BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP001G08 632 bp,

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99237.1|  unnamed protein product                                251   2e-80   Coffea canephora [robusta coffee]
gb|KDP40336.1|  hypothetical protein JCGZ_02334                         231   2e-72   Jatropha curcas
emb|CDP08010.1|  unnamed protein product                                230   2e-72   Coffea canephora [robusta coffee]
ref|XP_007035120.1|  Glutathione S-transferase tau 7                    230   5e-72   Theobroma cacao [chocolate]
ref|XP_007035121.1|  Glutathione S-transferase tau 7 isoform 1          229   9e-72   Theobroma cacao [chocolate]
emb|CDO99236.1|  unnamed protein product                                228   3e-71   Coffea canephora [robusta coffee]
ref|XP_007035122.1|  Glutathione S-transferase tau 7 isoform 2          226   5e-71   Theobroma cacao [chocolate]
ref|XP_011091312.1|  PREDICTED: glutathione transferase GST 23-like     226   9e-71   Sesamum indicum [beniseed]
ref|XP_010069125.1|  PREDICTED: glutathione transferase GST 23-like     223   1e-69   Eucalyptus grandis [rose gum]
ref|XP_011030495.1|  PREDICTED: probable glutathione S-transferase      223   1e-69   Populus euphratica
ref|XP_010069124.1|  PREDICTED: glutathione transferase GST 23-like     223   2e-69   Eucalyptus grandis [rose gum]
ref|XP_007159485.1|  hypothetical protein PHAVU_002G241400g             223   2e-69   Phaseolus vulgaris [French bean]
ref|XP_006378334.1|  hypothetical protein POPTR_0010s08170g             223   2e-69   Populus trichocarpa [western balsam poplar]
ref|XP_010025836.1|  PREDICTED: glutathione transferase GST 23-like     224   6e-69   Eucalyptus grandis [rose gum]
gb|KEH20685.1|  glutathione S-transferase                               221   7e-69   Medicago truncatula
gb|ACJ83863.1|  unknown                                                 219   4e-68   Medicago truncatula
emb|CDP08048.1|  unnamed protein product                                221   7e-68   Coffea canephora [robusta coffee]
ref|XP_002280532.1|  PREDICTED: probable glutathione S-transferase      217   3e-67   Vitis vinifera
ref|XP_002280676.1|  PREDICTED: probable glutathione S-transferase      216   4e-67   Vitis vinifera
ref|XP_003629836.1|  Receptor-like protein kinase                       227   9e-66   
ref|XP_002285214.1|  PREDICTED: glutathione transferase GST 23          213   1e-65   Vitis vinifera
ref|XP_003632015.1|  PREDICTED: probable glutathione S-transferase      213   1e-65   Vitis vinifera
ref|XP_006420238.1|  hypothetical protein CICLE_v10005771mg             213   1e-65   Citrus clementina
emb|CAN63628.1|  hypothetical protein VITISV_018696                     213   1e-65   Vitis vinifera
ref|XP_002285220.1|  PREDICTED: glutathione transferase GST 23          212   3e-65   Vitis vinifera
ref|XP_010279423.1|  PREDICTED: probable glutathione S-transferase      211   4e-65   Nelumbo nucifera [Indian lotus]
gb|AEC32486.1|  tau class glutathione S-transferase                     210   1e-64   Glycine soja [wild soybean]
gb|KCW57371.1|  hypothetical protein EUGRSUZ_H00157                     210   1e-64   Eucalyptus grandis [rose gum]
ref|XP_003524975.2|  PREDICTED: probable glutathione S-transferase      210   2e-64   
gb|ACU14737.1|  unknown                                                 210   2e-64   Glycine max [soybeans]
ref|XP_002285212.1|  PREDICTED: glutathione transferase GST 23          209   4e-64   Vitis vinifera
ref|XP_008224351.1|  PREDICTED: probable glutathione S-transferase      209   6e-64   Prunus mume [ume]
gb|AAG34804.1|AF243369_1  glutathione S-transferase GST 14              208   1e-63   Glycine max [soybeans]
ref|XP_007226113.1|  hypothetical protein PRUPE_ppa011087mg             208   1e-63   Prunus persica
gb|AFF18816.1|  glutathione transferase                                 207   2e-63   Dimocarpus longan [longan]
ref|NP_001234957.1|  glutathione S-transferase GST 17                   207   2e-63   Glycine max [soybeans]
gb|ACU20120.1|  unknown                                                 207   2e-63   Glycine max [soybeans]
gb|AFK41941.1|  unknown                                                 207   2e-63   Lotus japonicus
gb|AFF18814.1|  glutathione transferase                                 206   3e-63   Dimocarpus longan [longan]
ref|XP_010938159.1|  PREDICTED: glutathione transferase GST 23-like     206   4e-63   Elaeis guineensis
gb|KHN48020.1|  Glutathione transferase GST 23                          206   5e-63   Glycine soja [wild soybean]
ref|XP_006484731.1|  PREDICTED: probable glutathione S-transferas...    206   7e-63   Citrus sinensis [Valencia orange]
ref|XP_002532523.1|  glutathione s-transferase, putative                206   7e-63   Ricinus communis
gb|KHN06425.1|  Putative glutathione S-transferase                      206   8e-63   Glycine soja [wild soybean]
gb|AJE59670.1|  tau class glutathione S-transferase                     206   9e-63   Glycine max [soybeans]
ref|XP_006437360.1|  hypothetical protein CICLE_v10032686mg             205   1e-62   Citrus clementina
ref|XP_010278876.1|  PREDICTED: probable glutathione S-transferase      205   2e-62   Nelumbo nucifera [Indian lotus]
ref|XP_008232144.1|  PREDICTED: probable glutathione S-transferase      204   2e-62   Prunus mume [ume]
ref|XP_006489726.1|  PREDICTED: probable glutathione S-transferas...    204   3e-62   Citrus sinensis [Valencia orange]
gb|KHN48021.1|  Putative glutathione S-transferase                      206   3e-62   Glycine soja [wild soybean]
gb|KDO46806.1|  hypothetical protein CISIN_1g027333mg                   204   4e-62   Citrus sinensis [Valencia orange]
ref|XP_010067033.1|  PREDICTED: probable glutathione S-transferase      204   5e-62   Eucalyptus grandis [rose gum]
emb|CAN72240.1|  hypothetical protein VITISV_010777                     203   6e-62   Vitis vinifera
ref|XP_006437359.1|  hypothetical protein CICLE_v10032702mg             203   6e-62   Citrus clementina
ref|XP_002264117.1|  PREDICTED: probable glutathione S-transferase      203   6e-62   Vitis vinifera
ref|XP_008793319.1|  PREDICTED: probable glutathione S-transferase      203   7e-62   Phoenix dactylifera
ref|XP_006489728.1|  PREDICTED: glutathione S-transferase U8-like       203   8e-62   Citrus sinensis [Valencia orange]
emb|CAN78656.1|  hypothetical protein VITISV_006850                     203   8e-62   Vitis vinifera
ref|XP_006433894.1|  hypothetical protein CICLE_v10002406mg             203   9e-62   Citrus clementina
gb|KDP39591.1|  hypothetical protein JCGZ_02611                         202   1e-61   Jatropha curcas
gb|KDO81087.1|  hypothetical protein CISIN_1g027498mg                   202   1e-61   Citrus sinensis [Valencia orange]
ref|XP_010922854.1|  PREDICTED: probable glutathione S-transferase      202   2e-61   Elaeis guineensis
ref|XP_002523996.1|  glutathione s-transferase, putative                202   2e-61   Ricinus communis
gb|KDP42500.1|  hypothetical protein JCGZ_00297                         202   2e-61   Jatropha curcas
ref|XP_002532525.1|  glutathione s-transferase, putative                202   3e-61   Ricinus communis
ref|XP_008453455.1|  PREDICTED: probable glutathione S-transferase      201   3e-61   Cucumis melo [Oriental melon]
gb|KDO57583.1|  hypothetical protein CISIN_1g046710mg                   201   4e-61   Citrus sinensis [Valencia orange]
gb|AJE59654.1|  tau class glutathione S-transferase                     201   6e-61   Glycine max [soybeans]
ref|XP_008781341.1|  PREDICTED: glutathione transferase GST 23-like     201   7e-61   Phoenix dactylifera
ref|XP_006472526.1|  PREDICTED: glutathione transferase GST 23-like     201   8e-61   Citrus sinensis [Valencia orange]
ref|XP_006489727.1|  PREDICTED: probable glutathione S-transferas...    201   1e-60   Citrus sinensis [Valencia orange]
ref|XP_004299557.1|  PREDICTED: probable glutathione S-transferase      200   1e-60   Fragaria vesca subsp. vesca
ref|XP_006484732.1|  PREDICTED: probable glutathione S-transferas...    200   1e-60   Citrus sinensis [Valencia orange]
ref|XP_007218360.1|  hypothetical protein PRUPE_ppa011115mg             199   2e-60   Prunus persica
ref|XP_006420237.1|  hypothetical protein CICLE_v10005779mg             200   2e-60   Citrus clementina
gb|KDP42499.1|  hypothetical protein JCGZ_00296                         199   2e-60   Jatropha curcas
ref|XP_006420235.1|  hypothetical protein CICLE_v10006671mg             199   5e-60   Citrus clementina
ref|XP_007220010.1|  hypothetical protein PRUPE_ppb024827mg             198   7e-60   Prunus persica
ref|XP_002527848.1|  glutathione s-transferase, putative                197   1e-59   Ricinus communis
ref|XP_007036677.1|  Tau class glutathione transferase GSTU26           197   1e-59   Theobroma cacao [chocolate]
gb|KHN06423.1|  Putative glutathione S-transferase                      197   1e-59   Glycine soja [wild soybean]
ref|XP_004299558.1|  PREDICTED: probable glutathione S-transferase      197   1e-59   Fragaria vesca subsp. vesca
ref|XP_002264054.1|  PREDICTED: glutathione transferase GST 23          197   1e-59   Vitis vinifera
ref|XP_010921338.1|  PREDICTED: glutathione transferase GST 23-like     197   2e-59   Elaeis guineensis
ref|XP_009343223.1|  PREDICTED: probable glutathione S-transferas...    197   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_010067034.1|  PREDICTED: glutathione transferase GST 23-like     197   2e-59   Eucalyptus grandis [rose gum]
ref|XP_004160429.1|  PREDICTED: probable glutathione S-transferas...    197   2e-59   
emb|CDP09302.1|  unnamed protein product                                197   2e-59   Coffea canephora [robusta coffee]
ref|XP_004137330.1|  PREDICTED: probable glutathione S-transferas...    197   2e-59   Cucumis sativus [cucumbers]
emb|CDP15482.1|  unnamed protein product                                196   3e-59   Coffea canephora [robusta coffee]
ref|XP_002523997.1|  glutathione s-transferase, putative                196   3e-59   Ricinus communis
ref|XP_004957087.1|  PREDICTED: glutathione transferase GST 23-like     196   3e-59   Setaria italica
ref|XP_007210928.1|  hypothetical protein PRUPE_ppa026181mg             195   3e-59   Prunus persica
ref|XP_010938160.1|  PREDICTED: glutathione transferase GST 23-like     196   4e-59   Elaeis guineensis
ref|XP_004307164.1|  PREDICTED: glutathione transferase GST 23-li...    196   4e-59   Fragaria vesca subsp. vesca
ref|NP_001104994.1|  glutathione transferase GST 23                     196   4e-59   Zea mays [maize]
ref|XP_004297032.1|  PREDICTED: probable glutathione S-transferase      196   4e-59   Fragaria vesca subsp. vesca
ref|XP_008232147.1|  PREDICTED: probable glutathione S-transferase      196   5e-59   Prunus mume [ume]
ref|XP_002460369.1|  hypothetical protein SORBIDRAFT_02g027080          196   6e-59   Sorghum bicolor [broomcorn]
ref|XP_004133937.1|  PREDICTED: probable glutathione S-transferas...    196   6e-59   Cucumis sativus [cucumbers]
tpg|DAA61851.1|  TPA: hypothetical protein ZEAMMB73_518022              196   6e-59   Zea mays [maize]
ref|XP_010661155.1|  PREDICTED: probable glutathione S-transferas...    196   7e-59   Vitis vinifera
ref|XP_009343222.1|  PREDICTED: glutathione transferase GST 23-li...    195   7e-59   Pyrus x bretschneideri [bai li]
ref|XP_011004953.1|  PREDICTED: probable glutathione S-transferase      196   7e-59   Populus euphratica
ref|XP_006373657.1|  hypothetical protein POPTR_0016s02350g             196   7e-59   Populus trichocarpa [western balsam poplar]
ref|XP_002307924.1|  hypothetical protein POPTR_0006s02510g             196   7e-59   Populus trichocarpa [western balsam poplar]
emb|CDP21862.1|  unnamed protein product                                195   9e-59   Coffea canephora [robusta coffee]
ref|XP_010521899.1|  PREDICTED: glutathione S-transferase U7-like       195   9e-59   Tarenaya hassleriana [spider flower]
ref|XP_002266900.1|  PREDICTED: probable glutathione S-transferase      196   1e-58   Vitis vinifera
ref|XP_003629835.1|  Glutathione S-transferase GST                      195   1e-58   Medicago truncatula
emb|CBI26437.3|  unnamed protein product                                195   1e-58   Vitis vinifera
ref|XP_008240197.1|  PREDICTED: probable glutathione S-transferase      195   1e-58   Prunus mume [ume]
ref|XP_002319750.2|  hypothetical protein POPTR_0013s06950g             194   2e-58   Populus trichocarpa [western balsam poplar]
gb|ADB11358.1|  tau class glutathione transferase GSTU26                194   2e-58   Populus trichocarpa [western balsam poplar]
ref|XP_009593034.1|  PREDICTED: glutathione transferase GST 23-like     194   2e-58   Nicotiana tomentosiformis
ref|XP_006489767.1|  PREDICTED: glutathione transferase GST 23-like     193   2e-58   Citrus sinensis [Valencia orange]
ref|XP_010646030.1|  PREDICTED: probable glutathione S-transferase      194   2e-58   Vitis vinifera
ref|XP_011004483.1|  PREDICTED: probable glutathione S-transferase      194   3e-58   Populus euphratica
gb|ADB11367.1|  putative tau class glutathione transferase GSTU41       194   3e-58   Populus trichocarpa [western balsam poplar]
ref|XP_010663654.1|  PREDICTED: probable glutathione S-transferase      193   5e-58   Vitis vinifera
ref|XP_008793318.1|  PREDICTED: glutathione transferase GST 23-like     193   6e-58   Phoenix dactylifera
ref|XP_002264055.2|  PREDICTED: probable glutathione S-transferas...    193   7e-58   Vitis vinifera
gb|KDO57582.1|  hypothetical protein CISIN_1g043218mg                   193   8e-58   Citrus sinensis [Valencia orange]
gb|KEH26957.1|  glutathione S-transferase                               192   9e-58   Medicago truncatula
ref|XP_011040645.1|  PREDICTED: probable glutathione S-transferase      192   1e-57   Populus euphratica
ref|NP_001234088.1|  uncharacterized protein LOC543815                  192   1e-57   Solanum lycopersicum
ref|XP_011039096.1|  PREDICTED: probable glutathione S-transferase      192   1e-57   Populus euphratica
gb|ADB11328.1|  tau class glutathione transferase GSTU46                192   1e-57   Populus trichocarpa [western balsam poplar]
emb|CDP19810.1|  unnamed protein product                                192   2e-57   Coffea canephora [robusta coffee]
ref|XP_011086578.1|  PREDICTED: glutathione transferase GST 23-like     192   2e-57   Sesamum indicum [beniseed]
ref|XP_008219369.1|  PREDICTED: glutathione transferase GST 23-like     191   2e-57   Prunus mume [ume]
ref|XP_008438211.1|  PREDICTED: probable glutathione S-transferase      191   2e-57   Cucumis melo [Oriental melon]
ref|XP_002277759.2|  PREDICTED: probable glutathione S-transferase      191   3e-57   Vitis vinifera
ref|XP_010923032.1|  PREDICTED: probable glutathione S-transferase      191   3e-57   Elaeis guineensis
gb|ADB11356.1|  putative tau class glutathione transferase GSTU23       192   3e-57   Populus trichocarpa [western balsam poplar]
ref|XP_002321502.2|  hypothetical protein POPTR_0015s04200g             191   3e-57   Populus trichocarpa [western balsam poplar]
ref|XP_002266994.1|  PREDICTED: probable glutathione S-transferase      191   4e-57   Vitis vinifera
ref|XP_006376726.1|  hypothetical protein POPTR_0012s04780g             191   4e-57   Populus trichocarpa [western balsam poplar]
ref|NP_001063423.1|  Os09g0467200                                       191   5e-57   
ref|XP_007223941.1|  hypothetical protein PRUPE_ppa011108mg             191   5e-57   Prunus persica
emb|CBI26438.3|  unnamed protein product                                191   5e-57   Vitis vinifera
ref|XP_008240195.1|  PREDICTED: probable glutathione S-transferase      190   5e-57   Prunus mume [ume]
ref|XP_006420236.1|  hypothetical protein CICLE_v10005779mg             191   6e-57   Citrus clementina
emb|CAN73419.1|  hypothetical protein VITISV_027346                     191   6e-57   Vitis vinifera
ref|XP_003532764.1|  PREDICTED: probable glutathione S-transferase      191   6e-57   
ref|XP_010097693.1|  putative glutathione S-transferase                 191   6e-57   Morus notabilis
ref|XP_011000484.1|  PREDICTED: probable glutathione S-transferase      191   7e-57   Populus euphratica
ref|XP_002322571.1|  hypothetical protein POPTR_0016s02370g             190   7e-57   Populus trichocarpa [western balsam poplar]
ref|XP_009335025.1|  PREDICTED: probable glutathione S-transferas...    190   8e-57   Pyrus x bretschneideri [bai li]
ref|XP_002268774.2|  PREDICTED: probable glutathione S-transferase      191   9e-57   Vitis vinifera
ref|XP_002318530.2|  hypothetical protein POPTR_0012s04770g             190   1e-56   Populus trichocarpa [western balsam poplar]
gb|KDO66687.1|  hypothetical protein CISIN_1g041211mg                   189   2e-56   Citrus sinensis [Valencia orange]
ref|XP_009790678.1|  PREDICTED: glutathione transferase GST 23-like     189   2e-56   Nicotiana sylvestris
ref|XP_007029835.1|  Glutathione S-transferase TAU 8                    190   3e-56   Theobroma cacao [chocolate]
dbj|BAK02670.1|  predicted protein                                      189   3e-56   Hordeum vulgare subsp. vulgare [barley]
ref|NP_001234091.1|  uncharacterized protein LOC543816                  189   3e-56   Solanum lycopersicum
gb|AFK35732.1|  unknown                                                 189   3e-56   Lotus japonicus
gb|AFK34634.1|  unknown                                                 188   5e-56   Lotus japonicus
gb|KJB76665.1|  hypothetical protein B456_012G099100                    188   6e-56   Gossypium raimondii
gb|AAG34831.1|AF244688_1  glutathione S-transferase GST 23              187   7e-56   Zea mays [maize]
ref|XP_004307163.2|  PREDICTED: probable glutathione S-transferase      189   8e-56   Fragaria vesca subsp. vesca
gb|EYU26814.1|  hypothetical protein MIMGU_mgv1a013348mg                187   8e-56   Erythranthe guttata [common monkey flower]
ref|XP_006437357.1|  hypothetical protein CICLE_v10032696mg             187   8e-56   Citrus clementina
ref|XP_007209589.1|  hypothetical protein PRUPE_ppa011268mg             187   9e-56   Prunus persica
ref|XP_009335024.1|  PREDICTED: probable glutathione S-transferas...    187   9e-56   Pyrus x bretschneideri [bai li]
ref|NP_001237698.1|  glutathione S-transferase GST 20                   187   1e-55   Glycine max [soybeans]
ref|XP_006354565.1|  PREDICTED: glutathione transferase GST 23-li...    187   2e-55   Solanum tuberosum [potatoes]
ref|XP_006660720.1|  PREDICTED: glutathione transferase GST 23-like     187   2e-55   
ref|XP_008363399.1|  PREDICTED: glutathione transferase GST 23-like     186   2e-55   Malus domestica [apple tree]
ref|XP_009778650.1|  PREDICTED: glutathione transferase GST 23-like     187   2e-55   Nicotiana sylvestris
gb|KJB80746.1|  hypothetical protein B456_013G113600                    186   3e-55   Gossypium raimondii
emb|CDP11459.1|  unnamed protein product                                186   3e-55   Coffea canephora [robusta coffee]
ref|XP_003578262.1|  PREDICTED: glutathione transferase GST 23-li...    186   3e-55   Brachypodium distachyon [annual false brome]
gb|EMT19525.1|  hypothetical protein F775_31981                         186   4e-55   Aegilops tauschii
ref|XP_004299656.1|  PREDICTED: probable glutathione S-transferase      186   4e-55   Fragaria vesca subsp. vesca
ref|XP_004229525.1|  PREDICTED: glutathione transferase GST 23-like     186   4e-55   Solanum lycopersicum
ref|XP_009343224.1|  PREDICTED: probable glutathione S-transferas...    186   5e-55   Pyrus x bretschneideri [bai li]
ref|XP_009335026.1|  PREDICTED: probable glutathione S-transferas...    186   5e-55   Pyrus x bretschneideri [bai li]
gb|KJB19709.1|  hypothetical protein B456_003G127600                    186   6e-55   Gossypium raimondii
ref|XP_009343225.1|  PREDICTED: probable glutathione S-transferas...    185   7e-55   Pyrus x bretschneideri [bai li]
ref|XP_002277724.2|  PREDICTED: glutathione transferase GST 23          185   1e-54   Vitis vinifera
ref|XP_006354571.1|  PREDICTED: glutathione transferase GST 23-li...    185   1e-54   Solanum tuberosum [potatoes]
gb|KJB44380.1|  hypothetical protein B456_007G249200                    184   1e-54   Gossypium raimondii
ref|XP_011010098.1|  PREDICTED: probable glutathione S-transferase      184   1e-54   Populus euphratica
gb|AFY26875.1|  glutathione-S-transferase                               184   2e-54   Ipomoea batatas [batate]
ref|XP_004978487.1|  PREDICTED: glutathione transferase GST 23-like     184   2e-54   Setaria italica
ref|XP_004229524.1|  PREDICTED: glutathione transferase GST 23-like     184   2e-54   Solanum lycopersicum
ref|XP_009606213.1|  PREDICTED: glutathione transferase GST 23-like     184   2e-54   Nicotiana tomentosiformis
ref|XP_007145574.1|  hypothetical protein PHAVU_007G250000g             184   3e-54   Phaseolus vulgaris [French bean]
ref|XP_006354570.1|  PREDICTED: glutathione transferase GST 23-li...    184   3e-54   
gb|AFP20277.1|  glutathione transferase 23                              184   3e-54   Triticum aestivum [Canadian hard winter wheat]
emb|CDP11462.1|  unnamed protein product                                184   4e-54   Coffea canephora [robusta coffee]
ref|XP_010243655.1|  PREDICTED: probable glutathione S-transferase      183   4e-54   Nelumbo nucifera [Indian lotus]
ref|XP_006849232.1|  hypothetical protein AMTR_s00027p00233060          183   5e-54   Amborella trichopoda
ref|XP_011092669.1|  PREDICTED: glutathione S-transferase U7-like       183   7e-54   Sesamum indicum [beniseed]
ref|XP_008346936.1|  PREDICTED: probable glutathione S-transferase      184   7e-54   
ref|XP_006365401.1|  PREDICTED: probable glutathione S-transferas...    183   7e-54   Solanum tuberosum [potatoes]
ref|XP_002521517.1|  glutathione s-transferase, putative                183   8e-54   Ricinus communis
ref|XP_010060069.1|  PREDICTED: glutathione transferase GST 23-like     182   8e-54   Eucalyptus grandis [rose gum]
gb|KCW65098.1|  hypothetical protein EUGRSUZ_G02603                     182   9e-54   Eucalyptus grandis [rose gum]
ref|XP_008812228.1|  PREDICTED: glutathione transferase GST 23-like     182   1e-53   Phoenix dactylifera
ref|XP_002518184.1|  glutathione s-transferase, putative                182   1e-53   Ricinus communis
ref|XP_010238250.1|  PREDICTED: glutathione transferase GST 23-li...    182   1e-53   Brachypodium distachyon [annual false brome]
ref|XP_010693951.1|  PREDICTED: glutathione S-transferase U7-like       182   1e-53   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_002520474.1|  glutathione s-transferase, putative                182   1e-53   
gb|ADB11377.1|  putative tau class glutathione transferase GSTU53       182   1e-53   Populus trichocarpa [western balsam poplar]
ref|XP_004504278.1|  PREDICTED: probable glutathione S-transferas...    182   1e-53   Cicer arietinum [garbanzo]
gb|ADB11374.1|  tau class glutathione transferase GSTU50                182   2e-53   Populus trichocarpa [western balsam poplar]
ref|NP_001237959.1|  uncharacterized protein LOC100305870               181   2e-53   Glycine max [soybeans]
ref|XP_006354574.1|  PREDICTED: glutathione transferase GST 23-like     182   2e-53   Solanum tuberosum [potatoes]
ref|XP_006580178.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    181   2e-53   
gb|KHN06986.1|  Putative glutathione S-transferase                      181   2e-53   Glycine soja [wild soybean]
gb|KEH35720.1|  glutathione S-transferase, amino-terminal domain ...    181   2e-53   Medicago truncatula
gb|AFK37185.1|  unknown                                                 181   3e-53   Medicago truncatula
ref|XP_010939723.1|  PREDICTED: glutathione transferase GST 23-like     181   3e-53   Elaeis guineensis
gb|ACU15816.1|  unknown                                                 181   3e-53   Glycine max [soybeans]
ref|XP_010271921.1|  PREDICTED: probable glutathione S-transferase      181   3e-53   Nelumbo nucifera [Indian lotus]
gb|KHN05112.1|  Putative glutathione S-transferase                      181   3e-53   Glycine soja [wild soybean]
ref|XP_004301267.1|  PREDICTED: glutathione S-transferase U7-like       181   4e-53   Fragaria vesca subsp. vesca
gb|KJB28257.1|  hypothetical protein B456_005G037700                    180   7e-53   Gossypium raimondii
gb|AJE59685.1|  tau class glutathione S-transferase                     180   7e-53   Glycine max [soybeans]
ref|XP_007016281.1|  Glutathione S-transferase tau 7, putative          181   7e-53   Theobroma cacao [chocolate]
ref|XP_007026865.1|  Tau class glutathione transferase GSTU45           180   8e-53   Theobroma cacao [chocolate]
emb|CDP06552.1|  unnamed protein product                                180   8e-53   Coffea canephora [robusta coffee]
ref|XP_003529123.1|  PREDICTED: probable glutathione S-transferas...    180   9e-53   
ref|XP_002520473.1|  glutathione s-transferase, putative                180   1e-52   
ref|XP_010042776.1|  PREDICTED: glutathione S-transferase U8-like       179   1e-52   Eucalyptus grandis [rose gum]
ref|XP_007029718.1|  Glutathione S-transferase tau 7                    180   1e-52   Theobroma cacao [chocolate]
ref|XP_010243637.1|  PREDICTED: probable glutathione S-transferase      179   1e-52   Nelumbo nucifera [Indian lotus]
gb|ADB11327.1|  tau class glutathione transferase GSTU45                179   1e-52   Populus trichocarpa [western balsam poplar]
ref|XP_009347672.1|  PREDICTED: glutathione S-transferase U8-like       179   1e-52   Pyrus x bretschneideri [bai li]
ref|XP_010271919.1|  PREDICTED: glutathione transferase GST 23-like     179   1e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010037768.1|  PREDICTED: probable glutathione S-transferase      179   2e-52   Eucalyptus grandis [rose gum]
gb|KDP38795.1|  hypothetical protein JCGZ_05131                         179   2e-52   Jatropha curcas
ref|XP_006849222.1|  hypothetical protein AMTR_s00027p00229840          179   2e-52   Amborella trichopoda
ref|XP_010037769.1|  PREDICTED: probable glutathione S-transferase      179   2e-52   Eucalyptus grandis [rose gum]
ref|XP_010037776.1|  PREDICTED: probable glutathione S-transferase      179   3e-52   Eucalyptus grandis [rose gum]
ref|XP_002275657.2|  PREDICTED: probable glutathione S-transferase      178   3e-52   Vitis vinifera
emb|CAN73675.1|  hypothetical protein VITISV_001110                     179   3e-52   Vitis vinifera
ref|XP_009399930.1|  PREDICTED: probable glutathione S-transferase      178   3e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010939722.1|  PREDICTED: glutathione transferase GST 23-like     179   3e-52   Elaeis guineensis
ref|XP_010469949.1|  PREDICTED: glutathione S-transferase U1            178   4e-52   Camelina sativa [gold-of-pleasure]
ref|NP_001238721.1|  glutathione S-transferase GST 13                   178   4e-52   Glycine max [soybeans]
gb|EYU26622.1|  hypothetical protein MIMGU_mgv1a013365mg                178   4e-52   Erythranthe guttata [common monkey flower]
gb|KDP34500.1|  hypothetical protein JCGZ_11050                         178   4e-52   Jatropha curcas
ref|XP_008781207.1|  PREDICTED: probable glutathione S-transferase      178   4e-52   Phoenix dactylifera
ref|NP_001237856.1|  uncharacterized protein LOC100500680               178   4e-52   Glycine max [soybeans]
gb|KDP42181.1|  hypothetical protein JCGZ_02911                         178   4e-52   Jatropha curcas
ref|NP_180503.1|  glutathione S-transferase tau 7                       178   5e-52   Arabidopsis thaliana [mouse-ear cress]
gb|ACU15611.1|  unknown                                                 177   5e-52   Glycine max [soybeans]
gb|ACU24385.1|  unknown                                                 177   5e-52   Glycine max [soybeans]
ref|XP_007026866.1|  Tau class glutathione transferase GSTU45           178   6e-52   Theobroma cacao [chocolate]
ref|NP_001234986.1|  glutathione S-transferase GST 19                   178   6e-52   Glycine max [soybeans]
ref|NP_001238659.1|  glutathione S-transferase GST 7                    178   6e-52   Glycine max [soybeans]
ref|XP_010510486.1|  PREDICTED: glutathione S-transferase U1-like       177   7e-52   Camelina sativa [gold-of-pleasure]
gb|KHN05118.1|  Putative glutathione S-transferase                      177   7e-52   Glycine soja [wild soybean]
gb|KHG09979.1|  Glutathione S-transferase U8 -like protein              177   7e-52   Gossypium arboreum [tree cotton]
ref|XP_011000057.1|  PREDICTED: probable glutathione S-transferase      177   8e-52   Populus euphratica
ref|XP_008374802.1|  PREDICTED: glutathione S-transferase U8-like       177   8e-52   
ref|XP_003529119.1|  PREDICTED: probable glutathione S-transferas...    177   8e-52   
ref|XP_010279540.1|  PREDICTED: probable glutathione S-transferas...    177   8e-52   Nelumbo nucifera [Indian lotus]
gb|KHN05113.1|  Putative glutathione S-transferase                      177   9e-52   Glycine soja [wild soybean]
gb|AFK45620.1|  unknown                                                 177   1e-51   Lotus japonicus
ref|XP_002520477.1|  glutathione s-transferase, putative                177   1e-51   Ricinus communis
gb|KHN05121.1|  Putative glutathione S-transferase                      177   1e-51   Glycine soja [wild soybean]
gb|KDO66686.1|  hypothetical protein CISIN_1g041800mg                   177   1e-51   Citrus sinensis [Valencia orange]
ref|XP_002520476.1|  glutathione s-transferase, putative                177   1e-51   Ricinus communis
gb|KHG20964.1|  Glutathione S-transferase U7 -like protein              177   1e-51   Gossypium arboreum [tree cotton]
gb|AGH14251.1|  glutathione S-transferase                               177   2e-51   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010037777.1|  PREDICTED: probable glutathione S-transferase      177   2e-51   Eucalyptus grandis [rose gum]
ref|XP_002881053.1|  glutathione S-transferase 19                       177   2e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_009596758.1|  PREDICTED: probable glutathione S-transferase      176   2e-51   Nicotiana tomentosiformis
ref|XP_007026863.1|  Tau class glutathione transferase GSTU45           176   2e-51   Theobroma cacao [chocolate]
ref|XP_006488416.1|  PREDICTED: glutathione S-transferase U7-like       176   2e-51   Citrus sinensis [Valencia orange]
ref|NP_001238675.1|  glutathione S-transferase GST 8                    176   2e-51   Glycine max [soybeans]
ref|NP_001238643.1|  glutathione S-transferase GST 6                    176   3e-51   Glycine max [soybeans]
ref|XP_002266744.1|  PREDICTED: probable glutathione S-transferase      176   3e-51   Vitis vinifera
emb|CBI16040.3|  unnamed protein product                                180   3e-51   Vitis vinifera
ref|XP_002524046.1|  glutathione s-transferase, putative                176   3e-51   Ricinus communis
gb|KJB28236.1|  hypothetical protein B456_005G036300                    176   3e-51   
ref|NP_001238439.1|  probable glutathione S-transferase                 176   3e-51   
gb|KJB36831.1|  hypothetical protein B456_006G178600                    176   4e-51   
gb|ABW81037.1|  glutathione-s-transferase 7                             176   4e-51   
gb|ADD71974.1|  glutathione S-transferase                               176   4e-51   
ref|XP_002862399.1|  glutathione-s-transferase                          176   4e-51   
gb|KJB27950.1|  hypothetical protein B456_005G038200                    176   4e-51   
ref|XP_007016280.1|  Glutathione S-transferase tau 7, putative          175   5e-51   
gb|ABW81189.1|  glutathione-S-transferase                               176   5e-51   
gb|AJE59664.1|  tau class glutathione S-transferase                     175   5e-51   
ref|XP_003529124.1|  PREDICTED: probable glutathione S-transferas...    175   5e-51   
ref|NP_001236169.1|  uncharacterized protein LOC100500052               175   6e-51   
ref|XP_007134780.1|  hypothetical protein PHAVU_010G075400g             175   6e-51   
ref|XP_010279542.1|  PREDICTED: probable glutathione S-transferas...    175   7e-51   
gb|KHN25840.1|  Putative glutathione S-transferase                      175   7e-51   
ref|XP_010263987.1|  PREDICTED: probable glutathione S-transferase      175   8e-51   
ref|NP_001235279.1|  uncharacterized protein LOC100527381               174   8e-51   
ref|XP_008363401.1|  PREDICTED: glutathione S-transferase U8-like       175   8e-51   
ref|XP_008344765.1|  PREDICTED: glutathione S-transferase U8-like       175   8e-51   
ref|XP_009776230.1|  PREDICTED: probable glutathione S-transferase      174   9e-51   
ref|XP_010279541.1|  PREDICTED: probable glutathione S-transferas...    174   1e-50   
gb|AFS51729.1|  tau class glutathione S-transferase                     174   1e-50   
gb|AFK40836.1|  unknown                                                 174   1e-50   
ref|XP_006409999.1|  hypothetical protein EUTSA_v10017210mg             174   1e-50   
ref|XP_007034530.1|  Tau class glutathione transferase GSTU43           174   1e-50   
ref|XP_006294917.1|  hypothetical protein CARUB_v10023969mg             175   1e-50   
emb|CAN60691.1|  hypothetical protein VITISV_044168                     174   1e-50   
ref|XP_003632026.2|  PREDICTED: probable glutathione S-transferase      174   1e-50   
ref|XP_006424951.1|  hypothetical protein CICLE_v10030408mg             174   1e-50   
gb|KDO66688.1|  hypothetical protein CISIN_1g038634mg                   174   2e-50   
gb|ADB11371.1|  putative tau class glutathione transferase GSTU47       174   2e-50   
ref|XP_009606317.1|  PREDICTED: probable glutathione S-transferase      174   2e-50   
ref|XP_006849226.1|  hypothetical protein AMTR_s00027p00230760          174   2e-50   
ref|XP_002281843.2|  PREDICTED: glutathione S-transferase U7            174   2e-50   
ref|XP_008448606.1|  PREDICTED: probable glutathione S-transferase      174   2e-50   
ref|XP_006488417.1|  PREDICTED: glutathione S-transferase U7-like       174   2e-50   
ref|XP_009141006.1|  PREDICTED: glutathione S-transferase U2            175   2e-50   
gb|ABW81199.1|  glutathione-S-transferase 9                             174   2e-50   
ref|NP_180510.1|  glutathione S-transferase tau 1                       174   2e-50   
ref|XP_010036925.1|  PREDICTED: glutathione transferase GST 23-like     174   2e-50   
ref|XP_009360111.1|  PREDICTED: glutathione S-transferase U8-like       174   2e-50   
ref|XP_010521903.1|  PREDICTED: glutathione S-transferase U1-like       173   3e-50   
ref|XP_002881042.1|  glutathione-s-transferase                          174   3e-50   
ref|XP_002881054.1|  glutathione-s-transferase 9                        173   3e-50   
ref|XP_008806389.1|  PREDICTED: glutathione transferase GST 23-like     173   3e-50   
ref|XP_003529121.1|  PREDICTED: probable glutathione S-transferas...    173   4e-50   
ref|XP_009370935.1|  PREDICTED: glutathione transferase GST 23-like     173   4e-50   
emb|CDY51364.1|  BnaA04g28580D                                          173   4e-50   
ref|XP_006424949.1|  hypothetical protein CICLE_v10029241mg             173   5e-50   
ref|XP_008372419.1|  PREDICTED: glutathione transferase GST 23-like     172   5e-50   
ref|XP_010414381.1|  PREDICTED: glutathione S-transferase U1-like       172   6e-50   
gb|AJE59667.1|  tau class glutathione S-transferase                     172   6e-50   
gb|KHN05114.1|  Putative glutathione S-transferase                      172   6e-50   
gb|EYU40236.1|  hypothetical protein MIMGU_mgv1a020023mg                172   7e-50   
gb|KJB28263.1|  hypothetical protein B456_005G038700                    172   7e-50   
ref|XP_006489730.1|  PREDICTED: probable glutathione S-transferas...    172   7e-50   
ref|XP_006420233.1|  hypothetical protein CICLE_v10005812mg             172   8e-50   
ref|XP_002520472.1|  glutathione s-transferase, putative                172   8e-50   
emb|CAN73676.1|  hypothetical protein VITISV_001111                     172   8e-50   
ref|XP_002520478.1|  glutathione s-transferase, putative                172   9e-50   
ref|XP_002281694.2|  PREDICTED: uncharacterized protein LOC100246830    178   9e-50   
emb|CAN73674.1|  hypothetical protein VITISV_001109                     176   1e-49   
gb|KHG11257.1|  Glutathione transferase GST 23                          172   1e-49   
ref|XP_010037778.1|  PREDICTED: glutathione S-transferase U8-like       172   1e-49   
ref|XP_008382674.1|  PREDICTED: probable glutathione S-transferase      172   1e-49   
dbj|BAC21263.1|  glutathione S-transferase                              172   1e-49   
ref|XP_011041578.1|  PREDICTED: probable glutathione S-transferase      171   1e-49   
ref|XP_010542655.1|  PREDICTED: glutathione S-transferase U1-like       171   2e-49   
ref|XP_010039178.1|  PREDICTED: probable glutathione S-transferase      171   2e-49   
ref|XP_010039180.1|  PREDICTED: glutathione S-transferase U8-like       173   2e-49   
ref|XP_007140454.1|  hypothetical protein PHAVU_008G113600g             171   2e-49   
ref|XP_010101874.1|  putative glutathione S-transferase                 171   2e-49   
gb|KHG11258.1|  putative glutathione S-transferase                      171   2e-49   
gb|AFK37419.1|  unknown                                                 171   2e-49   
ref|XP_010243636.1|  PREDICTED: probable glutathione S-transferase      171   2e-49   
ref|XP_010023536.1|  PREDICTED: glutathione transferase GST 23-like     171   3e-49   
gb|AGV54744.1|  glutathione transferase                                 171   3e-49   
gb|AEB77869.1|  glutathione S-transferase protein                       171   3e-49   
ref|XP_007034547.1|  Tau class glutathione transferase GSTU43           174   3e-49   
gb|KFK44230.1|  hypothetical protein AALP_AA1G231500                    176   4e-49   
ref|XP_006410006.1|  hypothetical protein EUTSA_v10017660mg             171   4e-49   
emb|CBI38197.3|  unnamed protein product                                172   4e-49   
gb|AAO69664.1|  glutathione S-transferase                               171   4e-49   
ref|XP_007219176.1|  hypothetical protein PRUPE_ppa016653mg             170   4e-49   
gb|KJB28258.1|  hypothetical protein B456_005G037800                    170   4e-49   
ref|XP_002265084.1|  PREDICTED: glutathione transferase GST 23          170   4e-49   
ref|XP_008382671.1|  PREDICTED: glutathione transferase GST 23-like     170   5e-49   
gb|ABW69659.2|  glutathione S-transferase                               170   5e-49   
ref|XP_010036375.1|  PREDICTED: glutathione transferase GST 23-like     170   5e-49   
gb|ABW81132.1|  GST40                                                   170   5e-49   
gb|KHG01946.1|  Glutathione S-transferase U7 -like protein              170   5e-49   
ref|XP_010469952.1|  PREDICTED: glutathione S-transferase U4 isof...    170   6e-49   
ref|XP_002267733.1|  PREDICTED: probable glutathione S-transferase      170   7e-49   
ref|XP_010069088.1|  PREDICTED: glutathione transferase GST 23-like     170   7e-49   
ref|XP_010037773.1|  PREDICTED: glutathione S-transferase U8-like       169   8e-49   
ref|XP_009782545.1|  PREDICTED: glutathione transferase GST 23-like     169   9e-49   
ref|XP_002524048.1|  glutathione s-transferase, putative                170   9e-49   
ref|XP_002315607.2|  hypothetical protein POPTR_0010s07100g             170   9e-49   
gb|KFK44228.1|  hypothetical protein AALP_AA1G231200                    169   9e-49   
emb|CBI18225.3|  unnamed protein product                                171   1e-48   
ref|XP_002275539.1|  PREDICTED: glutathione S-transferase U8            169   1e-48   
gb|AFK44026.1|  unknown                                                 169   1e-48   
ref|XP_009618409.1|  PREDICTED: probable glutathione S-transferase      169   1e-48   
emb|CDX97882.1|  BnaC04g40570D                                          169   1e-48   
ref|XP_010091847.1|  Glutathione transferase GST 23                     169   1e-48   
gb|AFF18812.1|  glutathione transferase                                 169   1e-48   
ref|XP_008382670.1|  PREDICTED: glutathione transferase GST 23-like     169   1e-48   
ref|XP_009789711.1|  PREDICTED: probable glutathione S-transferase      169   1e-48   
ref|XP_010036377.1|  PREDICTED: glutathione transferase GST 23-like     169   1e-48   
gb|AFK43265.1|  unknown                                                 169   1e-48   
ref|XP_010414384.1|  PREDICTED: glutathione S-transferase U4-like       169   1e-48   
ref|XP_010037779.1|  PREDICTED: probable glutathione S-transferase      169   1e-48   
gb|ADB11369.1|  tau class glutathione transferase GSTU43                169   1e-48   
ref|XP_006344661.1|  PREDICTED: glutathione S-transferase U8-like       169   2e-48   
ref|XP_004971273.1|  PREDICTED: probable glutathione S-transferas...    169   2e-48   
ref|XP_010510490.1|  PREDICTED: glutathione S-transferase U4-like       169   2e-48   
ref|XP_007034532.1|  Glutathione S-transferase tau 7                    169   2e-48   
ref|XP_006420234.1|  hypothetical protein CICLE_v10005809mg             169   2e-48   
ref|XP_006294909.1|  hypothetical protein CARUB_v10023960mg             169   2e-48   
ref|XP_010036379.1|  PREDICTED: glutathione transferase GST 23-like     169   2e-48   
ref|XP_006494129.1|  PREDICTED: probable glutathione S-transferas...    168   3e-48   
ref|XP_004157056.1|  PREDICTED: glutathione S-transferase U8-like       168   3e-48   
ref|XP_010101873.1|  putative glutathione S-transferase                 168   3e-48   
ref|XP_010942640.1|  PREDICTED: glutathione transferase GST 23-like     168   3e-48   
emb|CDY53373.1|  BnaC04g54530D                                          168   3e-48   
ref|XP_003632028.2|  PREDICTED: glutathione transferase GST 23-like     167   3e-48   
gb|AEB77872.1|  glutathione S-transferase protein                       168   3e-48   
ref|XP_009370927.1|  PREDICTED: probable glutathione S-transferas...    168   3e-48   
ref|XP_008438428.1|  PREDICTED: probable glutathione S-transferas...    168   4e-48   
ref|NP_001234222.1|  glutathione-S-transferase                          168   4e-48   
ref|XP_006849236.1|  hypothetical protein AMTR_s00027p00235060          168   4e-48   
emb|CDX97887.1|  BnaC04g40520D                                          168   4e-48   
ref|XP_011029699.1|  PREDICTED: probable glutathione S-transferase      168   4e-48   
ref|XP_010521901.1|  PREDICTED: glutathione S-transferase U1-like       168   4e-48   
gb|ABW81194.1|  glutathione-S-transferase 5                             168   4e-48   
ref|XP_010510487.1|  PREDICTED: glutathione S-transferase U2-like       168   4e-48   
ref|XP_002275435.3|  PREDICTED: glutathione S-transferase U8            167   5e-48   
ref|XP_006489729.1|  PREDICTED: probable glutathione S-transferas...    168   5e-48   
ref|XP_010521898.1|  PREDICTED: glutathione S-transferase U7-like       167   5e-48   
emb|CDY45446.1|  BnaA05g12550D                                          167   5e-48   
ref|XP_010257729.1|  PREDICTED: glutathione transferase GST 23-like     168   5e-48   
ref|XP_008235548.1|  PREDICTED: probable glutathione S-transferase      167   5e-48   
ref|XP_002518185.1|  glutathione s-transferase, putative                167   6e-48   
ref|XP_003591644.1|  hypothetical protein MTR_1g090150                  167   6e-48   
ref|XP_004290016.1|  PREDICTED: glutathione transferase GST 23-like     167   6e-48   
gb|KEH28979.1|  glutathione S-transferase, amino-terminal domain ...    167   6e-48   
ref|XP_009625219.1|  PREDICTED: probable glutathione S-transferase      167   6e-48   
ref|XP_002520475.1|  glutathione s-transferase, putative                167   6e-48   
gb|KDO57584.1|  hypothetical protein CISIN_1g036834mg                   167   7e-48   
ref|XP_010264127.1|  PREDICTED: uncharacterized protein LOC104602212    173   7e-48   
ref|XP_007200430.1|  hypothetical protein PRUPE_ppa011142mg             167   8e-48   
ref|XP_007140455.1|  hypothetical protein PHAVU_008G113700g             167   8e-48   
ref|XP_007034526.1|  Glutathione S-transferase tau 7                    167   1e-47   
emb|CDY51366.1|  BnaA04g28600D                                          167   1e-47   
ref|XP_008438427.1|  PREDICTED: probable glutathione S-transferas...    167   1e-47   
ref|XP_006296522.1|  hypothetical protein CARUB_v10025711mg             167   1e-47   
ref|XP_006480912.1|  PREDICTED: glutathione S-transferase U8-like       167   1e-47   
ref|XP_010414386.1|  PREDICTED: glutathione S-transferase U7            167   1e-47   
ref|XP_006849223.1|  hypothetical protein AMTR_s00027p00230090          167   1e-47   
ref|XP_002881051.1|  glutathione-s-transferase 2                        167   1e-47   
ref|XP_009768031.1|  PREDICTED: probable glutathione S-transferase      166   1e-47   
ref|XP_003623210.1|  Glutathione S-transferase GST                      166   1e-47   
gb|KJB65834.1|  hypothetical protein B456_010G115400                    166   1e-47   
ref|XP_008372418.1|  PREDICTED: probable glutathione S-transferase      166   1e-47   
ref|XP_007034540.1|  Glutathione S-transferase tau 7                    166   2e-47   
ref|NP_001104997.1|  LOC541848                                          166   2e-47   
gb|EYU26621.1|  hypothetical protein MIMGU_mgv1a013264mg                166   2e-47   
gb|AAA87183.1|  auxin-induced protein                                   166   2e-47   
ref|XP_002881050.1|  glutathione-s-transferase 3                        166   2e-47   
ref|XP_009781771.1|  PREDICTED: probable glutathione S-transferase      166   2e-47   
gb|ACG44510.1|  glutathione S-transferase GSTU6                         165   2e-47   
gb|EYU26623.1|  hypothetical protein MIMGU_mgv1a013321mg                166   2e-47   
gb|AAF64450.1|AF239928_1  glutathione S-transferase                     166   2e-47   
ref|XP_009123411.1|  PREDICTED: glutathione S-transferase U8            166   2e-47   
ref|XP_010693980.1|  PREDICTED: probable glutathione S-transferase      166   2e-47   
ref|XP_006420232.1|  hypothetical protein CICLE_v10005808mg             166   2e-47   
ref|XP_004134026.1|  PREDICTED: glutathione transferase GST 23-like     166   2e-47   
emb|CDY22184.1|  BnaC01g39170D                                          166   2e-47   
ref|XP_010101872.1|  putative glutathione S-transferase                 166   2e-47   
ref|XP_009764523.1|  PREDICTED: glutathione transferase GST 23-like     166   2e-47   
ref|XP_004157654.1|  PREDICTED: glutathione transferase GST 23-like     166   2e-47   
emb|CDY51369.1|  BnaA04g28630D                                          166   3e-47   
ref|XP_009767206.1|  PREDICTED: probable glutathione S-transferase      166   3e-47   
ref|XP_010264128.1|  PREDICTED: glutathione transferase GST 23-like     166   3e-47   
emb|CAN62219.1|  hypothetical protein VITISV_042912                     166   3e-47   
ref|XP_009370896.1|  PREDICTED: probable glutathione S-transferase      166   3e-47   
ref|XP_010510492.1|  PREDICTED: glutathione S-transferase U7-like       167   3e-47   
ref|XP_007201513.1|  hypothetical protein PRUPE_ppa015182mg             166   3e-47   
ref|XP_006360613.1|  PREDICTED: probable glutathione S-transferas...    166   3e-47   
gb|ABW74586.1|  glutathione-S-transferase                               166   3e-47   
ref|XP_008346194.1|  PREDICTED: probable glutathione S-transferase      166   3e-47   
ref|XP_009802971.1|  PREDICTED: probable glutathione S-transferase      166   3e-47   
ref|XP_008810435.1|  PREDICTED: glutathione transferase GST 23-like     167   3e-47   
ref|XP_010029753.1|  PREDICTED: glutathione S-transferase U10-like      166   3e-47   
dbj|BAJ90384.1|  predicted protein                                      166   3e-47   
ref|XP_002520480.1|  glutathione s-transferase, putative                166   4e-47   
ref|XP_006429233.1|  hypothetical protein CICLE_v10012710mg             165   4e-47   
ref|XP_004983860.1|  PREDICTED: probable glutathione S-transferas...    166   4e-47   
ref|XP_006346688.1|  PREDICTED: probable glutathione S-transferas...    167   4e-47   
ref|XP_004962089.1|  PREDICTED: glutathione transferase GST 23-like     167   4e-47   
ref|XP_004983859.1|  PREDICTED: probable glutathione S-transferas...    166   4e-47   
gb|AFK36747.1|  unknown                                                 165   4e-47   
ref|XP_008793317.1|  PREDICTED: probable glutathione S-transferase      165   5e-47   
ref|XP_010907529.1|  PREDICTED: glutathione transferase GST 23-like     166   5e-47   
ref|XP_006294944.1|  hypothetical protein CARUB_v10023998mg             165   6e-47   
ref|XP_010051836.1|  PREDICTED: probable glutathione S-transferas...    165   6e-47   
ref|NP_180508.1|  glutathione S-transferase tau 3                       165   6e-47   
ref|XP_006420440.1|  hypothetical protein CICLE_v10005850mg             165   6e-47   
ref|XP_008240102.1|  PREDICTED: glutathione S-transferase U8-like       164   6e-47   
ref|XP_011016467.1|  PREDICTED: glutathione S-transferase U8-like       162   6e-47   
ref|XP_011041494.1|  PREDICTED: probable glutathione S-transferase      164   8e-47   
gb|ADE76765.1|  unknown                                                 165   8e-47   
gb|KFK44229.1|  hypothetical protein AALP_AA1G231400                    165   8e-47   
ref|XP_010938161.1|  PREDICTED: glutathione S-transferase U8-like       164   8e-47   
emb|CDX97884.1|  BnaC04g40550D                                          164   9e-47   
ref|XP_010040697.1|  PREDICTED: glutathione transferase GST 23-like     165   9e-47   
ref|XP_008812235.1|  PREDICTED: glutathione transferase GST 23-like     166   9e-47   
gb|AFK49084.1|  unknown                                                 164   9e-47   
ref|NP_001104993.1|  glutathione S-transferase GST 33                   165   9e-47   
ref|XP_006340906.1|  PREDICTED: glutathione transferase GST 23-like     164   9e-47   
ref|XP_002892975.1|  predicted protein                                  164   1e-46   



>emb|CDO99237.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M   +G+K++GFWVSP+VLRVKWAL++KG+EYEYIEED+ NK+PLL +LNPV  +VPVLV
Sbjct  1    MEENQGVKLLGFWVSPYVLRVKWALKLKGIEYEYIEEDVFNKSPLLLKLNPVKGQVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H+GKP+PES++ILEYIDE WKH+PLLP DPYERA +RFWA FA  K+   AWEALCS+G+
Sbjct  61   HDGKPIPESIVILEYIDEVWKHSPLLPQDPYERANSRFWAKFAAEKLQAYAWEALCSRGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
              E A+N++MEA+EK+E ELNGK+FFGG+KIG++DLV G++++ LP++EE+ S+KI DS 
Sbjct  121  DHERAINASMEALEKMEKELNGKKFFGGDKIGFVDLVAGFISYQLPVYEEIVSMKILDSS  180

Query  582  KFP  590
            KFP
Sbjct  181  KFP  183



>gb|KDP40336.1| hypothetical protein JCGZ_02334 [Jatropha curcas]
Length=230

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MA +E +K++G WVSPFV RV+WAL++KG++YEYIEEDI NK+PLL QLNPV+ KVPVLV
Sbjct  1    MAKKEEVKLLGLWVSPFVRRVEWALKLKGVDYEYIEEDIFNKSPLLLQLNPVNKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            H  K + ES +ILEYIDETWKHN PLLP DPY+RA+ARFWA FAE KI + AW ALCS G
Sbjct  61   HGNKVIAESFVILEYIDETWKHNYPLLPQDPYQRAKARFWAKFAEEKIFEAAWNALCSLG  120

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDS  578
             ++E A+   +EA+EKLE EL GKQFFGGE IGY+D++ GW+++ LP++EEV S+K  D+
Sbjct  121  DEKERAIKMTIEALEKLEGELEGKQFFGGENIGYVDILAGWISYWLPVWEEVGSMKFIDA  180

Query  579  QKFP  590
             +FP
Sbjct  181  LQFP  184



>emb|CDP08010.1| unnamed protein product [Coffea canephora]
Length=231

 Score =   230 bits (587),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 144/185 (78%), Gaps = 2/185 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M    G+K++GFWVSPF  RVKWAL++KG++YEYIEEDI NK+PLLS+LNPV+  VPVLV
Sbjct  1    MEETGGVKLLGFWVSPFAQRVKWALKLKGVQYEYIEEDIYNKSPLLSKLNPVYGMVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ES++ILEYIDE WK  PLLP DPYERA+ARFWA FAE K+    WEA+CS G+
Sbjct  61   HNGKPISESIIILEYIDEVWKQAPLLPQDPYERAQARFWAKFAEEKVRQSVWEAMCSSGE  120

Query  402  QQESAVNSamea--mekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
            +++ AV SA+EA    + E +  G +FFGGE IG++D+V G +++ L + EEV S+KI D
Sbjct  121  EKQKAVKSAVEAFEEFEKELKRRGTKFFGGETIGFVDIVAGCISYQLAVHEEVGSIKILD  180

Query  576  SQKFP  590
            S +FP
Sbjct  181  SSRFP  185



>ref|XP_007035120.1| Glutathione S-transferase tau 7 [Theobroma cacao]
 gb|EOY06046.1| Glutathione S-transferase tau 7 [Theobroma cacao]
Length=248

 Score =   230 bits (587),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 155/186 (83%), Gaps = 2/186 (1%)
 Frame = +3

Query  36   VIMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPV  215
            ++MA +E +K++GFWVSPFV RV+WAL++KG++YEYIEEDI NK+ LL +LNPV  KVPV
Sbjct  21   ILMATKE-VKLLGFWVSPFVFRVEWALKIKGVKYEYIEEDIFNKSTLLMELNPVRKKVPV  79

Query  216  LVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK  395
            LVH+GK + ES +ILEYIDETWK NPLLP DPY+RA ARFWA FAE KIL+ AW ALCS+
Sbjct  80   LVHDGKVIAESFVILEYIDETWKQNPLLPQDPYQRALARFWAKFAEEKILEGAWNALCSQ  139

Query  396  GKQQESAVNSameamekleaelNGK-QFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIF  572
            G++++ A+   +EAMEK+E EL GK QFFGGE +GYLD+++GW+++ LP++EEV S++I 
Sbjct  140  GEEKQKALRQTIEAMEKIEGELEGKQQFFGGESVGYLDIILGWISYWLPVWEEVGSMEIL  199

Query  573  DSQKFP  590
            +  KFP
Sbjct  200  NPIKFP  205



>ref|XP_007035121.1| Glutathione S-transferase tau 7 isoform 1 [Theobroma cacao]
 gb|EOY06047.1| Glutathione S-transferase tau 7 isoform 1 [Theobroma cacao]
Length=241

 Score =   229 bits (584),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 151/184 (82%), Gaps = 2/184 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MA EE +K++GFWVSP V RVKWAL +KG++YEYIEEDI NK+ LL +LNPVH KVPVLV
Sbjct  1    MATEE-VKLLGFWVSPPVFRVKWALEIKGVKYEYIEEDIFNKSTLLMELNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H+GK + ES +ILEYIDETWK NPLLP DPY+RA ARFWA FAE KIL  AW ALCS+G+
Sbjct  60   HDGKAIAESFVILEYIDETWKQNPLLPQDPYQRALARFWAKFAEEKILRGAWNALCSQGE  119

Query  402  QQESAVNSameamekleaelNGK-QFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDS  578
            +++ A+   +EAMEK+E EL GK QFFGGE +GYLD+++GW+++ LP++EEV S++I + 
Sbjct  120  EKQKALEQTIEAMEKIEGELEGKEQFFGGESVGYLDIILGWISYCLPVWEEVGSMQILNP  179

Query  579  QKFP  590
             KFP
Sbjct  180  LKFP  183



>emb|CDO99236.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 145/177 (82%), Gaps = 2/177 (1%)
 Frame = +3

Query  66   VVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPLPE  245
            ++GFW SPFV RVKWAL++KG+EYEYIEED+ +K+ LL +LNPV   VPVLVHN KP+ E
Sbjct  8    LLGFWASPFVQRVKWALKLKGVEYEYIEEDLFDKSSLLLKLNPVQKLVPVLVHNRKPISE  67

Query  246  SLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAVNS  425
            S+LILEYIDE WK NPLLP DPYERA+ARFWA FAE K+ +  W+ALCS+G+++E AV S
Sbjct  68   SILILEYIDEVWKQNPLLPHDPYERAQARFWAKFAEEKVRESTWDALCSRGEEREKAVKS  127

Query  426  ameamek--leaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            ++EA+EK   E +L G +FFGGE IG++DLV G++++ LP+FEEV S+KI DS KFP
Sbjct  128  SIEALEKFEEELKLKGTKFFGGETIGFVDLVAGFISYQLPVFEEVGSMKILDSSKFP  184



>ref|XP_007035122.1| Glutathione S-transferase tau 7 isoform 2, partial [Theobroma 
cacao]
 gb|EOY06048.1| Glutathione S-transferase tau 7 isoform 2, partial [Theobroma 
cacao]
Length=222

 Score =   226 bits (577),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 148/180 (82%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++GFWVSP V RVKWAL +KG++YEYIEEDI NK+ LL +LNPVH KVPVLVH+GK
Sbjct  1    EEVKLLGFWVSPPVFRVKWALEIKGVKYEYIEEDIFNKSTLLMELNPVHKKVPVLVHDGK  60

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
             + ES +ILEYIDETWK NPLLP DPY+RA ARFWA FAE KIL  AW ALCS+G++++ 
Sbjct  61   AIAESFVILEYIDETWKQNPLLPQDPYQRALARFWAKFAEEKILRGAWNALCSQGEEKQK  120

Query  414  AVNSameamekleaelNGK-QFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+   +EAMEK+E EL GK QFFGGE +GYLD+++GW+++ LP++EEV S++I +  KFP
Sbjct  121  ALEQTIEAMEKIEGELEGKEQFFGGESVGYLDIILGWISYCLPVWEEVGSMQILNPLKFP  180



>ref|XP_011091312.1| PREDICTED: glutathione transferase GST 23-like [Sesamum indicum]
Length=231

 Score =   226 bits (577),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            E  +K+VGFWVSPFV RV+WAL++KG+EYEYIEEDI NK+PLLS+LNP++ KVPVLVH+G
Sbjct  6    ESSVKLVGFWVSPFVHRVRWALKLKGVEYEYIEEDIFNKSPLLSELNPLYKKVPVLVHDG  65

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KPL +S +ILEY+D+ W+ NPL P DPY+RA+A  WA FA+ K+L+ AW ALCS+GK QE
Sbjct  66   KPLSDSSIILEYVDQKWRSNPLFPDDPYQRAQAHLWARFADEKVLESAWLALCSEGKTQE  125

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             AV  A+E +E +E +L GK+FFGG+ IG++DL++G++++ LP++EEV  +KI D  KFP
Sbjct  126  RAVKQAIENLEHVEEKLKGKRFFGGDIIGHVDLMMGFISYMLPVWEEVGGVKILDPHKFP  185



>ref|XP_010069125.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
 gb|KCW57370.1| hypothetical protein EUGRSUZ_H00155 [Eucalyptus grandis]
Length=226

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 143/183 (78%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MA  + ++++G WVSPFV RV+WAL++KG+ Y+YIEEDILNK+ LL +LNPVH KVPVLV
Sbjct  1    MANPKEVELLGLWVSPFVRRVEWALKLKGIAYDYIEEDILNKSALLLRLNPVHQKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H G+ + ES LILEYIDETWK +PLLP DPY+RA ARFWA  AE ++L  AW ALCS+G+
Sbjct  61   HGGRVICESFLILEYIDETWKQSPLLPQDPYDRATARFWASVAEGQLLRNAWIALCSEGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            ++E A+  A EA+  +E  + GK FFGGE IGYLDL +GWV H LP+++E+ S+KI D  
Sbjct  121  EKERAIEFATEALGHIEGVIEGKAFFGGEGIGYLDLAIGWVCHWLPVWDELGSMKICDPA  180

Query  582  KFP  590
            KFP
Sbjct  181  KFP  183



>ref|XP_011030495.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=229

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 147/183 (80%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MA+ E +K++GFW SPF  RV+WAL++KG++YEYIEEDI NK+ LL +LNPVH KVPVLV
Sbjct  1    MASTEQVKLLGFWASPFARRVEWALKLKGVDYEYIEEDIFNKSTLLMELNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
               K + ES +ILE+IDETWK  PL+P DPYERA  RFWA FAE KILD AW A+CS G+
Sbjct  61   RGRKVIAESFVILEFIDETWKQCPLMPQDPYERAMTRFWAKFAEEKILDAAWIAMCSLGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            ++E A+  A+EAMEK+E EL GKQFFGGE IGYLD+ +GW+++ LP++EEV S+KI ++ 
Sbjct  121  EKEKALKLAVEAMEKIEGELKGKQFFGGENIGYLDIAMGWMSYWLPVWEEVGSMKIVNAL  180

Query  582  KFP  590
            +FP
Sbjct  181  QFP  183



>ref|XP_010069124.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
 gb|KCW57369.1| hypothetical protein EUGRSUZ_H00154 [Eucalyptus grandis]
Length=226

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 142/183 (78%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MA  + ++++G WVSPFV RV+WAL++KG+ Y+YIEEDILNK+ LL +LNPVH KVPVLV
Sbjct  1    MANPKEVELLGLWVSPFVRRVEWALKLKGIAYDYIEEDILNKSALLLRLNPVHQKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H G+ + ES LILEYIDETWK  PLLP DPY+RA ARFWA  AE ++L  AW A CS+G+
Sbjct  61   HAGRVVCESFLILEYIDETWKQIPLLPRDPYDRAMARFWASVAEGQLLANAWVASCSEGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            +QE A+  A EA+  +E  + GK FFGGE IGYLDL +GWVA+ LPI++EV S+KIFD  
Sbjct  121  EQERAIKVATEALGHIEGVIKGKAFFGGEGIGYLDLAIGWVAYWLPIWDEVGSMKIFDPA  180

Query  582  KFP  590
             FP
Sbjct  181  MFP  183



>ref|XP_007159485.1| hypothetical protein PHAVU_002G241400g [Phaseolus vulgaris]
 gb|ESW31479.1| hypothetical protein PHAVU_002G241400g [Phaseolus vulgaris]
Length=228

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 145/183 (79%), Gaps = 1/183 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M +EE +KVV FWVSPF +RV+WAL++KG+EYEYIEEDI NK+ LL QLNPVH KVPVL+
Sbjct  1    MGSEE-VKVVSFWVSPFGIRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLL  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +IL+YIDE WKH PLLP  PY+RA   FWA F + K+LDP+W A+CS G 
Sbjct  60   HAHKPIAESFIILQYIDEIWKHYPLLPQHPYQRALVHFWANFGDQKLLDPSWIAMCSSGD  119

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
             QE+A+  A E+MEK+E E+ GK+FFGG+ IGYLD+ +GW+++ LP++EEV S++I D  
Sbjct  120  DQENALKVARESMEKIEEEIKGKKFFGGDNIGYLDIALGWISYWLPVWEEVGSMQIMDPL  179

Query  582  KFP  590
            KFP
Sbjct  180  KFP  182



>ref|XP_006378334.1| hypothetical protein POPTR_0010s08170g [Populus trichocarpa]
 gb|ADB11376.1| tau class glutathione transferase GSTU52 [Populus trichocarpa]
 gb|ERP56131.1| hypothetical protein POPTR_0010s08170g [Populus trichocarpa]
Length=229

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MA  E +K++GFW SPF  RV+WAL++KG++YEYIEEDI NK+ LL +LNPVH KVPVLV
Sbjct  1    MANTEQVKLLGFWASPFARRVEWALKLKGVDYEYIEEDIFNKSSLLMELNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  K + ES +ILE+IDETWK  PL+P DPYERA+ RFWA FAE KILD AW A+CS G+
Sbjct  61   HGRKVIAESFVILEFIDETWKQCPLMPQDPYERAKTRFWAKFAEEKILDGAWIAMCSLGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            ++E A+  A+EA+EK+E EL GK FFGGE IGYLD+ +GW+++ LP++EEV S+KI +  
Sbjct  121  EKEKAIKLAVEAIEKIEGELKGKHFFGGENIGYLDIAMGWMSYWLPVWEEVGSMKIVNPL  180

Query  582  KFP  590
            +FP
Sbjct  181  QFP  183



>ref|XP_010025836.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
Length=292

 Score =   224 bits (570),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 140/182 (77%), Gaps = 0/182 (0%)
 Frame = +3

Query  45   AAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVH  224
            A  E +K++G WVSPFV RV+WAL++KG+ Y+YIEEDILNK+ LL +LNP H KVPVLVH
Sbjct  68   ANPEEVKLLGLWVSPFVWRVEWALKLKGIAYDYIEEDILNKSALLLRLNPAHQKVPVLVH  127

Query  225  NGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
             G+ + ES LILEYIDETWK +PLLP DPY+RA ARFWA  AE ++L  AW AL S+G++
Sbjct  128  GGRVICESFLILEYIDETWKQSPLLPQDPYDRAMARFWASVAEGQLLKNAWIALISEGEE  187

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
            +E A+  A E +   E  + GK FFGGE IGYLDL +GW++H+LP+++EV S+KI D  K
Sbjct  188  KERAIEFATEVLGHFEGVIEGKAFFGGEGIGYLDLAIGWISHSLPVYDEVGSMKILDPAK  247

Query  585  FP  590
            FP
Sbjct  248  FP  249



>gb|KEH20685.1| glutathione S-transferase [Medicago truncatula]
Length=224

 Score =   221 bits (563),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
              + +K+VGFWVSPFV RV+WAL++KG+ YEY+EEDI NKTPLL +LNPVH KVPVLVH 
Sbjct  2    GSQDVKLVGFWVSPFVKRVEWALKLKGVNYEYVEEDIFNKTPLLLELNPVHKKVPVLVHA  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             KP+ ES +ILEYIDETWK +PLLP  PYERA ARFWA FAE K+L+ AW A+C+ G++Q
Sbjct  62   QKPIAESFIILEYIDETWKQSPLLPQHPYERALARFWADFAEQKLLNAAWIAMCNSGEEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
            E A+  A EA+EK+E E+ GK+FFGG+ IGYLDL +GW+++ LP+FEEV S++I D  K
Sbjct  122  EKALKVAREAIEKIEEEIKGKKFFGGDNIGYLDLALGWISYWLPVFEEVGSMQIIDPLK  180



>gb|ACJ83863.1| unknown [Medicago truncatula]
 gb|AFK45626.1| unknown [Medicago truncatula]
Length=224

 Score =   219 bits (558),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
              + +K+VGFWVSPFV RV+WAL++KG+ YEY+EEDI NKTPLL +LNPVH KVPVLVH 
Sbjct  2    GSQDVKLVGFWVSPFVKRVEWALKLKGVNYEYVEEDIFNKTPLLLELNPVHKKVPVLVHA  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             KP+ ES +ILEYIDETWK +PLLP  PYERA ARFWA FAE K+L+ AW A+C+ G+++
Sbjct  62   QKPIAESFIILEYIDETWKQSPLLPQHPYERALARFWADFAEQKLLNAAWIAMCNSGEER  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
            E A+  A EA+EK+E E+ GK+FFGG+ IGYLDL +GW+++ LP+FEEV S++I D
Sbjct  122  EKALKVAREAIEKIEEEIKGKKFFGGDNIGYLDLALGWISYWLPVFEEVGSMQIID  177



>emb|CDP08048.1| unnamed protein product [Coffea canephora]
Length=279

 Score =   221 bits (562),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 135/185 (73%), Gaps = 2/185 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M    G+K+ GFWVSPF  RVKWAL++KG++YEYIEED  NK+PLL +LNPV+ KVPVLV
Sbjct  1    MEEAGGVKLFGFWVSPFAQRVKWALKLKGIQYEYIEEDKYNKSPLLLKLNPVYGKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ES++ILEYIDE WK  PLLP DPYERA+A FWA FAE K+     EA+CS G 
Sbjct  61   HNGKPISESIIILEYIDEVWKQAPLLPQDPYERAQAHFWAKFAEEKVRQSVVEAMCSSGD  120

Query  402  QQESAVN--SameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
            +++ AV          + E +  G +FFGGE IG++D+V G +++ LP+ EEV SLKI D
Sbjct  121  EKQKAVKLAVEAFEEFEKELKRRGTKFFGGETIGFVDIVAGCISYQLPVHEEVGSLKILD  180

Query  576  SQKFP  590
            S KFP
Sbjct  181  SSKFP  185



>ref|XP_002280532.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   217 bits (553),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV+G  +S F +RV+WAL++KG+EYEYI+ED+ NK+P+L + NPVH KVPVLVH  K
Sbjct  3    EEVKVIGSILSGFCVRVEWALKLKGVEYEYIKEDLRNKSPMLLKYNPVHKKVPVLVHGDK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+PESL+ILEYIDETWK NPLLP DPYERA ARFWA +A+ K L  AWEA  ++G+++E 
Sbjct  63   PIPESLVILEYIDETWKDNPLLPEDPYERAMARFWAKYADEKCLFGAWEAFKAEGEEKEK  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+ SA+E+   LE  + GK+FFGGEK+G+LDLVVGW+ H L + EEV  +K+ D+++FP
Sbjct  123  AMESALESFAFLEKAIKGKKFFGGEKMGFLDLVVGWIPHWLSVLEEVGGMKMLDAERFP  181



>ref|XP_002280676.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   216 bits (551),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV+G   S F +RV+WAL++KG+EYEYI+ED+ NK+P+L + NPVH KVPVLVH  K
Sbjct  3    EEVKVIGSIKSGFCVRVEWALKLKGVEYEYIKEDLRNKSPMLLKYNPVHKKVPVLVHGDK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+PESL+ILEYIDETWK NPLLP DPYERA ARFWA +A+ K +  AWEA  ++G+++E 
Sbjct  63   PIPESLVILEYIDETWKDNPLLPEDPYERAMARFWAKYADEKCMFGAWEAFKAEGEEKEK  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+ SA+E+   LE  + GK+FFGGEK+G+LDLVVGW+ H L + EEV  +K+ D++KFP
Sbjct  123  AMESALESFAFLEKAIKGKKFFGGEKMGFLDLVVGWIPHWLSVLEEVGGMKMLDAEKFP  181



>ref|XP_003629836.1| Receptor-like protein kinase [Medicago truncatula]
Length=869

 Score =   227 bits (579),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 156/196 (80%), Gaps = 5/196 (3%)
 Frame = +3

Query  9    EKQDRNITVV----IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPL  176
            E++DR   +V    IM +++ +K+VGFWVSPFV RV+WAL++KG+ YEY+EEDI NKTPL
Sbjct  631  ERRDRGNKLVQQYNIMGSQD-VKLVGFWVSPFVKRVEWALKLKGVNYEYVEEDIFNKTPL  689

Query  177  LSQLNPVHAKVPVLVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEF  356
            L +LNPVH KVPVLVH  KP+ ES +ILEYIDETWK +PLLP  PYERA ARFWA FAE 
Sbjct  690  LLELNPVHKKVPVLVHAQKPIAESFIILEYIDETWKQSPLLPQHPYERALARFWADFAEQ  749

Query  357  KILDPAWEALCSKGKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNL  536
            K+L+ AW A+C+ G++QE A+  A EA+EK+E E+ GK+FFGG+ IGYLDL +GW+++ L
Sbjct  750  KLLNAAWIAMCNSGEEQEKALKVAREAIEKIEEEIKGKKFFGGDNIGYLDLALGWISYWL  809

Query  537  PIFEEVASLKIFDSQK  584
            P+FEEV S++I D  K
Sbjct  810  PVFEEVGSMQIIDPLK  825



>ref|XP_002285214.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
Length=227

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 141/181 (78%), Gaps = 0/181 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEED+ NK+PLL QLNP+H +VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDVFNKSPLLLQLNPLHKRVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             + + ES +I++YIDETW   PLLP  PYERA ARFWA FAE K+ + AW ALCS+G+++
Sbjct  62   HRVICESYVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLFESAWMALCSRGEER  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E A   AMEA+EK+E  + GK+ FGGE IGYLD+ +GW+++ LPI+EEV  ++I D  KF
Sbjct  122  ERAAKLAMEAVEKIEELVKGKKLFGGESIGYLDICLGWISYWLPIWEEVGCMQIIDPIKF  181

Query  588  P  590
            P
Sbjct  182  P  182



>ref|XP_003632015.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=227

 Score =   213 bits (542),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEEDI NK+PLL QLNP+H +VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDIFNKSPLLLQLNPLHKRVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             + + ES +I++YIDETW   PLLP  PYERA ARFWA FAE K+L+ AW  +CS+G+++
Sbjct  62   HRVICESYVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLLETAWMGICSRGEER  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E A   A+EA+ K+E  + GK+ FGGE IGYLD+ +GW+++ LPI+EEV  ++I D  KF
Sbjct  122  ERAAKLAIEAVAKIEELVKGKKLFGGESIGYLDICLGWISYWLPIWEEVGCMQIIDPIKF  181

Query  588  P  590
            P
Sbjct  182  P  182



>ref|XP_006420238.1| hypothetical protein CICLE_v10005771mg [Citrus clementina]
 gb|ESR33478.1| hypothetical protein CICLE_v10005771mg [Citrus clementina]
Length=236

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 147/186 (79%), Gaps = 3/186 (2%)
 Frame = +3

Query  36   VIMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPV  215
            +IMA +  +KV+GFW SPFV RV WAL++KG+E+EYIEEDI NK+  L +LNPVH KVPV
Sbjct  1    MIMATK--VKVLGFWCSPFVFRVVWALKLKGVEFEYIEEDIFNKSTRLLELNPVHKKVPV  58

Query  216  LVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK  395
            LVH+ K + ESL+ILEYIDETW  +PLLP DPYERA ARFWA FA+ K++  AW++ C+K
Sbjct  59   LVHDDKVIVESLVILEYIDETWPQDPLLPQDPYERAMARFWAKFADEKLMQTAWKSTCTK  118

Query  396  GKQQESAVNSameamekleaelNGKQFFGGE-KIGYLDLVVGWVAHNLPIFEEVASLKIF  572
            G+++E A+ + ME +EK+E EL GK +FGGE K  YL++ +GW+ + +PI+EE+AS++  
Sbjct  119  GEEKEDALKATMEVLEKIEGELKGKSYFGGENKYAYLEIAIGWINYLIPIWEEIASIQFL  178

Query  573  DSQKFP  590
            D ++FP
Sbjct  179  DPKRFP  184



>emb|CAN63628.1| hypothetical protein VITISV_018696 [Vitis vinifera]
Length=227

 Score =   213 bits (541),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 141/181 (78%), Gaps = 0/181 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEEDI NK+PLL QLNP+H +VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDIFNKSPLLLQLNPLHKRVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             + + ES +I++YIDETW   PLLP  PYERA ARFWA FAE K+L+ AW  +CS+G+++
Sbjct  62   HRVICESYVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLLETAWMGICSRGEER  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E A   A+EA+EK+E  + GK+ FGGE IGYLD+ +GW+++ LPI+EEV  ++I D  KF
Sbjct  122  ERAAKLAIEAVEKIEELVKGKKLFGGESIGYLDICLGWISYWLPIWEEVGCMQIIDPIKF  181

Query  588  P  590
            P
Sbjct  182  P  182



>ref|XP_002285220.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
Length=227

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEED+ NK+PLL QLNP+H  VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDVFNKSPLLLQLNPLHKSVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             + + ES +I++YIDETW   PLLP +PYERA ARFWA FAE K+++ AW   CS+G+++
Sbjct  62   HRVICESFVIVQYIDETWPQYPLLPQNPYERAMARFWAEFAESKLMESAWMGQCSRGEER  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E A N AME +EK+E  + GK+ FGGE IGYLD+ +GW+++ LPI+EEV  ++I D  KF
Sbjct  122  ERAANLAMETVEKIEELVKGKKLFGGESIGYLDICLGWLSYWLPIWEEVGCMQIIDPIKF  181

Query  588  P  590
            P
Sbjct  182  P  182



>ref|XP_010279423.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=223

 Score =   211 bits (538),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KVVG   S F  R++WAL+++G+EYEY++ED+ NK+PLL + NPVH KVPV +HNG+P+
Sbjct  4    VKVVGSSPSLFCYRIEWALKLQGIEYEYLKEDLRNKSPLLLKYNPVHKKVPVFLHNGRPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK+NPLLP DP+ERA ARFWA F + K L  AW ALC++G ++E AV
Sbjct  64   AESLVILEYIDETWKNNPLLPEDPHERALARFWAKFGDEKCLMGAWAALCAEGPEKEKAV  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             +AME +  LE ++ GK+FFGG+ IG+LDLV+GW+ H L + +EV  +K+FD+++FP
Sbjct  124  ETAMETLNYLEKQIEGKKFFGGKTIGFLDLVIGWIPHWLDVLDEVGGMKLFDAERFP  180



>gb|AEC32486.1| tau class glutathione S-transferase [Glycine soja]
 gb|KHN06426.1| Putative glutathione S-transferase [Glycine soja]
Length=224

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 145/183 (79%), Gaps = 1/183 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL++KG+EYEYIE+DI NKT LL QLNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFNKTSLLLQLNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA FAE K+LD AW  + S G 
Sbjct  60   HAHKPIAESFVIVEYVDETWKQYPLLPQDPYQRALARFWANFAEQKLLDAAWIGMYSSGD  119

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            +Q++AV  A EA+EK+E E+ GK++FGGE IGYLD+ +GW+++ LPI+EEV S++I D  
Sbjct  120  EQQNAVKVAREAIEKIEEEIKGKKYFGGENIGYLDIALGWISYWLPIWEEVGSIQIIDPL  179

Query  582  KFP  590
            KFP
Sbjct  180  KFP  182



>gb|KCW57371.1| hypothetical protein EUGRSUZ_H00157, partial [Eucalyptus grandis]
Length=211

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = +3

Query  87   PFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPLPESLLILEY  266
            PFV RV+WAL++KG+ Y+YIEEDILNK+ LL +LNP H KVPVLVH G+ + ES LILEY
Sbjct  1    PFVWRVEWALKLKGIAYDYIEEDILNKSALLLRLNPAHQKVPVLVHGGRVICESFLILEY  60

Query  267  IDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAVNSameamek  446
            IDETWK +PLLP DPY+RA ARFWA  AE ++L  AW AL S+G+++E A+  A E +  
Sbjct  61   IDETWKQSPLLPQDPYDRAMARFWASVAEGQLLKNAWIALISEGEEKERAIEFATEVLGH  120

Query  447  leaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             E  + GK FFGGE IGYLDL +GW++H+LP+++EV S+KI D  KFP
Sbjct  121  FEGVIEGKAFFGGEGIGYLDLAIGWISHSLPVYDEVGSMKILDPAKFP  168



>ref|XP_003524975.2| PREDICTED: probable glutathione S-transferase [Glycine max]
 gb|AJE59657.1| tau class glutathione S-transferase [Glycine max]
Length=224

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 145/183 (79%), Gaps = 1/183 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL++KG+EYEYIE+DI NKT LL QLNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFNKTSLLLQLNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA FAE K+LD AW  + S G 
Sbjct  60   HAHKPIAESFVIVEYVDETWKQYPLLPRDPYQRALARFWANFAEQKLLDAAWIGMYSSGD  119

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            +Q++AV  A EA+EK+E E+ GK++FGGE IGYLD+ +GW+++ LPI+EEV S++I D  
Sbjct  120  EQQNAVKVAREAIEKIEEEIKGKKYFGGENIGYLDIALGWISYWLPIWEEVGSIQIIDPL  179

Query  582  KFP  590
            KFP
Sbjct  180  KFP  182



>gb|ACU14737.1| unknown [Glycine max]
Length=244

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 145/183 (79%), Gaps = 1/183 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL++KG+EYEYIE+DI NKT LL QLNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFNKTSLLLQLNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA FAE K+LD AW  + S G 
Sbjct  60   HAHKPIAESFVIVEYVDETWKQYPLLPRDPYQRALARFWANFAEQKLLDAAWIGMYSSGD  119

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            +Q++AV  A EA+EK+E E+ GK++FGGE IGYLD+ +GW+++ LPI+EEV S++I D  
Sbjct  120  EQQNAVKVAREAIEKIEEEIKGKKYFGGENIGYLDIALGWISYWLPIWEEVGSIQIIDPL  179

Query  582  KFP  590
            KFP
Sbjct  180  KFP  182



>ref|XP_002285212.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
Length=227

 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            A++ +K++GFW SPF  RV WAL++KG++YEYIEED+ NK+PLL QLNP+H  VPVL+H 
Sbjct  2    AQQEVKLLGFWASPFAYRVIWALKLKGVDYEYIEEDVFNKSPLLLQLNPLHKSVPVLIHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             + + ES +I++YIDETW   PLLP  PYERA ARFWA FAE K+++ AW   CS+G+++
Sbjct  62   HRVICESFVIVQYIDETWPQYPLLPQHPYERAMARFWAEFAESKLMESAWMGQCSRGEER  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E A   AME +EK+E  + GK+ FGGE IGYLD+ +GW+++ LPI+EEV  ++I D  KF
Sbjct  122  ERAAKLAMETVEKIEELVKGKKLFGGESIGYLDICLGWLSYWLPIWEEVGCMQIIDPIKF  181

Query  588  P  590
            P
Sbjct  182  P  182



>ref|XP_008224351.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=224

 Score =   209 bits (531),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 139/182 (76%), Gaps = 1/182 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            A + +K++G+  SPF  RV+WAL++KG++YEY+EEDI NK+PLL QLNPV  KVPVLVH 
Sbjct  2    ATDKVKLLGYVFSPFSRRVEWALKLKGIDYEYVEEDIFNKSPLLLQLNPVRKKVPVLVHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEAL-CSKGKQ  404
             + + ES  ILEYIDETWK NPLLP DPY RA +RFWA F E K+LD A+ AL CS G+Q
Sbjct  62   NEVVSESFTILEYIDETWKQNPLLPQDPYARAISRFWANFTEEKVLDAAFTALICSTGEQ  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
            QE A+ S +EA+E +E +L GK+  GGE IGYLD+ +GW+++ LPI+EEV S ++ D  K
Sbjct  122  QEKALKSTIEALEHIEGDLMGKKILGGESIGYLDIAMGWISYWLPIWEEVGSGQVLDPSK  181

Query  585  FP  590
            FP
Sbjct  182  FP  183



>gb|AAG34804.1|AF243369_1 glutathione S-transferase GST 14, partial [Glycine max]
Length=219

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++ F+ SPF  RV+WAL++KG+EYEYIE+DI NKT LL QLNPVH KVPVLVH  KP+
Sbjct  1    VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFNKTSLLLQLNPVHKKVPVLVHAHKPI  60

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +I+EY+DETWK  PLLP DPY+RA ARFWA FAE K+LD AW  + S G +Q++AV
Sbjct  61   AESFVIVEYVDETWKQYPLLPRDPYQRALARFWANFAEQKLLDAAWIGMYSSGDEQQNAV  120

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A EA+EK+E E+ GK++FGGE IGYLD+ +GW+++ LPI+EEV S++I D  KFP
Sbjct  121  KVAREAIEKIEEEIKGKKYFGGENIGYLDIALGWISYWLPIWEEVGSIQIIDPLKFP  177



>ref|XP_007226113.1| hypothetical protein PRUPE_ppa011087mg [Prunus persica]
 gb|EMJ27312.1| hypothetical protein PRUPE_ppa011087mg [Prunus persica]
Length=224

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            A + +K++G+  SPF  RV+WAL++KG++YEY+EEDI NK+PLL QLNPV  KVPVLVH 
Sbjct  2    ATDKVKLLGYVFSPFSRRVEWALKLKGIDYEYVEEDIFNKSPLLLQLNPVRKKVPVLVHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEAL-CSKGKQ  404
             + + ES  ILEYIDETWK NPLLP DPY RA +RFWA F E K+LD  + AL CS G+Q
Sbjct  62   NEVVSESFTILEYIDETWKQNPLLPQDPYARAISRFWANFTEEKVLDAGFTALICSTGEQ  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
            QE A+ S +EA+E +E +L GK+  GGE IGYLD+ +GW+++ LPI+EEV S ++ D  K
Sbjct  122  QEKALKSTIEALEHIEGDLMGKKILGGESIGYLDIAMGWISYWLPIWEEVGSRQVLDPSK  181

Query  585  FP  590
            FP
Sbjct  182  FP  183



>gb|AFF18816.1| glutathione transferase, partial [Dimocarpus longan]
Length=224

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 135/179 (75%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W S F LR+ WAL++KG+EY+ I ED+ NK+PLL Q NP++ KVPVL+HNGK
Sbjct  3    EKVKLFNTWSSRFGLRIVWALKLKGVEYDSINEDLSNKSPLLLQYNPIYKKVPVLLHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P  ESL+ILEYIDETWKHNPLLP DPYE+A ARFWA F + K++   W A  ++GK+QE 
Sbjct  63   PTSESLVILEYIDETWKHNPLLPEDPYEKATARFWAKFGDDKVMSSIWSAFTNEGKEQED  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+  A+E +  LE +L GK+FFGGEKIG  DL +GW+A+ + +FEE+  +KI D ++FP
Sbjct  123  AIGQAIENLNFLEEQLKGKKFFGGEKIGLTDLALGWLANLVRVFEEIIGVKIIDHERFP  181



>ref|NP_001234957.1| glutathione S-transferase GST 17 [Glycine max]
 gb|AAG34807.1|AF243372_1 glutathione S-transferase GST 17 [Glycine max]
 gb|AJE59656.1| tau class glutathione S-transferase [Glycine max]
Length=229

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 138/183 (75%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M     +K++ FWVSPF  RV+WAL++KG+EYEYIEEDI NK+ LL QLNPVH KVPVLV
Sbjct  1    MMGSGDVKLLSFWVSPFGKRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +ILEYIDETWK  PLLP  P++RA ARFWA   E K+    W A+ + G+
Sbjct  61   HAHKPIAESFIILEYIDETWKQYPLLPCHPHQRALARFWATSVEQKLGKAGWVAMSTSGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            +QE AV  A+E MEK+E E+ GK+FFGG+ IGYLD+ +GW+A+ +P++EEV S++I D  
Sbjct  121  EQEKAVKEAIEMMEKIEEEIKGKKFFGGDNIGYLDIALGWIAYLVPVWEEVGSMQIIDPL  180

Query  582  KFP  590
            KFP
Sbjct  181  KFP  183



>gb|ACU20120.1| unknown [Glycine max]
Length=229

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 138/183 (75%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M     +K++ FWVSPF  RV+WAL++KG+EYEYIEEDI NK+ LL QLNPVH KVPVLV
Sbjct  1    MMGSGDVKLLSFWVSPFGKRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +ILEYIDETWK  PLLP  P++RA ARFWA   E K+    W A+ + G+
Sbjct  61   HAHKPIAESFIILEYIDETWKQYPLLPCHPHQRALARFWATSVEQKLGKAGWVAMSTSGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            +QE AV  A+E MEK+E E+ GK+FFGG+ IGYLD+ +GW+A+ +P++EEV S++I D  
Sbjct  121  EQEKAVKEAIEMMEKIEEEIKGKKFFGGDNIGYLDIALGWIAYLVPVWEEVGSMQIIDPL  180

Query  582  KFP  590
            KFP
Sbjct  181  KFP  183



>gb|AFK41941.1| unknown [Lotus japonicus]
Length=228

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 136/179 (76%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            + +K++  W SPF  RV+WAL++KG+EYEY+EEDI NK+ LL +LNPVH K+PVLVH  K
Sbjct  4    QDVKLLSSWPSPFSERVEWALKLKGVEYEYVEEDIFNKSSLLLELNPVHKKIPVLVHGHK  63

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
             + ES +I+EYIDETWK  PLLP DPYERA ARFWA F E K+L+  + A+C  G +QE 
Sbjct  64   TIAESFIIIEYIDETWKQYPLLPHDPYERALARFWANFTEQKLLETVFVAMCITGDEQEK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+N A EAMEK+E  + GK+FFGGE IGYLD+ VGW+++ + I+EEV S+ I D  KFP
Sbjct  124  ALNEAREAMEKIEEVIEGKRFFGGENIGYLDIAVGWISYWIHIWEEVGSIHIIDPLKFP  182



>gb|AFF18814.1| glutathione transferase, partial [Dimocarpus longan]
Length=216

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 142/178 (80%), Gaps = 2/178 (1%)
 Frame = +3

Query  63   KVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPLP  242
            +++GFW SPFV RVKWAL +KG++YEYIEEDI NK+  L +LNPVH KVPV VH  + + 
Sbjct  1    QLLGFWASPFVFRVKWALELKGIDYEYIEEDIFNKSSRLLELNPVHKKVPVFVHEHRVIS  60

Query  243  ESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAVN  422
            ES +ILEYIDETW+ NPLLP DPY+RA ARFWA FAE K+L+PAW A+ SKG+++E A  
Sbjct  61   ESFVILEYIDETWRQNPLLPQDPYQRAMARFWAKFAEEKLLEPAWMAMWSKGEEKEKAKK  120

Query  423  SameamekleaelNGKQFFGG--EKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              +EA+EK+E +L G Q+FGG  +KIGYLD+ +GW+++ LP++EEV SLKI D +KFP
Sbjct  121  QTIEALEKIEEQLKGTQYFGGDDDKIGYLDVAIGWISYWLPVWEEVGSLKILDPEKFP  178



>ref|XP_010938159.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=225

 Score =   206 bits (525),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 136/181 (75%), Gaps = 0/181 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            A+  +K++G W SPFVLR+KWAL+MKG+EY++IEED+ NK+PLL + NPVH KVPVLVH 
Sbjct  2    AKAEVKLLGTWSSPFVLRIKWALKMKGVEYDFIEEDLQNKSPLLLKYNPVHKKVPVLVHE  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKP+ ESL+ILEY+DETWK NP+LP DPY+RA ARFW+ F E K L   W    S+G+  
Sbjct  62   GKPIAESLVILEYMDETWKENPILPEDPYQRAMARFWSKFGEEKCLPSIWRVFISQGENT  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E A+ SA E ++ LE EL GK+FF GE +G+ D+ +GW+ + + + EE+  LK+ D Q++
Sbjct  122  EEALVSASENLKILEGELKGKKFFNGETLGFADISLGWIVNMVILLEEIMELKMIDDQRY  181

Query  588  P  590
            P
Sbjct  182  P  182



>gb|KHN48020.1| Glutathione transferase GST 23 [Glycine soja]
 gb|AJE59669.1| tau class glutathione S-transferase [Glycine max]
Length=228

 Score =   206 bits (525),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 136/181 (75%), Gaps = 0/181 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
              E +K++ FWVSPF  RV+WAL++KG+EYEYIEEDI NK+ LL +LNPVH KVPVLVH 
Sbjct  2    GSEDVKLLNFWVSPFGKRVEWALKLKGVEYEYIEEDIFNKSNLLLELNPVHKKVPVLVHA  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             KP+ ES +ILEYIDETWK  PLLP +PY+RA ARFWA   E K+    W A+ + G +Q
Sbjct  62   QKPIAESFIILEYIDETWKKYPLLPHNPYQRALARFWATCVEQKLGKAGWVAMSTSGDEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E A+  A E MEK+E E+ GK FFGG+ IGYLD+ +GW+A+ +P++EEV S++I D  KF
Sbjct  122  EEAMKEAKEMMEKIEEEIKGKNFFGGDNIGYLDIAIGWIAYLVPVWEEVGSMQIIDPLKF  181

Query  588  P  590
            P
Sbjct  182  P  182



>ref|XP_006484731.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=225

 Score =   206 bits (523),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W SPF LR  W L++KG+++++I+ED+ NK+PLL Q NPV+ KVPVL+HNGK
Sbjct  3    EEVKLLKTWSSPFGLRAFWILKLKGVQFDFIDEDLSNKSPLLLQSNPVYKKVPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETWK NPLLP DPYERARARFWA F E K+L   W A   +GK+QE 
Sbjct  63   PISESLVILEYVDETWKQNPLLPEDPYERARARFWAKFGEDKVLVSIWNAFIKQGKEQEE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+  A+E ++ LE EL GK+FFGGEKIG  DL +GW+A+ + +FEEV  +K+ + ++FP
Sbjct  123  AIGLAIETLKFLEEELKGKRFFGGEKIGLADLALGWLANLIGVFEEVIGVKLIEKERFP  181



>ref|XP_002532523.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF29857.1| glutathione s-transferase, putative [Ricinus communis]
Length=227

 Score =   206 bits (524),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F  R++WAL++KG++YE ++ED++NK+P+L + NPVH KVPVLVH   P+
Sbjct  6    VKLIGSETSVFCTRIEWALKLKGVDYENLKEDLMNKSPILLKYNPVHKKVPVLVHGENPV  65

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWKHNPLLP DPYERA ARFWA FA+ K L   ++A   +G+Q+E+A+
Sbjct  66   AESLVILEYIDETWKHNPLLPQDPYERAMARFWAKFADEKCLYGMFDACWQEGEQKENAI  125

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             SAME++  LE ++ GK+FF GEKIGYLD+V+GW+ H L + EEV ++K+ DS+KFP
Sbjct  126  ASAMESLAFLEEQIKGKKFFNGEKIGYLDIVIGWIPHWLNVMEEVGAMKLVDSEKFP  182



>gb|KHN06425.1| Putative glutathione S-transferase [Glycine soja]
Length=228

 Score =   206 bits (523),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++ FWVSPF  RV+WAL++KG+EYEYIEEDI NK+ LL QLNPVH KVPVLVH  KP+
Sbjct  6    VKLLSFWVSPFGKRVEWALKLKGIEYEYIEEDIFNKSNLLLQLNPVHKKVPVLVHAHKPI  65

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYIDETWK  PLLP  P++RA ARFWA   E K+    W A+ + G++QE AV
Sbjct  66   AESFIILEYIDETWKQYPLLPCHPHQRALARFWATSVEQKLGKAGWVAMSTSGEEQEKAV  125

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A+E MEK+E E+ GK+FFGG+ IGYLD+ +GW+A+ +P++EEV S++I D  KFP
Sbjct  126  KEAIEMMEKIEEEIKGKKFFGGDNIGYLDIALGWIAYLVPVWEEVGSMQIIDPLKFP  182



>gb|AJE59670.1| tau class glutathione S-transferase [Glycine max]
Length=228

 Score =   206 bits (523),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 141/183 (77%), Gaps = 1/183 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL++KG+EYEYIE+DI  K+ LL +LNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFKKSNLLLELNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA  AE K++D AW A+C+ G 
Sbjct  60   HAQKPIAESFVIVEYVDETWKQCPLLPQDPYQRALARFWAYSAEQKLIDAAWIAMCTSGD  119

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
             Q++AV    E MEK+E E+ GK+FFGG+ IGYLD+ +GW+++ +P++EEV S+ I +  
Sbjct  120  DQQNAVKVGRELMEKIEEEIKGKKFFGGDNIGYLDIALGWISYWIPVWEEVGSMLIIEPL  179

Query  582  KFP  590
            KFP
Sbjct  180  KFP  182



>ref|XP_006437360.1| hypothetical protein CICLE_v10032686mg [Citrus clementina]
 gb|ESR50600.1| hypothetical protein CICLE_v10032686mg [Citrus clementina]
Length=225

 Score =   205 bits (522),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W SPF LR  W L++KG+++++++ED+ NK+PLL Q NPV+ KVPVL+HNGK
Sbjct  3    EEVKLLKTWSSPFGLRAFWILKLKGVQFDFVDEDLSNKSPLLLQSNPVYKKVPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETWK NPLLP DPYERARARFWA F E K+L   W A   +GK+QE 
Sbjct  63   PISESLVILEYVDETWKQNPLLPEDPYERARARFWAKFGEDKVLVSIWNAFIKQGKEQEE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+  A+E ++ LE EL GK+FFGGEKIG  DL +GW+A+ + +FEEV  +K+ + ++FP
Sbjct  123  AIGLAIETLKFLEEELKGKRFFGGEKIGLADLALGWLANLIGVFEEVIGVKLIEKERFP  181



>ref|XP_010278876.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=225

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 131/177 (74%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            LK+ G W SPF  RVK AL++KG++YEY EED+ NK+P L + +PVH K+PVLVH+GKP+
Sbjct  6    LKLFGAWFSPFSFRVKLALKLKGIQYEYAEEDLQNKSPELLKYSPVHKKIPVLVHDGKPI  65

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK NPLLP DPYERA  RFW  FAE K ++    AL S+G +QE  V
Sbjct  66   VESLIILEYIDETWKQNPLLPEDPYERAMVRFWVTFAEEKFIEALRRALFSEGTKQEKEV  125

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
                EA+E LE EL GK+FFGGE IG+LD+ + WV   L + EEVAS K+FDS KFP
Sbjct  126  KQIAEALEILERELKGKKFFGGETIGFLDIALSWVPAWLGVMEEVASFKVFDSNKFP  182



>ref|XP_008232144.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=223

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 131/177 (74%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H KVPVLVHNGKP+
Sbjct  4    VKLFRTWSSPFALRIVWALKLKGVSYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK NPLLP DP ERA ARFWA F + K+L   WE+  ++GK QE A+
Sbjct  64   AESLVILEYIDETWKENPLLPEDPLERAAARFWAKFGDEKVLPSIWESFTNEGKGQEEAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A E +  LE EL GK+FFGGEK+G  D+ +GW+AH   +FE+VA +K+   ++FP
Sbjct  124  VKAKENLNYLEEELKGKKFFGGEKLGLADIALGWLAHYESVFEDVAGMKLLTEEEFP  180



>ref|XP_006489726.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=234

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+GFW SPFV RV WAL++KG+E+EYIEEDI NK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKVLGFWCSPFVFRVVWALKLKGVEFEYIEEDIFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYIDETW  +PLLP DPYERA ARFWA FA+ K++  AW++  +KG+++E A+
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYERAMARFWAKFADEKLMQTAWKSTWTKGEEKEDAL  124

Query  420  NSameamekleaelNGKQFFGGE-KIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             +  E +EK+E EL GK +FGGE K  YL++ +GW+ + +PI+EE+AS++  D ++FP
Sbjct  125  KATKEVLEKIEGELKGKSYFGGENKYAYLEVAIGWINYLIPIWEEIASIQFLDPKRFP  182



>gb|KHN48021.1| Putative glutathione S-transferase [Glycine soja]
Length=285

 Score =   206 bits (525),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 141/183 (77%), Gaps = 1/183 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ F+ SPF  RV+WAL++KG+EYEYIE+DI  K+ LL +LNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFFASPFGKRVEWALKLKGVEYEYIEQDIFKKSNLLLELNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES +I+EY+DETWK  PLLP DPY+RA ARFWA  AE K++D AW A+C+ G 
Sbjct  60   HAQKPIAESFVIVEYVDETWKQCPLLPQDPYQRALARFWAYSAEQKLIDAAWIAMCTSGD  119

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
             Q++AV    E MEK+E E+ GK+FFGG+ IGYLD+ +GW+++ +P++EEV S+ I +  
Sbjct  120  DQQNAVKVGRELMEKIEEEIKGKKFFGGDNIGYLDIALGWISYWIPVWEEVGSMLIIEPL  179

Query  582  KFP  590
            KFP
Sbjct  180  KFP  182



>gb|KDO46806.1| hypothetical protein CISIN_1g027333mg [Citrus sinensis]
Length=225

 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W SPF LR  W L++KG+++++I+ED+ NK+PLL Q NPV+ KVPVL+HNGK
Sbjct  3    EEVKLLKTWSSPFGLRAFWILKLKGVQFDFIDEDLSNKSPLLLQSNPVYKKVPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETWK NPLLP DPYERARARFWA F + K+L   W A   +GK+QE 
Sbjct  63   PISESLVILEYVDETWKQNPLLPEDPYERARARFWAKFGDDKVLASIWNAFIKQGKEQEE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+  A+E ++ LE EL GK+FFGGEKIG  DL +GW+A+ + +FEEV  +K+ + ++FP
Sbjct  123  AIGLAIETLKFLEEELKGKRFFGGEKIGLPDLALGWLANLIGVFEEVIGVKLIEKERFP  181



>ref|XP_010067033.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW65099.1| hypothetical protein EUGRSUZ_G02604 [Eucalyptus grandis]
Length=224

 Score =   204 bits (518),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+     SPF LRV WALR+KG++YE + ED+  K+ LL Q NPV+ KVPVL+HNG+
Sbjct  3    EEVKLFKTLSSPFALRVDWALRLKGIQYESVLEDLSEKSDLLLQYNPVYKKVPVLLHNGR  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
             + ESL+ILEYI+ETWK +PLLP DPY RARARFWA F + K+L   W A  S+GK+QE+
Sbjct  63   SISESLIILEYIEETWKQDPLLPQDPYARARARFWAKFGDDKVLPSLWTAFISEGKEQEA  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+  A E ++KLE ELNGK+FFGG+ IGYLD+ +GW+A+ + +FEE++SLK+ D ++FP
Sbjct  123  ALAEASENLQKLEGELNGKKFFGGDNIGYLDIALGWLANLITVFEEISSLKLVDGERFP  181



>emb|CAN72240.1| hypothetical protein VITISV_010777 [Vitis vinifera]
Length=225

 Score =   203 bits (517),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+   W S F LR+ WAL++KG+EYE I ED+ NK+P L Q NPVH KVPVLVHNGK
Sbjct  3    EELKLFRTWSSVFALRIVWALKIKGVEYETIFEDLSNKSPSLLQYNPVHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
            P+ ESL+ILEYIDETW+  PLLP DPYERA ARFWA F + K+L    W     +GK+QE
Sbjct  63   PIAESLVILEYIDETWRETPLLPEDPYERAMARFWAKFGDDKVLTSIVWGVFFKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A+  AME ++ LE EL GK+FFGGE+IG++DL +GW+A+ + IFEEVA LK+ D  KFP
Sbjct  123  EAMLEAMEHLQFLEDELKGKRFFGGERIGFVDLALGWLANMISIFEEVAGLKMVDEDKFP  182



>ref|XP_006437359.1| hypothetical protein CICLE_v10032702mg [Citrus clementina]
 gb|ESR50599.1| hypothetical protein CICLE_v10032702mg [Citrus clementina]
Length=221

 Score =   203 bits (517),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 134/179 (75%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W SPF LRV WAL++KG++++ IEED+ NK+PLL Q NPVH K+PVLVHNGK
Sbjct  3    EEVKLLTTWSSPFALRVVWALKLKGVQFDSIEEDLSNKSPLLLQYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETW+ NPLLP  PY+RARARFWA F++ K+    W     +GK++E 
Sbjct  63   PISESLVILEYVDETWRQNPLLPDGPYDRARARFWAKFSDDKVSPSIWGVFIKQGKEREE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A +   E ++ LE EL GK+FFGGEKIG+ DL +GW+A  + + EE+  +KI + +KFP
Sbjct  123  AFDQVFENLKFLEEELKGKKFFGGEKIGFADLALGWIAERVCVLEEIIGVKIVEEEKFP  181



>ref|XP_002264117.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   203 bits (517),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+   W S F LR+ WAL++KG+EYE I ED+ NK+P L Q NPVH KVPVLVHNGK
Sbjct  3    EELKLFRTWSSVFALRIVWALKIKGVEYETIFEDLSNKSPSLLQYNPVHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
            P+ ESL+ILEYIDETW+  PLLP DPYERA ARFWA F + K+L    W     +GK+QE
Sbjct  63   PIAESLVILEYIDETWRETPLLPEDPYERAMARFWAKFGDDKVLTSIVWGVFFKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A+  AME ++ LE EL GK+FFGGE+IG++DL +GW+A+ + IFEEVA LK+ D  KFP
Sbjct  123  EAMLEAMEHLQFLEDELKGKRFFGGERIGFVDLALGWLANMISIFEEVAGLKMVDEDKFP  182



>ref|XP_008793319.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=226

 Score =   203 bits (517),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 137/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AE  +K++G W SPFVLR+KWAL++KG+EY++IEED+ NK+PLL + NPVH KVPVLVH+
Sbjct  2    AEAEVKLLGTWSSPFVLRIKWALKLKGVEYDFIEEDLQNKSPLLLKYNPVHKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GK + ES +ILEYIDETWK NP+LP DPY+RA ARFW+ F + K L   W+   S+G+++
Sbjct  62   GKSIAESYVILEYIDETWKENPILPEDPYQRAMARFWSKFGDEKFLPSMWKFFISQGEKR  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E A+ SA E ++ LE EL GK+FF GE +G+ D+ +GW+   + + EE+  LK+ D Q++
Sbjct  122  EEALVSASENLKILEGELKGKKFFNGETLGFADISLGWIVDMVSLLEEIMELKMIDEQRY  181

Query  588  P  590
            P
Sbjct  182  P  182



>ref|XP_006489728.1| PREDICTED: glutathione S-transferase U8-like [Citrus sinensis]
Length=227

 Score =   203 bits (517),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SPF  RV WAL++KG+E+EYIEEDI NK+  L +LNPVH KVPVLVH+ + +
Sbjct  5    VKLLGFWCSPFAFRVVWALKLKGVEFEYIEEDIFNKSTELLELNPVHKKVPVLVHDKRVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYIDETW  +PLLP DPYE+A ARFWA F + K+L+ A++A+ SKG++++ A+
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYEKAMARFWAKFGDEKLLESAYKAMWSKGEEKQKAM  124

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEV-ASLKIFDSQKFP  590
              A+E++EK+E  L GK F GG  IGYLDL +GW+ + +P++EE   S++I DSQKFP
Sbjct  125  KEAVESLEKIEEVLGGKNFMGGNSIGYLDLAIGWIGYWIPVWEEAGGSMRILDSQKFP  182



>emb|CAN78656.1| hypothetical protein VITISV_006850 [Vitis vinifera]
Length=228

 Score =   203 bits (517),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 132/179 (74%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SPF LR  WAL++KG++YE I ED+ NK+PLL Q NPV  KVPVLVHNGK
Sbjct  3    EEVKLFRTWSSPFALRAVWALKIKGIDYETIFEDLSNKSPLLLQYNPVFKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWKH PLLP DP+ERA ARFWA F E K+L   W     +GK+QE 
Sbjct  63   PIAESLVILEYIDETWKHAPLLPEDPHERATARFWAKFGEDKVLTSIWSVFIKQGKEQEE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+  A+E ++ LE EL GK+FFGGE IG++DL +GW+ + + I EE+  LK+ D +KFP
Sbjct  123  AMVPALENLKFLEEELKGKKFFGGETIGFVDLALGWLGNLISILEEIVGLKVVDGEKFP  181



>ref|XP_006433894.1| hypothetical protein CICLE_v10002406mg [Citrus clementina]
 gb|ESR47134.1| hypothetical protein CICLE_v10002406mg [Citrus clementina]
Length=222

 Score =   203 bits (516),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 134/181 (74%), Gaps = 1/181 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AEE +K++G+W SPF LRVKWAL++KG+ YEY+EE++ NK+PLL + NPV+ K+PVLVHN
Sbjct  2    AEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKPL ESLLI+EYIDE WK NPLLP DPYERA ARFWA F + K +     A  SKG++Q
Sbjct  62   GKPLAESLLIIEYIDEAWKQNPLLPEDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E A  +  E ++ LE  L GK FFGG+KIG+LD+ VGW+     I EE+A + + D++  
Sbjct  122  EKAAKA-RENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETM  180

Query  588  P  590
            P
Sbjct  181  P  181



>gb|KDP39591.1| hypothetical protein JCGZ_02611 [Jatropha curcas]
Length=217

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 133/183 (73%), Gaps = 2/183 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MA E  +K++  W SPF LR+ WAL++KG++Y+ I+ED+ NK+PLL Q NPVH K+PV V
Sbjct  1    MAGE--VKLLKSWSSPFALRIVWALKLKGIQYDSIDEDMTNKSPLLLQYNPVHKKIPVFV  58

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ES +ILEYIDE WKH PLLP DP++RA ARF A F + K++   W    +KGK
Sbjct  59   HNGKPIAESFVILEYIDEMWKHYPLLPQDPHKRATARFLAKFGDEKVMKSLWAISITKGK  118

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            +QE A   A E ++ LE  L GK+FFGGEKIG+LD+ +GW+A+ +P+ EE+   K+ D Q
Sbjct  119  EQEEASAKATENLKYLEEALTGKRFFGGEKIGFLDIALGWLANVVPVVEEIVGFKVIDKQ  178

Query  582  KFP  590
             FP
Sbjct  179  GFP  181



>gb|KDO81087.1| hypothetical protein CISIN_1g027498mg [Citrus sinensis]
Length=222

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 134/181 (74%), Gaps = 1/181 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AEE +K++G+W SPF LRVKWAL++KG+ YEY+EE++ NK+PLL + NPV+ K+PVLVHN
Sbjct  2    AEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKPL ESLLI+EYIDE WK NPLLP DPYERA ARFWA F + K +     A  SKG++Q
Sbjct  62   GKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARFWAKFFDEKCVPEVMGAFASKGEEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E A  +  E ++ LE  L GK FFGG+KIG+LD+ VGW+     I EE+A + + D++  
Sbjct  122  EKAAKA-RENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETM  180

Query  588  P  590
            P
Sbjct  181  P  181



>ref|XP_010922854.1| PREDICTED: probable glutathione S-transferase [Elaeis guineensis]
Length=224

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 133/177 (75%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+ G W SPFVL VKWALR+KG+EYEYIEED+ NK+ LL + NPVH KVPV+VHNGKP+
Sbjct  6    VKLFGIWSSPFVLIVKWALRIKGVEYEYIEEDLSNKSNLLLEYNPVHKKVPVMVHNGKPI  65

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYI+ETWK+NP+LP DPYERA ARFW  F   K+  P W    S+GK+QE A 
Sbjct  66   AESAVILEYIEETWKNNPILPDDPYERAMARFWCKFVVDKLSPPIWRLFISQGKEQEEAY  125

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A+E ++ LE EL GK FF GE IG  D+ +G +A+ +PI+EE+  LK+ D+++FP
Sbjct  126  ALAIENLKILEQELQGKMFFCGETIGLADISIGPLAYVMPIYEEITKLKMVDAERFP  182



>ref|XP_002523996.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF38364.1| glutathione s-transferase, putative [Ricinus communis]
Length=219

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W S F LR+ WAL++K + Y+ I+ED+ NK+PLL Q NPVH K+PVLVHNGK
Sbjct  3    EEVKLLKTWSSIFGLRIVWALKLKAINYDSIDEDLTNKSPLLLQYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETW+ NPLLP DP++RA ARFWA F + K++   W  L  +GK+QE 
Sbjct  63   PIVESLVILEYIDETWQQNPLLPQDPHDRAEARFWAKFGDDKVIPSMWAILTKEGKEQEE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A     E ++ LE EL GK+FFGGE+IGYLD+ +GW+A+++P+ EE+ SLK+ D + FP
Sbjct  123  ASAQTNENLKFLEEELKGKKFFGGEQIGYLDIALGWLANSVPVLEEI-SLKVIDKEAFP  180



>gb|KDP42500.1| hypothetical protein JCGZ_00297 [Jatropha curcas]
Length=221

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LKV   W S F LR  WAL++KG+EYE + ED+ NK+PLL Q NPV+ KVPVL+HNGK
Sbjct  3    EDLKVFRTWSSSFALRAVWALKLKGIEYETVYEDLSNKSPLLLQYNPVYKKVPVLLHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
            PL ESL+ILEYIDETWK NPLLP DP ERARARFWA F + K+     +     +GK+QE
Sbjct  63   PLCESLVILEYIDETWKQNPLLPEDPLERARARFWAKFGDDKVFQSIVYGIFLKQGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A+  A+E ++ LE EL GK+FFGGEKIG LDL +GW+AH+  +FEE+   K+ D QKFP
Sbjct  123  EAIPLAIENLKHLEKELRGKKFFGGEKIGLLDLALGWLAHHNGVFEEILGFKLIDQQKFP  182



>ref|XP_002532525.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF29859.1| glutathione s-transferase, putative [Ricinus communis]
Length=224

 Score =   202 bits (513),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+G + S F  RV+WAL++KG+EYEY++ED+ NK+P+L ++NPVH KVPVLVH  KP+
Sbjct  4    VKVIGSYTSLFCTRVEWALKIKGVEYEYLKEDLRNKSPILLKVNPVHKKVPVLVHEEKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETW  NPL P DPYERA ARFWA FA+ K L  A+ A   +G+++E A+
Sbjct  64   AESLVILEYIDETWNKNPLFPQDPYERAMARFWAKFADDKCLYGAFHACWKEGEEKEKAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             SAME+   LE ++ GK+FF GE+IGYLDL +GW+ + L + EEV  +K+ D++KFP
Sbjct  124  ESAMESFAMLEEQIKGKKFFNGEQIGYLDLALGWIPYWLNVMEEVGGMKLVDAEKFP  180



>ref|XP_008453455.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=224

 Score =   201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 135/177 (76%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F +RV+WAL++KG+EYEYI ED+ NK+ LL + NPV+ K+PVL+HN K +
Sbjct  4    VKIIGSAASLFSVRVEWALKLKGIEYEYIVEDLRNKSELLLKSNPVYKKIPVLLHNDKAI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESLLI+EYIDETWK NP+LP DPY+RA ARFWA F + K L  AWEA  ++G+++E AV
Sbjct  64   SESLLIIEYIDETWKENPILPEDPYDRANARFWAKFLDEKGLLGAWEACQAEGEEKEKAV  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             +A++ +  L+ E+ GK+FFGGEKIGYLDL  GW+ H L + +EV  + +FD ++FP
Sbjct  124  EAAVQHLALLDKEIQGKKFFGGEKIGYLDLAAGWICHWLSVLDEVGEMNVFDRERFP  180



>gb|KDO57583.1| hypothetical protein CISIN_1g046710mg [Citrus sinensis]
Length=227

 Score =   201 bits (512),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SPF  RV WAL++KG+E+EYIEEDI NK+  L +LNPVH KVPVLVH+ + +
Sbjct  5    VKLLGFWCSPFAFRVVWALKLKGVEFEYIEEDIFNKSTELLELNPVHKKVPVLVHDKRVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES + LEYIDETW  +PLLP DPYE+A ARFWA F + K+L+ A++A+ SKG++++ A+
Sbjct  65   VESFVFLEYIDETWPQDPLLPQDPYEKAMARFWAKFGDEKLLESAYKAMWSKGEEKQKAM  124

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEV-ASLKIFDSQKFP  590
              A+E++EK+E  L GK F GG  IGYLDL +GW+ + +P++EE   S++I DSQKFP
Sbjct  125  KEAVESLEKIEEVLGGKNFMGGNSIGYLDLAIGWIGYWIPVWEEAGGSMRILDSQKFP  182



>gb|AJE59654.1| tau class glutathione S-transferase [Glycine max]
Length=217

 Score =   201 bits (510),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 135/183 (74%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M +E+ +K+V FW SPF  RV+WAL++KG++YEYIEED+ N + L+ +LNPVH KVP+LV
Sbjct  1    MGSEDRVKLVNFWASPFGKRVEWALKLKGVKYEYIEEDVYNMSSLVMELNPVHKKVPILV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES  ILEYIDETWK  PLLP DPY+RA ARFWA F E K++  A +A+ +   
Sbjct  61   HAQKPIAESFTILEYIDETWKQYPLLPQDPYQRALARFWANFGEQKLMRAARKAMTTSRD  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            ++  A+    E ME++E E+ GK++FGG+ IG+LD+ +GW+++ LP+ EEV S+ I D  
Sbjct  121  ERAKALKETRELMERIEEEIKGKKYFGGDNIGFLDIALGWISYWLPVVEEVGSMHIIDPL  180

Query  582  KFP  590
            KFP
Sbjct  181  KFP  183



>ref|XP_008781341.1| PREDICTED: glutathione transferase GST 23-like [Phoenix dactylifera]
Length=231

 Score =   201 bits (511),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 138/184 (75%), Gaps = 1/184 (1%)
 Frame = +3

Query  42   MAAEEG-LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVL  218
            MA+  G +K+ G W SP V RV+WAL+MKG+EYEYIEED+ NK+  L   NP++ +VPVL
Sbjct  1    MASGGGEVKLFGMWASPAVRRVEWALKMKGIEYEYIEEDLSNKSASLLAYNPINKQVPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            +HNGKP+ ESL+I+EYIDE WKHNP+LP DPYER +ARFW+ ++E K  D   +   ++G
Sbjct  61   LHNGKPIAESLVIIEYIDEVWKHNPILPEDPYERTKARFWSTYSEGKCRDAVGKGYFTEG  120

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDS  578
            +++E+A+    E +  L+ EL GK+FFGGE +G+ DLV+GW+A  LP+ EEVA  ++ DS
Sbjct  121  EEKENAIKYLEETVRVLDEELKGKKFFGGENLGFSDLVLGWMAFWLPVAEEVAFFEVLDS  180

Query  579  QKFP  590
            +KFP
Sbjct  181  KKFP  184



>ref|XP_006472526.1| PREDICTED: glutathione transferase GST 23-like [Citrus sinensis]
Length=222

 Score =   201 bits (510),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 133/181 (73%), Gaps = 1/181 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AEE +K++G+W SPF LRVKWAL++KG+ YEY+EE++ NK+PLL + NPV+ K+PVLVHN
Sbjct  2    AEESVKLLGYWASPFALRVKWALKLKGVHYEYVEENLPNKSPLLLRYNPVYKKIPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKPL ESLLI+EYIDE WK NPLLP DPYERA AR WA F + K +     A  SKG++Q
Sbjct  62   GKPLAESLLIIEYIDEAWKQNPLLPDDPYERANARLWAKFFDEKCVPEVMGAFASKGEEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E A  +  E ++ LE  L GK FFGG+KIG+LD+ VGW+     I EE+A + + D++  
Sbjct  122  EKAAKA-RENLKMLERALEGKPFFGGDKIGFLDIAVGWIGIWGRIVEEIAGVSLIDAETM  180

Query  588  P  590
            P
Sbjct  181  P  181



>ref|XP_006489727.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=234

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+G W SPFV RV WAL++KG+E+EYIEEDI NK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKVLGVWCSPFVFRVVWALKLKGVEFEYIEEDIFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYIDETW  +PLLP DPYERA ARFWA FA+ K++   W++  +KG+++E A+
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYERAMARFWAKFADEKLMQTVWKSTWTKGEEKEDAL  124

Query  420  NSameamekleaelNGKQFFGGE-KIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             + MEA+EK+E EL GK +FGGE K  YL++ +GW+ + +PI+EE+AS++  D ++FP
Sbjct  125  KATMEALEKIEGELKGKSYFGGENKYAYLEVAIGWINYLIPIWEEIASIQFLDPKRFP  182



>ref|XP_004299557.1| PREDICTED: probable glutathione S-transferase [Fragaria vesca 
subsp. vesca]
Length=224

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 138/178 (78%), Gaps = 0/178 (0%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKP  236
            G+K+V    S F  RV+WAL++KG+EYE+IEED+ NK+P+L + NPVH KVPVLVH+  P
Sbjct  3    GVKLVATTQSFFCTRVQWALKLKGVEYEFIEEDLRNKSPVLLKYNPVHKKVPVLVHHDTP  62

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            + ESL+ILEYIDETWK NPLLP DP++RA ARFWA FA+ K++   W A  ++G+ +E A
Sbjct  63   IVESLVILEYIDETWKENPLLPQDPFDRAAARFWAKFADEKVVFGVWTACTAEGEGKEKA  122

Query  417  VNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            + +A+E++  LE ++ GK+FFGGE+IGYLDLV+GW+ H L   EEV  +K+ ++++FP
Sbjct  123  IEAALESLAHLEKQIEGKKFFGGEQIGYLDLVLGWIPHWLNTVEEVGGMKLLEAERFP  180



>ref|XP_006484732.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=221

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 133/179 (74%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W SPF LRV WAL++KG++++ IEED+ NK+PLL Q NPVH K+PVLVHNGK
Sbjct  3    EEVKLLMTWSSPFALRVVWALKLKGVQFDSIEEDLSNKSPLLLQYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETW+  PLLP  PY+RARARFWA F++ K+    W     +GK++E 
Sbjct  63   PISESLVILEYVDETWRQYPLLPDGPYDRARARFWAKFSDDKVSPSMWGVFIKQGKEREE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A +   E ++ LE EL GK+FFGGEKIG+ DL +GW+A  + + EE+  +KI + +KFP
Sbjct  123  AFDQVFENLKFLEEELKGKKFFGGEKIGFADLALGWIAERVCVLEEIIGVKIVEEEKFP  181



>ref|XP_007218360.1| hypothetical protein PRUPE_ppa011115mg [Prunus persica]
 gb|EMJ19559.1| hypothetical protein PRUPE_ppa011115mg [Prunus persica]
Length=223

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 131/177 (74%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H KVPVLVHNGKP+
Sbjct  4    VKLFRTWSSPFALRIVWALKLKGVPYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK NPLLP DP ERA ARFWA F + K +   WE+  ++GK+QE A+
Sbjct  64   AESLVILEYIDETWKENPLLPEDPLERAAARFWAKFGDEKAVPSIWESFTNEGKEQEEAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A E ++ LE EL GK+FFGGEK+G  D+ +G +AH   +FEEVA +K+   ++FP
Sbjct  124  VKAKENLKYLEEELKGKKFFGGEKLGLADIALGLLAHYESVFEEVAGMKLLTEEEFP  180



>ref|XP_006420237.1| hypothetical protein CICLE_v10005779mg [Citrus clementina]
 gb|ESR33477.1| hypothetical protein CICLE_v10005779mg [Citrus clementina]
Length=234

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+GFW SPFV RV WAL++KG+E+EYIEED+ NK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKVLGFWCSPFVFRVVWALKLKGVEFEYIEEDVFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYIDETW  +PLLP DPYE+A ARFWA FA+ K++  A ++  +KG+++E A+
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYEKATARFWAKFADEKLMQTACKSTWTKGEEKEDAL  124

Query  420  NSameamekleaelNGKQFFGGE-KIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             + MEA+EK+E EL GK +FGGE K  YL++ +GW+ + LPI+EE+AS++  D ++FP
Sbjct  125  KATMEALEKIEGELKGKSYFGGENKYAYLEIAIGWINYLLPIWEEIASIQFLDPKRFP  182



>gb|KDP42499.1| hypothetical protein JCGZ_00296 [Jatropha curcas]
Length=224

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LKV   W SPF LRV WAL++KG+EYE + ED+ NK+PLL Q NPV+ KVPVL+HNGK
Sbjct  3    EELKVFRTWSSPFALRVVWALKLKGIEYETVYEDLSNKSPLLLQYNPVYKKVPVLLHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK-GKQQE  410
            PL ESL+ILEYIDETWK NPLLP DP ERARARFWA F + K+    +  +  K GK+QE
Sbjct  63   PLCESLVILEYIDETWKQNPLLPEDPLERARARFWAKFCDDKVAQTIFNGVFLKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A+  A+E ++ LE EL GK+FFGG+KIG +DL +GW+AH   +FEE+   K+ D + FP
Sbjct  123  EAIPLAIENLKHLEKELRGKKFFGGDKIGLVDLALGWLAHYNGVFEEILGFKLIDQENFP  182



>ref|XP_006420235.1| hypothetical protein CICLE_v10006671mg [Citrus clementina]
 gb|ESR33475.1| hypothetical protein CICLE_v10006671mg [Citrus clementina]
Length=231

 Score =   199 bits (505),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 139/182 (76%), Gaps = 5/182 (3%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SPF  RV WAL++KG+E+EYIEEDI NK+  L +LNPVH KVPVLVH+ + +
Sbjct  5    VKLLGFWCSPFAFRVVWALKLKGVEFEYIEEDIFNKSTELLELNPVHKKVPVLVHDKRVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAE----FKILDPAWEALCSKGKQQ  407
             ES +ILEYIDETW  +PLLP DPYE+A ARFWA F +     K+L+ A++A+ SKG+++
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYEKAMARFWAKFGDEKVTVKLLESAYKAMWSKGEEK  124

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEV-ASLKIFDSQK  584
            + A+  A+E++EK+E  L GK F GG  IGYLDL +GW+ + +P++EE   S++I DSQK
Sbjct  125  QKAMKEAVESLEKIEEVLRGKNFMGGNSIGYLDLAIGWIGYWIPVWEEAGGSMRILDSQK  184

Query  585  FP  590
            FP
Sbjct  185  FP  186



>ref|XP_007220010.1| hypothetical protein PRUPE_ppb024827mg [Prunus persica]
 gb|EMJ21209.1| hypothetical protein PRUPE_ppb024827mg [Prunus persica]
Length=224

 Score =   198 bits (503),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 132/178 (74%), Gaps = 1/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H KVPVLVHNGKP+
Sbjct  4    VKLFRTWSSPFALRIVWALKLKGVPYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES ++LEYIDETWK NPLLP DP ERA ARFWA F + K+L   WE+  S GK+QE A+
Sbjct  64   VESFVVLEYIDETWKENPLLPEDPLERAAARFWAKFGDDKVLPSIWESFTSDGKEQEEAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVA-HNLPIFEEVASLKIFDSQKFP  590
              A E ++ LE EL GK+FFGGEK+G++D+ +GW+A +   +FE+V  +K+   ++FP
Sbjct  124  VKAKENLKYLEEELKGKKFFGGEKLGFVDIALGWLAQYESSVFEDVTGMKLLTEEEFP  181



>ref|XP_002527848.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF34551.1| glutathione s-transferase, putative [Ricinus communis]
Length=225

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SPF LRV WAL++KG+EYE I ED+ +K+PLL Q NPVH KVPVLVHNGK
Sbjct  3    EEVKIFRTWSSPFALRVIWALKLKGIEYETIYEDLSSKSPLLVQYNPVHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPA-WEALCSKGKQQE  410
             + ESL+ILEY+DETWK  PLLP DP+ERARARFWA F + K+L    +     +GK+ E
Sbjct  63   AISESLVILEYMDETWKQYPLLPQDPHERARARFWAKFGDDKVLQSIFYGTFLKQGKELE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              + SA E ++ LE EL GK+FFGG+ IG +DL +GW+AH   +FEE+  LKI D +KFP
Sbjct  123  EGLASATENLQCLEEELKGKKFFGGDNIGVVDLALGWLAHYNSVFEEIIGLKIIDQEKFP  182



>ref|XP_007036677.1| Tau class glutathione transferase GSTU26 [Theobroma cacao]
 gb|EOY21178.1| Tau class glutathione transferase GSTU26 [Theobroma cacao]
Length=224

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            LK++   +S F  R++WAL++KG+ YEY+EED+ NK+PLL   NPVH KVPVL+ NGKP+
Sbjct  4    LKLIASSLSVFCARIEWALKLKGVGYEYLEEDLRNKSPLLLTHNPVHKKVPVLLQNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYI+ETWK +PLLP DPYE+A ARFWA FA+ K L  A++A  + G ++E A+
Sbjct  64   AESLIILEYIEETWKDSPLLPEDPYEKAMARFWAKFADEKCLHGAFDACRAVGDEKEKAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             SA ++   LE +L GK++FGGE+IGYLDL +GW+ H L + EEV  +K+ D+Q+ P
Sbjct  124  ESAAKSFAFLEKQLEGKKYFGGEQIGYLDLALGWIPHWLNVMEEVGCMKLVDTQRTP  180



>gb|KHN06423.1| Putative glutathione S-transferase [Glycine soja]
Length=217

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 134/183 (73%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M +E+ +K+V FW SPF  RV+WAL++KG++YEYIEED+ N + L+ +LNPVH KVP+LV
Sbjct  1    MGSEDRVKLVNFWASPFGKRVEWALKLKGVKYEYIEEDVYNMSSLVMELNPVHKKVPILV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES  ILEYIDETWK  PLLP DP +RA ARFWA F E K++  A +A+ +   
Sbjct  61   HAQKPIAESFTILEYIDETWKQYPLLPQDPNQRALARFWANFGEQKLMRAARKAMTTSRD  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            ++  A+    E ME++E E+ GK++FGG+ IG+LD+ +GW+++ LP+ EEV S+ I D  
Sbjct  121  ERAKALKETRELMERIEEEIKGKKYFGGDNIGFLDIALGWISYWLPVVEEVGSMHIIDPL  180

Query  582  KFP  590
            KFP
Sbjct  181  KFP  183



>ref|XP_004299558.1| PREDICTED: probable glutathione S-transferase [Fragaria vesca 
subsp. vesca]
Length=224

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S    R++WAL++KG+EYE+IEED+ NK+ LL + NPVH KVPVLVH+ KP+
Sbjct  4    VKLLGTTQSFPCARIQWALKLKGVEYEFIEEDLGNKSSLLRKYNPVHKKVPVLVHHDKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK NPLLP DPY++A ARFWA FA+ K+L   W A  ++G+++E A+
Sbjct  64   AESLVILEYIDETWKDNPLLPQDPYDKAVARFWAKFADEKVLIAVWGAFTAEGEEKEKAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             SA+E +  LE ++ GK+FFGGEKIGY DLVVGW++  L + EEV  +K+ ++++FP
Sbjct  124  KSALEPLAYLEQQIEGKKFFGGEKIGYFDLVVGWLSQWLNVMEEVGGMKLLEAERFP  180



>ref|XP_002264054.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
Length=228

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 130/179 (73%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SPF LR  WAL++KG++YE I ED+ NK+P L Q NPV+ KVPVLVH GK
Sbjct  3    EEVKLFRTWSSPFALRAVWALKIKGIDYETIFEDLSNKSPSLLQYNPVYKKVPVLVHKGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK  PLLP DP+ERA ARFWA F E K+L   W     +GK+QE 
Sbjct  63   PIAESLVILEYIDETWKQAPLLPEDPHERATARFWAKFGEDKVLTSIWSVFIKQGKEQEE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+  A+E ++ LE EL GK+FFGGE IG++DL +GW+ + + I EE+  LK+ D +KFP
Sbjct  123  AMVPALENLKFLEEELKGKKFFGGETIGFVDLALGWLGNLISILEEIVGLKVVDGEKFP  181



>ref|XP_010921338.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=231

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 136/183 (74%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M +   +K+ G W SP V RV+WAL++KG+EYEYIEED+ NK+  L + NP++ +VPVL+
Sbjct  1    MVSGGEVKLFGMWASPAVRRVEWALKIKGIEYEYIEEDLSNKSTSLLEYNPINKQVPVLL  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H GKP+ ESL+++EYIDE WKHNP+LP DPYER +ARFWA + E +  D   +   ++G+
Sbjct  61   HKGKPIVESLVMIEYIDEVWKHNPILPEDPYERTKARFWATYGEGECRDAVGKVYFTEGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            ++E+A+    + +  L+ EL GK+FFGGE IG+ DLV+GW+A  LP+ EEVAS ++ +S+
Sbjct  121  EKENAIKHLEDTVRVLDEELKGKKFFGGENIGFSDLVLGWMAFWLPVAEEVASFEVLNSK  180

Query  582  KFP  590
            KFP
Sbjct  181  KFP  183



>ref|XP_009343223.1| PREDICTED: probable glutathione S-transferase isoform X2 [Pyrus 
x bretschneideri]
Length=219

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 133/177 (75%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NPVH KVPVL+HNG  +
Sbjct  4    VKLLRTWSSPFPLRIVWALQLKGVPYETIYEDLSNKSPLLLQSNPVHKKVPVLLHNGNAV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP +RA ARFWA + + K+L   WE    +GK+QE A+
Sbjct  64   VESLIILEYVDETWKENPLLPEDPLDRATARFWARYIDDKVLPSIWEFFTKEGKEQEEAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A E ++ LE EL GK+FFGGEK+G++D+ +GW+A+N  +FEEVA +K+   ++FP
Sbjct  124  VKAKENLKYLEEELKGKKFFGGEKVGFVDIALGWLAYNESLFEEVAGMKVVTKEEFP  180



>ref|XP_010067034.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
Length=235

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 138/184 (75%), Gaps = 0/184 (0%)
 Frame = +3

Query  39   IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVL  218
            I+A  E +K+   W SPF LRV WAL++KG++YE + ED+ NK+ LL Q NPV+ KVPVL
Sbjct  9    ILARPEEVKLFKTWSSPFPLRVAWALQLKGIQYESVLEDLSNKSNLLLQYNPVYKKVPVL  68

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            +HNG+P+ ESL+ILEY+DETWK  PLLP DPY RA ARFWA F + K+L   +    S+G
Sbjct  69   LHNGRPISESLIILEYVDETWKQYPLLPQDPYARAMARFWAKFGDDKVLPSIYAVFKSEG  128

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDS  578
            K+QE+ +  A E ++KLE EL GK+FF G+ IGYLD+ +GW+A+ + +FEEV+SL++ D 
Sbjct  129  KEQEAVLAEASEHLQKLEEELRGKKFFRGDNIGYLDIALGWLANLVRVFEEVSSLRVLDV  188

Query  579  QKFP  590
            ++FP
Sbjct  189  ERFP  192



>ref|XP_004160429.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
Length=224

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 133/177 (75%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F +RV+WAL++KG+E+EYI ED+ NK+ LL + NPVH K+PV +HN K +
Sbjct  4    VKIIGSAGSLFCIRVEWALKLKGIEFEYIVEDLRNKSELLLKSNPVHKKIPVFLHNDKAI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESLLI+EYIDETWK NP+LP DPY+RA ARFWA F + K L  AWEA  ++G+++E AV
Sbjct  64   SESLLIIEYIDETWKENPILPEDPYDRANARFWAKFLDEKGLIGAWEACQAEGEEKEKAV  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             +A++ +  L+ E+ GK+FFGGE+IGYLDL  GW+ H L + +EV  + +FD ++ P
Sbjct  124  EAAIQNLALLDKEIQGKKFFGGEQIGYLDLAAGWICHWLNVLDEVGEMNVFDRERVP  180



>emb|CDP09302.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 131/179 (73%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SP+ LR+ WAL++KG+EYE I ED+ NK+P L Q NP H KVPVLV +GK
Sbjct  3    EEVKLFRTWSSPYALRIVWALKLKGIEYETIFEDLTNKSPSLLQYNPTHGKVPVLVRDGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETWKHNPLLP DPYE++ ARFWA F + K++   W+   +  K Q+ 
Sbjct  63   PVCESLVILEYVDETWKHNPLLPQDPYEKSMARFWANFGDDKLMKSIWQLFIAHEKDQDV  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A  +A+E ++ +E +L GK+FF GE IGYLDL  GW+A+ + I EE+ SLK+ D ++FP
Sbjct  123  AAVAALENLKIVEEQLKGKKFFHGETIGYLDLAFGWIANLVSILEEIMSLKLVDGERFP  181



>ref|XP_004137330.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN63854.1| hypothetical protein Csa_1G024860 [Cucumis sativus]
Length=224

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 133/177 (75%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F +RV+WAL++KG+E+EYI ED+ NK+ LL + NPVH K+PV +HN K +
Sbjct  4    VKIIGSAGSLFCIRVEWALKLKGIEFEYIVEDLRNKSELLLKSNPVHKKIPVFLHNDKAI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESLLI+EYIDETWK NP+LP DPY+RA ARFWA F + K L  AWEA  ++G+++E AV
Sbjct  64   SESLLIIEYIDETWKENPILPEDPYDRANARFWAKFLDEKGLIGAWEACQAEGEEKEKAV  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             +A++ +  L+ E+ GK+FFGGE+IGYLDL  GW+ H L + +EV  + +FD ++ P
Sbjct  124  EAAIQNLALLDKEIQGKKFFGGEQIGYLDLAAGWICHWLNVLDEVGEMNVFDRERVP  180



>emb|CDP15482.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 133/179 (74%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK++G   S FV R  WAL++KGLEY YIEE++ NK+ LL +LNPV+ KVPVLVH GK
Sbjct  4    EDLKLLGTRSSSFVWRTVWALKIKGLEYTYIEENLYNKSSLLLELNPVYKKVPVLVHRGK  63

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+I+EYIDETWK NP+LP DP ERA ARFWA F++ K+ + A + L + G++Q  
Sbjct  64   PICESLVIIEYIDETWKENPILPEDPLERAYARFWAKFSDEKLAESAGQVLRTTGEEQAK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+    EAME LE E++GK+FFGG+KIGYLD+V+GW A+ L   EEV   K  DS K+P
Sbjct  124  ALERMTEAMEILEREISGKKFFGGDKIGYLDIVIGWSAYWLQFLEEVGCFKAMDSTKYP  182



>ref|XP_002523997.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF38365.1| glutathione s-transferase, putative [Ricinus communis]
Length=216

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 128/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  84   SPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPLPESLLILE  263
            SPF LRV WAL++KG+ YE IEED+ NK+PLL Q NP++ KVPVLVH+GKP+ ESL+ILE
Sbjct  13   SPFGLRVVWALKLKGIRYESIEEDLSNKSPLLLQYNPIYKKVPVLVHDGKPVVESLIILE  72

Query  264  YIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAVNSameame  443
            YI+ETW+ +PLLPA PY+RA A FWA F + K+L   W     KGK+QE A+  A+E ++
Sbjct  73   YIEETWQQSPLLPAHPYQRAMAHFWAKFGDDKVLPSIWYVFIKKGKEQEDAIPEALENLK  132

Query  444  kleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             LE EL GK+FFGGEKIG++DL  GW+A+ L + EEV  LK+ D  KFP
Sbjct  133  ILEEELRGKKFFGGEKIGFVDLAFGWLANTLSVLEEVVGLKLIDEMKFP  181



>ref|XP_004957087.1| PREDICTED: glutathione transferase GST 23-like [Setaria italica]
Length=222

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+KV G W SP V+RV+WALR+KG+EYEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVFGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRYNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWK-HNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ES +I+EYIDE WK  +P++PADPYERA+ARFWA +AE K     +    + G++
Sbjct  62   GKPIAESTIIVEYIDEAWKGGHPIMPADPYERAQARFWARYAEDKCNAALYPIFTATGEE  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
            Q      A + ++ LE  L GK+FFGG+ +GYLD+VVGW AH LP+ EEV  + I   ++
Sbjct  122  QRKVAQEAQQCLKTLETALEGKKFFGGDAVGYLDIVVGWFAHWLPVVEEVCGVSIVTDEE  181

Query  585  FP  590
             P
Sbjct  182  LP  183



>ref|XP_007210928.1| hypothetical protein PRUPE_ppa026181mg, partial [Prunus persica]
 gb|EMJ12127.1| hypothetical protein PRUPE_ppa026181mg, partial [Prunus persica]
Length=186

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 137/180 (76%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            EG+K+V    S F  R++WAL++KG+EYEYIEED+ NK+P+L + NPVH KVPV VH+ +
Sbjct  2    EGVKLVATTQSLFCTRIEWALKLKGVEYEYIEEDLRNKSPILLKYNPVHKKVPVFVHDDR  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEAL-CSKGKQQE  410
             + ESL+ILEYIDETWK +PLLP D Y+RA ARFWA FA+ K++  AW A   ++G+++E
Sbjct  62   AIAESLVILEYIDETWKEHPLLPQDSYDRAIARFWAKFADEKVVFGAWRACTAAEGEEKE  121

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A+ SA+E++  LE ++ GK+FFGGE+IGYLDL +GW+ H L   EE   +K+ ++++FP
Sbjct  122  KAIESALESLAYLEKQIEGKKFFGGEEIGYLDLALGWIPHWLNTMEEAGGMKLLEAERFP  181



>ref|XP_010938160.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=225

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 134/183 (73%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MA+   +K+ G W SP V RV+WAL++KG+EYEYIEEDI NK+  L + NP++ +VPVL+
Sbjct  1    MASGGEVKLFGMWASPAVRRVEWALKLKGIEYEYIEEDISNKSKDLVKYNPINKQVPVLL  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ESL+I+EYIDE WKHNP+LP DPYERA ARFWA ++E K      E   ++G+
Sbjct  61   HNGKPIIESLVIIEYIDEVWKHNPILPKDPYERAMARFWATYSEDKCRGAVREVFFAEGE  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            ++  A+    E +  L+ EL GK+FFGGE IG+ DLV+GW+A  L + EEVAS ++ D +
Sbjct  121  KRVKAIKCLEETLRALDEELKGKKFFGGENIGFSDLVLGWMAFWLGVSEEVASFEVLDPK  180

Query  582  KFP  590
            KFP
Sbjct  181  KFP  183



>ref|XP_004307164.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011469436.1| PREDICTED: glutathione transferase GST 23-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=223

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 130/177 (73%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W SPF LR+ WAL++K ++Y+ I ED+ NK+PLL Q NPVH KVPVLVHNGK +
Sbjct  4    VKLFRTWSSPFALRIVWALKLKDVQYDTIFEDLSNKSPLLLQYNPVHKKVPVLVHNGKSV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYI+ETWKHNPLL  DP+ERA ARFWA F + K+L   WEA  S+G++QE  +
Sbjct  64   AESFVILEYIEETWKHNPLLSEDPHERAAARFWAKFGDEKVLTSIWEAFISEGEKQEEGI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A E ++ LE ELNGK+FFGGE+IG+ D+ +GW+   + +FEEV S+K+    + P
Sbjct  124  VKAKENLKYLEGELNGKKFFGGEQIGFADIALGWLTEYVDVFEEVTSMKLITEGELP  180



>ref|NP_001104994.1| glutathione transferase GST 23 [Zea mays]
 sp|Q9FQA3.1|GST23_MAIZE RecName: Full=Glutathione transferase GST 23; AltName: Full=Glutathione 
transferase GST 36 [Zea mays]
 gb|AAG34844.1|AF244701_1 glutathione S-transferase GST 36 [Zea mays]
 gb|ACF85476.1| unknown [Zea mays]
 gb|ACG35906.1| glutathione S-transferase [Zea mays]
 tpg|DAA61852.1| TPA: glutathione S-transferase GST 23 [Zea mays]
Length=222

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+KV+G W SP V+RV+WALR+KG+EYEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVLGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRHNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ES +I+EYIDE WK   P++P DPYERA+ARFWA FAE K     +    + G+ 
Sbjct  62   GKPVAESTIIVEYIDEVWKGGYPIMPGDPYERAQARFWARFAEDKCNAALYPIFTATGEA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
            Q  AV+ A + ++ LE  L GK+FFGG+ +GYLD+VVGW AH LP+ EEV    +   ++
Sbjct  122  QRKAVHEAQQCLKTLETALEGKKFFGGDAVGYLDIVVGWFAHWLPVIEEVTGASVVTHEE  181

Query  585  FP  590
             P
Sbjct  182  LP  183



>ref|XP_004297032.1| PREDICTED: probable glutathione S-transferase [Fragaria vesca 
subsp. vesca]
Length=222

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 133/177 (75%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W S F LR+ WAL++K + Y+ I ED+ NK+PLL Q NP+H  VPVLVHNGK +
Sbjct  4    VKLFRTWSSSFALRIVWALKLKDVPYDTIFEDLSNKSPLLLQHNPIHKLVPVLVHNGKSI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYI+ETWKHNPLLPADP+ RA ARFWA F + K+  P  + LCS+GK+QE A+
Sbjct  64   AESLVILEYIEETWKHNPLLPADPHNRAAARFWAKFGDDKVFPPILDTLCSEGKEQEEAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A ++++ LE EL GK+FFGGE+IG+ D+ +GW+AH+  +F EVA++K+    +FP
Sbjct  124  VKAKDSLKYLEEELKGKKFFGGEQIGFADIALGWLAHHENVFAEVANVKLIAEDEFP  180



>ref|XP_008232147.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=224

 Score =   196 bits (498),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 132/178 (74%), Gaps = 1/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+   W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H KVPVLVHNGKP+
Sbjct  4    VKLFRTWSSPFALRIVWALKLKGVPYETIYEDLSNKSPLLLQYNPIHKKVPVLVHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES ++LEYIDETWK NPLLP DP ERA ARFWA F + K+L   WE+  + GK+QE A+
Sbjct  64   VESFVVLEYIDETWKENPLLPEDPLERAAARFWAKFGDDKVLPSIWESFTNDGKEQEEAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVA-HNLPIFEEVASLKIFDSQKFP  590
              A E ++ LE EL GK+FFGGEK+G++D+ +GW++ +   +FE+V  +K+   ++FP
Sbjct  124  VKAKENLKYLEEELKGKKFFGGEKLGFVDIALGWLSQYESSVFEDVTGMKLLTEEEFP  181



>ref|XP_002460369.1| hypothetical protein SORBIDRAFT_02g027080 [Sorghum bicolor]
 gb|EER96890.1| hypothetical protein SORBIDRAFT_02g027080 [Sorghum bicolor]
Length=222

 Score =   196 bits (497),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+KV+G W SP V+RV+WALR+KG+EYEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVLGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRYNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            G P+ ES +I+EYIDE WK   P++PADPYERA+ARFWA FAE K     +    + G+ 
Sbjct  62   GNPIAESTIIVEYIDEAWKGGYPIMPADPYERAQARFWARFAEEKCNAALYPIFTATGEA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
            Q  AV  A + ++ LE  L GK+FFGG+ +GYLD+VVGW AH LP+ EEV    +   ++
Sbjct  122  QRKAVQEAQQCLKTLETALEGKKFFGGDAVGYLDIVVGWYAHWLPVMEEVIGAGVVTDKE  181

Query  585  FP  590
             P
Sbjct  182  LP  183



>ref|XP_004133937.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 ref|XP_004155775.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN56630.1| hypothetical protein Csa_3G126940 [Cucumis sativus]
Length=222

 Score =   196 bits (497),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 134/180 (74%), Gaps = 0/180 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            EE LK+   W SPF LR+ WAL++KG+EYE + ED+ NK+PLL + NP+H KVPVLVH G
Sbjct  2    EEELKLFRTWSSPFPLRIVWALKLKGIEYETVYEDLANKSPLLLEYNPIHKKVPVLVHGG  61

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL+ILEYI+ETWK NPLLP DPY+RA ARFWA F + K+L+   +   ++GK +E
Sbjct  62   KPIAESLVILEYIEETWKQNPLLPQDPYQRAVARFWAKFGDDKVLESIKKVFMNQGKVRE  121

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              V  AME ++ LE EL GK+FFGGE IG++D+ VGW+A+ + + EEV  L++   ++FP
Sbjct  122  EGVEEAMENLKHLEEELKGKRFFGGEAIGFVDIAVGWLANIVSVMEEVVGLELITEERFP  181



>tpg|DAA61851.1| TPA: hypothetical protein ZEAMMB73_518022, partial [Zea mays]
Length=230

 Score =   196 bits (497),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 131/182 (72%), Gaps = 1/182 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+KV+G W SP V+RV+WALR+KG+EYEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVLGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRHNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ES +I+EYIDE WK   P++P DPYERA+ARFWA FAE K     +    + G+ 
Sbjct  62   GKPVAESTIIVEYIDEVWKGGYPIMPGDPYERAQARFWARFAEDKCNAALYPIFTATGEA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
            Q  AV+ A + ++ LE  L GK+FFGG+ +GYLD+VVGW AH LP+ EEV    +   ++
Sbjct  122  QRKAVHEAQQCLKTLETALEGKKFFGGDAVGYLDIVVGWFAHWLPVIEEVTGASVVTHEE  181

Query  585  FP  590
             P
Sbjct  182  LP  183



>ref|XP_010661155.1| PREDICTED: probable glutathione S-transferase isoform X2 [Vitis 
vinifera]
Length=225

 Score =   196 bits (497),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W +PF LR+ WAL++KG+EYE I ED+ NK+P L Q NP H KVPVLVHNGK
Sbjct  3    EEVKLFRTWSTPFALRIVWALKIKGVEYETIFEDLYNKSPSLLQYNPAHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPA-WEALCSKGKQQE  410
            P+ ES +ILEYIDETWK  PLLP DPYERA ARFWA F + K+     W     +GK+QE
Sbjct  63   PISESYVILEYIDETWKETPLLPEDPYERAMARFWAKFGDDKVFTSIFWGVFVKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A+  AME ++ LE EL GK+FFGGE+IG++DL +GW+A+ + I E+VA LKI    KFP
Sbjct  123  EAMVEAMENLQFLEEELRGKKFFGGERIGFVDLALGWLANLISILEDVAGLKIVGEDKFP  182



>ref|XP_009343222.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Pyrus 
x bretschneideri]
Length=219

 Score =   195 bits (496),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 132/177 (75%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W S F LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H K+PVL+HNG  +
Sbjct  4    VKLLRTWSSAFGLRIVWALQLKGIPYETIYEDLSNKSPLLLQSNPIHKKIPVLLHNGNAV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP ERA ARFWA + + K+L   WE    +GK+QE A+
Sbjct  64   VESLIILEYVDETWKENPLLPEDPLERATARFWARYGDEKVLPSIWEFFTKEGKEQEEAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A E ++ LE EL GK+FFGGEK+G++D+ +GW+A+N  +FEEVA +K+   ++FP
Sbjct  124  VKAKENLKYLEEELKGKKFFGGEKVGFVDIALGWLAYNESLFEEVAGMKVVTKEEFP  180



>ref|XP_011004953.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   196 bits (497),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            E+G+K+   W SPF +R+ WAL++KG+++E I+ED+ NK+PLL   NPVH K+PVLVH+G
Sbjct  2    EKGVKLFKTWSSPFGIRIVWALKVKGVQFEQIDEDLANKSPLLLLYNPVHKKIPVLVHDG  61

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL+ILEYI+ETWK NPL P DP ERA ARFWA F + K++   WEA     +++E
Sbjct  62   KPVVESLVILEYIEETWKQNPLFPEDPLERAAARFWAKFGDDKVMPSIWEAFIKGREEEE  121

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A   A E ++ LE EL GKQFFGGE+IG +D+  GW+A+ +P+FEE+ ++K+ D ++FP
Sbjct  122  CAFAPAFENLKFLEEELKGKQFFGGERIGIVDIAFGWLANLVPVFEEIHAIKVIDEERFP  181



>ref|XP_006373657.1| hypothetical protein POPTR_0016s02350g [Populus trichocarpa]
 gb|ERP51454.1| hypothetical protein POPTR_0016s02350g [Populus trichocarpa]
Length=225

 Score =   196 bits (497),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV   W SPF LRV WAL++KG+E++ I ED+ NK+PLL Q NP+H KVPVLVHNGK
Sbjct  3    EEVKVFRTWSSPFALRVIWALKLKGVEFDTIYEDLSNKSPLLLQYNPIHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
             + ESL+ILEYIDETWK NPLLP DP+++A ARFWA F + K+L    W  L  +GK+ E
Sbjct  63   VICESLVILEYIDETWKQNPLLPEDPHQQANARFWAKFGDDKVLQSIVWGVLMKEGKELE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              V +++E ++ LE E+ GK+FFGGE IG  D+ +GW+A+ L IFEE+  LK+ D +KFP
Sbjct  123  EGVLASLENLKYLEEEIRGKKFFGGETIGLADIALGWLAYYLDIFEEILGLKLIDQEKFP  182



>ref|XP_002307924.1| hypothetical protein POPTR_0006s02510g [Populus trichocarpa]
 gb|EEE91447.1| hypothetical protein POPTR_0006s02510g [Populus trichocarpa]
 gb|ADB11389.1| tau class glutathione transferase GSTU18 [Populus trichocarpa]
Length=225

 Score =   196 bits (497),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV   W SPF LRV WALR+KG++++ I ED+ NK+PLL Q NPV  KVPVLVHNGK
Sbjct  3    EEVKVFRSWSSPFPLRVIWALRLKGVKFDVICEDLFNKSPLLLQYNPVGKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
             + ESL+ILEYI+ETWK  PLLP DPY++A ARFWA F++ K+L    W+ L  +GK+QE
Sbjct  63   AICESLVILEYIEETWKQTPLLPEDPYQKANARFWAKFSDDKVLQSIKWDVLLKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              + ++++ +  LE EL GK+FFGGE IG  DL +GW+A+ L IFEEVA LK+ D + FP
Sbjct  123  EGILASLQNLRYLEEELRGKKFFGGEAIGLADLALGWLAYYLNIFEEVAGLKLVDQESFP  182



>emb|CDP21862.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   195 bits (496),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 130/179 (73%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W S + LR+ WAL++KG+EYE I ED+ NK+P L Q NP+H KVPVLVH+GK
Sbjct  3    EEVKLFRTWSSGYALRIVWALKLKGIEYETIFEDLTNKSPSLLQYNPIHGKVPVLVHDGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETWKHNPLLP DPYE++ ARFWA F + K++   W+   ++ K Q+ 
Sbjct  63   PVCESLVILEYVDETWKHNPLLPQDPYEKSMARFWANFGDDKLMKSIWQLFIAREKDQDV  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A   A+E ++ +E +L GK+FF GE +GYLDL  GW A  + I EE+ SLK+ D ++FP
Sbjct  123  AAVEALENLKLVEEQLKGKKFFHGETVGYLDLAFGWFADFVSILEEIMSLKLVDGERFP  181



>ref|XP_010521899.1| PREDICTED: glutathione S-transferase U7-like [Tarenaya hassleriana]
Length=222

 Score =   195 bits (496),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 134/183 (73%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MA EE +K++G W SPF  R++ AL++KG+ Y+Y+EED+ NK+PLL QLNPVH K+PV V
Sbjct  1    MAEEEEVKLLGLWSSPFSCRIEMALKLKGVPYKYLEEDLENKSPLLLQLNPVHKKIPVFV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ESL+IL+YIDETWKHNP+LP DPYERA ARFWA F + ++L    + +   G+
Sbjct  61   HNGKPIAESLVILDYIDETWKHNPILPQDPYERAMARFWARFIDEQVLLTGLKIVAQTGR  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            ++E+AV +  + ++ LE EL GK FFGGE  GYLD+V   VA  L   +++  +++   +
Sbjct  121  EREAAVEATRDLVKFLEKELKGKDFFGGESFGYLDMVATLVAFWLMRSDDLVGVEVLPEE  180

Query  582  KFP  590
            KFP
Sbjct  181  KFP  183



>ref|XP_002266900.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=236

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 133/186 (72%), Gaps = 6/186 (3%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G WVSPFV RV+WAL+ KG+EYEY+EED+ NK+ LL   NPVH KVPVL+HNG
Sbjct  8    EEQVKLLGIWVSPFVKRVEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKVPVLLHNG  67

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             P+ ESL+I+EYIDE WK NP+LP DP+ERA+ARFWA F E KI +    AL ++G+QQE
Sbjct  68   NPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQE  127

Query  411  SAVNSameamekleaelNGK-----QFFGGEK-IGYLDLVVGWVAHNLPIFEEVASLKIF  572
              V    EAME LE E   K      FFGG+  +GY+D+V+GW+ + + + EEV   K+ 
Sbjct  128  KVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVIEEVGGFKVL  187

Query  573  DSQKFP  590
            D QK P
Sbjct  188  DPQKQP  193



>ref|XP_003629835.1| Glutathione S-transferase GST [Medicago truncatula]
 gb|AET04311.1| glutathione S-transferase [Medicago truncatula]
 gb|AFK38611.1| unknown [Medicago truncatula]
Length=225

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 134/183 (73%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M   + +K++ F +SP   RV+WAL++KG+E++YIEEDI NK+ LL ++NPVH KVPVLV
Sbjct  1    MMGNQDVKLLNFLLSPVGRRVEWALKLKGVEFDYIEEDIFNKSSLLLEMNPVHKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  K + ESL+ILEYIDETWK  PLLP DPY+R+RARFWA  ++ K+   +W AL  KG 
Sbjct  61   HGQKSIAESLIILEYIDETWKQYPLLPPDPYQRSRARFWAKLSDEKLALGSWIALIKKGN  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            + E A+  A E MEKLE ++ GK+FFGG+ IGYLDL +GW+   LPI+EE+ S +I D  
Sbjct  121  EWEKALKEAREIMEKLEEDIKGKKFFGGDTIGYLDLTLGWITCFLPIWEEIGSTQILDPL  180

Query  582  KFP  590
            K P
Sbjct  181  KCP  183



>emb|CBI26437.3| unnamed protein product [Vitis vinifera]
Length=231

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 133/186 (72%), Gaps = 6/186 (3%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G WVSPFV RV+WAL+ KG+EYEY+EED+ NK+ LL   NPVH KVPVL+HNG
Sbjct  3    EEQVKLLGIWVSPFVKRVEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKVPVLLHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             P+ ESL+I+EYIDE WK NP+LP DP+ERA+ARFWA F E KI +    AL ++G+QQE
Sbjct  63   NPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQE  122

Query  411  SAVNSameamekleaelNGK-----QFFGGEK-IGYLDLVVGWVAHNLPIFEEVASLKIF  572
              V    EAME LE E   K      FFGG+  +GY+D+V+GW+ + + + EEV   K+ 
Sbjct  123  KVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVIEEVGGFKVL  182

Query  573  DSQKFP  590
            D QK P
Sbjct  183  DPQKQP  188



>ref|XP_008240197.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=225

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 138/180 (77%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            EG+K++    S F  R++WAL++KG+EYEYIEED+ NK+P+L + NPVH KVPV VH+ +
Sbjct  2    EGVKLIATTQSLFCTRIEWALKLKGVEYEYIEEDLRNKSPILLKYNPVHKKVPVFVHDDR  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEAL-CSKGKQQE  410
             + ESL+ILEYIDETWK +PLLP D Y+RA ARFWA FA+ K++  AW A   ++G+++E
Sbjct  62   AIAESLVILEYIDETWKEHPLLPQDSYDRAIARFWAKFADEKVVFGAWRACTAAEGEEKE  121

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            +A+ SA+E++  LE ++ GK+FFGGE+IGYLDL +GW+ H L   EE   +K+ ++++FP
Sbjct  122  TAIESALESLAYLEKQIEGKKFFGGEEIGYLDLALGWIPHWLNTMEEAGGMKLLEAERFP  181



>ref|XP_002319750.2| hypothetical protein POPTR_0013s06950g [Populus trichocarpa]
 gb|EEE95673.2| hypothetical protein POPTR_0013s06950g [Populus trichocarpa]
Length=225

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 136/180 (76%), Gaps = 0/180 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            E+G+K+   W SPF +R+ WAL++KG+++E I+ED++NK+PLL   NPVH K+PVLVH+G
Sbjct  2    EKGVKLFKTWSSPFGIRIVWALKVKGVQFEQIDEDLVNKSPLLLLYNPVHKKIPVLVHDG  61

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL+ILEYI+ TWK NPL P DP ERA ARFWA F + K++   WEA     +++E
Sbjct  62   KPVVESLIILEYIEGTWKQNPLFPEDPLERAAARFWAKFGDDKVMPSIWEAFIKGREEEE  121

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A   A E ++ LE EL GKQFFGGE+IG +D+ +GW+A+ +P+FEE+ ++K+ D ++FP
Sbjct  122  CAFAPAFENLKFLEEELKGKQFFGGERIGIVDIALGWLANLVPVFEEIHAIKMIDEERFP  181



>gb|ADB11358.1| tau class glutathione transferase GSTU26 [Populus trichocarpa]
Length=225

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 134/178 (75%), Gaps = 1/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+G   S F  RV+WAL++KG+EYEY++EDI NK+PLL + NPVH KVPVLVH+ KP+
Sbjct  4    VKVIGSSKSLFCARVEWALKLKGVEYEYLQEDIWNKSPLLLKHNPVHKKVPVLVHDDKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK  PLLP DPYERA ARFWA FAE K L  A+ A   +G+++E A+
Sbjct  64   AESLVILEYIDETWKDYPLLPEDPYERAMARFWAKFAEEKCLMGAFAAFWKEGEEKEKAI  123

Query  420  NSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             SA+E+   LE ++ GK+FF G + IGYLDLV+GW+   L + EE   +K+ D+QKFP
Sbjct  124  ESALESFTFLEKQIQGKKFFSGDDNIGYLDLVMGWIPLWLNVMEEAGGMKLMDAQKFP  181



>ref|XP_009593034.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana tomentosiformis]
Length=225

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 132/181 (73%), Gaps = 0/181 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            A EG+K++G+W SP+ LRV WAL++KG+EY+Y EED+ NK+PLL Q NPVH K+PVLVHN
Sbjct  2    AGEGVKLLGYWASPYALRVHWALKLKGVEYDYQEEDLPNKSPLLLQYNPVHKKIPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKP+ ESL+ILEYIDETWK NPLLP DPYERA+ARFWA F + K +   +      G++Q
Sbjct  62   GKPIAESLVILEYIDETWKQNPLLPEDPYERAKARFWAKFVDDKCVPGIFATFSKVGEEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            +  V  A E ++ LE EL+ K+FFG  +IG++D+   W+     I EE+  +K+ D+++ 
Sbjct  122  QKIVKEARENLKLLEGELDKKRFFGDTRIGFIDVASAWIICWAQIVEEIIDIKLIDAEEM  181

Query  588  P  590
            P
Sbjct  182  P  182



>ref|XP_006489767.1| PREDICTED: glutathione transferase GST 23-like [Citrus sinensis]
Length=185

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 131/178 (74%), Gaps = 2/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SP V RV WAL++KG+E+E IEEDI NK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKLLGFWSSPPVFRVVWALKLKGVEFENIEEDIFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             +S +ILEYID TW+H+PLLP DPYE A ARFWA FA  K+L+ A++A+ SKG++++  +
Sbjct  65   VDSFVILEYIDVTWQHDPLLPQDPYETAMARFWAKFAYEKLLESAYKAMWSKGEEKQKTM  124

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEV-ASLKIFDSQKFP  590
                    +   EL GK F GG  IGYLDL +GW+++ LP++EE   S++I DSQKFP
Sbjct  125  KE-AIESLEKIEELRGKNFIGGNSIGYLDLAIGWISYWLPVWEEADGSMRILDSQKFP  181



>ref|XP_010646030.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=231

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SPF LR+ WAL++KG+EYE I ED+ +K+P L Q NP H K+PVLVH+GK
Sbjct  3    EEVKLFRTWSSPFALRIVWALKIKGVEYETIFEDLSDKSPSLLQYNPAHKKIPVLVHSGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
            P+ ES +ILEYIDETWK  PLLP DPYERA ARFWA F + K+L    W     +G +QE
Sbjct  63   PIAESYVILEYIDETWKETPLLPEDPYERAMARFWAKFGDDKVLTSIVWGVFIKEGNEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A+  AM+ +  LE EL GK+FFGGE+IG++DL +GW+A+ + I E+VA LKI D  KFP
Sbjct  123  EAMVEAMKNLWLLEEELRGKKFFGGERIGFVDLALGWLANLISILEDVAGLKIVDEDKFP  182



>ref|XP_011004483.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV   W SPF LRV WALR+KG++++ I ED+ NK+PLL Q NPV  KVPVLVHNGK
Sbjct  3    EEVKVFRSWASPFPLRVIWALRLKGVKFDVICEDLFNKSPLLLQYNPVEKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
             + ESL+ILEYI+ETWK +PLLP DPY++A ARFWA F++ K+     W+ L  +GK+QE
Sbjct  63   AICESLVILEYIEETWKQSPLLPEDPYQKANARFWAKFSDDKVFQSIKWDVLLKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              + ++++ +  LE EL GK+FFGGE IG  DL +GW+A+ + IFEEV  LK+ D ++FP
Sbjct  123  EGILASLQNLRYLEEELRGKKFFGGEAIGLADLALGWLAYYINIFEEVVGLKLVDQERFP  182



>gb|ADB11367.1| putative tau class glutathione transferase GSTU41 [Populus trichocarpa]
Length=225

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            E+G+K+   W SPF +R+ WAL++KG+++E I+ED++NK+PLL   NPVH K+PVLVH+G
Sbjct  2    EKGVKLFKTWSSPFGIRIVWALKVKGVQFEQIDEDLVNKSPLLLLYNPVHKKIPVLVHDG  61

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL+ILEYI+ TWK NPL P DP ERA ARFWA F + K++   WEA     +++E
Sbjct  62   KPVVESLIILEYIEGTWKQNPLFPEDPLERAAARFWAKFGDDKVMPSIWEAFIKGREEEE  121

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A   A E ++ LE EL GKQFFGGE+IG +D+  GW+A+ +P+FEE+ ++K+ D ++FP
Sbjct  122  CAFAPAFENLKFLEEELKGKQFFGGERIGIVDIAFGWLANLVPVFEEIHAIKMIDEERFP  181



>ref|XP_010663654.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=221

 Score =   193 bits (491),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 131/177 (74%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+G  +S F  RV+WAL++KG+ YEY+EED+ NK+P+L Q NPVH KVPVLVH+G+P+
Sbjct  4    VKVLGASLSFFCCRVEWALKLKGVAYEYLEEDLRNKSPMLLQSNPVHKKVPVLVHDGRPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDE WK  PLLP DP ERA+ RFWA F + K +  AW A C+KG ++E A+
Sbjct  64   AESLVILEYIDEAWKGYPLLPEDPSERAKIRFWARFTDEKCVLGAWAACCAKGHEREKAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             SA E++  LE ++ GK+FFGGE +G LDLVVG + + +   EE   +K+ D +KFP
Sbjct  124  ESAQESLSFLEKQIEGKKFFGGETMGLLDLVVGSLPNWIEFLEEHGGMKLLDEEKFP  180



>ref|XP_008793318.1| PREDICTED: glutathione transferase GST 23-like [Phoenix dactylifera]
Length=225

 Score =   193 bits (490),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M +   +K+ G W SP V RV+WAL++KG++YEY+EEDI NK+  L + NP++ +VPVL+
Sbjct  1    MVSGGEVKLFGMWASPAVRRVEWALKLKGIKYEYVEEDISNKSGALVRYNPINKQVPVLL  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ESL+ILEYIDE WKH+P+LP DPYERA ARFWA ++E K  D       ++G 
Sbjct  61   HNGKPIVESLVILEYIDEVWKHHPILPKDPYERAMARFWAAYSEDKCRDAVRRVFFAEGG  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            ++  A+    E +  L+ EL GK+FFGGE IG+ DLV+GW+A  L + EEVAS ++ D +
Sbjct  121  ERAKAIECLEETLRALDGELEGKEFFGGENIGFSDLVLGWMAFWLGVSEEVASFEVLDPK  180

Query  582  KFP  590
            KFP
Sbjct  181  KFP  183



>ref|XP_002264055.2| PREDICTED: probable glutathione S-transferase isoform X1 [Vitis 
vinifera]
Length=225

 Score =   193 bits (490),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W +PF LR+ WAL++KG+EYE I ED+ NK+P L Q NP H KVPVLVHNGK
Sbjct  3    EEVKLFRTWSTPFALRIVWALKIKGVEYETIFEDLYNKSPSLLQYNPAHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK-GKQQE  410
            P+ ES +ILEYIDETWK  PLLP DPYERA ARFWA F + K+    +  +  K GK+QE
Sbjct  63   PISESYVILEYIDETWKETPLLPEDPYERAMARFWAKFGDDKVFTSIFGGVFVKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A+  AME ++ LE EL GK+FFGGE+IG++DL +GW+A+ + I E+VA LKI    KFP
Sbjct  123  EAMVEAMENLQFLEEELRGKKFFGGERIGFVDLALGWLANLISILEDVAGLKIVGEDKFP  182



>gb|KDO57582.1| hypothetical protein CISIN_1g043218mg [Citrus sinensis]
Length=226

 Score =   193 bits (490),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 131/178 (74%), Gaps = 2/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++GFW SP V RV WAL++KG+E+E IEEDI NK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKLLGFWSSPPVFRVVWALKLKGVEFENIEEDIFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             +S +ILEYID TW+H+PLLP DPYE A ARFWA FA  K+L+ A++A+ SKG++++  +
Sbjct  65   VDSFVILEYIDVTWQHDPLLPQDPYETAMARFWAKFAYEKLLESAYKAMWSKGEEKQKTM  124

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEV-ASLKIFDSQKFP  590
                    +   EL GK F GG  IGYLDL +GW+++ LP++EE   S++I DSQKFP
Sbjct  125  KE-AIESLEKIEELRGKNFIGGNSIGYLDLAIGWISYWLPVWEEADGSMRILDSQKFP  181



>gb|KEH26957.1| glutathione S-transferase [Medicago truncatula]
Length=223

 Score =   192 bits (489),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 133/164 (81%), Gaps = 0/164 (0%)
 Frame = +3

Query  99   RVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPLPESLLILEYIDET  278
            R++WALR+KG+EYEYI+ED+LNK+PLL + NPV+ KVPVL+H+GK + ESL+ILEYIDET
Sbjct  17   RIEWALRIKGVEYEYIQEDLLNKSPLLLESNPVYKKVPVLLHDGKSIAESLVILEYIDET  76

Query  279  WKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAVNSameamekleae  458
            WK NPLLP DPYE+A ARFWA F + K +   W A  ++G+++  AV++A+E++  LE +
Sbjct  77   WKDNPLLPLDPYEKALARFWAKFIDEKCIFGVWGACVAQGEEKAKAVDAAIESLAFLEKQ  136

Query  459  lNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            + GK+FFGGEKIGYLD+V GW+++ L + EE+  +++ +++KFP
Sbjct  137  IQGKKFFGGEKIGYLDIVAGWISYWLNVLEELGEMELINAEKFP  180



>ref|XP_011040645.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV   W SPF LRV WALR+KG++++ I ED+ NK+PLL Q NPV  KVPVLVHNGK
Sbjct  3    EEVKVFRSWASPFPLRVIWALRLKGVKFDVICEDLFNKSPLLLQYNPVEKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPA-WEALCSKGKQQE  410
             + ESL+ILEYI+ETWK +PLLP DPY++A ARFWA F++ K+     W+ L  +GK+QE
Sbjct  63   AICESLVILEYIEETWKQSPLLPEDPYQKANARFWAKFSDDKVFQSMKWDVLLKEGKEQE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              + ++++ +  LE EL GK+FFGGE IG  DL +GW+A+ + IFEEV  LK+ D  +FP
Sbjct  123  EGILASLQNLRYLEEELRGKKFFGGEAIGLADLALGWLAYYINIFEEVVGLKLVDQGRFP  182



>ref|NP_001234088.1| uncharacterized protein LOC543815 [Solanum lycopersicum]
 gb|AAG16758.1| putative glutathione S-transferase T3 [Solanum lycopersicum]
Length=225

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 128/181 (71%), Gaps = 0/181 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            A E +K++G+W SPF L+V WAL++KG+EYEY EED+ NK+PLL Q NPVH K+PVLVHN
Sbjct  2    ASEKVKLLGYWASPFALKVHWALKLKGIEYEYQEEDLSNKSPLLLQYNPVHKKIPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKP+ ESL+ILEYI+ETWKHNPLLP DPYERA+ARFWA F + K +   +      G +Q
Sbjct  62   GKPIAESLVILEYIEETWKHNPLLPEDPYERAKARFWAKFVDDKCVPGIFGTFAKVGVEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            +     A E ++ LE EL  K FFG  KIG++D+   W+     I EEV  +++ D+++ 
Sbjct  122  QKIAKEARENLKILEDELGKKHFFGDAKIGFMDVTSAWIICWAQIVEEVVDIRLIDAEEM  181

Query  588  P  590
            P
Sbjct  182  P  182



>ref|XP_011039096.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 133/178 (75%), Gaps = 1/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+G   S F  RV+WAL++KG+EYEY+EED+LNK+PLL + NPVH KVPVLVH+ KP+
Sbjct  4    VKVIGSSKSLFCARVEWALKLKGVEYEYLEEDLLNKSPLLLKHNPVHKKVPVLVHDDKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL ILEYIDE WK+ PLLP DPYERA ARFWA FA+ K +  A+ A   +G+++E A+
Sbjct  64   AESLFILEYIDERWKNYPLLPEDPYERAMARFWAKFADEKCVMGAFAAFRKEGEEREKAI  123

Query  420  NSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             SA+E+   +E ++ GK+FF G + IGYLDLV+GW+   L   EE   +K+ D+QKFP
Sbjct  124  ESALESFTFVEKQIQGKKFFSGDDNIGYLDLVMGWIPLWLNAMEEAGGMKLMDAQKFP  181



>gb|ADB11328.1| tau class glutathione transferase GSTU46 [Populus trichocarpa]
Length=223

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 130/179 (73%), Gaps = 1/179 (1%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKP  236
             +K++G + S F  RV+WAL++KG++YEY+E+D+ NK+PLL + NPVH KVPVLVH+ KP
Sbjct  4    AVKLIGSYTSLFCTRVEWALKLKGVQYEYVEDDVFNKSPLLLKHNPVHKKVPVLVHDDKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            +PESL+IL+YIDETW  N LLP D YERA A FWA F E K L   + A   +G+++E A
Sbjct  64   IPESLVILQYIDETWNDNNLLPQDSYERAMAHFWAKFTEEKCLMETFTAAYKEGEEKERA  123

Query  417  VNSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            + SA E+   LE  + GK+FF G +KIGYLDL +GW+   L I EEV  +K+ D++KFP
Sbjct  124  IESAQESFAFLEKLIQGKKFFSGDDKIGYLDLAMGWIPLCLDIIEEVGDMKLVDAEKFP  182



>emb|CDP19810.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 130/179 (73%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W S + LR+ WAL++KG+EYE I ED+ NK+P L Q NP H KVPVLVH+GK
Sbjct  3    EEVKLFRTWSSRYSLRIVWALKLKGIEYETIFEDLTNKSPSLLQYNPTHGKVPVLVHDGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEY+DETWKHNPLLP DPYE++ ARFWA F + K++    +   +  K Q+ 
Sbjct  63   PVCESLVILEYVDETWKHNPLLPQDPYEKSMARFWANFGDDKLMKSISQLFIAHEKDQDV  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A  +A+E ++ +E +L GK+FF GE IGYLDL  GW+A+ + I EE+ SLK+ D ++FP
Sbjct  123  AAVAALENLKIVEEQLKGKKFFHGETIGYLDLAFGWIANLVSILEEIMSLKLVDGERFP  181



>ref|XP_011086578.1| PREDICTED: glutathione transferase GST 23-like [Sesamum indicum]
Length=222

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 126/179 (70%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+   W SP+ LRV  AL++KGL+YE I ED+ NK+  L + NP + KVPVLVHNGK
Sbjct  3    EELKLFRTWSSPYSLRVVHALKIKGLKYETILEDLKNKSASLLEYNPTYKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESLLILEYIDETWK +PL P DPY++A ARFWA F + K+L   W    S+GK+QE 
Sbjct  63   PICESLLILEYIDETWKQHPLFPQDPYQKAMARFWAKFGDDKVLPSIWSVFISQGKEQEE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+  A   ++ LE  L GK+FFGGE IGYLDL  GW+A+ + I EE+  LK+ D + FP
Sbjct  123  AIAPAAGNLKFLEDLLKGKKFFGGETIGYLDLAFGWMANLISILEEIIDLKLIDPENFP  181



>ref|XP_008219369.1| PREDICTED: glutathione transferase GST 23-like [Prunus mume]
Length=223

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 128/181 (71%), Gaps = 0/181 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            + + +K++G W SP  LRVKW L++K +EY+Y+EED+ NK+PLL Q NPVH K+PVLVH 
Sbjct  2    SADSVKLLGNWASPSALRVKWTLKLKEIEYQYVEEDLSNKSPLLLQYNPVHKKIPVLVHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKP+ ESL+ILEYI+ETWK NP+LP DPYERA+ARFWA F + K       A   KG+++
Sbjct  62   GKPVAESLVILEYIEETWKPNPILPEDPYERAQARFWAKFVDEKCAPSIMSAFTKKGEEK  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E     A E ++ LE+ L GKQFFGGE IG++D+  GW+     I EE+A + + D++  
Sbjct  122  EKVAKEARENLQILESGLGGKQFFGGESIGFVDIAAGWIGLWARIVEEIAEVNLIDTETM  181

Query  588  P  590
            P
Sbjct  182  P  182



>ref|XP_008438211.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=222

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 134/180 (74%), Gaps = 0/180 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            EE LK+   W SPF LR+ WAL++KG+EY+ + ED+ NK+PLL + NP++ KVPVLVH G
Sbjct  2    EEELKLFRTWSSPFPLRIVWALKLKGIEYDTVYEDLANKSPLLLEYNPIYKKVPVLVHGG  61

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL+ILEYI+ETWK NPLLP DPY+RA ARFWA F + K+L+   +   ++GK +E
Sbjct  62   KPIAESLVILEYIEETWKQNPLLPQDPYQRAVARFWAKFGDDKVLESIKKVFMNQGKVRE  121

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              V  A+E ++ LE EL GK+FFGGE IG++D+ VGW+A+ + + EEV  L++   ++FP
Sbjct  122  EGVEEALENLKHLEEELKGKRFFGGEAIGFVDIAVGWLANLVSVIEEVVGLELITEERFP  181



>ref|XP_002277759.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=221

 Score =   191 bits (486),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 130/177 (73%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+G  +S F  RV+WAL++KG+ YEY+EED+ NK+P+L Q NPVH KVPVLV +G+P+
Sbjct  4    VKVLGASLSFFCCRVEWALKLKGVAYEYLEEDLRNKSPMLLQSNPVHKKVPVLVQDGRPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDE WK  PLLP DP ERA+ RFWA F + K +  AW A C+KG ++E A+
Sbjct  64   AESLVILEYIDEAWKGYPLLPEDPSERAKTRFWARFTDEKCVLGAWAACCAKGHEREKAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             SA E++  LE ++ GK+FFGGE +G LDLVVG + + +   EE   +K+ D +KFP
Sbjct  124  ESAQESLSFLEKQIEGKKFFGGETMGLLDLVVGSLPNWIEFLEEHGGMKLLDEEKFP  180



>ref|XP_010923032.1| PREDICTED: probable glutathione S-transferase [Elaeis guineensis]
Length=222

 Score =   191 bits (486),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+ G W SPFV RV+WAL++KG++YEYIEED+ NK+P L   +P++ +VPVL+H+GKP+
Sbjct  3    VKLFGAWSSPFVRRVEWALKIKGIKYEYIEEDLYNKSPSLLTYSPINKQVPVLLHDGKPI  62

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES++I+EYID+TWK  PLLP DPY+R+ ARFW+ + E K  +    A  ++G++Q++AV
Sbjct  63   IESMVIIEYIDDTWKQKPLLPIDPYQRSMARFWSQYVEDKFYESVKRAFFTEGEEQKAAV  122

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             SA+EA++ LE EL GK+FF GE+IG++DLV GW+AH L + EEV  +K+ D + FP
Sbjct  123  ESAVEALKPLEQELKGKKFFCGEEIGFVDLVAGWIAHWLEVVEEVLCIKVVDPENFP  179



>gb|ADB11356.1| putative tau class glutathione transferase GSTU23 [Populus trichocarpa]
Length=254

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 133/179 (74%), Gaps = 2/179 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEE-DILNKTPLLSQLNPVHAKVPVLVHNGKP  236
            +K++GFW SPF  RV WAL++KG++YEYIEE DI NK+  L +LNPVH KVPV VH  K 
Sbjct  4    VKLLGFWASPFARRVAWALKLKGVDYEYIEEEDIFNKSSQLIELNPVHKKVPVFVHGQKV  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFA-EFKILDPAWEALCSKGKQQES  413
            + ES +IL+   +TWK  PL+P DP+ERA  RFW  FA E KIL  AW A+CS+G+++E 
Sbjct  64   IAESFVILQDCLKTWKQCPLMPQDPHERAMIRFWTKFAEEKKILHAAWNAMCSRGEEKEK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A    ++ +EK+E EL GKQFFGGE IGYLD+ +GW+++ LP++EEV S+KI D  +FP
Sbjct  124  AAKLTVDVIEKIEGELKGKQFFGGESIGYLDIALGWMSYWLPVWEEVGSMKIVDPLQFP  182



>ref|XP_002321502.2| hypothetical protein POPTR_0015s04200g [Populus trichocarpa]
 gb|EEF05629.2| hypothetical protein POPTR_0015s04200g [Populus trichocarpa]
Length=223

 Score =   191 bits (486),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 130/179 (73%), Gaps = 1/179 (1%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKP  236
             +K++G + S F  RV+WAL++KG++YEY+E+D+ NK+PLL + NPVH KVPVLVH+ KP
Sbjct  4    AVKLIGSYTSLFCTRVEWALKLKGVQYEYVEDDVFNKSPLLLKHNPVHKKVPVLVHDDKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            +PESL+IL+YIDETW  N LLP D YERA A FWA F + K L   + A   +G+++E A
Sbjct  64   IPESLVILQYIDETWNDNNLLPQDSYERAMAHFWAKFTDEKCLMQTFTAAYKEGEEKERA  123

Query  417  VNSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            + SA E+   LE  + GK+FF G +KIGYLDL +GW+   L I EEV  +K+ D++KFP
Sbjct  124  IESAQESFAFLEKLIQGKKFFSGDDKIGYLDLAMGWIPLCLDIIEEVGDMKLVDAEKFP  182



>ref|XP_002266994.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=236

 Score =   191 bits (486),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 132/186 (71%), Gaps = 6/186 (3%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G W SPFV R++WAL+ KG+EYEY+EED+ NK+ LL   NPVH KVPVL+HNG
Sbjct  8    EEQVKLLGIWFSPFVRRIEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKVPVLLHNG  67

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             P+ ESL+I+EYIDE WK NP+LP DP+ERA+ARFWA F E KI +    AL ++G+QQ+
Sbjct  68   NPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQK  127

Query  411  SAVNSameamekleaelNGK-----QFFGGEK-IGYLDLVVGWVAHNLPIFEEVASLKIF  572
              V    EAME LE E   K      FFGG+  +GY+D+V+GW+ + + + EEV   K+ 
Sbjct  128  KVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVIEEVGGFKVL  187

Query  573  DSQKFP  590
            D QK P
Sbjct  188  DPQKQP  193



>ref|XP_006376726.1| hypothetical protein POPTR_0012s04780g [Populus trichocarpa]
 gb|ERP54523.1| hypothetical protein POPTR_0012s04780g [Populus trichocarpa]
Length=225

 Score =   191 bits (485),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 133/178 (75%), Gaps = 1/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+G   S F  RV+WAL++KG+EYEY++ED+ NK+ LL + NPVH KVPVL+H+ KP+
Sbjct  4    VKVIGSSKSLFCARVEWALKLKGVEYEYLQEDLWNKSTLLLKHNPVHKKVPVLIHDDKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK  PLLP DPYERA ARFWA FA+ K +  A+ A   +G+++E A+
Sbjct  64   AESLVILEYIDETWKDYPLLPEDPYERAMARFWAKFADEKCVMGAFVAFLKEGEEKEKAI  123

Query  420  NSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             SA+E+   LE ++ GK+FF G + IGYLDLV+GW+ H L   EE   +K+ D+QKFP
Sbjct  124  ESALESFTFLEKQIQGKKFFSGDDNIGYLDLVMGWIPHWLNAIEEAGGMKLMDAQKFP  181



>ref|NP_001063423.1| Os09g0467200 [Oryza sativa Japonica Group]
 gb|AAK98545.1|AF402804_1 putative glutathione S-transferase OsGSTU17 [Oryza sativa Japonica 
Group]
 dbj|BAD17523.1| putative glutathione S-transferase [Oryza sativa Japonica Group]
 dbj|BAD19734.1| putative glutathione S-transferase [Oryza sativa Japonica Group]
 dbj|BAF25337.1| Os09g0467200 [Oryza sativa Japonica Group]
 gb|EAZ09424.1| hypothetical protein OsI_31697 [Oryza sativa Indica Group]
 gb|EAZ45045.1| hypothetical protein OsJ_29684 [Oryza sativa Japonica Group]
 dbj|BAG88140.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94156.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=223

 Score =   191 bits (485),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 131/184 (71%), Gaps = 1/184 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MAA++G+KV G W SP  +RV+WALR+KG++YEY++ED+ NK+  L + NPV  KVPVLV
Sbjct  1    MAADKGVKVFGMWASPMAIRVEWALRLKGVDYEYVDEDLANKSEALLRHNPVTKKVPVLV  60

Query  222  HNGKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            H+GKPL ES +I+EYIDE WKH  P++P+DP++RA+ARFWA FAE K     +    + G
Sbjct  61   HDGKPLAESTVIVEYIDEAWKHGYPIMPSDPFDRAQARFWARFAEEKCNAALYPIFMTTG  120

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDS  578
            ++Q   V+ A + ++ LE  L GK+FFGG+  GYLD+V GW A+ LP+ EE   +++   
Sbjct  121  EEQRKLVHEAQQCLKTLETALEGKKFFGGDAFGYLDIVTGWFAYWLPVIEEACGVEVVTD  180

Query  579  QKFP  590
            +  P
Sbjct  181  EALP  184



>ref|XP_007223941.1| hypothetical protein PRUPE_ppa011108mg [Prunus persica]
 gb|EMJ25140.1| hypothetical protein PRUPE_ppa011108mg [Prunus persica]
Length=223

 Score =   191 bits (484),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 126/179 (70%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            + +K++G W SP  LRVKW L++K +EY+Y+EED+ NK+PLL   NPVH K+PVLVH+GK
Sbjct  4    DSVKLLGCWASPAALRVKWTLKLKEIEYQYVEEDLQNKSPLLLHYNPVHKKIPVLVHDGK  63

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYI+ETW  NP+LP DPYERA+ARFWA F E K       A   KG+++E 
Sbjct  64   PVAESLIILEYIEETWMQNPILPEDPYERAQARFWAKFVEEKCGPSIMSAFTKKGEEKEK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
                A E ++ LE+ L GKQFFGGE IG++D+  GW+     I EE+A + + D++  P
Sbjct  124  GAKEARENLKILESGLGGKQFFGGESIGFVDIAAGWIGLWARIVEEIAEVNLIDTETMP  182



>emb|CBI26438.3| unnamed protein product [Vitis vinifera]
Length=231

 Score =   191 bits (485),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 132/186 (71%), Gaps = 6/186 (3%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G W SPFV R++WAL+ KG+EYEY+EED+ NK+ LL   NPVH KVPVL+HNG
Sbjct  3    EEQVKLLGIWFSPFVRRIEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKVPVLLHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             P+ ESL+I+EYIDE WK NP+LP DP+ERA+ARFWA F E KI +    AL ++G+QQ+
Sbjct  63   NPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQK  122

Query  411  SAVNSameamekleaelNGK-----QFFGGEK-IGYLDLVVGWVAHNLPIFEEVASLKIF  572
              V    EAME LE E   K      FFGG+  +GY+D+V+GW+ + + + EEV   K+ 
Sbjct  123  KVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVIEEVGGFKVL  182

Query  573  DSQKFP  590
            D QK P
Sbjct  183  DPQKQP  188



>ref|XP_008240195.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=216

 Score =   190 bits (483),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 128/177 (72%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+G  +S F  R++WAL+ KG+ YEYIEED+ NK+PLL Q NPVH K+PVLVH  KP+
Sbjct  4    VKVIGASLSLFCCRIEWALKHKGIAYEYIEEDLRNKSPLLLQYNPVHKKIPVLVHGEKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESLLILEYIDETW  NP+LP DP+E+A ARFWA + + K +  AW A  +KG +QE A+
Sbjct  64   AESLLILEYIDETWTENPMLPEDPFEKAMARFWAKYVDEKCVISAWTASRTKGHEQEKAL  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             SA E+++ L   + GK+FFGGE +G+LD  VG + + L   EE   +K+FD+++ P
Sbjct  124  ESAQESLQLLNKLIEGKKFFGGETMGFLDFAVGSLPNWLKFLEEFQGIKLFDTKELP  180



>ref|XP_006420236.1| hypothetical protein CICLE_v10005779mg [Citrus clementina]
 gb|ESR33476.1| hypothetical protein CICLE_v10005779mg [Citrus clementina]
Length=227

 Score =   191 bits (484),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 136/178 (76%), Gaps = 8/178 (4%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+GFW SPFV RV WAL++KG+E+EYIEED+ NK+  L +LNPVH KVPVLVH+ K +
Sbjct  5    VKVLGFWCSPFVFRVVWALKLKGVEFEYIEEDVFNKSTRLLELNPVHKKVPVLVHDDKVI  64

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES +ILEYIDETW  +PLLP DPYE+A ARFWA FA+ K       +  +KG+++E A+
Sbjct  65   VESFVILEYIDETWPQDPLLPQDPYEKATARFWAKFADEK-------STWTKGEEKEDAL  117

Query  420  NSameamekleaelNGKQFFGGE-KIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             + MEA+EK+E EL GK +FGGE K  YL++ +GW+ + LPI+EE+AS++  D ++FP
Sbjct  118  KATMEALEKIEGELKGKSYFGGENKYAYLEIAIGWINYLLPIWEEIASIQFLDPKRFP  175



>emb|CAN73419.1| hypothetical protein VITISV_027346 [Vitis vinifera]
Length=236

 Score =   191 bits (485),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 131/186 (70%), Gaps = 6/186 (3%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G W SPFV R++WAL+ KG+EYEY+EED+ NK+ LL   NPVH KVPVL+HNG
Sbjct  8    EEQVKLLGIWFSPFVRRIEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHXKVPVLLHNG  67

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             P+ ESL+I+EYIDE WK NP+LP DP+ERA+ARFWA F E KI +    AL ++G+QQ 
Sbjct  68   NPIVESLVIIEYIDENWKQNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGEQQX  127

Query  411  SAVNSameamekleaelNGK-----QFFGGEK-IGYLDLVVGWVAHNLPIFEEVASLKIF  572
              V    EAME LE E   K      FFGG+  +GY+D+V+GW+ + + + EEV   K+ 
Sbjct  128  KVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVIEEVGGFKVL  187

Query  573  DSQKFP  590
            D QK P
Sbjct  188  DPQKQP  193



>ref|XP_003532764.1| PREDICTED: probable glutathione S-transferase [Glycine max]
 gb|KHN48019.1| Putative glutathione S-transferase [Glycine soja]
 gb|AJE59668.1| tau class glutathione S-transferase [Glycine max]
Length=226

 Score =   191 bits (484),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 134/183 (73%), Gaps = 2/183 (1%)
 Frame = +3

Query  39   IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVL  218
            +M ++  +K++ F +SP   RV+WAL++KG+E+EY+EEDI NK+ LL +LNPVH KVPVL
Sbjct  1    MMGSKNDVKLLSFLLSPVGHRVEWALKLKGVEFEYVEEDIFNKSNLLLELNPVHKKVPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            VH+ KP+ ESL+I+EYID+TWK +PLLP  PY+RA ARFW   A+ K++  ++ A+CS G
Sbjct  61   VHHQKPIAESLIIVEYIDQTWKQHPLLPQHPYQRALARFWGTVAD-KLVKTSYVAMCSSG  119

Query  399  KQQESAVN-SameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
             +QE +V  +     +  E  + GK+FFGG+ IGYLDL  GW+ + LPI+EEV S++I D
Sbjct  120  DEQEKSVKEAKEVMDKIEEEIIKGKKFFGGDNIGYLDLAFGWIPYWLPIWEEVGSMQIVD  179

Query  576  SQK  584
              K
Sbjct  180  PLK  182



>ref|XP_010097693.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB70648.1| putative glutathione S-transferase [Morus notabilis]
Length=227

 Score =   191 bits (484),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 135/181 (75%), Gaps = 0/181 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
             +E +K+   W SP+ LR+ WAL++KG+EYE I E++ +K+ LL   NP+H KVPVLVHN
Sbjct  2    GDEEVKLFRTWSSPYALRIVWALKLKGVEYETIYEEVSHKSDLLIGYNPIHKKVPVLVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKP+ ESL+ILEYIDETWK +PLL   P++RA ARFWA F + K+L   WEA   +GK+Q
Sbjct  62   GKPIAESLVILEYIDETWKQHPLLSDQPHQRALARFWAKFGDEKVLPAIWEAFTKQGKEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E A+++A+E ++ LE EL GK+ FGGE+IG +D+ +GW+A+ + +FEE+  LK+   +KF
Sbjct  122  EEALSTAVENLKYLEEELKGKKLFGGEEIGLVDIALGWLANLVSVFEEITGLKLIPEEKF  181

Query  588  P  590
            P
Sbjct  182  P  182



>ref|XP_011000484.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=223

 Score =   191 bits (484),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 130/179 (73%), Gaps = 1/179 (1%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKP  236
             +K++G + S F  RV+WAL++KG++YEY+E+D+ NK+PLL + NPVH KVPVLVH+ KP
Sbjct  4    AVKLIGSYTSLFCTRVEWALKLKGVQYEYVEDDVFNKSPLLLEHNPVHKKVPVLVHDDKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            +PESL+IL+YIDETW  N LLP D YER  A FWA F + K L   + A   +G+++E A
Sbjct  64   IPESLIILQYIDETWNDNNLLPQDSYERTMAHFWAKFTDEKCLMETFTAAYKEGEEKEKA  123

Query  417  VNSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            + SA E++  LE  + GK+FF G +KIGYLDL +GW+   L I EEV  +K+ D++KFP
Sbjct  124  IESAQESLAFLEKLIQGKKFFSGDDKIGYLDLAMGWIPLCLDIIEEVGGMKLVDAEKFP  182



>ref|XP_002322571.1| hypothetical protein POPTR_0016s02370g [Populus trichocarpa]
 gb|EEF04332.1| hypothetical protein POPTR_0016s02370g [Populus trichocarpa]
 gb|ADB11390.1| tau class glutathione transferase GSTU24 [Populus trichocarpa]
Length=225

 Score =   190 bits (483),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV   W S F LRV WAL++KG+E++ I ED+ NK+PLL Q NP+H KVPVLVHNGK
Sbjct  3    EEVKVFRTWSSRFALRVIWALKLKGVEFDTIYEDLSNKSPLLLQYNPIHKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
             + ESL+ILEYIDETWK NPLLP DP+++A ARFWA F + K+L    W  L  +GK+ E
Sbjct  63   VICESLVILEYIDETWKQNPLLPEDPHQQANARFWAKFGDDKVLQSIVWGVLMKEGKELE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              V +++E ++ LE E+ GK+FFGGE IG  D+ +GW+A+ L I EE+  LK+ D +KFP
Sbjct  123  EGVLASLENLKYLEEEIRGKKFFGGETIGLADIALGWLAYYLDIIEEILGLKLIDQEKFP  182



>ref|XP_009335025.1| PREDICTED: probable glutathione S-transferase isoform X2 [Pyrus 
x bretschneideri]
Length=219

 Score =   190 bits (482),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 131/177 (74%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NPVH KVPVL+HNG  +
Sbjct  4    VKLLRTWSSPFPLRIVWALQLKGVPYETIYEDLSNKSPLLLQSNPVHKKVPVLLHNGNAV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP +RA ARFWA + + K+    WE+   +GK+QE  +
Sbjct  64   VESLIILEYVDETWKENPLLPEDPLDRATARFWARYIDDKVSPSIWESFTKEGKEQEEGI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A E ++ LE EL GK+FFGGEK+G++D+ +GW+A+   +FE++A +K+   ++FP
Sbjct  124  VKAKENLKYLEEELKGKKFFGGEKVGFVDIALGWLAYYESLFEDIAGMKVVTKEEFP  180



>ref|XP_002268774.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
 emb|CBI26443.3| unnamed protein product [Vitis vinifera]
Length=236

 Score =   191 bits (484),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 131/185 (71%), Gaps = 5/185 (3%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++G W SPFV RV+WAL+ KG+EYEY+EED++NK+ LL   NPV+ KVPVL+HNG
Sbjct  9    EEQVKLLGSWYSPFVKRVEWALKFKGIEYEYVEEDLINKSSLLLTSNPVYKKVPVLLHNG  68

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             P+ ++L+I+EYIDETWKHNP+LP DP+ERA+ARFWA F E K+ D    AL ++G+QQE
Sbjct  69   NPIAQTLVIIEYIDETWKHNPILPQDPHERAKARFWADFIEVKLTDVVRTALITQGEQQE  128

Query  411  SAVNSameamek----leaelNGKQFFGGEK-IGYLDLVVGWVAHNLPIFEEVASLKIFD  575
             AV  A EAME            + FFGG   IGY+D+V+G +   + + EEV   K+ D
Sbjct  129  KAVKEAKEAMEVLEGEAAKLKGERVFFGGNNGIGYVDIVLGLMCGWVEVIEEVGGFKLLD  188

Query  576  SQKFP  590
             QK P
Sbjct  189  PQKQP  193



>ref|XP_002318530.2| hypothetical protein POPTR_0012s04770g [Populus trichocarpa]
 gb|EEE96750.2| hypothetical protein POPTR_0012s04770g [Populus trichocarpa]
Length=225

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 133/178 (75%), Gaps = 1/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+G   S F  RV+WAL++KG+EYEY++ED+ NK+ LL + NPVH KVPVLVH+ KP+
Sbjct  4    VKVIGSSKSLFCARVEWALKLKGVEYEYLQEDLWNKSTLLLKHNPVHKKVPVLVHDDKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK  PLLP DPYERA ARFWA FA+ K L  A+ A   +G+++E A+
Sbjct  64   AESLVILEYIDETWKDYPLLPEDPYERAMARFWAKFADEKCLMGAFAAFWKEGEEKEKAI  123

Query  420  NSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             SA+E+   LE ++ GK+FF G + IGYLDLV+GW+   L + EE   +K+ D+QKFP
Sbjct  124  ESALESFTFLEKQIQGKKFFSGDDNIGYLDLVMGWIPLWLNVMEEAGGMKLMDAQKFP  181



>gb|KDO66687.1| hypothetical protein CISIN_1g041211mg [Citrus sinensis]
Length=222

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 130/179 (73%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G WVSPF  R++ AL++KG+ +EY+EED+ NK+P L + NPVH K+PVLVHNGK
Sbjct  3    EEVKLYGTWVSPFSRRIELALKLKGVPFEYMEEDLSNKSPELLKYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK+NP+LP DPY+RA  RFWA F + KIL   W+A   +GK++E 
Sbjct  63   PIAESLVILEYIDETWKNNPILPQDPYQRAMVRFWAKFIDEKILATGWKANFGEGKEREV  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+    E M+ LE ELNGK FF GE IG+LD+V   +A   P+ ++   ++ F  +KFP
Sbjct  123  AIEEFAEQMKFLENELNGKDFFEGETIGFLDIVANLIAFWFPVRQDALGIEAFTQEKFP  181



>ref|XP_009790678.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana sylvestris]
Length=224

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 126/179 (70%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+   W SPF LR  WAL +KG++Y+ I ED+  K+P L Q NPVH K+PVLVH GK
Sbjct  3    EELKLHRTWSSPFGLRAVWALHIKGIQYDTIYEDLSQKSPELLQHNPVHKKIPVLVHKGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK  PLLP DPYE+A  RFWA F E K+L   W     +G ++  
Sbjct  63   PICESLVILEYIDETWKEAPLLPQDPYEKATVRFWAKFGEEKLLPSIWSVFTGQGNEKNE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+  A++ +E  E +L  K+FFGGE+IGYLDL +GW+A+ L +FEEV  LK+FD+ K P
Sbjct  123  ALGPAVQNLELFEEQLKEKKFFGGEEIGYLDLSLGWLAYLLDVFEEVIDLKLFDAAKLP  181



>ref|XP_007029835.1| Glutathione S-transferase TAU 8 [Theobroma cacao]
 gb|EOY10337.1| Glutathione S-transferase TAU 8 [Theobroma cacao]
Length=252

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = +3

Query  30   TVVIMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKV  209
             V I  +   +K+   W + F  RV WAL++KG++YE I+ED+ NK+ LL Q NPV+ KV
Sbjct  27   VVEIANSMAEVKLFKTWSTQFGARVVWALKLKGIQYEAIDEDLSNKSALLLQYNPVYKKV  86

Query  210  PVLVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALC  389
            PVLVHNGKP+ ESL+ILEYI+ETWK NP+LP DP  +A ARFWA F + K+L   W A  
Sbjct  87   PVLVHNGKPISESLVILEYIEETWKQNPILPEDPLGKANARFWAKFNDEKLLPSIWSAFT  146

Query  390  SKGKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKI  569
             +GK++E A+ + +E+++ +E EL GK+FFGGEKIG  DLV GW+A+  P+FEEVA LKI
Sbjct  147  KEGKEREEAMGAVLESLKFVEEELKGKKFFGGEKIGLADLVFGWLANLAPVFEEVAGLKI  206

Query  570  FDSQKFP  590
             D +++P
Sbjct  207  LD-ERYP  212



>dbj|BAK02670.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=222

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+KV G W SP V+RV+WALR+KG+ YEY++ED+ +K+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVFGMWASPMVIRVEWALRLKGVVYEYVDEDLASKSDALLRRNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ES +I+EYIDE WK   P++PADP++RA+ARFWA FA+ K     +    + GK 
Sbjct  62   GKPIVESTIIVEYIDEAWKDGYPIMPADPHDRAQARFWARFADDKCNAAIYPVFTATGKA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
            Q   V  A   ++ LE  L GK+FFGG+ IGYLD+VVGW A+ LP+ EEV+   I   ++
Sbjct  122  QREVVREAQRCLKTLETALEGKKFFGGDAIGYLDVVVGWYAYWLPVIEEVSGASIVTDEE  181

Query  585  FP  590
             P
Sbjct  182  LP  183



>ref|NP_001234091.1| uncharacterized protein LOC543816 [Solanum lycopersicum]
 gb|AAG16759.1| putative glutathione S-transferase T4 [Solanum lycopersicum]
Length=226

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 131/179 (73%), Gaps = 2/179 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F  RV+WAL++KG++YEYI+ED+LNK+ LL + NPVH K+PVL+H+ KP+
Sbjct  4    VKLIGSSGSLFCTRVEWALKLKGVDYEYIQEDLLNKSELLIKSNPVHKKIPVLLHDDKPV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALC--SKGKQQES  413
             ESLLILEYIDETWK  PLLP DP+ERA ARFWA F + K +  +WEA+    +G+ +  
Sbjct  64   VESLLILEYIDETWKGYPLLPQDPHERATARFWAKFVDDKCVIGSWEAMAMQDEGEAKTK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+ S  E    +E ++ GK+FFGGE+IGYLDLV+GW    L   EEV ++K+ D +KFP
Sbjct  124  AIESIQELYAFIEKQIEGKKFFGGEQIGYLDLVMGWKTLWLSAMEEVGNVKLLDPEKFP  182



>gb|AFK35732.1| unknown [Lotus japonicus]
Length=222

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 136/184 (74%), Gaps = 2/184 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M ++E ++++ F +SP   RV+WAL++KG+++EY+EEDI NK+ LL ++NPVH KVPVLV
Sbjct  1    MGSQE-VQLLNFLLSPVGRRVEWALKLKGVDFEYVEEDIFNKSNLLLEMNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALC-SKG  398
            H  KP+ ESL+ILEYIDE WK  PLLP  PYERA ARFWA  A+ K+   +W AL  S G
Sbjct  60   HGHKPIAESLIILEYIDEIWKQYPLLPLHPYERAHARFWANLADEKLALGSWVALMRSSG  119

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDS  578
             +QE  V    E MEKLE E+ GK+FFGG+ IGYLDLV+GW+   LP++EEV S+++ D+
Sbjct  120  DEQEKRVKEVREVMEKLEEEILGKKFFGGDNIGYLDLVLGWIPCWLPVWEEVGSMQVLDT  179

Query  579  QKFP  590
             K P
Sbjct  180  NKCP  183



>gb|AFK34634.1| unknown [Lotus japonicus]
Length=222

 Score =   188 bits (477),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 136/184 (74%), Gaps = 2/184 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M ++E ++++ F +SP   RV+WAL++KG+++EY+EEDI NK+ LL ++NPVH KVPVLV
Sbjct  1    MGSQE-VQLLNFLLSPVGRRVEWALKLKGVDFEYVEEDIFNKSNLLLEMNPVHKKVPVLV  59

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALC-SKG  398
            H  KP+ ESL+ILEYIDE WK  PLLP  PYERA ARFWA  A+ K+   +W AL  S G
Sbjct  60   HGHKPIVESLIILEYIDEIWKQYPLLPLHPYERAHARFWANLADEKLALGSWVALMRSSG  119

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDS  578
             +QE  V    E MEKLE E+ GK+FFGG+ IGYLDLV+GW+   LP++EEV S+++ D+
Sbjct  120  DEQEKRVKEVREVMEKLEEEILGKKFFGGDNIGYLDLVLGWIPCWLPVWEEVGSMQVLDT  179

Query  579  QKFP  590
             K P
Sbjct  180  NKCP  183



>gb|KJB76665.1| hypothetical protein B456_012G099100 [Gossypium raimondii]
Length=220

 Score =   188 bits (477),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 126/172 (73%), Gaps = 0/172 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W S F LRV WAL++KG+ YE I+ED+ NK+ LL Q NPVH K+PVLVHNG 
Sbjct  3    EEVKLLKTWSSRFGLRVVWALKLKGIPYEAIDEDLSNKSALLLQYNPVHKKIPVLVHNGN  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK NP+LP DP  RAR RFWA F++ K+L   W A   +GK +E 
Sbjct  63   PISESLVILEYIDETWKQNPILPQDPLHRARERFWAKFSDEKLLPSVWGAFTKEGKDREE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKI  569
            A+ + ME ++ +E EL GK+FF GEKIG +DLV GW+A+ + IFEEV+   I
Sbjct  123  AMAATMENLKFVEEELKGKKFFSGEKIGLVDLVFGWLANLISIFEEVSGFNI  174



>gb|AAG34831.1|AF244688_1 glutathione S-transferase GST 23, partial [Zea mays]
Length=214

 Score =   187 bits (476),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 125/175 (71%), Gaps = 1/175 (1%)
 Frame = +3

Query  69   VGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPLPES  248
            +G W SP V+RV+WALR+KG+EYEY++ED+ NK+  L + NPV  KVPVLVH+GKP+ ES
Sbjct  1    LGMWASPMVIRVEWALRLKGVEYEYVDEDLANKSADLLRHNPVTKKVPVLVHDGKPVAES  60

Query  249  LLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAVNS  425
             +I+EYIDE WK   P++P DPYERA+ARFWA FAE K     +    + G+ Q  AV+ 
Sbjct  61   TIIVEYIDEVWKGGYPIMPGDPYERAQARFWARFAEDKCNAALYPIFTATGEAQRKAVHE  120

Query  426  ameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A + ++ LE  L+GK+FFGG+ +GYLD+VVGW AH LP+ EEV    +   ++ P
Sbjct  121  AQQCLKTLETALDGKKFFGGDAVGYLDIVVGWFAHWLPVIEEVTGASVVTDEELP  175



>ref|XP_004307163.2| PREDICTED: probable glutathione S-transferase [Fragaria vesca 
subsp. vesca]
Length=256

 Score =   189 bits (479),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 131/185 (71%), Gaps = 0/185 (0%)
 Frame = +3

Query  36   VIMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPV  215
            +I      +K+   W S F LR+ WAL++K + Y+ I ED+ NK+PLL Q NP+H K+PV
Sbjct  26   LIQTKMAEVKLFSTWSSAFSLRIVWALKLKDVPYDTIFEDLSNKSPLLLQYNPIHKKIPV  85

Query  216  LVHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK  395
            LVHNGK + ESL+ILEYI+ETWK NPLLP DP++RA ARFWA F + K+  P  +A  S+
Sbjct  86   LVHNGKSIAESLVILEYIEETWKQNPLLPEDPHDRAAARFWAKFGDDKVFPPIVDAFYSE  145

Query  396  GKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
            GK+QE A+  A E ++ LE EL GK FFGG++IG+ D+ +GW+AH L + EE+A++ +  
Sbjct  146  GKEQEEAIVKAKENLKYLEEELKGKNFFGGDQIGFADIALGWLAHYLKVLEEIANMNLIA  205

Query  576  SQKFP  590
              +FP
Sbjct  206  EDEFP  210



>gb|EYU26814.1| hypothetical protein MIMGU_mgv1a013348mg [Erythranthe guttata]
Length=223

 Score =   187 bits (476),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 126/181 (70%), Gaps = 0/181 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AEE +K+   W SPF +RV  AL++KGL+YE I ED+ NK+  L   NP+H K+PV VHN
Sbjct  2    AEEEMKLFRSWSSPFGMRVVHALKIKGLQYETILEDLSNKSASLLNYNPIHKKIPVFVHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            G P+ ESL+ILEYIDETW  +PLLP DPY ++ ARFWA F + K++   W    S+G  +
Sbjct  62   GNPICESLVILEYIDETWTQSPLLPQDPYAKSTARFWAKFGDDKVMPSIWSVFTSQGDAR  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E A+  A   +E LE E+ GK+FFGGE IGY+DL  GW+A+ + I EE+  LK+ D++KF
Sbjct  122  EEAIVQAKTNLEFLEEEIKGKKFFGGEAIGYVDLAFGWMANLIGILEEIIDLKLVDAEKF  181

Query  588  P  590
            P
Sbjct  182  P  182



>ref|XP_006437357.1| hypothetical protein CICLE_v10032696mg [Citrus clementina]
 ref|XP_006484734.1| PREDICTED: glutathione transferase GST 23-like [Citrus sinensis]
 gb|ESR50597.1| hypothetical protein CICLE_v10032696mg [Citrus clementina]
Length=222

 Score =   187 bits (476),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 126/177 (71%), Gaps = 1/177 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W S F LRV WAL++KG++++ IEED+ NK+PLL Q NPV+ K+PVLVHNG+ +
Sbjct  4    VKLLKTWSSHFALRVVWALKLKGVQFDSIEEDLSNKSPLLLQHNPVYKKIPVLVHNGRAI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK  PLLP DPYE ARARFWA F++ K+    W     +GK+QE A 
Sbjct  64   SESLVILEYIDETWKQYPLLPDDPYESARARFWAKFSDDKVFPSIWGVFIKQGKEQEEAF  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
                E    LE EL GK+FFGGEKIGY DL +GW+A  +   EE+  +K+ + +KFP
Sbjct  124  AQVFENFSFLEEELKGKKFFGGEKIGYADLALGWIAERVFELEEIG-VKVIEKEKFP  179



>ref|XP_007209589.1| hypothetical protein PRUPE_ppa011268mg [Prunus persica]
 gb|EMJ10788.1| hypothetical protein PRUPE_ppa011268mg [Prunus persica]
Length=216

 Score =   187 bits (475),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 128/177 (72%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+G  +S F  +++WAL+ KG+ YEYIEED+ NK+PLL Q NPVH K+PVLVH  KP+
Sbjct  4    VKVIGASLSLFCCKIEWALKHKGIAYEYIEEDLRNKSPLLLQYNPVHKKIPVLVHGEKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETW  NP+LP DP+E+A ARFWA + + K +  AW A  +KG +QE A+
Sbjct  64   AESLIILEYIDETWTENPMLPEDPFEKAMARFWARYVDEKCVISAWTASRTKGHEQEKAL  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             SA E+++ L   + G +FFGGE +G+LD VVG + + L   EE   +K+FD+++ P
Sbjct  124  ESAQESLQLLNKLIEGNKFFGGETMGFLDFVVGSLPNWLKFLEEFQGIKLFDTKELP  180



>ref|XP_009335024.1| PREDICTED: probable glutathione S-transferase isoform X1 [Pyrus 
x bretschneideri]
Length=219

 Score =   187 bits (476),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 130/177 (73%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W S F LR+ WAL++KG+ YE I ED+ NK+PLL Q NPVH KVPVL+HNG  +
Sbjct  4    VKLLRTWSSRFGLRIVWALQLKGIPYETIYEDLSNKSPLLLQSNPVHKKVPVLLHNGNAV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP +RA ARFWA + + K+    WE+   +GK+QE  +
Sbjct  64   VESLIILEYVDETWKENPLLPEDPLDRATARFWARYIDDKVSPSIWESFTKEGKEQEEGI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A E ++ LE EL GK+FFGGEK+G++D+ +GW+A+   +FE++A +K+   ++FP
Sbjct  124  VKAKENLKYLEEELKGKKFFGGEKVGFVDIALGWLAYYESLFEDIAGMKVVTKEEFP  180



>ref|NP_001237698.1| glutathione S-transferase GST 20 [Glycine max]
 gb|AAG34810.1|AF243375_1 glutathione S-transferase GST 20 [Glycine max]
 gb|KHN06424.1| Glutathione transferase GST 23 [Glycine soja]
 gb|AJE59655.1| tau class glutathione S-transferase [Glycine max]
Length=224

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 134/186 (72%), Gaps = 4/186 (2%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M +EE +K++ FWVSPF  R++WAL++KG+EYEYIEEDI NK+ LL +LNPVH KVPVLV
Sbjct  1    MGSEE-VKLLSFWVSPFGKRIEWALKLKGVEYEYIEEDIFNKSSLLLELNPVHKKVPVLV  59

Query  222  HNGKP-LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCS--  392
            H  K  + ES +ILEYIDE WK   LLP  PY+RA ARFWA  AE       W AL S  
Sbjct  60   HAEKSIIAESFIILEYIDEKWKQYSLLPHHPYQRALARFWAATAEEMFRKVVWIALRSPT  119

Query  393  KGKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIF  572
             G ++E A+  + E ME++E E+ GK++FGG+ IGYLD+ +GW+++ LP+ EEV S++I 
Sbjct  120  SGDEREKALKESREVMERIEEEIRGKKYFGGDNIGYLDIALGWISYWLPVLEEVGSMQII  179

Query  573  DSQKFP  590
            D  KFP
Sbjct  180  DPLKFP  185



>ref|XP_006354565.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Solanum 
tuberosum]
Length=225

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 126/179 (70%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SP  LRV WAL++KG+EY+Y EED+ NK+PLL Q NPVH K+PVLVHNGK
Sbjct  4    EKVKLLGNWASPSALRVHWALKLKGIEYDYQEEDLRNKSPLLLQYNPVHKKIPVLVHNGK  63

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYI+ETWKHNPLLP DPYERA+ARFWA F + K +   +      G++Q+ 
Sbjct  64   PIAESLVILEYIEETWKHNPLLPEDPYERAKARFWAKFVDDKCVPGIFGTFVKVGEEQQK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
                A E ++ LE EL  K FFG  KIG++D+   W+     I EE+  +K+ D+++ P
Sbjct  124  IAKEARENLKILEGELGKKHFFGDTKIGFMDVASAWIICWAQIVEEIVDIKLIDAEEMP  182



>ref|XP_006660720.1| PREDICTED: glutathione transferase GST 23-like [Oryza brachyantha]
Length=222

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 124/182 (68%), Gaps = 1/182 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            A++G+KV G W SP  +R +WALR+KG++YEYI+ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    ADKGVKVFGMWASPMAIRAEWALRLKGVDYEYIDEDLANKSEALLRYNPVTEKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKPL ES +I+EYIDE WK   P++PADP+ERA+ARFWA FAE K     +    + G+ 
Sbjct  62   GKPLAESTVIVEYIDEAWKDGYPIMPADPFERAQARFWARFAEEKCNAALYPIFMTTGEA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
            Q   V  A + ++ LE  L GK FFGG+  GYLD+V GW A+ LPI EEV  + I   + 
Sbjct  122  QSKLVQEAQQCLKTLETALEGKTFFGGDAFGYLDIVTGWYAYWLPIIEEVTGVAIVTDEA  181

Query  585  FP  590
             P
Sbjct  182  LP  183



>ref|XP_008363399.1| PREDICTED: glutathione transferase GST 23-like [Malus domestica]
 ref|XP_008364890.1| PREDICTED: glutathione transferase GST 23-like [Malus domestica]
Length=216

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 130/177 (73%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+G  +S F  R++WAL+ KG+ YEYIEED+ NK+ LL + NPVH KVPVLVH  KP+
Sbjct  4    VKVIGASLSLFCCRIEWALKHKGIAYEYIEEDLRNKSHLLLRYNPVHKKVPVLVHGEKPV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETW+ NPLLP DP+E+A ARFWA + + K +  AW A  +KG +QE ++
Sbjct  64   AESLVILEYIDETWRENPLLPEDPFEKAXARFWAKYVDEKCVISAWTASRTKGHEQEKSL  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             +A E++E L   + GK+FFGGE IG+LDLVVG + + L   EE   +K+FD+++ P
Sbjct  124  EAARESLEVLNKLIEGKKFFGGEIIGFLDLVVGTLPNWLKFLEESEGIKLFDTKELP  180



>ref|XP_009778650.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana sylvestris]
Length=225

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 127/179 (71%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            EG+K++G W SPF LRV WAL++KG+EY+Y EED+ NK+PLL Q NPVH K+PVLVHNGK
Sbjct  4    EGVKLLGHWASPFALRVHWALKLKGVEYDYQEEDLPNKSPLLLQYNPVHKKIPVLVHNGK  63

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ES +ILEYIDETWK NPLLP DPYERA+ARFWA F + K +   +      G++Q+ 
Sbjct  64   PIAESSVILEYIDETWKKNPLLPEDPYERAKARFWAKFIDDKCVPGIFRTFSKVGEEQQK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
                A E ++ LE EL+ K+ FG  +IG++D+   W+     I EE+  +K+ D+++ P
Sbjct  124  IAKEARENLKLLEGELDKKRVFGDSRIGFIDVASAWIICWAQIVEEIVDIKLIDAEEMP  182



>gb|KJB80746.1| hypothetical protein B456_013G113600 [Gossypium raimondii]
Length=226

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 130/185 (70%), Gaps = 1/185 (1%)
 Frame = +3

Query  39   IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVL  218
            +  A E LKV+G   S F  RV WAL++KG+EYE+IEED+++K+ LL  LNPVH KVPVL
Sbjct  1    MAGAAEDLKVLGTKQSMFTQRVVWALKLKGVEYEFIEEDLVHKSSLLLALNPVHKKVPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            VH+GKP+ ES +ILEY+DETWK  PLLP DP ERA  RFWA F + K+++ + +A  S G
Sbjct  61   VHDGKPIAESKIILEYLDETWKERPLLPEDPRERANVRFWAAFIDDKLMEASKKAFVSTG  120

Query  399  KQQESAVNSameamekleaelNGKQFFGG-EKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
              +  A+ S ME ++ LE EL GK++F G E IGY D+V GW+A+ L   EE+   K+ +
Sbjct  121  DDRAKAMESTMEGLKLLEQELQGKKYFSGDEGIGYFDIVAGWIAYWLQFIEEIGGFKVME  180

Query  576  SQKFP  590
            S KFP
Sbjct  181  STKFP  185



>emb|CDP11459.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 134/182 (74%), Gaps = 2/182 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            A EG+K++G+W SPF LRV+ AL++KG+EYEY EED+ NK+PLL Q NPV+ KVPVL+H 
Sbjct  2    AGEGVKLLGYWASPFALRVRSALKLKGIEYEYQEEDLGNKSPLLLQGNPVYKKVPVLLHK  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK-GKQ  404
            GK + ESL+ILEYIDE WKHNPLLP DPYERAR+RFWA F + K + PA   + +K G++
Sbjct  62   GKSISESLVILEYIDEVWKHNPLLPEDPYERARSRFWAKFVDEKCV-PALVGVITKVGEE  120

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
             E +   A E ++ LE+ L+GK+ FGG KIG+ D+ + W+A+ + + +E   +++ D Q 
Sbjct  121  LEKSAREAREHLKTLESGLDGKRCFGGTKIGFADVAIAWIAYWVRMEQEAFKIQLIDQQN  180

Query  585  FP  590
             P
Sbjct  181  MP  182



>ref|XP_003578262.1| PREDICTED: glutathione transferase GST 23-like isoform X2 [Brachypodium 
distachyon]
Length=222

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+KV G W SP  +R++WALR+K + YEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVFGMWASPMAIRLEWALRLKSVVYEYVDEDLGNKSDALLRYNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ES +I+EYIDE WK   P++PADPYERA+ARFWA FA+ K     +    + G+ 
Sbjct  62   GKPVVESAIIVEYIDEAWKDGYPIMPADPYERAQARFWANFADEKCNAAVYPVFTATGEA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
            Q   V+ A + ++ LE  L GK+FFGG+ +GYLDLVVGW A+ LPI EEV+   +   ++
Sbjct  122  QGKVVHEAQQCLKTLEKALEGKKFFGGDAVGYLDLVVGWYAYWLPIIEEVSGASVVTDEE  181

Query  585  FP  590
             P
Sbjct  182  LP  183



>gb|EMT19525.1| hypothetical protein F775_31981 [Aegilops tauschii]
Length=221

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+KV G W SP  +RV+WALR+KG+ YEY++ED+ +K+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVFGMWASPMAIRVEWALRLKGVGYEYVDEDLASKSDALLRHNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ES +I+EYIDE WK   P++PADPY+RA+ARFWA FA+ K     +    + G+ 
Sbjct  62   GKPIAESTIIVEYIDEAWKDGYPIMPADPYDRAQARFWARFADDKCNAAIFPVFTATGEA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
            Q   V  A   ++ LE  L GK+FFGG+ +GYLD+VVGW A+ LPI EEV+   +   ++
Sbjct  122  QREVVREAQRCLKTLEKALEGKKFFGGDAVGYLDVVVGWYAYWLPIIEEVSGADVVTDEE  181

Query  585  FP  590
             P
Sbjct  182  LP  183



>ref|XP_004299656.1| PREDICTED: probable glutathione S-transferase [Fragaria vesca 
subsp. vesca]
Length=227

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 130/179 (73%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W S F LR+ WAL++K + Y+ I ED+ NK+PLL Q NP+H  +PVLVHNGK
Sbjct  2    EEVKLFRTWTSSFSLRIVWALKLKDVPYDTIFEDLSNKSPLLLQYNPIHKAIPVLVHNGK  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYI+ETWK NPLLP DP++RA ARF A F + K++    +A+ S+GK+QE 
Sbjct  62   PIAESLVILEYIEETWKQNPLLPQDPHDRATARFLAKFGDDKVMPSIVDAVFSEGKEQEE  121

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+  A E +  LEAEL GK++FGGE+IG+ D+  GW+AH+L + EEV + K+    +FP
Sbjct  122  AIAKAKENLNYLEAELKGKKYFGGERIGFADIAQGWLAHSLKVLEEVTNTKLIVEDEFP  180



>ref|XP_004229525.1| PREDICTED: glutathione transferase GST 23-like [Solanum lycopersicum]
Length=223

 Score =   186 bits (471),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 131/185 (71%), Gaps = 4/185 (2%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MA E  +K+   W SPF LR+ WAL +KG+EYE I ED+  K+P L Q NPVH K+PVLV
Sbjct  1    MADE--VKLYRTWSSPFGLRIVWALHIKGIEYEAIFEDLSQKSPQLLQYNPVHKKIPVLV  58

Query  222  HNGKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            H GKP+ ESL+ILEYIDETWK   PLLP DPYE+A ARFWA F E K+L   W     +G
Sbjct  59   HKGKPICESLVILEYIDETWKETAPLLPQDPYEKAMARFWAKFVEDKLLPSVWSIFTEQG  118

Query  399  -KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
               ++ A   A++ +E +E +L  K+FFGGE IGY+DLV+GW+A+ L +FEEV  LK+FD
Sbjct  119  YDAKKEAFVPAVQNLEIIEEQLKEKKFFGGESIGYVDLVLGWMAYLLDVFEEVLDLKLFD  178

Query  576  SQKFP  590
            + KFP
Sbjct  179  ADKFP  183



>ref|XP_009343224.1| PREDICTED: probable glutathione S-transferase isoform X3 [Pyrus 
x bretschneideri]
Length=219

 Score =   186 bits (471),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 129/177 (73%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W S F LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H K+PVL+HNG  +
Sbjct  4    VKLLRTWSSAFGLRIVWALQLKGIPYETIYEDLSNKSPLLLQSNPIHKKIPVLLHNGNAV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP ERA ARFWA + + K+    WE+   +GK+QE  +
Sbjct  64   VESLIILEYVDETWKENPLLPEDPLERATARFWARYGDEKVSPSIWESFTKEGKEQEEGI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A E ++ LEAEL GK+FFGGEK+G++D+ +GW+ +   +FE++  +K+   ++FP
Sbjct  124  VKAKEKLKYLEAELKGKKFFGGEKVGFVDIALGWLTYYESLFEDITGMKVVTKEEFP  180



>ref|XP_009335026.1| PREDICTED: probable glutathione S-transferase isoform X3 [Pyrus 
x bretschneideri]
Length=218

 Score =   186 bits (471),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NPVH KVPVL+HNG  +
Sbjct  4    VKLLRTWSSPFPLRIVWALQLKGVPYETIYEDLSNKSPLLLQSNPVHKKVPVLLHNGNAI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP ERA ARFWA + + ++    WE+   +GK+QE  +
Sbjct  64   VESLIILEYVDETWKENPLLPEDPLERATARFWARYID-EVSPSIWESFTKEGKEQEEGI  122

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A E ++ LEAEL GK+FFGGEK+G++D+ +GW+ +   +FE+VA +K+   ++FP
Sbjct  123  VKAKEKLKYLEAELKGKKFFGGEKVGFVDIALGWLTYYESLFEDVAGMKVVTKEEFP  179



>gb|KJB19709.1| hypothetical protein B456_003G127600 [Gossypium raimondii]
Length=236

 Score =   186 bits (472),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 126/184 (68%), Gaps = 1/184 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M  +E +KV G W SP+  RV+ AL++KG+ YEYIEED+ NK+ LL Q NPVH K+PVLV
Sbjct  12   MGDDEEVKVFGMWASPYSRRVELALKLKGIPYEYIEEDLSNKSALLIQHNPVHQKIPVLV  71

Query  222  HNGKPLPESLLILEYIDETWKHNP-LLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            HNGK +PESL+ILEYIDETW++NP LL  DPY+RA ARFWA F + KIL    +   + G
Sbjct  72   HNGKSIPESLVILEYIDETWRNNPILLSQDPYDRAMARFWAKFIDEKILSTTRKVSFTTG  131

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDS  578
            K+QE A+    E ++ LE E+ GK +FGGE IGY+D+V  ++       +E   + IF  
Sbjct  132  KEQEHAIEEVTEQLKLLETEVKGKAYFGGEGIGYVDIVANFLVFWFGNLQEALGINIFSQ  191

Query  579  QKFP  590
             KFP
Sbjct  192  HKFP  195



>ref|XP_009343225.1| PREDICTED: probable glutathione S-transferase isoform X4 [Pyrus 
x bretschneideri]
Length=218

 Score =   185 bits (470),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NPVH KVPVL+HNG  +
Sbjct  4    VKLLSTWSSPFPLRIIWALQLKGVPYETIHEDLSNKSPLLLQSNPVHKKVPVLLHNGNAI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP ERA ARFWA + + ++    WE+   +GK+QE  +
Sbjct  64   VESLIILEYVDETWKENPLLPEDPLERATARFWARYID-EVSPSIWESFTKEGKEQEEGI  122

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A E ++ LEAEL GK+FFGGEK+G++D+ +GW+ +   +FE++  +K+   ++FP
Sbjct  123  VKAKEKLKYLEAELKGKKFFGGEKVGFVDIALGWLTYYESLFEDITGMKVVTKEEFP  179



>ref|XP_002277724.2| PREDICTED: glutathione transferase GST 23 [Vitis vinifera]
 emb|CBI32812.3| unnamed protein product [Vitis vinifera]
Length=227

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 127/186 (68%), Gaps = 9/186 (5%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            A E + ++G W SP  LR++WAL+ KG+ Y+ I+ED+LNK+  L   NP+H K+PVL+H 
Sbjct  2    AREEVTLLGMWASPLALRIEWALKCKGIWYKCIDEDLLNKSQRLLTHNPIHKKIPVLLHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEAL-----CS  392
            GK +PESL+ILEYIDETWK NPLLP DPYERA ARFWA F + K     W  +       
Sbjct  62   GKSIPESLVILEYIDETWKQNPLLPEDPYERAMARFWAKFVDEK----CWTTIPGVFGNE  117

Query  393  KGKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIF  572
            +G +QE +   A+E +  LE +L GK+FFGGE +G+LD+V GW+A+ LP  E++  LK+ 
Sbjct  118  RGDEQEKSKEKAIEELRILEKQLEGKKFFGGESVGFLDIVCGWIAYWLPFIEDITGLKLV  177

Query  573  DSQKFP  590
            D   FP
Sbjct  178  DETSFP  183



>ref|XP_006354571.1| PREDICTED: glutathione transferase GST 23-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006354572.1| PREDICTED: glutathione transferase GST 23-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006354573.1| PREDICTED: glutathione transferase GST 23-like isoform X4 [Solanum 
tuberosum]
Length=223

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 132/185 (71%), Gaps = 4/185 (2%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MA E  +K+   W SP+ LR+ WA+ +KG+EYE + ED+  K+P L Q NPVH K+PVLV
Sbjct  1    MADE--VKLYRTWSSPYGLRIVWAMHIKGIEYENVFEDLSQKSPQLLQYNPVHKKIPVLV  58

Query  222  HNGKPLPESLLILEYIDETWKH-NPLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            H GKP+ ESL+ILEYIDETWK   PLLP DPYE+A ARFWA F + K+L   W     KG
Sbjct  59   HKGKPICESLVILEYIDETWKETTPLLPQDPYEKAMARFWAKFVDDKLLPSVWSVFTEKG  118

Query  399  KQ-QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
             + ++ A+  A++ +E +E +L  K+FFGGE IGY+DL +GWVA+ L +FEEV  LK+FD
Sbjct  119  YEAKKEALVPAVQNLEIIEEQLKEKKFFGGESIGYVDLALGWVAYLLDVFEEVIDLKLFD  178

Query  576  SQKFP  590
            + KFP
Sbjct  179  AHKFP  183



>gb|KJB44380.1| hypothetical protein B456_007G249200 [Gossypium raimondii]
Length=220

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 123/172 (72%), Gaps = 0/172 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++  W S F LRV WAL++KG+ YE I+ED+ NK+ LL Q NPVH K+PVLVHNG 
Sbjct  3    EEVKLLKTWSSAFGLRVVWALKLKGIPYEAIDEDLSNKSALLLQYNPVHKKIPVLVHNGN  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK NP+LP DP  RAR RFWA F + K+L   W A   +GK +E 
Sbjct  63   PISESLVILEYIDETWKQNPILPQDPLHRARERFWAKFNDEKLLPSVWGAFTKEGKDREE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKI  569
            A+ + ME ++ +E EL GK+FF GEKIG +DLV GW+A+ + IFE V    I
Sbjct  123  AMAATMENLKFVEEELKGKKFFSGEKIGLVDLVFGWLANLISIFEAVTGFNI  174



>ref|XP_011010098.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV   W S F LRV WAL++KG+E++ I ED+ NK+PLL Q NP++ KVPVLVHNGK
Sbjct  3    EEVKVFRTWSSSFALRVIWALKLKGVEFDTIYEDLSNKSPLLLQYNPIYKKVPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDP-AWEALCSKGKQQE  410
             + ESL+ILEYIDETWK NPLLP DP+++A ARFWA F + K+L     + L  +GK+ E
Sbjct  63   VICESLVILEYIDETWKQNPLLPEDPHQQANARFWAKFGDDKVLQSIVGDVLMKEGKELE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              V +++E ++ LE E+ GK+FFGGE IG  D+ +GW+A+ L IFEE+  L + D +KFP
Sbjct  123  EGVLASLENLKYLEEEIRGKKFFGGETIGLADIALGWLAYYLGIFEEILGLILIDQEKFP  182



>gb|AFY26875.1| glutathione-S-transferase [Ipomoea batatas]
Length=224

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 131/179 (73%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G   S F  RV+WALR+KG++YEYI+ED+ NK+ LL + NPV+ KVPVL+ N  
Sbjct  2    EEVKLIGSSPSLFCTRVEWALRLKGVKYEYIKEDLRNKSDLLLKSNPVYKKVPVLLINHN  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
             + ESL+ILEYID++WKH PLLP DP+ERA+ARFWA FA+ K L   W A  ++G+++  
Sbjct  62   SIAESLIILEYIDDSWKHYPLLPQDPFERAQARFWAKFADDKCLMGTWTACMAEGEEKVR  121

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+ S  E+   +E ++ GK+FFGGE+IG+LDL +GW+   L + EEV  +K+ D +KFP
Sbjct  122  AIESVQESFAFIEKQIEGKKFFGGEEIGFLDLGIGWICLWLNVMEEVGGMKLLDPEKFP  180



>ref|XP_004978487.1| PREDICTED: glutathione transferase GST 23-like [Setaria italica]
Length=231

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 136/183 (74%), Gaps = 2/183 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
             ++ +K+ GFW SP+VL+V WALR+KG+EY+YIEED+ NK+  L + NPVH KVPVLV+ 
Sbjct  7    GDKQVKLFGFWPSPYVLKVIWALRIKGVEYDYIEEDLSNKSDQLLEYNPVHKKVPVLVYQ  66

Query  228  GKPLPESLLILEYIDETWKH--NPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            GKP+ ES +I+++IDE WK   +P+LP DPYERA ARFW  F + K+  P W+   ++G+
Sbjct  67   GKPIAESEVIIQFIDEAWKDRGDPILPEDPYERAMARFWVRFLQDKLSPPIWKWFTTQGQ  126

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            QQE A  +A++ +  LE EL+GK+FF GEKIG++DL +G +++ +PI+EE+  +K+   +
Sbjct  127  QQEDAHGAAIDQLLVLEKELDGKRFFAGEKIGFVDLSLGPLSYVIPIYEEITGVKMITEE  186

Query  582  KFP  590
            K P
Sbjct  187  KLP  189



>ref|XP_004229524.1| PREDICTED: glutathione transferase GST 23-like [Solanum lycopersicum]
 ref|XP_010323325.1| PREDICTED: glutathione transferase GST 23-like [Solanum lycopersicum]
Length=223

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 132/185 (71%), Gaps = 4/185 (2%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MA E  +K+   W SP+ LRV WAL +KG+EYE I ED+  K+P L Q NPVH K+PVLV
Sbjct  1    MADE--VKIYRNWSSPYGLRVVWALDIKGIEYENIFEDLSQKSPQLLQYNPVHKKIPVLV  58

Query  222  HNGKPLPESLLILEYIDETWKH-NPLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            H GKP+ ESL+ILEYIDETWK   PLLP DPYE+A ARFWA F + K+L   W     K 
Sbjct  59   HKGKPICESLVILEYIDETWKETTPLLPKDPYEKAIARFWAKFVDDKLLPSIWSVFTEKR  118

Query  399  KQ-QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
             + ++ A+  AM+ +E +E +L GK+FFGGE IGY+DL +GW+A+ L +FEEV  LK+FD
Sbjct  119  YEAKKEALVPAMQNLEFIEEQLKGKKFFGGESIGYVDLALGWMAYLLDVFEEVLDLKLFD  178

Query  576  SQKFP  590
            + KFP
Sbjct  179  ADKFP  183



>ref|XP_009606213.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana tomentosiformis]
Length=224

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 127/179 (71%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+   W SPF LR  WAL +KG++YE I ED+  K+P L Q NPVH K+PVLVH GK
Sbjct  3    EELKLHRTWSSPFGLRAVWALHIKGIQYETIFEDLSQKSPELLQHNPVHKKIPVLVHKGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK  PLLP DPYE+A ARFWA F E K+L   W     +G ++  
Sbjct  63   PICESLVILEYIDETWKEAPLLPQDPYEKAIARFWAKFGEDKLLPSIWSVFTGQGNEKNE  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+  A++ +E LE +L  K+FFGGEKIGYLDL +G +A+   +FEEV  LK+FD+ KFP
Sbjct  123  ALGPAVQNLELLEEQLKEKKFFGGEKIGYLDLSLGLLAYLRDVFEEVIDLKLFDAGKFP  181



>ref|XP_007145574.1| hypothetical protein PHAVU_007G250000g [Phaseolus vulgaris]
 gb|ESW17568.1| hypothetical protein PHAVU_007G250000g [Phaseolus vulgaris]
Length=225

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +3

Query  99   RVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPLPESLLILEYIDET  278
            RV+WALR+KG+EYEY++E++ NK+PLL Q NPVH KVPV +HN  PLPESL+ILEYIDET
Sbjct  18   RVEWALRIKGVEYEYLQENLANKSPLLLQSNPVHKKVPVFLHNHNPLPESLVILEYIDET  77

Query  279  WKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAVNSameamekleae  458
            WK NPLLP DPY+RA+ARFWA F + K+L   W A  ++G+++  AV++A+E++  LE E
Sbjct  78   WKDNPLLPLDPYQRAQARFWARFIDEKVLYGVWGATVAEGEEKGKAVDAALESLAFLEKE  137

Query  459  lNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            + GK++FGG+KIGYLD+  GW++H L + EE+  +++ ++++FP
Sbjct  138  IEGKKYFGGDKIGYLDIAAGWLSHWLSVLEELGEMELLNAERFP  181



>ref|XP_006354570.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Solanum 
tuberosum]
Length=225

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 132/186 (71%), Gaps = 5/186 (3%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MA E  +K+   W S F LR+ WAL +KG+EYE I ED+ +K+P L Q NPVH KVPVLV
Sbjct  1    MADE--VKLYRTWSSRFSLRIVWALHIKGIEYEAIFEDLSHKSPQLLQYNPVHKKVPVLV  58

Query  222  HNGKPLPESLLILEYIDETWKH--NPLLPADPYERARARFWAGFAEFKILDPAWEALCSK  395
            H GKP+ ESL+ILEYIDETWK    PLLP DPYE+A ARFWA F + K+L         K
Sbjct  59   HQGKPICESLVILEYIDETWKKETTPLLPQDPYEKAMARFWAKFVDDKLLPSVTSVFTEK  118

Query  396  GKQ-QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIF  572
            G + ++ A+  A++ +E +E +L GK+FFGGE IGY+DLV+GW+A  L +FEEV  LK+F
Sbjct  119  GYEAKKEALVPAVQNLELIEEQLKGKKFFGGESIGYVDLVLGWMAFLLDVFEEVIDLKLF  178

Query  573  DSQKFP  590
            D+ KFP
Sbjct  179  DAHKFP  184



>gb|AFP20277.1| glutathione transferase 23 [Triticum aestivum]
Length=221

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 126/182 (69%), Gaps = 1/182 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+KV G W SP  +RV+WALR+KG+ YEY++ED+ +K+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVFGMWASPMAIRVEWALRLKGVGYEYVDEDLASKSDALLRHNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ES +I+E+IDE WK   P++PADPY+RA+ARFWA FA+ K     +    + G+ 
Sbjct  62   GKPIAESTIIVEFIDEAWKDGYPIMPADPYDRAQARFWARFADDKCNAAIFPVFTATGEA  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
            Q   V  A   ++ LE  L GK+FFGG+ +GYLD+VVGW A+ LPI EEV+   +   + 
Sbjct  122  QREVVREAQRCLKTLEKALEGKKFFGGDAVGYLDVVVGWYAYWLPIIEEVSGADVVTDEG  181

Query  585  FP  590
             P
Sbjct  182  LP  183



>emb|CDP11462.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 129/176 (73%), Gaps = 2/176 (1%)
 Frame = +3

Query  66   VVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPLPE  245
            ++G+W SPF LRV+ AL++KG+EYEY EED+ NK+PLL Q NPV+ K+PVL+HNGK + E
Sbjct  44   LLGYWGSPFALRVRSALKLKGIEYEYQEEDLGNKSPLLLQSNPVYKKIPVLLHNGKSISE  103

Query  246  SLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK-GKQQESAVN  422
            SL+ILEYIDE WKHNPLLP DPYERAR+RFWA F + K + PA     SK G++ E  V 
Sbjct  104  SLVILEYIDEVWKHNPLLPEDPYERARSRFWAKFVDEKCV-PALVGTISKVGEELEKGVR  162

Query  423  SameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A E ++ LE+ L+GK+ FGG KIG+ D+ +GW+A+   I +E   +++ D Q  P
Sbjct  163  EAREHLKTLESGLDGKRCFGGAKIGFADVAIGWIAYLARIEQEALKIQLIDQQSMP  218



>ref|XP_010243655.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=230

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 127/179 (71%), Gaps = 2/179 (1%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKP  236
            G+K++GFW SP+V RV WAL++KG+EYEYIEEDI NK+ +L + NPVH KVPVLVHNGKP
Sbjct  13   GVKLIGFWSSPYVYRVIWALKLKGVEYEYIEEDIFNKSDILLKYNPVHKKVPVLVHNGKP  72

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            + ES+++LEYIDETW  +P+LP D  ERA ARFWA FAE K     W    S G++ E A
Sbjct  73   IVESMVVLEYIDETWPEHPVLPEDAQERATARFWAKFAEDK-GSCIWAMFRSSGEKVEKA  131

Query  417  VNSameamekleaelNG-KQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
               ++E +  +E    G K+FFGG+ IG+ DL  G +AH L + E+V  +K+ ++Q FP
Sbjct  132  KKESLEMLRTIEEHGLGEKKFFGGDTIGFADLAFGGIAHWLGVMEDVVGVKLLEAQSFP  190



>ref|XP_006849232.1| hypothetical protein AMTR_s00027p00233060 [Amborella trichopoda]
 gb|ERN10813.1| hypothetical protein AMTR_s00027p00233060 [Amborella trichopoda]
Length=228

 Score =   183 bits (465),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 128/180 (71%), Gaps = 1/180 (1%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            ++ ++V+G W SPF   VK AL++KG++YEYIEED+ NK PLL + NPVH K+PVL+H  
Sbjct  6    DQKVRVLGVWNSPFSAMVKLALKLKGVQYEYIEEDLQNKGPLLLESNPVHKKIPVLIHGR  65

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ES++ILEYI+ETW  NPLLP DPYERA+ARFWA F E K     W A  ++G+++E
Sbjct  66   KPVAESVVILEYINETWPENPLLPNDPYERAQARFWAKFIEEKCGRAIWTAYGTQGEEKE  125

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A+  A E ++ LE  L GK FF GE IG+LD+V   +A  LP+ EE A +K FD +K P
Sbjct  126  KAIKDAEEGLKILEEGLKGK-FFNGETIGFLDIVACGIAFWLPVLEEAADIKFFDPEKLP  184



>ref|XP_011092669.1| PREDICTED: glutathione S-transferase U7-like [Sesamum indicum]
Length=230

 Score =   183 bits (464),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 128/183 (70%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M+  E +K++G  VSPF  R+ WAL+ KG+++E+IEED+ NK+PLLS+ NPV+  +PVL 
Sbjct  1    MSNNETVKLLGTGVSPFEWRIIWALKWKGIDFEFIEEDVSNKSPLLSEKNPVYKMIPVLF  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H    + ESL+ILEYIDETWK NP+LPADP ERA ARFWA F+E KIL+ +  A    G 
Sbjct  61   HAQNAVSESLIILEYIDETWKENPILPADPTERAYARFWAKFSEEKILEASRLAFHYTGN  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            +Q   V    E++E LE E+ GK+FFGG+  GYLD+VVGW+A+ L   +E    K+ D  
Sbjct  121  KQAEGVKLMSESLEILEGEIRGKKFFGGQTFGYLDIVVGWIAYWLHFTQEAGGYKVMDPT  180

Query  582  KFP  590
            +FP
Sbjct  181  RFP  183



>ref|XP_008346936.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=275

 Score =   184 bits (468),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 127/177 (72%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++  W SPF LR+ WAL++KG+ YE I ED+ NK+PLL Q NP+H K+PVL+HNG  +
Sbjct  60   VKLLRSWSSPFGLRIVWALQLKGIPYEXIYEDLSNKSPLLLQSNPIHKKIPVLLHNGNAV  119

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY+DETWK NPLLP DP ERA ARFWA + +  +    WE+   +GK+QE  +
Sbjct  120  VESLIILEYVDETWKENPLLPEDPLERATARFWARYCDETVSPSIWESFTKEGKEQEEGI  179

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A E ++ LE EL GK+FFGGEKIG +D+ +GW+ +   +FE++  +K+   ++FP
Sbjct  180  VKAKENLKYLEEELKGKKFFGGEKIGIVDIALGWLXYYESLFEDIVGMKVVTKEEFP  236



>ref|XP_006365401.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=226

 Score =   183 bits (464),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 129/179 (72%), Gaps = 2/179 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G   S F  RV+WAL++KG++YEYI+ED+LNK+ LL + NPVH K+PVL+H+ KP+
Sbjct  4    VKLIGSSGSLFCTRVEWALKLKGVDYEYIQEDLLNKSELLIKSNPVHKKIPVLLHDDKPV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALC--SKGKQQES  413
             ESL+ILEYIDETWK   LLP DP+ERA ARFWA F + K +  +W+A+    +G+ +  
Sbjct  64   VESLVILEYIDETWKGYSLLPQDPHERATARFWAKFVDDKCVIGSWQAMAMQDEGEAKAK  123

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             + S  E    +E ++ GK+FFGGE+IGYLDLV+GW    L   EEV ++K+ D +KFP
Sbjct  124  TIESVQELYAFIEKQIEGKKFFGGEQIGYLDLVMGWKTLWLSAMEEVGNVKLLDPEKFP  182



>ref|XP_002521517.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF40788.1| glutathione s-transferase, putative [Ricinus communis]
Length=236

 Score =   183 bits (464),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 128/187 (68%), Gaps = 3/187 (2%)
 Frame = +3

Query  39   IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVL  218
            + A +E +K+ G W SPFV RV+ AL++KG+ YE +EED+ NK+ LL ++NPV+ K+PVL
Sbjct  1    MAAGQEEVKLFGGWYSPFVYRVEVALKIKGIPYEVVEEDVTNKSKLLLKVNPVYKKIPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCS--  392
             HNGK + ESLLILEYIDETWKHNP+LP DPYE+A ARFWA F   K        L    
Sbjct  61   FHNGKSICESLLILEYIDETWKHNPILPQDPYEKAMARFWAHFFNDKFTRAIMVILTGTI  120

Query  393  -KGKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKI  569
             + KQ+E     A   + + + +  GK FFGG++IGY+D+V+GW+   +   EE+AS+KI
Sbjct  121  EERKQKEVEKAMAALTVLEGQLKAKGKTFFGGDRIGYVDIVLGWIPRWVGAVEEIASVKI  180

Query  570  FDSQKFP  590
             D +KFP
Sbjct  181  HDPEKFP  187



>ref|XP_010060069.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
 gb|KCW66601.1| hypothetical protein EUGRSUZ_F00396 [Eucalyptus grandis]
Length=225

 Score =   182 bits (463),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 127/184 (69%), Gaps = 1/184 (1%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNK-TPLLSQLNPVHAKVPVL  218
            MA    +K+ GFW SP+ LRV W L++K + Y+Y+EED+ NK + LL Q NPVH KVPVL
Sbjct  1    MADGGEVKLHGFWGSPYALRVIWTLKLKQVPYDYLEEDLPNKKSSLLLQYNPVHKKVPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            VH+GKP+PESL+ILEYIDETWK +PLLP DPYERAR RFWA FA+ K +       C++G
Sbjct  61   VHHGKPIPESLVILEYIDETWKQSPLLPQDPYERARVRFWAKFADEKCMPAMKAVFCTEG  120

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDS  578
            ++Q+ AV  A E ++ LE+ L GK FFGGE I + D+  G++     I EE+    + D+
Sbjct  121  EEQQKAVLEARETLKTLESGLEGKLFFGGETINFADVATGYIGCWARIVEEITGTTLIDA  180

Query  579  QKFP  590
            +  P
Sbjct  181  ESMP  184



>gb|KCW65098.1| hypothetical protein EUGRSUZ_G02603 [Eucalyptus grandis]
Length=213

 Score =   182 bits (462),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 128/179 (72%), Gaps = 11/179 (6%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+   W SP+ LRV WAL++KG++YE + ED+  K+ L+ + NPV+ KVPVL+HNG+
Sbjct  3    EEVKLFRTWSSPYALRVVWALQLKGIQYESVLEDVSEKSDLVRRYNPVYKKVPVLLHNGR  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK +PLLP DPY R  ARFWA             A  S+GK+QE+
Sbjct  63   PISESLIILEYIDETWKQHPLLPRDPYARTMARFWAN-----------SATTSEGKEQEA  111

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            A+  A E ++KLE  L GK+FF G+ IGYLD+ +GW+A+ + +FEE+ SLK+ D ++FP
Sbjct  112  ALAEASEHLQKLEEVLRGKKFFSGDNIGYLDIALGWLANLIRVFEEICSLKVVDYERFP  170



>ref|XP_008812228.1| PREDICTED: glutathione transferase GST 23-like [Phoenix dactylifera]
Length=221

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+K+ G  +SP  LRV+WAL++KG+EYEY++ED+L+K+  L + NPV  K+PVLVH+
Sbjct  2    AEKGVKLFGMSLSPMALRVEWALKLKGVEYEYVDEDLLHKSEELLRYNPVTKKIPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQ  404
            GKP+ ESL+I+EY+DE WK   P++P DPYERA+ARFWA F E KI    +   C+ G+Q
Sbjct  62   GKPMAESLVIIEYVDEVWKDGYPIMPKDPYERAQARFWAKFVEDKINPAIYAVFCTTGEQ  121

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
            Q+ A+  A E+   LE  L  K+FFGGE IG++D+V GW+ + L I EE+  + I +   
Sbjct  122  QQKALQEAQESFMTLEVALKSKKFFGGEMIGFVDIVAGWLPYWLRIIEEIVGVSIVNENI  181

Query  585  FP  590
             P
Sbjct  182  QP  183



>ref|XP_002518184.1| glutathione s-transferase, putative [Ricinus communis]
 pdb|4J2F|A Chain A, Crystal Structure Of A Glutathione Transferase Family 
Member From Ricinus Communis, Target Efi-501866
 gb|EEF44317.1| glutathione s-transferase, putative [Ricinus communis]
Length=223

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 127/182 (70%), Gaps = 4/182 (2%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E LK+ G W SPF  RV WAL++KG+ YEY+EED+ NK+PLL Q NPVH K+PVLVH GK
Sbjct  3    EVLKLHGAWPSPFSCRVIWALKLKGIPYEYVEEDLFNKSPLLLQYNPVHKKIPVLVHGGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ES +ILEY+DETW  NPLLP+DP+ERA ARFW  F E K     W    +KG++ E 
Sbjct  63   PICESTIILEYLDETWPENPLLPSDPHERAVARFWVKFIEDK-GTAIWNIFRTKGEELEK  121

Query  414  AVNSameamekleaelNG---KQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQK  584
            AV + +E ++ +E    G    ++FGG+KIG +D+    +AH L + EEVA +K+ +SQK
Sbjct  122  AVKNCLEVLKTIEEHAMGVSDDKYFGGDKIGIVDIAFCGIAHWLGVIEEVAGVKVLESQK  181

Query  585  FP  590
            FP
Sbjct  182  FP  183



>ref|XP_010238250.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Brachypodium 
distachyon]
Length=229

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 130/189 (69%), Gaps = 8/189 (4%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AE+G+KV G W SP  +R++WALR+K + YEY++ED+ NK+  L + NPV  KVPVLVH+
Sbjct  2    AEKGVKVFGMWASPMAIRLEWALRLKSVVYEYVDEDLGNKSDALLRYNPVTKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILD-------PAWEA  383
            GKP+ ES +I+EYIDE WK   P++PADPYERA+ARFWA FA+ K L+         +  
Sbjct  62   GKPVVESAIIVEYIDEAWKDGYPIMPADPYERAQARFWANFADEKDLNGFVQCNAAVYPV  121

Query  384  LCSKGKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASL  563
              + G+ Q   V+ A + ++ LE  L GK+FFGG+ +GYLDLVVGW A+ LPI EEV+  
Sbjct  122  FTATGEAQGKVVHEAQQCLKTLEKALEGKKFFGGDAVGYLDLVVGWYAYWLPIIEEVSGA  181

Query  564  KIFDSQKFP  590
             +   ++ P
Sbjct  182  SVVTDEELP  190



>ref|XP_010693951.1| PREDICTED: glutathione S-transferase U7-like [Beta vulgaris subsp. 
vulgaris]
Length=221

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 129/178 (72%), Gaps = 0/178 (0%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKP  236
            G+K+ G W SPF +RV+ AL++KG+EYE++EED+L+K+  L++ NP+H KVPVL+H+GK 
Sbjct  2    GVKIYGTWASPFSMRVEIALQIKGIEYEFVEEDLLHKSDELAKYNPIHKKVPVLIHDGKV  61

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            + ESL+ILEYIDETWK NP+LP D Y++A+ARFWA F + K+      AL S+G++ E A
Sbjct  62   MVESLVILEYIDETWKANPILPTDAYQKAQARFWAKFVDDKVTPLVRSALMSEGEESEKA  121

Query  417  VNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            +    E ++ LE+E+ GKQFFGG+ IGYLD+V   V   +   +EV   ++   +KFP
Sbjct  122  IPQLDEVLQILESEIKGKQFFGGKSIGYLDIVASMVPFWITCLQEVVGKEVITKEKFP  179



>ref|XP_002520474.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41887.1| glutathione s-transferase, putative [Ricinus communis]
Length=222

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 130/179 (73%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SPF  R++ AL++KG++YEYIEED+ NK+PLL   NPVH K+PVL+HNGK
Sbjct  3    EEVKLLGAWASPFSHRIELALKLKGIQYEYIEEDLSNKSPLLLSTNPVHKKIPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYI+ETW+ NP+LP DPY+RA ARFWA F + KIL  A +   +K +++  
Sbjct  63   PIAESLVILEYIEETWQSNPILPKDPYDRAVARFWAKFVDEKILQTASKFRSAKEEEKLQ  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
                  + ++ LE EL G++FFGGE IG++D+V+ ++ H   + +EV  ++   ++KFP
Sbjct  123  IFEELGQHLKVLENELRGREFFGGESIGFVDIVIFFIVHWFQLRQEVMQIEFISNEKFP  181



>gb|ADB11377.1| putative tau class glutathione transferase GSTU53 [Populus trichocarpa]
Length=219

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 122/178 (69%), Gaps = 2/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G W SPF  RV WAL++KG+ YEYIEED+ NK+PLL Q NPVH K+PVL+H GK +
Sbjct  4    VKLLGTWPSPFSYRVIWALKLKGIPYEYIEEDLSNKSPLLLQCNPVHKKIPVLIHGGKSI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY++ETW   PL+P DPYERARARFW  F E K +   W    S G++QE AV
Sbjct  64   CESLVILEYMEETWPQIPLMPDDPYERARARFWVKFVEDKGV-AVWIMFHSSGEEQEKAV  122

Query  420  -NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             +S        E  L  K+FF G+KI  +D+  GW+A  L + EEVA +K+ + QKFP
Sbjct  123  KDSLEMLKTIEEHALGKKRFFCGDKISLVDIAYGWIAQWLAVLEEVAGIKLMEPQKFP  180



>ref|XP_004504278.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=224

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
              + +K++ F +SP   RV+WAL++KG++YEYIEEDI NK+ LL +LNPVH KVPVLVH 
Sbjct  2    GSQDVKLLNFLLSPVGRRVEWALKLKGVDYEYIEEDIFNKSNLLLELNPVHKKVPVLVHG  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             K + ESL+ILEYIDETWK  PLLP  PY+RA ARFWA  ++   L  AW A+  +G ++
Sbjct  62   QKSMAESLIILEYIDETWKQYPLLPHHPYQRALARFWAKLSDELALG-AWRAMVRRGDER  120

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E  +  A+E MEK+E  + G +FFGG  IGYLDL  GW+   LP++EE+ S+++ D  K 
Sbjct  121  EKVLKEAIEVMEKIEQLIKGNKFFGGNNIGYLDLAFGWITCWLPVWEEIGSMQVLDPLKC  180

Query  588  P  590
            P
Sbjct  181  P  181



>gb|ADB11374.1| tau class glutathione transferase GSTU50 [Populus trichocarpa]
Length=219

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 122/178 (69%), Gaps = 2/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G W SPF  RV WAL++KG+ YEYIEED+ NK+PLL Q NPVH K+PVL+H GK +
Sbjct  4    VKLLGTWPSPFSYRVIWALKLKGIPYEYIEEDLSNKSPLLLQCNPVHKKIPVLIHGGKSI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEY++ETW   PL+P DPYERARARFW  F E K +   W    S G++QE AV
Sbjct  64   CESLVILEYMEETWPQIPLMPDDPYERARARFWVKFVEDKGV-AVWIMFYSSGEEQEKAV  122

Query  420  -NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             +S        E  L  K+FF G+KI  +D+  GW+A  L + EEVA +K+ + QKFP
Sbjct  123  KDSLEMLKTIEEHALGKKRFFCGDKISLVDIAYGWIAQWLEVLEEVAGIKLIEPQKFP  180



>ref|NP_001237959.1| uncharacterized protein LOC100305870 [Glycine max]
 gb|ACU13765.1| unknown [Glycine max]
Length=205

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 129/191 (68%), Gaps = 15/191 (8%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
              E +K++ FWVSPF  RV+WAL++KG+EYEYIEEDI NK+ LL +LNPVH KVPVLVH 
Sbjct  2    GSEDVKLLNFWVSPFGKRVEWALKLKGVEYEYIEEDIFNKSNLLLELNPVHKKVPVLVHA  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
             KP+ ES +ILEYIDETWK  PLLP +PY+RA ARFWA   E K+    W A+ + G +Q
Sbjct  62   QKPIAESFIILEYIDETWKKYPLLPHNPYQRALARFWATCVEQKLGKAGWVAMSTSGDEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVG------------WV-AHNLPIFE  548
            E A+  A E MEK+E E+ GK FFGG+ IGYLD+ +G            W+ A N PI  
Sbjct  122  EEAMKEAKEMMEKIEEEIKGKNFFGGDNIGYLDIAIGMDCLLGSCLGGSWINADNRPI--  179

Query  549  EVASLKIFDSQ  581
            E++S    D Q
Sbjct  180  EISSHLCMDDQ  190



>ref|XP_006354574.1| PREDICTED: glutathione transferase GST 23-like [Solanum tuberosum]
Length=223

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 129/185 (70%), Gaps = 4/185 (2%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MA E  +K+   W SPF LR+ WAL +KG+EYE I ED+  K+  L Q NPVH K+PVLV
Sbjct  1    MADE--VKLYRTWSSPFGLRIVWALHIKGIEYEAIFEDLTQKSSELLQYNPVHKKIPVLV  58

Query  222  HNGKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            H GKP+ ESL+ILEYIDETW    PLLP DPYE+A ARFWA F + K+L   W     KG
Sbjct  59   HKGKPICESLVILEYIDETWNETAPLLPQDPYEKAMARFWAKFVDDKLLPSVWSIFTEKG  118

Query  399  KQ-QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
             + ++ A   A++ +E +E +L  K+FFGGE IGY+DL +GW+A+ L +FEEV  LK+FD
Sbjct  119  DEAKKEAFVPAVQNLEIIEEQLKEKKFFGGESIGYVDLALGWMAYLLDVFEEVMDLKLFD  178

Query  576  SQKFP  590
            + KFP
Sbjct  179  AHKFP  183



>ref|XP_006580178.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase U1-like 
[Glycine max]
Length=206

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 131/193 (68%), Gaps = 15/193 (8%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            M +E+ +K+V FW SPF  RV+WAL++KG++YEYIEED+ N + L+ +LNPVH KVP+LV
Sbjct  1    MGSEDRVKLVNFWASPFGKRVEWALKLKGVKYEYIEEDVYNMSSLVMELNPVHKKVPILV  60

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            H  KP+ ES  ILEYIDETWK  PLLP DPY+RA ARFWA F E K++  A +A+ +   
Sbjct  61   HAQKPIAESFTILEYIDETWKQYPLLPQDPYQRALARFWANFGEQKLMRAARKAMTTSRD  120

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVG------------WV-AHNLPI  542
            ++  A+    E ME++E E+ GK++FGG+ IG+LD+ +G            W+ AHN PI
Sbjct  121  ERAKALKETRELMERIEEEIKGKKYFGGDNIGFLDIALGXDLLLASCCGGSWIDAHNRPI  180

Query  543  FEEVASLKIFDSQ  581
              E++S    D Q
Sbjct  181  --EISSHHFMDDQ  191



>gb|KHN06986.1| Putative glutathione S-transferase [Glycine soja]
Length=225

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 140/185 (76%), Gaps = 1/185 (1%)
 Frame = +3

Query  39   IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVL  218
            + A++E +K++G   SPFV RV+ AL++KG+EY+++EE++ NK+ LL + NPVH KVPV 
Sbjct  1    MAASQEDVKLLGVLGSPFVCRVQIALKLKGIEYKFVEENLANKSDLLLKSNPVHKKVPVF  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCS-K  395
            +HN KP+ ESL+I+EYIDETWK+NP+LP+DPY RA ARFW+ F + K+   AW+++ +  
Sbjct  61   IHNEKPIAESLVIVEYIDETWKNNPILPSDPYHRALARFWSKFIDDKVFGAAWKSVFTLD  120

Query  396  GKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
             K++E  V  ++EA++ LE EL   +FFGGE+ G +D+   ++A  +PIF+E+A L+IF 
Sbjct  121  EKEREKNVEESLEALQFLENELKDNKFFGGEEFGLVDIAAIFIAFWIPIFQEIAGLQIFT  180

Query  576  SQKFP  590
            S+KFP
Sbjct  181  SEKFP  185



>gb|KEH35720.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=223

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 133/179 (74%), Gaps = 2/179 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AE+ L ++GFW SPFVLRVKWAL +KG++Y+Y+EED  NK+ +L Q NPV+ KVPVLVH+
Sbjct  2    AEDSLTILGFWGSPFVLRVKWALELKGVQYQYVEEDFKNKSDMLLQYNPVYKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK-GKQ  404
            GK + ESL+ILEYIDE WK NPLLP DPYERA+ARFWA FA+ K + PA+ A  SK G++
Sbjct  62   GKSISESLVILEYIDEIWKQNPLLPHDPYERAKARFWAKFADEKCV-PAFIATFSKIGEE  120

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            Q+ A   A E ++ LE+ L G+++FGGE IG+ D+ VG+    + + EE   + + D++
Sbjct  121  QQEAAQEARENLKILESGLEGRRYFGGENIGFADIAVGFFGRWVRVVEETVGINLIDTE  179



>gb|AFK37185.1| unknown [Medicago truncatula]
Length=223

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 133/179 (74%), Gaps = 2/179 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            AE+ L ++GFW SPFVLRVKWAL +KG++Y+Y+EED  NK+ +L Q NPV+ KVPVLVH+
Sbjct  2    AEDSLTILGFWGSPFVLRVKWALELKGVQYQYVEEDFKNKSDMLLQYNPVYKKVPVLVHD  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSK-GKQ  404
            GK + ESL+ILEYIDE WK NPLLP DPYERA+ARFWA FA+ K + PA+ A  SK G++
Sbjct  62   GKSISESLVILEYIDEIWKQNPLLPHDPYERAKARFWAKFADEKCV-PAFIATFSKIGEE  120

Query  405  QESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            Q+ A   A E ++ LE+ L G+++FGGE IG+ D+ VG+    + + EE   + + D++
Sbjct  121  QQEAAQEARENLKILESGLEGRRYFGGENIGFADIAVGFFGRWVRVVEETVGINLIDTE  179



>ref|XP_010939723.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=222

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 128/183 (70%), Gaps = 2/183 (1%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNK-TPLLSQLNPVHAKVPVLVH  224
            AE+G+K+ G W SP  LRV+WAL++KG+EYEY+EED+ +K +  L + NPV  K+PVLVH
Sbjct  2    AEKGVKLFGMWCSPIALRVEWALKLKGVEYEYVEEDLFHKKSEELLRYNPVTKKIPVLVH  61

Query  225  NGKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            +GKPL ESL+I+EY+DE WK   P++P DPYERA+ARFWA FAE KI    +    + G+
Sbjct  62   DGKPLAESLVIVEYVDEVWKDGFPIMPKDPYERAQARFWAKFAEDKISPATFAVYSTTGE  121

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            QQ+ A+  A E  + LE  L GK+FFGGE IG++D+  GW+   + I EE+ S+ I +  
Sbjct  122  QQQKALQEAQELFKTLEEALKGKKFFGGETIGFVDIAAGWLPCWVRIIEEIVSVSIVNEN  181

Query  582  KFP  590
              P
Sbjct  182  NLP  184



>gb|ACU15816.1| unknown [Glycine max]
Length=228

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 139/185 (75%), Gaps = 1/185 (1%)
 Frame = +3

Query  39   IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVL  218
            + A +E +K++G   SPFV RV+ AL++KG+EY+++EE++ NK+ LL + NPVH KVPV 
Sbjct  1    MAATQEDVKLLGIVGSPFVCRVQIALKLKGVEYKFLEENLGNKSDLLLKYNPVHKKVPVF  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCS-K  395
            VHN KP+ ESL+I+EYIDETWK+NP+LP+DPY+RA ARFW+ F + KI+   W+++ +  
Sbjct  61   VHNEKPIAESLVIVEYIDETWKNNPILPSDPYQRALARFWSKFIDDKIVGAVWKSVFTVD  120

Query  396  GKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
             K++E  V    EA++ LE EL  K+FFGGE+ G +D+   ++A  +PIF+E+A L++F 
Sbjct  121  EKEREKNVEETYEALQFLENELKDKKFFGGEEFGLVDIAAVFIAFWIPIFQEIAGLQLFT  180

Query  576  SQKFP  590
            S+KFP
Sbjct  181  SEKFP  185



>ref|XP_010271921.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=235

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 130/177 (73%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            LK++G  +SPF  RV+W L++KG++YE+IEE++ NK+ LL   NP + K+PVL+H GKP+
Sbjct  18   LKLLGTKLSPFSRRVEWVLKLKGVKYEFIEENLFNKSSLLLASNPYYEKIPVLIHAGKPI  77

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ES+ ILEYI+E WK NP++P DPYERARAR  A FA+ K  +    A  S G+ Q  A 
Sbjct  78   SESICILEYIEERWKGNPIMPEDPYERARARLLAKFADEKFFEAIKTAFESIGEVQARAA  137

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             SAMEA++ LE E+ GK+FFGG++IG LD+VVGW+A+ L + EE A  K+ DS+KFP
Sbjct  138  ESAMEALKILEGEIKGKKFFGGDRIGMLDIVVGWIAYWLQLVEEAAGFKVMDSKKFP  194



>gb|KHN05112.1| Putative glutathione S-transferase [Glycine soja]
Length=225

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 139/185 (75%), Gaps = 1/185 (1%)
 Frame = +3

Query  39   IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVL  218
            + A +E +K++G   SPFV RV+ AL++KG+EY+++EE++ NK+ LL + NPVH KVPV 
Sbjct  1    MAATQEDVKLLGIVGSPFVCRVQIALKLKGVEYKFLEENLGNKSDLLLKYNPVHKKVPVF  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCS-K  395
            VHN KP+ ESL+I+EYIDETWK+NP+LP+DPY+RA ARFW+ F + KI+   W+++ +  
Sbjct  61   VHNEKPIAESLVIVEYIDETWKNNPILPSDPYQRALARFWSKFIDDKIVGAVWKSVFTVD  120

Query  396  GKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
             K++E  V    EA++ LE EL  K+FFGGE+ G +D+   ++A  +PIF+E+A L++F 
Sbjct  121  EKEREKNVEETYEALQFLENELKDKKFFGGEEFGLVDIAAVFIAFWIPIFQEIAGLQLFT  180

Query  576  SQKFP  590
            S+KFP
Sbjct  181  SEKFP  185



>ref|XP_004301267.1| PREDICTED: glutathione S-transferase U7-like [Fragaria vesca 
subsp. vesca]
Length=216

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 124/174 (71%), Gaps = 0/174 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +KV+G  +S F  R++WAL+ K + YEYIEED+ NK+ LL + NPVH K+PVL+H  KP+
Sbjct  4    VKVLGASLSLFCCRIEWALKHKVITYEYIEEDLRNKSTLLLKSNPVHKKIPVLLHGDKPV  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETW+ NPLLP DP+E+A  RFWA + + K +  AW A  +KG +QE A+
Sbjct  64   AESLVILEYIDETWRENPLLPDDPFEKAMVRFWAKYVDEKCVISAWTASRTKGHEQEKAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
             S  E+++ L   + GK+FFGGE IG+LDLVVG + + +   EE   +K+FD+ 
Sbjct  124  ESTQESLKLLNKLIEGKKFFGGETIGFLDLVVGSLPNWIKFIEEFVGIKLFDTN  177



>gb|KJB28257.1| hypothetical protein B456_005G037700 [Gossypium raimondii]
Length=224

 Score =   180 bits (457),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 118/179 (66%), Gaps = 3/179 (2%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDI-LNKTPLLSQLNPVHAKVPVLVHNGKP  236
            +K+ GFW SPF  RV WAL++KG+EYEYIEED+  NK+ LL Q NPVH K+PVLVH GKP
Sbjct  4    VKLFGFWASPFSRRVIWALKLKGVEYEYIEEDLPYNKSDLLLQYNPVHKKIPVLVHGGKP  63

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            + ESL+ILEYIDE W HNPLLP D YER+ ARFWA F E K   P W+     G++Q+ A
Sbjct  64   IAESLVILEYIDEVWPHNPLLPKDAYERSVARFWAKFIEEKT-QPMWDFFRKFGEEQQKA  122

Query  417  V-NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            + N+        E  L  K+FFGG++IG  DLV G V H L   EEV   K   +  FP
Sbjct  123  IENNYEILRTIEEHGLGDKKFFGGDQIGIADLVFGMVIHMLAPMEEVVGYKFIKADSFP  181



>gb|AJE59685.1| tau class glutathione S-transferase [Glycine max]
Length=225

 Score =   180 bits (457),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 139/185 (75%), Gaps = 1/185 (1%)
 Frame = +3

Query  39   IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVL  218
            + A +E +K++G   SPFV RV+ AL++KG+EY+++EE++ NK+ LL + NPVH KVPV 
Sbjct  1    MAAGQEDVKLLGVVGSPFVCRVQIALKLKGIEYKFVEENLANKSDLLLKSNPVHKKVPVF  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCS-K  395
            +HN KP+ ESL+I+EYIDETWK+NP+LP+DPY RA ARFW+ F + K+   AW+++ +  
Sbjct  61   IHNEKPIAESLVIVEYIDETWKNNPILPSDPYHRALARFWSKFIDDKVFGAAWKSVFTLD  120

Query  396  GKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
             K++E  V  ++EA++ LE EL   +FFGGE+ G +D+   ++A  +PIF+E+A L+IF 
Sbjct  121  EKEREKNVEESLEALQFLENELKDNKFFGGEEFGLVDIAAIFIAFWIPIFQEIAGLQIFT  180

Query  576  SQKFP  590
            S+KFP
Sbjct  181  SEKFP  185



>ref|XP_007016281.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
 gb|EOY33900.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
Length=261

 Score =   181 bits (460),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 128/183 (70%), Gaps = 0/183 (0%)
 Frame = +3

Query  42   MAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLV  221
            MA E+ +K+ G W SP+  RV+ AL++KG+ YEY+EED+ +K+ LL + NPVH K+PVLV
Sbjct  38   MADEDEVKLFGMWASPYSRRVELALKLKGIPYEYVEEDLSSKSCLLLKYNPVHQKIPVLV  97

Query  222  HNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGK  401
            HNGKP+ ESL+ILEYIDETW +NP+LP DPY+RA ARFWA F + K+L    +A  + GK
Sbjct  98   HNGKPIAESLVILEYIDETWTNNPILPQDPYDRAMARFWAKFIDEKLLMTTRKASVASGK  157

Query  402  QQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQ  581
            ++E A+    E ++ LE+EL GK++F G  IGYLD+V   +       +E   + +F  +
Sbjct  158  EKEQAIEEITEQLKLLESELQGKEYFSGPSIGYLDIVASVLVFWFGNLQEALGVDMFTKE  217

Query  582  KFP  590
            KFP
Sbjct  218  KFP  220



>ref|XP_007026865.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
 gb|EOY07367.1| Tau class glutathione transferase GSTU45 [Theobroma cacao]
Length=220

 Score =   180 bits (456),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDI-LNKTPLLSQLNPVHAKVPVLVHNG  230
            E +KV G W SPF  RV+ AL++KG++YEYIEED+  NK+PLL + NPVH KVPVL+HNG
Sbjct  3    EEVKVFGAWGSPFSRRVELALQLKGVQYEYIEEDVHKNKSPLLLKYNPVHKKVPVLLHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL+ILEYI+ETWK NP+LP DPY+RA ARFWA F + K L   W+A  S   ++E
Sbjct  63   KPIAESLVILEYIEETWKGNPILPEDPYDRAMARFWAKFIDEKCLPAIWKAGWSPESERE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              V  A E ++ LE+ L GK+FFGG+K+G +D+   ++ + L + +EV  +++  ++KFP
Sbjct  123  KPVEEACECLKTLESALGGKRFFGGDKVGMVDIAANFIGYWLRLIQEVTGMELLSAEKFP  182



>emb|CDP06552.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 125/179 (70%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G+WVSPF   V+ AL +KG++YEYIEED+ NK+P L Q NPV+ K+PVL+HNGK
Sbjct  2    EEVKLFGYWVSPFCRSVEIALNIKGIQYEYIEEDLTNKSPQLLQYNPVYKKIPVLLHNGK  61

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ES++ILEYIDETWK+NP+LP DP+E+ARARFWA F + K     W+ + S  +Q E 
Sbjct  62   PIVESMVILEYIDETWKNNPILPEDPFEKARARFWANFVDQKCFPALWKTIWSTSEQYEQ  121

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
                A+E ++ LE EL GK+FFGG+ IG +D+V  ++  +    +E   L +F    FP
Sbjct  122  NKAEALERLKVLENELGGKRFFGGDSIGMVDIVANFIGFSFRTIQEALKLDVFTEDNFP  180



>ref|XP_003529123.1| PREDICTED: probable glutathione S-transferase-like [Glycine max]
 gb|AJE59661.1| tau class glutathione S-transferase [Glycine max]
Length=225

 Score =   180 bits (456),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 139/185 (75%), Gaps = 1/185 (1%)
 Frame = +3

Query  39   IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVL  218
            + A +E +K++G   SPFV RV+ AL++KG+EY+++EE++ NK+ LL + NPVH KVPV 
Sbjct  1    MAATQEDVKLLGIVGSPFVCRVQIALKLKGVEYKFLEENLGNKSDLLLKYNPVHKKVPVF  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCS-K  395
            VHN +P+ ESL+I+EYIDETWK+NP+LP+DPY+RA ARFW+ F + KI+   W+++ +  
Sbjct  61   VHNEQPIAESLVIVEYIDETWKNNPILPSDPYQRALARFWSKFIDDKIVGAVWKSVFTVD  120

Query  396  GKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
             K++E  V    EA++ LE EL  K+FFGGE+ G +D+   ++A  +PIF+E+A L++F 
Sbjct  121  EKEREKNVEETYEALQFLENELKDKKFFGGEEFGLVDIAAVFIAFWIPIFQEIAGLQLFT  180

Query  576  SQKFP  590
            S+KFP
Sbjct  181  SEKFP  185



>ref|XP_002520473.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41886.1| glutathione s-transferase, putative [Ricinus communis]
Length=242

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 128/179 (72%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E ++++G W SPF  R + AL++KG++YEYIEED+ NK+PLL + NPV+ K+PVLVH GK
Sbjct  26   EEVQLIGMWASPFNCRAQLALKLKGVQYEYIEEDLSNKSPLLLKYNPVYKKIPVLVHKGK  85

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYI+ETWK+NP++P D Y  A ARFWA FA+  IL  A ++  +KG+++E 
Sbjct  86   PISESLVILEYIEETWKNNPIMPQDSYSTAIARFWANFADENILQTAIKSSKAKGEEREK  145

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              +   + ++ LE ELNGKQFFGG+ IGYLD+V   + H   +  EV  +++   + FP
Sbjct  146  LWDEVCQNLKLLENELNGKQFFGGKNIGYLDIVAFSLVHWFQVANEVTQMELITEENFP  204



>ref|XP_010042776.1| PREDICTED: glutathione S-transferase U8-like [Eucalyptus grandis]
Length=224

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 125/180 (69%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIL-NKTPLLSQLNPVHAKVPVLVHNG  230
            E LK++G W S F  RV+  L++KG+EYEY+EED+  NK+ LL Q NPVH KVPVLVHNG
Sbjct  3    EELKLLGAWGSSFSRRVEIVLKIKGVEYEYLEEDVFQNKSDLLLQYNPVHKKVPVLVHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL+ILEYIDETWK NP+LP DPYERA ARFWA F + K     W++  S G ++E
Sbjct  63   KPIAESLVILEYIDETWKDNPILPRDPYERAMARFWAKFLDEKCRPALWKSYTSVGPERE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A   A E +  LE EL GK+FFGGE +G+LD+V  +V +   + +E   + +   +KFP
Sbjct  123  KAHEEAQELLSTLEGELEGKKFFGGETVGFLDIVANFVGYWAGVLQEAVGVDVLTEEKFP  182



>ref|XP_007029718.1| Glutathione S-transferase tau 7 [Theobroma cacao]
 gb|EOY10220.1| Glutathione S-transferase tau 7 [Theobroma cacao]
Length=233

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 124/180 (69%), Gaps = 3/180 (2%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEE---DILNKTPLLSQLNPVHAKVPVLVHNG  230
            +K+VG W SP+V RV W L++KG++YE++EE   D+  K+  L   NPV+ KVPVL+H+G
Sbjct  11   VKLVGAWYSPYVHRVAWVLKLKGIQYEFVEENLRDLNKKSSFLLDCNPVYKKVPVLLHHG  70

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL I+EYIDETWKHNP+ P DPY+RA ARFWA   +  +L+ +  ALC++G Q +
Sbjct  71   KPIVESLFIIEYIDETWKHNPIFPTDPYDRAMARFWARLMDEMLLEGSKRALCAEGDQLK  130

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              +    +AME LE    GK+FFGGE +G+LD+  GW    L   EEVA ++ F+  K+P
Sbjct  131  KEIEQVSDAMEVLEGMKKGKKFFGGETVGFLDVAFGWTTIWLEAIEEVAGVEFFNRDKYP  190



>ref|XP_010243637.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=220

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (68%), Gaps = 2/178 (1%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K+ G W SPFV RV WAL++KG+EYEYIEED+ NK+ LL + NPVH KVPVLVHNGKP+
Sbjct  4    VKLFGNWSSPFVYRVIWALKLKGVEYEYIEEDLSNKSELLLKYNPVHKKVPVLVHNGKPI  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETW  +PLLP D   RA ARFWA FAE K +   W    S G++QE A 
Sbjct  64   AESLVILEYIDETWPEHPLLPKDAQLRAEARFWAKFAEDKGI-CIWRFFSSVGEEQEKAK  122

Query  420  N-SameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              S        E  L  K+FFGG  IG+ DL  GW++H + + E++  +K+ ++Q FP
Sbjct  123  KESLEMLRTIEEHGLAEKKFFGGYTIGFADLAFGWISHWMGVMEDIVGVKLVEAQTFP  180



>gb|ADB11327.1| tau class glutathione transferase GSTU45 [Populus trichocarpa]
Length=220

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 129/177 (73%), Gaps = 0/177 (0%)
 Frame = +3

Query  60   LKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKPL  239
            +K++G W SPF  RV+ AL++KG+EYEYI+ED+ NK+PLL + NP+H KVPVL+HNGK +
Sbjct  4    VKLLGAWGSPFSRRVEMALKLKGVEYEYIDEDLANKSPLLLKYNPIHKKVPVLLHNGKTM  63

Query  240  PESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESAV  419
             ESL+ILEYIDETWK NP+LP DPY++A ARFWA F + K +   W+ + SK  ++E A+
Sbjct  64   AESLVILEYIDETWKSNPILPEDPYDKAMARFWAKFIDEKCMPAIWQIMLSKENEREKAI  123

Query  420  NSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              A++ ++ LE EL  K+FFGGE IG +D+V  ++   L   +E   +++ + ++FP
Sbjct  124  EEAIQHLKTLENELKDKKFFGGETIGLVDIVANFIGFWLGAAQEATGMELVNKERFP  180



>ref|XP_009347672.1| PREDICTED: glutathione S-transferase U8-like [Pyrus x bretschneideri]
Length=224

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 128/178 (72%), Gaps = 0/178 (0%)
 Frame = +3

Query  57   GLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGKP  236
            G+K+     S F  R++WAL++KG+EYE+I ED+ NK+PLL + NP++ KVPVLVH    
Sbjct  3    GVKLFATKESLFSARIQWALKLKGVEYEFILEDLANKSPLLLKYNPIYKKVPVLVHGDNV  62

Query  237  LPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQESA  416
            + ESL+ILEYI+ETWK +PLLP D Y+RA ARFWA F + K++ P W A   +G+ QE A
Sbjct  63   IVESLVILEYIEETWKEHPLLPRDSYDRATARFWAKFNDEKLVPPVWTACTGEGEAQEKA  122

Query  417  VNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
              S +E++  LE ++ GK+FFGGE+IGYLDLV+GW+++ +   EE    K+ +++ FP
Sbjct  123  KESVLESLALLEKQIEGKKFFGGEQIGYLDLVLGWISYWISAVEEAGGNKVLEAEMFP  180



>ref|XP_010271919.1| PREDICTED: glutathione transferase GST 23-like [Nelumbo nucifera]
Length=223

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 124/181 (69%), Gaps = 0/181 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
            A + + ++G W SP  LR++WAL++KG+ YEYI+ED+ NK+  L   NPVH KVPVLVH 
Sbjct  2    ATDQVTLLGMWASPLSLRIEWALKIKGIHYEYIDEDLDNKSQRLLTCNPVHKKVPVLVHA  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKP+ ESL+ILEYIDETW H+ +LP DPYERA ARFWA FA+ K            G++Q
Sbjct  62   GKPIAESLVILEYIDETWSHSRILPEDPYERAMARFWAKFADDKCWTTIHGVFTKTGQEQ  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E+A + A+E+++ LE      +FFGG+ IG+LD+V GW+A+ +P+ EE+  + +      
Sbjct  122  ENAKSEAIESLKTLEKIPRESKFFGGDAIGFLDIVFGWMAYWVPLLEEITGIILVGEDSL  181

Query  588  P  590
            P
Sbjct  182  P  182



>ref|XP_010037768.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49501.1| hypothetical protein EUGRSUZ_K03019 [Eucalyptus grandis]
Length=224

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 126/180 (70%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIL-NKTPLLSQLNPVHAKVPVLVHNG  230
            E LK++G W S F  RV+ AL++KG+EYEY+EED+  NK+ LL Q NPVH KVPVLVHNG
Sbjct  3    EELKLLGAWGSSFSRRVEIALKIKGVEYEYLEEDVFQNKSDLLLQYNPVHKKVPVLVHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ESL+IL+YIDETWK NP+LP DPYERA ARFWA F + K     W++  S G ++E
Sbjct  63   KPIAESLVILKYIDETWKDNPILPRDPYERAMARFWAKFLDEKCRPALWKSYTSVGPERE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A   A E +  LE EL GK+FFGGE +G+LD+V  +V +   + +E   + +   +KFP
Sbjct  123  KAHEEAQELLSTLEGELKGKKFFGGETVGFLDIVANFVGYWAGVLQEAVGVDVLTEEKFP  182



>gb|KDP38795.1| hypothetical protein JCGZ_05131 [Jatropha curcas]
Length=228

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 136/185 (74%), Gaps = 1/185 (1%)
 Frame = +3

Query  39   IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVL  218
            + + ++ +K++G W SPF  RV+ AL++KG+ YE++EED+ NK+PLL + NP++ ++PVL
Sbjct  1    MASQDQAVKLLGGWFSPFAHRVEVALKLKGIPYEFLEEDLANKSPLLLKYNPIYKRIPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNP-LLPADPYERARARFWAGFAEFKILDPAWEALCSK  395
            V N +P+ ES LILEYIDETWKH+P LLP DPY++A ARFWA F + K+ +     + ++
Sbjct  61   VQNERPIVESQLILEYIDETWKHSPLLLPQDPYQKAMARFWANFIDDKLTEAVRRVIATE  120

Query  396  GKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
            G+ Q+  V  A+EA E LE E+ GK+FFGGE +G++D+V+GW+   L + EE   +KI++
Sbjct  121  GEAQQKEVKQAIEAFEVLEREIKGKKFFGGETVGFVDIVLGWITIWLEVVEETTCVKIYN  180

Query  576  SQKFP  590
             +K+P
Sbjct  181  PEKYP  185



>ref|XP_006849222.1| hypothetical protein AMTR_s00027p00229840 [Amborella trichopoda]
 gb|ERN10803.1| hypothetical protein AMTR_s00027p00229840 [Amborella trichopoda]
Length=226

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 135/184 (73%), Gaps = 1/184 (1%)
 Frame = +3

Query  39   IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVL  218
            + + E+ ++++G + SPFV RV+ AL++KG+EYEYIEED+ NK+PLL + NPVH K+PVL
Sbjct  1    MASKEQRVRLLGSFRSPFVHRVQLALKLKGIEYEYIEEDLKNKSPLLLKANPVHKKIPVL  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKG  398
            +H  KP+ ES++ILEYI+ETW  NP+LP DPY+RA+ARFWA F + K+L   W A  ++G
Sbjct  61   IHGDKPVCESVVILEYIEETWPENPILPKDPYDRAQARFWAKFIDEKVLLACWTAYSTQG  120

Query  399  KQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDS  578
             QQ  A+    E+++ LE  L GK FFGGE IG+LD+V  +++  + +  E A+++ +D+
Sbjct  121  VQQAKALEEFQESLKTLERGLKGK-FFGGENIGFLDIVANFLSLWMGVLGEAANIEHYDA  179

Query  579  QKFP  590
            +K P
Sbjct  180  EKTP  183



>ref|XP_010037769.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49508.1| hypothetical protein EUGRSUZ_K03029 [Eucalyptus grandis]
Length=226

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 124/180 (69%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIL-NKTPLLSQLNPVHAKVPVLVHNG  230
            E LK+ G W SPF  R++ AL++KG+EYEY+EEDI  NK+ LL + NPVH K+PVLVHNG
Sbjct  3    EELKLFGVWGSPFSRRIEIALKIKGVEYEYLEEDIFHNKSALLLKYNPVHKKIPVLVHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ES +ILEYIDETW  NP+LP DPY+RA ARFWA F + K +   W++L S G ++E
Sbjct  63   KPIAESQVILEYIDETWNDNPILPRDPYKRAMARFWAKFIDEKCVPAIWKSLTSVGPEKE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A   A E +  LE EL GK+FFGGE +G++D+V  ++ H +   +E A        KFP
Sbjct  123  KANEEACELLSTLEGELKGKKFFGGETVGFVDIVASFIGHWVGAVQEAAGFDFLTEDKFP  182



>ref|XP_010037776.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49511.1| hypothetical protein EUGRSUZ_K03034 [Eucalyptus grandis]
Length=226

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 124/180 (69%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDIL-NKTPLLSQLNPVHAKVPVLVHNG  230
            E LK+ G W SPF  R++ AL++KG+EYEY+EEDI  NK+ LL + NPVH K+PVLVHNG
Sbjct  3    EELKLFGVWGSPFSRRIEIALKIKGVEYEYLEEDIFHNKSALLLKYNPVHKKIPVLVHNG  62

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            KP+ ES +ILEYIDETW  NP+LP DPY+RA ARFWA F + K +   W++L S G ++E
Sbjct  63   KPIAESQVILEYIDETWNDNPILPRDPYKRAMARFWAKFIDEKCVPAIWKSLTSVGPEKE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A   A E +  LE EL GK+FFGGE +G++D+V  ++ H +   +E A        KFP
Sbjct  123  KANEEACELLSTLEGELKGKKFFGGETVGFVDIVASFIGHWVGAVQEAAGFDFLTEDKFP  182



>ref|XP_002275657.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=218

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 126/179 (70%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G WVS F LRV+ AL++KG++YEYIE D+ NK+PLL + NPVH KVPVL+HNGK
Sbjct  3    EEVKLIGMWVSSFSLRVEIALKLKGVQYEYIEVDLTNKSPLLLKSNPVHKKVPVLLHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWK NP+LP  PY+RA ARFWA + + K +   W+A   + K++E 
Sbjct  63   PIAESLVILEYIDETWKDNPILPQHPYDRAMARFWAKYIDEKCVPALWKACWCEEKEREK  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
            AV  A   ++ LE EL  K+FFGGE +G++D+V  ++   +    E   +++    KFP
Sbjct  123  AVEEACVCLKTLENELKDKKFFGGESVGFVDIVANFIGFWVGAIGEAVGVELLTRDKFP  181



>emb|CAN73675.1| hypothetical protein VITISV_001110 [Vitis vinifera]
Length=221

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 129/179 (72%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K+ G W SPF  R++ AL++KG+++EYIEE++ NK+P L + NPVH K+PVLVHNGK
Sbjct  3    EEVKLFGTWASPFSRRIEVALKLKGVQFEYIEENLXNKSPALLKYNPVHKKIPVLVHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETWKHNP+LP DPYE+A ARFWA + + K+   A + + SKG++Q++
Sbjct  63   PVAESLVILEYIDETWKHNPILPTDPYEKAMARFWAKYMDDKLWPAATKVVVSKGEEQKA  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             +    E ++ LE+EL  K+FFGGE +G++D+    +   L   E +  ++I   +KFP
Sbjct  123  VIEEIQEQLKTLESELKEKKFFGGESLGFVDIAANIIVFLLVAQEALGLMEILTEEKFP  181



>ref|XP_009399930.1| PREDICTED: probable glutathione S-transferase [Musa acuminata 
subsp. malaccensis]
Length=224

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 127/179 (71%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV   W SPF  RV+ ALR+KG+ YEYIEED+ NK+ LL + NPVH KVPVL+H+GK
Sbjct  3    EEVKVFRSWGSPFSYRVELALRLKGVAYEYIEEDLSNKSTLLLEYNPVHKKVPVLLHHGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYI+ETW+ NP+LP DP ERA ARFW+ F + K     W +  ++G+ Q++
Sbjct  63   PIAESLVILEYIEETWQENPILPKDPRERAVARFWSRFLDDKCSLALWMSCWTEGETQQN  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             +  A E +  LE EL GK+FFGG+ IG +D+   ++AH L + EEVA + + D +K+P
Sbjct  123  FMEQAKECLHLLEEELKGKKFFGGDSIGMVDIAASFIAHWLGVLEEVAGISLLDEEKYP  181



>ref|XP_010939722.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=237

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 128/188 (68%), Gaps = 2/188 (1%)
 Frame = +3

Query  33   VVIMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNK-TPLLSQLNPVHAKV  209
            +V   AE+ +K+ G W SPF LR +WAL++KG+EYEY+EED+ +K +  L + NPV  KV
Sbjct  12   IVEAMAEKRVKLFGMWCSPFALRAEWALKLKGVEYEYVEEDLFHKKSEELLRYNPVTKKV  71

Query  210  PVLVHNGKPLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEAL  386
            PVLVH+GKP+ ESL+I+EY+DE WK   P+LP DPYERA+ARFWA FAE KI    +   
Sbjct  72   PVLVHDGKPIAESLVIIEYVDEVWKDGYPILPKDPYERAQARFWAKFAEDKINPATFAVY  131

Query  387  CSKGKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLK  566
             + G+QQ+ A+  A E  + LE  L GK+FFGGE IG++D+  GW+   + I EE+  + 
Sbjct  132  STTGEQQQKALQDAQEVFKTLEEALKGKKFFGGETIGFVDIAAGWLPCWVRIIEEIVGIN  191

Query  567  IFDSQKFP  590
            I +    P
Sbjct  192  IVNENNLP  199



>ref|XP_010469949.1| PREDICTED: glutathione S-transferase U1 [Camelina sativa]
Length=224

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 116/156 (74%), Gaps = 0/156 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            EE +K++GFW SPF  RV+ AL++KG+ YEY+EED+ NKTPLL +LNP+H KVPVLVHN 
Sbjct  5    EETVKLLGFWGSPFSRRVEMALKLKGVPYEYLEEDLPNKTPLLLELNPLHKKVPVLVHND  64

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            K LPES LILEYID+TWK+NP+LP DPYE+A ARFWA F + +IL   + +L    K +E
Sbjct  65   KVLPESHLILEYIDQTWKNNPILPQDPYEKAMARFWAKFIDEQILTLGFRSLVKAEKGRE  124

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVG  518
             A+      +  LE E+ GK FFGG+ +G+LD+V G
Sbjct  125  VAIGETQAMLMFLEKEVTGKDFFGGKTVGFLDMVAG  160



>ref|NP_001238721.1| glutathione S-transferase GST 13 [Glycine max]
 gb|AAG34803.1|AF243368_1 glutathione S-transferase GST 13 [Glycine max]
 gb|KHN47445.1| Putative glutathione S-transferase [Glycine soja]
 gb|AJE59653.1| tau class glutathione S-transferase [Glycine max]
Length=220

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 127/180 (71%), Gaps = 0/180 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            EE ++++G W SPF  RV  AL++KG+ Y+Y EED+ NK+  L + NPVH KVPVLVHNG
Sbjct  6    EEEVRLLGKWASPFSNRVDLALKLKGVPYKYSEEDLANKSADLLKYNPVHKKVPVLVHNG  65

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             PLPESL+I+EYIDETWK+NPLLP DPYERA ARFW+   + KIL   W A  S    +E
Sbjct  66   NPLPESLIIVEYIDETWKNNPLLPQDPYERALARFWSKTLDDKILPAIWNACWSDENGRE  125

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             AV  A+EA++ L+  L  K+FFGGE IG +D+   ++ + + I +E+A L++   +KFP
Sbjct  126  KAVEEALEALKILQETLKDKKFFGGESIGLVDIAANFIGYWVAILQEIAGLELLTIEKFP  185



>gb|EYU26622.1| hypothetical protein MIMGU_mgv1a013365mg [Erythranthe guttata]
Length=222

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E ++V+G W SPF  RV+ AL+ KG+EYEYIE+D+ NK+PLL   NPVH KVPVL+HNGK
Sbjct  3    EEVQVLGSWASPFSKRVEMALKFKGVEYEYIEQDLKNKSPLLLNYNPVHKKVPVLLHNGK  62

Query  234  PLPESLLILEYIDETWKHN-PLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
            P+ ESL+ILEYID+TW+   P+LP DPY+RA ARFWA F + K +   W+A  S+G+++E
Sbjct  63   PIAESLIILEYIDDTWQQGPPILPKDPYQRAHARFWAKFVDDKCMPQVWKACWSEGEERE  122

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             A+  A +A+E LE E+ GK+FFGG+ +G +D    ++A+   I  E++ L+    +K+P
Sbjct  123  KAMEEASKALEFLENEIKGKKFFGGDNVGLVDFSANFLAYWCGILAELSGLQFLTEEKYP  182



>gb|KDP34500.1| hypothetical protein JCGZ_11050 [Jatropha curcas]
Length=224

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 130/179 (73%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SPF  R++ AL++KG++Y YIEED+ NK+PLL Q NPVH KVPVL+HNGK
Sbjct  3    EEVKLLGAWASPFSHRIELALKLKGIQYHYIEEDLFNKSPLLLQSNPVHKKVPVLIHNGK  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+IL+YI+ETW++NP+LP DPY+RA  RFWA F + KIL  A +   +KG++++ 
Sbjct  63   PISESLVILDYIEETWQNNPILPKDPYDRAVVRFWAKFIDEKILKIASKFKAAKGEEKKQ  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             +    E ++ LE EL  K+FFGGE IGYLD+V  ++ +   + +EV  +K    +KFP
Sbjct  123  VLEELGEQLKILEKELEEKEFFGGETIGYLDIVAFFIVYWFQVRQEVLQIKFISEEKFP  181



>ref|XP_008781207.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
 ref|XP_008781208.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=225

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 125/179 (70%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +KV G W SPF  RV  ALR+KG+ YEYIEED+ NK+ LL + NPVH KVPVLVH G+
Sbjct  3    EEVKVFGHWTSPFSCRVGIALRLKGVPYEYIEEDLSNKSSLLLEYNPVHKKVPVLVHGGR  62

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL++LEYI+ETW+ NP+LP DP+ RA ARFW  F + K +   W++L S+G+ Q+ 
Sbjct  63   PIAESLVVLEYIEETWRGNPMLPQDPHRRAMARFWTKFVDEKCMPIMWKSLWSEGEMQQK  122

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             +    E +  LE EL+GK+FFGG  IG +D+   ++++   + +EVA + +F+ +K P
Sbjct  123  LMEETNENLSILERELDGKKFFGGNSIGLVDIAANFLSYWTEVLQEVAGISLFNEEKHP  181



>ref|NP_001237856.1| uncharacterized protein LOC100500680 [Glycine max]
 gb|ACU15822.1| unknown [Glycine max]
Length=225

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 139/185 (75%), Gaps = 1/185 (1%)
 Frame = +3

Query  39   IMAAEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVL  218
            + A +E +K++G   SPFV RV+ AL++KG+EY+++EE++ NK+ LL + NPVH KVPV 
Sbjct  1    MAAGQEDVKLLGVVGSPFVCRVQIALKLKGIEYKFVEENLANKSDLLLKSNPVHKKVPVF  60

Query  219  VHNGKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCS-K  395
            +HN KP+ ESL+I+EYIDETWK+NP+LP++PY RA ARFW+ F + K+   AW+++ +  
Sbjct  61   IHNEKPIAESLVIVEYIDETWKNNPILPSEPYHRALARFWSKFIDDKVFGAAWKSVFTLD  120

Query  396  GKQQESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFD  575
             K++E  V  ++EA++ LE EL   +FFGGE+ G +D+   ++A  +PIF+E+A L+IF 
Sbjct  121  EKEREKNVEESLEALQFLENELKDNKFFGGEEFGLVDIAAIFIAFWIPIFQEIAGLQIFT  180

Query  576  SQKFP  590
            S+KFP
Sbjct  181  SEKFP  185



>gb|KDP42181.1| hypothetical protein JCGZ_02911 [Jatropha curcas]
Length=224

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 126/181 (70%), Gaps = 0/181 (0%)
 Frame = +3

Query  48   AEEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHN  227
             E  +K++G W SPF  R+K AL++KG++YEYIE+D+ NK+ LL + NPVH K+PVL+HN
Sbjct  2    GEGEVKLLGTWASPFSHRIKLALKLKGIQYEYIEQDLTNKSTLLLKSNPVHKKIPVLLHN  61

Query  228  GKPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQ  407
            GKP+ ESL+ILEY+DE W++NP LP DPY +A ARFWA F + KIL    +A  + G+++
Sbjct  62   GKPIAESLVILEYVDEKWQNNPFLPEDPYNKAMARFWATFVDQKILQVTLKASAATGEEK  121

Query  408  ESAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKF  587
            E  +    + ++ LE ELN K  FGGE IGYLD+V   + +   I +E+  +++   +KF
Sbjct  122  EQILEEVDQYLKLLENELNEKDLFGGENIGYLDIVAFSILYFFQIRKEIMRIELISEEKF  181

Query  588  P  590
            P
Sbjct  182  P  182



>ref|NP_180503.1| glutathione S-transferase tau 7 [Arabidopsis thaliana]
 sp|Q9ZW24.1|GSTU7_ARATH RecName: Full=Glutathione S-transferase U7; Short=AtGSTU7; AltName: 
Full=GST class-tau member 7; AltName: Full=Glutathione 
S-transferase 25 [Arabidopsis thaliana]
 gb|AAG30137.1|AF288188_1 glutathione S-transferase [Arabidopsis thaliana]
 gb|AAC95196.1| putative glutathione S-transferase [Arabidopsis thaliana]
 gb|AAK74037.1| At2g29420/F16P2.20 [Arabidopsis thaliana]
 gb|AAL06974.1| At2g29420/F16P2.20 [Arabidopsis thaliana]
 gb|AAM64426.1| putative glutathione S-transferase [Arabidopsis thaliana]
 gb|AEC08252.1| glutathione S-transferase tau 7 [Arabidopsis thaliana]
Length=227

 Score =   178 bits (451),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 125/179 (70%), Gaps = 0/179 (0%)
 Frame = +3

Query  54   EGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNGK  233
            E +K++G W SPF  R++ AL +KG+ YE++E+DI NK+ LL QLNPVH  +PVLVHNGK
Sbjct  8    EEVKLLGMWASPFSRRIEIALTLKGVSYEFLEQDITNKSSLLLQLNPVHKMIPVLVHNGK  67

Query  234  PLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQES  413
            P+ ESL+ILEYIDETW+ NP+LP DPYER  ARFW+ F + +I   A + +   GK++++
Sbjct  68   PISESLVILEYIDETWRDNPILPQDPYERTMARFWSKFVDEQIYVTAMKVVGKTGKERDA  127

Query  414  AVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             V +  + +  LE EL GK F GG+ +G++D+V   VA  L   EE+  +K+   +KFP
Sbjct  128  VVEATRDLLMFLEKELVGKDFLGGKSLGFVDIVATLVAFWLMRTEEIVGVKVVPVEKFP  186



>gb|ACU15611.1| unknown [Glycine max]
Length=217

 Score =   177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 126/180 (70%), Gaps = 0/180 (0%)
 Frame = +3

Query  51   EEGLKVVGFWVSPFVLRVKWALRMKGLEYEYIEEDILNKTPLLSQLNPVHAKVPVLVHNG  230
            EE ++++G W SPF  RV  AL++KG+ Y+Y EED+ NK+  L + NPVH KVPVLVHNG
Sbjct  6    EEEVRLLGKWASPFSNRVDLALKLKGVPYKYSEEDLANKSADLLKYNPVHKKVPVLVHNG  65

Query  231  KPLPESLLILEYIDETWKHNPLLPADPYERARARFWAGFAEFKILDPAWEALCSKGKQQE  410
             PLPESL+I+EYIDETWK+NPLLP DPYERA ARFW+   + KIL   W A  S    +E
Sbjct  66   NPLPESLIIVEYIDETWKNNPLLPQDPYERALARFWSKTLDDKILPAIWNACWSDENGRE  125

Query  411  SAVNSameamekleaelNGKQFFGGEKIGYLDLVVGWVAHNLPIFEEVASLKIFDSQKFP  590
             AV  A+EA++ L+  L  K+FFGGE IG +D+    + + + I +E+A L++   +KFP
Sbjct  126  KAVEEALEALKILQETLKDKKFFGGESIGLVDIAANLIGYWVAILQEIAGLELLTIEKFP  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160