGRNICG  144



>gb|ADY04336.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04343.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   137 bits (345),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YK
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYK  135

Query  183  ICRGRNICG  209
            ICRGRNICG
Sbjct  136  ICRGRNICG  144



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYK
Sbjct  279  MQTYVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYK  338

Query  183  ICRGRNICGVDSMVSLV  233
            ICRG NICGVD+MVS V
Sbjct  339  ICRGHNICGVDAMVSTV  355



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score =   142 bits (358),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 71/84 (85%), Gaps = 4/84 (5%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPY C++RLDHGVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYK
Sbjct  246  MQTYVGGVSCPYTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYK  301

Query  183  ICRGRNICGVDSMVSLVAAVTTPT  254
            ICRGRNICGVDSMVS VAA  T T
Sbjct  302  ICRGRNICGVDSMVSTVAAAQTTT  325



>gb|ADY04262.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04263.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04264.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04265.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04266.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04267.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04269.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04270.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04271.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04272.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04273.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04274.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04275.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04276.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04277.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04278.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04279.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04280.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04281.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04282.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04283.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04284.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04285.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04286.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04287.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04288.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04289.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04290.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04291.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04292.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04294.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04296.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04298.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04299.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04300.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04301.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04302.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04303.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04304.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04305.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04306.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04307.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04308.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04309.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04310.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04311.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04312.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04313.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04314.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04315.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04316.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04317.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04318.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04319.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04320.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04321.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04322.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04323.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04324.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04325.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04326.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04327.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04328.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04329.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04330.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04331.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04332.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04333.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04334.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04335.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04337.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04338.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04339.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04340.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04341.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04344.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04345.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04346.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04347.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04348.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04349.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04350.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04351.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04352.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04353.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04354.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04355.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04356.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04357.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04360.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04362.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04363.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04364.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04365.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04366.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04367.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04369.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04370.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04371.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04372.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04373.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04374.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04377.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04378.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04379.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04380.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04381.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04382.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04383.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04384.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04385.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04386.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04387.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04388.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04389.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04391.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04392.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04393.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04394.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04395.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04396.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04397.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04398.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04399.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04400.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04401.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04402.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04403.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04404.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04405.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04406.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04407.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04408.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04409.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04410.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04411.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04412.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04413.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04415.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04416.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04417.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04418.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04419.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04420.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04421.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04422.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04423.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04424.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04425.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04426.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04427.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04428.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04429.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04430.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04431.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04432.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04433.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04434.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04435.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04436.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04437.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04438.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04439.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04440.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04441.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04442.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04443.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04444.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04445.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04446.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04447.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04448.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04449.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04450.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04451.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04452.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04453.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04454.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04455.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04456.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04458.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04459.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04460.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04461.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04462.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04463.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04464.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04465.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04466.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04467.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04468.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04469.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04470.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04471.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04472.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04473.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04474.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04475.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04476.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04478.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04481.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04483.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04484.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04485.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04486.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04487.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04488.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04489.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04491.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04493.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04501.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04502.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04503.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04504.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04505.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04506.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04507.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04508.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04509.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04510.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04511.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04512.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04513.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04514.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04515.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04516.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04517.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04518.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YK
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYK  135

Query  183  ICRGRNICG  209
            ICRGRNICG
Sbjct  136  ICRGRNICG  144



>gb|ADY04457.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YK
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYK  135

Query  183  ICRGRNICG  209
            ICRGRNICG
Sbjct  136  ICRGRNICG  144



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY  GVSCP++CS  LDHGVLLVGYGSAGY+PIR KEKPYWI+KNSW + WGE GYY+
Sbjct  283  MQTYTAGVSCPFLCSGELDHGVLLVGYGSAGYSPIRFKEKPYWILKNSWSKYWGEHGYYR  342

Query  183  ICRGRNICGVDSMVSLVAAVTTPTS  257
            ICRG+N+CGVDSMVS V A    TS
Sbjct  343  ICRGQNMCGVDSMVSSVVAAIQTTS  367



>gb|ADY04414.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YK
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYK  135

Query  183  ICRGRNICG  209
            ICRGRNICG
Sbjct  136  ICRGRNICG  144



>gb|ADY04359.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   137 bits (344),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YK
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDRWGEEGFYK  135

Query  183  ICRGRNICG  209
            ICRGRNICG
Sbjct  136  ICRGRNICG  144



>dbj|BAC57957.1| thiol protease [Aster tripolium]
Length=188

 Score =   138 bits (348),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 71/83 (86%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTYIG VSCPY+CSK+ LDHGVLLVGYGSAGYAP RLKEKPYWIIKNSWG  WGE GYY
Sbjct  106  MQTYIGKVSCPYVCSKKPLDHGVLLVGYGSAGYAPSRLKEKPYWIIKNSWGPDWGEDGYY  165

Query  180  KICRGRNICGVDSMVSLVAAVTT  248
            KIC G N+CG+D+MVS V + + 
Sbjct  166  KICSGHNLCGMDTMVSAVVSTSA  188



>gb|ADY04482.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   137 bits (344),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YK
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRVKEKPYWIIKNSWGDKWGEEGFYK  135

Query  183  ICRGRNICG  209
            ICRGRNICG
Sbjct  136  ICRGRNICG  144



>gb|ADY04358.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYG++GY+P+R+KEKPYWIIKNSWG+ WGE+G+YK
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGTSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYK  135

Query  183  ICRGRNICG  209
            ICRGRNICG
Sbjct  136  ICRGRNICG  144



>gb|ADY04368.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04375.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04376.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04390.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04477.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04479.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG  WGE+G+YK
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGNKWGEEGFYK  135

Query  183  ICRGRNICG  209
            ICRGRNICG
Sbjct  136  ICRGRNICG  144



>gb|AAB16997.1| thiol protease isoform A, partial [Glycine max]
Length=318

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 70/81 (86%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEK-GYY  179
            MQTY+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE  GY 
Sbjct  233  MQTYVGGVSCPYICGKHLDHGVLLVGYGEGRYAPIRFKNKPYWIIKNSWGESWGENDGYD  292

Query  180  KICRGRNICGVDSMVSLVAAV  242
            +ICRGRN+CGVD+MVS VAA+
Sbjct  293  EICRGRNVCGVDAMVSTVAAI  313



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 71/83 (86%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTYIG VSCPYICSK ++DHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE WGE GYY
Sbjct  281  MQTYIGQVSCPYICSKTKMDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGEDWGEDGYY  340

Query  180  KICRGRNICGVDSMVSLVAAVTT  248
            K+C G N CG+D+MVS V +  T
Sbjct  341  KLCSGYNACGMDTMVSAVVSTNT  363



>gb|ADY04480.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+++KEKPYWIIKNSWG+ WGE+G+YK
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVKMKEKPYWIIKNSWGDKWGEEGFYK  135

Query  183  ICRGRNICG  209
            ICRGRNICG
Sbjct  136  ICRGRNICG  144



>gb|ADY04268.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKP+WIIKNSWG+ WGE+G+YK
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPHWIIKNSWGDKWGEEGFYK  135

Query  183  ICRGRNICG  209
            ICRGRNICG
Sbjct  136  ICRGRNICG  144



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTY+GGVSCPY+C+K+ LDHGVLLVGYG+AGYAP RLK KP+WIIKNSWG  WGE GYY
Sbjct  307  MQTYVGGVSCPYVCNKQNLDHGVLLVGYGAAGYAPGRLKNKPFWIIKNSWGPDWGEDGYY  366

Query  180  KICRGRNICGVDSMVSLVAAVTTPTSN  260
            K+CRG N+CG+++MVS VAA    T +
Sbjct  367  KLCRGHNVCGINTMVSTVAAANIQTDD  393



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 72/85 (85%), Gaps = 4/85 (5%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTYIGGVSCPYIC + LDH V LVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYK
Sbjct  294  MQTYIGGVSCPYICGRHLDH-VFLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYK  352

Query  183  ICRG---RNICGVDSMVSLVAAVTT  248
            ICRG   +N CGVDSMVS V A+ T
Sbjct  353  ICRGPHVKNKCGVDSMVSTVTAIHT  377



>gb|AAB53103.1| cysteine protease, partial [Brassica napus]
Length=85

 Score =   133 bits (335),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 68/75 (91%), Gaps = 1/75 (1%)
 Frame = +3

Query  3    MQTYIGGVS-CPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTYIGGVS CPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+Y
Sbjct  11   MQTYIGGVSACPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFY  70

Query  180  KICRGRNICGVDSMV  224
            KICRGRN+CGVD  V
Sbjct  71   KICRGRNVCGVDMSV  85



>gb|ADY04295.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   135 bits (340),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYK  182
            MQTY+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+ +KEKPYWIIKNSWG+ WGE+G+YK
Sbjct  76   MQTYMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVSMKEKPYWIIKNSWGDKWGEEGFYK  135

Query  183  ICRGRNICG  209
            ICRGRNICG
Sbjct  136  ICRGRNICG  144



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score =   140 bits (352),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTYI GVSCP +C K  LDHGVL+VGYGS+GYAPIRLK KPYWI+KNSWG++WGEKGYY
Sbjct  273  MQTYIRGVSCPLVCGKSNLDHGVLMVGYGSSGYAPIRLKNKPYWIVKNSWGKNWGEKGYY  332

Query  180  KICRGRNICGVDSMVSLVAAVTT  248
            KICRG NICGV+SMVS V A+ +
Sbjct  333  KICRGSNICGVESMVSTVTAIHS  355



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    MQTYIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYY  179
            MQTY+ GVSCP IC K RLDHG+L+VGYG++GYAPIRLKEKPYWI+KNSWGE+WGE+GYY
Sbjct  256  MQTYVHGVSCPLICMKTRLDHGILIVGYGASGYAPIRLKEKPYWIVKNSWGENWGEQGYY  315

Query  180  KICRGRNICGVDSMVSLVAA  239
            KIC+G N+CGV+S+VS V A
Sbjct  316  KICKGHNVCGVESLVSTVTA  335



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553413336175