BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP001F04 635 bp,:PolyA

Length=576
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KGN63923.1|  hypothetical protein Csa_1G027520                       310   2e-103   Cucumis sativus [cucumbers]
ref|XP_007017105.1|  Leucine-rich repeat protein kinase family pr...    327   2e-102   Theobroma cacao [chocolate]
emb|CAN75549.1|  hypothetical protein VITISV_043541                     324   2e-102   Vitis vinifera
ref|XP_007017104.1|  Leucine-rich repeat protein kinase family pr...    328   2e-102   Theobroma cacao [chocolate]
emb|CBI15799.3|  unnamed protein product                                325   3e-101   Vitis vinifera
ref|XP_002276020.1|  PREDICTED: probable LRR receptor-like serine...    324   3e-101   Vitis vinifera
ref|XP_008239253.1|  PREDICTED: probable LRR receptor-like serine...    323   6e-101   Prunus mume [ume]
ref|XP_007206440.1|  hypothetical protein PRUPE_ppa000952mg             323   6e-101   Prunus persica
ref|XP_009768306.1|  PREDICTED: probable LRR receptor-like serine...    322   3e-100   Nicotiana sylvestris
ref|XP_008782698.1|  PREDICTED: probable LRR receptor-like serine...    319   4e-100   
gb|KHG15448.1|  hypothetical protein F383_00176                         321   5e-100   Gossypium arboreum [tree cotton]
ref|XP_008366212.1|  PREDICTED: probable LRR receptor-like serine...    321   7e-100   
ref|XP_010094444.1|  putative LRR receptor-like serine/threonine-...    321   1e-99    Morus notabilis
gb|KJB83922.1|  hypothetical protein B456_013G271600                    320   1e-99    Gossypium raimondii
ref|XP_008782697.1|  PREDICTED: probable LRR receptor-like serine...    320   1e-99    Phoenix dactylifera
ref|XP_011461391.1|  PREDICTED: probable LRR receptor-like serine...    320   1e-99    Fragaria vesca subsp. vesca
gb|KDO54930.1|  hypothetical protein CISIN_1g002174mg                   315   1e-99    Citrus sinensis [Valencia orange]
ref|XP_011461389.1|  PREDICTED: probable LRR receptor-like serine...    320   1e-99    Fragaria vesca subsp. vesca
ref|XP_002533344.1|  protein with unknown function                      317   2e-99    
ref|XP_009374400.1|  PREDICTED: probable LRR receptor-like serine...    319   2e-99    Pyrus x bretschneideri [bai li]
ref|XP_010326255.1|  PREDICTED: probable LRR receptor-like serine...    318   3e-99    Solanum lycopersicum
ref|XP_004247017.1|  PREDICTED: probable LRR receptor-like serine...    318   4e-99    Solanum lycopersicum
ref|XP_009374406.1|  PREDICTED: probable LRR receptor-like serine...    318   5e-99    Pyrus x bretschneideri [bai li]
emb|CDP04034.1|  unnamed protein product                                318   6e-99    Coffea canephora [robusta coffee]
ref|XP_010032944.1|  PREDICTED: probable LRR receptor-like serine...    318   7e-99    Eucalyptus grandis [rose gum]
ref|XP_006344368.1|  PREDICTED: probable LRR receptor-like serine...    318   7e-99    Solanum tuberosum [potatoes]
ref|XP_009628064.1|  PREDICTED: probable LRR receptor-like serine...    318   7e-99    Nicotiana tomentosiformis
ref|XP_006464963.1|  PREDICTED: probable LRR receptor-like serine...    315   1e-98    Citrus sinensis [Valencia orange]
ref|XP_008354310.1|  PREDICTED: probable LRR receptor-like serine...    309   1e-98    Malus domestica [apple tree]
gb|AFW78405.1|  putative leucine-rich repeat receptor-like protei...    296   4e-98    Zea mays [maize]
gb|KDP45677.1|  hypothetical protein JCGZ_17284                         316   5e-98    Jatropha curcas
ref|XP_009355132.1|  PREDICTED: probable LRR receptor-like serine...    316   5e-98    Pyrus x bretschneideri [bai li]
gb|KDO54922.1|  hypothetical protein CISIN_1g002174mg                   315   6e-98    Citrus sinensis [Valencia orange]
ref|XP_008354331.1|  PREDICTED: probable LRR receptor-like serine...    315   6e-98    
ref|XP_010675302.1|  PREDICTED: probable LRR receptor-like serine...    315   7e-98    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010675301.1|  PREDICTED: probable LRR receptor-like serine...    315   7e-98    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009355137.1|  PREDICTED: probable LRR receptor-like serine...    315   7e-98    Pyrus x bretschneideri [bai li]
ref|XP_006432044.1|  hypothetical protein CICLE_v10000174mg             315   8e-98    Citrus clementina
ref|XP_010921201.1|  PREDICTED: probable LRR receptor-like serine...    314   1e-97    Elaeis guineensis
ref|XP_010278952.1|  PREDICTED: probable LRR receptor-like serine...    314   2e-97    Nelumbo nucifera [Indian lotus]
ref|XP_004137372.1|  PREDICTED: probable LRR receptor-like serine...    314   2e-97    Cucumis sativus [cucumbers]
ref|XP_011089544.1|  PREDICTED: probable LRR receptor-like serine...    314   2e-97    Sesamum indicum [beniseed]
ref|XP_003537371.1|  PREDICTED: probable LRR receptor-like serine...    313   6e-97    Glycine max [soybeans]
gb|KCW52448.1|  hypothetical protein EUGRSUZ_J01846                     313   9e-97    Eucalyptus grandis [rose gum]
ref|XP_008649785.1|  PREDICTED: probable LRR receptor-like serine...    295   2e-96    Zea mays [maize]
ref|XP_008457284.1|  PREDICTED: probable LRR receptor-like serine...    311   3e-96    Cucumis melo [Oriental melon]
gb|KHN18646.1|  Putative LRR receptor-like serine/threonine-prote...    310   1e-95    Glycine soja [wild soybean]
ref|XP_003552905.1|  PREDICTED: probable LRR receptor-like serine...    310   1e-95    Glycine max [soybeans]
ref|XP_002319433.2|  hypothetical protein POPTR_0013s15520g             310   1e-95    Populus trichocarpa [western balsam poplar]
ref|XP_004500393.1|  PREDICTED: probable LRR receptor-like serine...    308   4e-95    Cicer arietinum [garbanzo]
dbj|BAD87127.1|  receptor protein kinase-like                           292   6e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010922797.1|  PREDICTED: probable LRR receptor-like serine...    306   7e-95    Elaeis guineensis
ref|XP_007146906.1|  hypothetical protein PHAVU_006G080500g             307   8e-95    Phaseolus vulgaris [French bean]
ref|XP_002447392.1|  hypothetical protein SORBIDRAFT_06g000230          288   9e-95    Sorghum bicolor [broomcorn]
ref|XP_003600556.1|  hypothetical protein MTR_3g062590                  307   1e-94    Medicago truncatula
ref|XP_002326064.2|  leucine-rich repeat transmembrane protein ki...    306   1e-94    Populus trichocarpa [western balsam poplar]
ref|XP_011041757.1|  PREDICTED: probable LRR receptor-like serine...    307   1e-94    Populus euphratica
tpg|DAA38792.1|  TPA: putative leucine-rich repeat receptor-like ...    296   2e-94    Zea mays [maize]
ref|XP_011080636.1|  PREDICTED: probable LRR receptor-like serine...    306   2e-94    Sesamum indicum [beniseed]
ref|XP_010922796.1|  PREDICTED: probable LRR receptor-like serine...    306   2e-94    Elaeis guineensis
ref|XP_010457836.1|  PREDICTED: probable LRR receptor-like serine...    305   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_011011783.1|  PREDICTED: probable LRR receptor-like serine...    304   8e-94    Populus euphratica
ref|XP_011011784.1|  PREDICTED: probable LRR receptor-like serine...    303   1e-93    Populus euphratica
ref|XP_011011778.1|  PREDICTED: probable LRR receptor-like serine...    304   1e-93    Populus euphratica
ref|XP_010475436.1|  PREDICTED: probable LRR receptor-like serine...    302   2e-93    Camelina sativa [gold-of-pleasure]
ref|XP_002892361.1|  predicted protein                                  303   2e-93    Arabidopsis lyrata subsp. lyrata
ref|XP_006306699.1|  hypothetical protein CARUB_v10008222mg             303   2e-93    Capsella rubella
ref|XP_010486768.1|  PREDICTED: probable LRR receptor-like serine...    302   2e-93    Camelina sativa [gold-of-pleasure]
gb|KFK42998.1|  hypothetical protein AALP_AA1G066200                    302   5e-93    Arabis alpina [alpine rockcress]
ref|XP_010457834.1|  PREDICTED: probable LRR receptor-like serine...    303   7e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010475435.1|  PREDICTED: probable LRR receptor-like serine...    302   8e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010486760.1|  PREDICTED: probable LRR receptor-like serine...    301   9e-93    Camelina sativa [gold-of-pleasure]
ref|XP_008803012.1|  PREDICTED: probable LRR receptor-like serine...    300   4e-92    Phoenix dactylifera
ref|XP_011466400.1|  PREDICTED: probable LRR receptor-like serine...    281   4e-92    Fragaria vesca subsp. vesca
ref|XP_004974947.1|  PREDICTED: probable LRR receptor-like serine...    300   6e-92    Setaria italica
ref|XP_008669743.1|  PREDICTED: probable LRR receptor-like serine...    300   6e-92    Zea mays [maize]
ref|NP_172169.2|  probable LRR receptor-like serine/threonine-pro...    300   6e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417874.1|  hypothetical protein EUTSA_v10006712mg             300   6e-92    Eutrema salsugineum
ref|XP_009406863.1|  PREDICTED: probable LRR receptor-like serine...    299   7e-92    Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW78403.1|  putative leucine-rich repeat receptor-like protei...    297   8e-92    Zea mays [maize]
gb|AAF63151.1|AC011001_21  Hypothetical protein                         297   2e-91    Arabidopsis thaliana [mouse-ear cress]
emb|CDY10230.1|  BnaC05g04730D                                          298   2e-91    Brassica napus [oilseed rape]
ref|XP_009119026.1|  PREDICTED: probable LRR receptor-like serine...    298   2e-91    Brassica rapa
ref|XP_009783324.1|  PREDICTED: probable LRR receptor-like serine...    297   2e-91    Nicotiana sylvestris
ref|XP_002319436.2|  hypothetical protein POPTR_0013s15550g             293   2e-91    Populus trichocarpa [western balsam poplar]
emb|CDY54882.1|  BnaA10g27950D                                          298   2e-91    Brassica napus [oilseed rape]
ref|XP_010278958.1|  PREDICTED: probable LRR receptor-like serine...    296   2e-91    Nelumbo nucifera [Indian lotus]
ref|XP_002439970.1|  hypothetical protein SORBIDRAFT_09g023620          297   3e-91    Sorghum bicolor [broomcorn]
ref|XP_008649777.1|  PREDICTED: probable LRR receptor-like serine...    297   4e-91    Zea mays [maize]
ref|XP_006842574.1|  hypothetical protein AMTR_s00077p00152440          296   5e-91    
gb|KEH34525.1|  LRR receptor-like kinase                                291   8e-91    Medicago truncatula
gb|AFW78415.1|  putative leucine-rich repeat receptor-like protei...    295   8e-91    Zea mays [maize]
gb|EMT18733.1|  Putative LRR receptor-like serine/threonine-prote...    285   8e-91    Aegilops tauschii
ref|XP_006376568.1|  hypothetical protein POPTR_0013s15550g             293   2e-90    Populus trichocarpa [western balsam poplar]
gb|EEC72208.1|  hypothetical protein OsI_05296                          295   2e-90    Oryza sativa Indica Group [Indian rice]
ref|NP_001045466.1|  Os01g0960400                                       295   2e-90    
ref|XP_006842576.1|  hypothetical protein AMTR_s00077p00154750          295   2e-90    Amborella trichopoda
ref|XP_006645416.1|  PREDICTED: probable LRR receptor-like serine...    295   2e-90    Oryza brachyantha
ref|XP_006376567.1|  hypothetical protein POPTR_0013s15550g             293   3e-90    Populus trichocarpa [western balsam poplar]
ref|XP_009621388.1|  PREDICTED: probable LRR receptor-like serine...    293   3e-90    Nicotiana tomentosiformis
dbj|BAG94134.1|  unnamed protein product                                277   4e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010522022.1|  PREDICTED: probable LRR receptor-like serine...    293   4e-90    Tarenaya hassleriana [spider flower]
ref|XP_011001645.1|  PREDICTED: probable LRR receptor-like serine...    295   4e-90    Populus euphratica
ref|XP_008649789.1|  PREDICTED: probable LRR receptor-like serine...    295   4e-90    Zea mays [maize]
gb|KEH34526.1|  LRR receptor-like kinase                                292   5e-90    Medicago truncatula
ref|XP_008649788.1|  PREDICTED: probable LRR receptor-like serine...    295   5e-90    Zea mays [maize]
ref|XP_011001644.1|  PREDICTED: probable LRR receptor-like serine...    295   5e-90    Populus euphratica
ref|XP_009783321.1|  PREDICTED: probable LRR receptor-like serine...    294   7e-90    Nicotiana sylvestris
ref|XP_009783320.1|  PREDICTED: probable LRR receptor-like serine...    294   9e-90    Nicotiana sylvestris
gb|AFW78404.1|  putative leucine-rich repeat receptor-like protei...    289   9e-90    Zea mays [maize]
ref|XP_010522021.1|  PREDICTED: probable LRR receptor-like serine...    294   9e-90    Tarenaya hassleriana [spider flower]
ref|XP_004961725.1|  PREDICTED: probable LRR receptor-like serine...    293   1e-89    Setaria italica
ref|XP_009621385.1|  PREDICTED: probable LRR receptor-like serine...    293   1e-89    Nicotiana tomentosiformis
ref|XP_003600554.1|  hypothetical protein MTR_3g062570                  293   1e-89    
gb|AES70805.2|  LRR receptor-like kinase                                293   2e-89    Medicago truncatula
gb|KDP21843.1|  hypothetical protein JCGZ_00630                         293   3e-89    Jatropha curcas
ref|XP_003565200.1|  PREDICTED: probable LRR receptor-like serine...    292   3e-89    Brachypodium distachyon [annual false brome]
ref|XP_002531806.1|  ATP binding protein, putative                      292   4e-89    Ricinus communis
ref|XP_010043831.1|  PREDICTED: probable LRR receptor-like serine...    291   5e-89    Eucalyptus grandis [rose gum]
ref|XP_010542705.1|  PREDICTED: probable LRR receptor-like serine...    292   5e-89    Tarenaya hassleriana [spider flower]
ref|XP_004490733.1|  PREDICTED: probable LRR receptor-like serine...    290   5e-89    
ref|XP_010043840.1|  PREDICTED: probable LRR receptor-like serine...    291   6e-89    Eucalyptus grandis [rose gum]
ref|XP_010043852.1|  PREDICTED: probable LRR receptor-like serine...    291   7e-89    Eucalyptus grandis [rose gum]
tpg|DAA57081.1|  TPA: putative leucine-rich repeat receptor-like ...    287   7e-89    Zea mays [maize]
gb|AFW78402.1|  putative leucine-rich repeat receptor-like protei...    291   7e-89    Zea mays [maize]
ref|XP_004490730.1|  PREDICTED: probable LRR receptor-like serine...    291   9e-89    
ref|XP_010244582.1|  PREDICTED: probable LRR receptor-like serine...    288   1e-88    Nelumbo nucifera [Indian lotus]
ref|XP_011006277.1|  PREDICTED: probable LRR receptor-like serine...    291   1e-88    Populus euphratica
gb|KDO64177.1|  hypothetical protein CISIN_1g002158mg                   290   1e-88    Citrus sinensis [Valencia orange]
ref|XP_006481245.1|  PREDICTED: probable LRR receptor-like serine...    289   2e-88    Citrus sinensis [Valencia orange]
ref|XP_011006276.1|  PREDICTED: probable LRR receptor-like serine...    290   2e-88    Populus euphratica
ref|XP_010043866.1|  PREDICTED: probable LRR receptor-like serine...    290   2e-88    Eucalyptus grandis [rose gum]
dbj|BAD73350.1|  protein kinase-like                                    279   2e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002323098.2|  hypothetical protein POPTR_0016s14720g             290   2e-88    Populus trichocarpa [western balsam poplar]
ref|XP_006481243.1|  PREDICTED: probable LRR receptor-like serine...    290   3e-88    Citrus sinensis [Valencia orange]
ref|XP_006481242.1|  PREDICTED: probable LRR receptor-like serine...    290   3e-88    Citrus sinensis [Valencia orange]
ref|XP_008652670.1|  PREDICTED: probable LRR receptor-like serine...    288   3e-88    Zea mays [maize]
ref|XP_006842575.1|  hypothetical protein AMTR_s00077p00153450          288   3e-88    
ref|XP_006575460.1|  PREDICTED: probable LRR receptor-like serine...    288   3e-88    Glycine max [soybeans]
ref|XP_007033464.1|  Leucine-rich repeat protein kinase family pr...    289   4e-88    Theobroma cacao [chocolate]
ref|XP_006429640.1|  hypothetical protein CICLE_v10013792mg             290   4e-88    Citrus clementina
ref|XP_010244581.1|  PREDICTED: probable LRR receptor-like serine...    287   7e-88    Nelumbo nucifera [Indian lotus]
ref|XP_006575461.1|  PREDICTED: probable LRR receptor-like serine...    287   8e-88    Glycine max [soybeans]
ref|XP_008652663.1|  PREDICTED: probable LRR receptor-like serine...    288   9e-88    Zea mays [maize]
gb|KHN40999.1|  Putative LRR receptor-like serine/threonine-prote...    288   9e-88    Glycine soja [wild soybean]
ref|XP_010244577.1|  PREDICTED: probable LRR receptor-like serine...    288   1e-87    Nelumbo nucifera [Indian lotus]
gb|KJB27626.1|  hypothetical protein B456_005G002700                    280   4e-87    Gossypium raimondii
ref|XP_003616057.1|  Protein kinase-like protein                        286   4e-87    Medicago truncatula
gb|KHN30616.1|  Putative LRR receptor-like serine/threonine-prote...    284   7e-87    Glycine soja [wild soybean]
ref|XP_004500392.1|  PREDICTED: probable LRR receptor-like serine...    285   9e-87    Cicer arietinum [garbanzo]
gb|EPS60654.1|  hypothetical protein M569_14148                         284   1e-86    Genlisea aurea
ref|XP_006596482.1|  PREDICTED: probable LRR receptor-like serine...    284   1e-86    Glycine max [soybeans]
ref|XP_004970379.1|  PREDICTED: probable LRR receptor-like serine...    284   2e-86    Setaria italica
ref|XP_006596480.1|  PREDICTED: probable LRR receptor-like serine...    284   3e-86    Glycine max [soybeans]
ref|XP_007142004.1|  hypothetical protein PHAVU_008G244400g             284   3e-86    Phaseolus vulgaris [French bean]
ref|XP_011018958.1|  PREDICTED: probable LRR receptor-like serine...    283   7e-86    Populus euphratica
ref|XP_011018957.1|  PREDICTED: probable LRR receptor-like serine...    283   8e-86    Populus euphratica
gb|EPS63348.1|  hypothetical protein M569_11437                         281   1e-85    Genlisea aurea
ref|XP_004247008.1|  PREDICTED: probable LRR receptor-like serine...    282   2e-85    Solanum lycopersicum
ref|XP_003567224.1|  PREDICTED: probable LRR receptor-like serine...    282   2e-85    Brachypodium distachyon [annual false brome]
ref|XP_010326251.1|  PREDICTED: probable LRR receptor-like serine...    281   2e-85    Solanum lycopersicum
ref|XP_006359984.1|  PREDICTED: probable LRR receptor-like serine...    282   2e-85    
ref|XP_006644909.1|  PREDICTED: probable LRR receptor-like serine...    282   2e-85    
ref|XP_007205469.1|  hypothetical protein PRUPE_ppa008002mg             267   3e-85    Prunus persica
gb|EMT12400.1|  Putative LRR receptor-like serine/threonine-prote...    281   4e-85    Aegilops tauschii
ref|XP_008366925.1|  PREDICTED: probable LRR receptor-like serine...    266   5e-85    Malus domestica [apple tree]
gb|KJB27625.1|  hypothetical protein B456_005G002700                    281   6e-85    Gossypium raimondii
gb|EEC79410.1|  hypothetical protein OsI_20362                          281   6e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_002458681.1|  hypothetical protein SORBIDRAFT_03g038090          281   7e-85    Sorghum bicolor [broomcorn]
ref|XP_006381260.1|  hypothetical protein POPTR_0006s11180g             280   8e-85    Populus trichocarpa [western balsam poplar]
gb|EYU46036.1|  hypothetical protein MIMGU_mgv1a021178mg                280   8e-85    Erythranthe guttata [common monkey flower]
ref|NP_001240130.1|  probable LRR receptor-like serine/threonine-...    277   9e-85    Glycine max [soybeans]
ref|NP_001174468.1|  Os05g0481100                                       280   1e-84    
ref|XP_010098600.1|  putative LRR receptor-like serine/threonine-...    280   1e-84    Morus notabilis
gb|EEC71706.1|  hypothetical protein OsI_04218                          279   1e-84    Oryza sativa Indica Group [Indian rice]
gb|KHN29480.1|  Putative LRR receptor-like serine/threonine-prote...    280   2e-84    Glycine soja [wild soybean]
gb|EEE64118.1|  hypothetical protein OsJ_18950                          280   2e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654549.1|  PREDICTED: probable LRR receptor-like serine...    279   2e-84    Oryza brachyantha
gb|EEE55585.1|  hypothetical protein OsJ_03881                          279   2e-84    Oryza sativa Japonica Group [Japonica rice]
gb|KHG06096.1|  hypothetical protein F383_05597                         276   2e-84    Gossypium arboreum [tree cotton]
ref|XP_006587902.1|  PREDICTED: probable LRR receptor-like serine...    279   2e-84    Glycine max [soybeans]
ref|XP_003533651.1|  PREDICTED: probable LRR receptor-like serine...    279   2e-84    Glycine max [soybeans]
dbj|BAK03216.1|  predicted protein                                      271   2e-84    Hordeum vulgare subsp. vulgare [barley]
ref|XP_010653122.1|  PREDICTED: probable LRR receptor-like serine...    278   3e-84    Vitis vinifera
ref|XP_007033468.1|  LRR receptor-like serine/threonine-protein k...    279   3e-84    Theobroma cacao [chocolate]
ref|XP_009395171.1|  PREDICTED: probable LRR receptor-like serine...    278   3e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006362336.1|  PREDICTED: probable LRR receptor-like serine...    278   4e-84    Solanum tuberosum [potatoes]
ref|XP_002266206.1|  PREDICTED: probable LRR receptor-like serine...    278   4e-84    Vitis vinifera
ref|XP_010653120.1|  PREDICTED: probable LRR receptor-like serine...    278   4e-84    Vitis vinifera
emb|CDP06372.1|  unnamed protein product                                278   5e-84    Coffea canephora [robusta coffee]
ref|XP_003552328.1|  PREDICTED: probable LRR receptor-like serine...    278   5e-84    Glycine max [soybeans]
ref|XP_004249029.1|  PREDICTED: probable LRR receptor-like serine...    278   5e-84    Solanum lycopersicum
gb|KHN30615.1|  Putative LRR receptor-like serine/threonine-prote...    278   6e-84    Glycine soja [wild soybean]
gb|KHN40602.1|  Putative LRR receptor-like serine/threonine-prote...    278   6e-84    Glycine soja [wild soybean]
ref|XP_006595541.1|  PREDICTED: probable LRR receptor-like serine...    278   6e-84    Glycine max [soybeans]
ref|XP_002323097.2|  hypothetical protein POPTR_0016s14710g             272   7e-84    Populus trichocarpa [western balsam poplar]
ref|XP_004163829.1|  PREDICTED: probable LRR receptor-like serine...    270   7e-84    
ref|XP_009395172.1|  PREDICTED: probable LRR receptor-like serine...    276   8e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010231258.1|  PREDICTED: probable LRR receptor-like serine...    275   2e-83    Brachypodium distachyon [annual false brome]
dbj|BAJ98336.1|  predicted protein                                      276   2e-83    Hordeum vulgare subsp. vulgare [barley]
dbj|BAK06660.1|  predicted protein                                      276   3e-83    Hordeum vulgare subsp. vulgare [barley]
gb|KJB29851.1|  hypothetical protein B456_005G121200                    276   3e-83    Gossypium raimondii
ref|XP_009337807.1|  PREDICTED: probable LRR receptor-like serine...    276   4e-83    Pyrus x bretschneideri [bai li]
ref|XP_003568234.2|  PREDICTED: probable LRR receptor-like serine...    276   4e-83    
emb|CBI31162.3|  unnamed protein product                                280   6e-83    Vitis vinifera
emb|CDM84746.1|  unnamed protein product                                274   6e-83    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003623645.1|  Leucine-rich repeat protein kinase                 276   8e-83    
ref|XP_008244528.1|  PREDICTED: probable LRR receptor-like serine...    272   1e-82    Prunus mume [ume]
ref|XP_004142673.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    274   1e-82    
ref|XP_007140045.1|  hypothetical protein PHAVU_008G079800g             274   1e-82    Phaseolus vulgaris [French bean]
ref|XP_008244520.1|  PREDICTED: probable LRR receptor-like serine...    274   1e-82    Prunus mume [ume]
gb|KEH23301.1|  LRR receptor-like kinase                                271   2e-82    Medicago truncatula
gb|KHG26417.1|  hypothetical protein F383_04408                         274   2e-82    Gossypium arboreum [tree cotton]
ref|XP_008463287.1|  PREDICTED: probable LRR receptor-like serine...    274   2e-82    Cucumis melo [Oriental melon]
ref|XP_008463289.1|  PREDICTED: probable LRR receptor-like serine...    273   2e-82    Cucumis melo [Oriental melon]
ref|XP_009614147.1|  PREDICTED: probable LRR receptor-like serine...    273   3e-82    Nicotiana tomentosiformis
gb|KHG26416.1|  hypothetical protein F383_04408                         273   3e-82    Gossypium arboreum [tree cotton]
ref|XP_010683436.1|  PREDICTED: probable LRR receptor-like serine...    273   3e-82    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009780438.1|  PREDICTED: probable LRR receptor-like serine...    273   4e-82    Nicotiana sylvestris
ref|XP_010683435.1|  PREDICTED: probable LRR receptor-like serine...    273   5e-82    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008350579.1|  PREDICTED: probable LRR receptor-like serine...    271   6e-82    
gb|EMT05020.1|  Putative LRR receptor-like serine/threonine-prote...    272   6e-82    Aegilops tauschii
gb|KEH23302.1|  LRR receptor-like kinase                                271   8e-82    Medicago truncatula
gb|KGN54467.1|  hypothetical protein Csa_4G336750                       272   1e-81    Cucumis sativus [cucumbers]
ref|XP_008350578.1|  PREDICTED: probable LRR receptor-like serine...    272   1e-81    Malus domestica [apple tree]
ref|XP_009370883.1|  PREDICTED: probable LRR receptor-like serine...    271   1e-81    Pyrus x bretschneideri [bai li]
ref|XP_007142017.1|  hypothetical protein PHAVU_008G245600g             271   2e-81    Phaseolus vulgaris [French bean]
gb|AES79863.2|  LRR receptor-like kinase                                271   2e-81    Medicago truncatula
ref|XP_007206541.1|  hypothetical protein PRUPE_ppa018820mg             271   2e-81    Prunus persica
gb|EMT31232.1|  Putative LRR receptor-like serine/threonine-prote...    270   3e-81    Aegilops tauschii
emb|CDM84748.1|  unnamed protein product                                266   3e-81    Triticum aestivum [Canadian hard winter wheat]
ref|XP_011001647.1|  PREDICTED: probable LRR receptor-like serine...    267   5e-80    Populus euphratica
ref|XP_010067119.1|  PREDICTED: probable LRR receptor-like serine...    265   6e-80    Eucalyptus grandis [rose gum]
ref|XP_008244509.1|  PREDICTED: probable LRR receptor-like serine...    267   7e-80    
gb|KCW88415.1|  hypothetical protein EUGRSUZ_A00802                     266   7e-80    Eucalyptus grandis [rose gum]
gb|EMT31233.1|  Putative LRR receptor-like serine/threonine-prote...    266   9e-80    Aegilops tauschii
ref|XP_002323095.2|  hypothetical protein POPTR_0016s14690g             265   9e-80    Populus trichocarpa [western balsam poplar]
ref|XP_008388895.1|  PREDICTED: probable LRR receptor-like serine...    266   1e-79    
ref|XP_011001639.1|  PREDICTED: probable LRR receptor-like serine...    266   1e-79    Populus euphratica
ref|XP_011001640.1|  PREDICTED: probable LRR receptor-like serine...    266   2e-79    Populus euphratica
ref|XP_002987562.1|  hypothetical protein SELMODRAFT_10265              265   2e-79    Selaginella moellendorffii
ref|XP_007142006.1|  hypothetical protein PHAVU_008G244600g             255   2e-79    Phaseolus vulgaris [French bean]
ref|XP_011001641.1|  PREDICTED: probable LRR receptor-like serine...    265   2e-79    Populus euphratica
ref|XP_010043804.1|  PREDICTED: probable LRR receptor-like serine...    265   3e-79    Eucalyptus grandis [rose gum]
ref|XP_010553166.1|  PREDICTED: probable LRR receptor-like serine...    265   4e-79    Tarenaya hassleriana [spider flower]
gb|AES77893.2|  LRR receptor-like kinase                                265   6e-79    Medicago truncatula
ref|XP_003621675.1|  Receptor protein kinase-like protein               265   6e-79    
ref|XP_002992827.1|  hypothetical protein SELMODRAFT_136038             263   1e-78    Selaginella moellendorffii
ref|XP_007208638.1|  hypothetical protein PRUPE_ppa020089mg             263   1e-78    Prunus persica
ref|XP_011095176.1|  PREDICTED: probable LRR receptor-like serine...    263   3e-78    Sesamum indicum [beniseed]
dbj|BAF01740.1|  hypothetical protein                                   254   5e-77    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ97393.1|  predicted protein                                      258   9e-77    Hordeum vulgare subsp. vulgare [barley]
ref|XP_008344795.1|  PREDICTED: probable LRR receptor-like serine...    240   1e-76    
ref|XP_009614146.1|  PREDICTED: probable LRR receptor-like serine...    258   1e-76    Nicotiana tomentosiformis
ref|XP_010424012.1|  PREDICTED: probable LRR receptor-like serine...    253   1e-76    Camelina sativa [gold-of-pleasure]
gb|KJB71495.1|  hypothetical protein B456_011G125500                    258   2e-76    Gossypium raimondii
ref|NP_195815.3|  leucine-rich repeat protein kinase-like protein       257   3e-76    Arabidopsis thaliana [mouse-ear cress]
emb|CAB82765.1|  putative protein                                       257   4e-76    Arabidopsis thaliana [mouse-ear cress]
dbj|BAF46308.1|  leucine-rich repeat transmembrane protein kinase       244   4e-76    Ipomoea nil [qian niu]
ref|XP_010496824.1|  PREDICTED: probable LRR receptor-like serine...    252   7e-76    Camelina sativa [gold-of-pleasure]
ref|XP_010490488.1|  PREDICTED: probable LRR receptor-like serine...    255   1e-75    Camelina sativa [gold-of-pleasure]
ref|XP_002870890.1|  ATP binding protein                                253   5e-75    Arabidopsis lyrata subsp. lyrata
ref|XP_010653123.1|  PREDICTED: probable LRR receptor-like serine...    253   9e-75    Vitis vinifera
ref|XP_003632548.1|  PREDICTED: probable LRR receptor-like serine...    253   1e-74    Vitis vinifera
ref|XP_009780439.1|  PREDICTED: probable LRR receptor-like serine...    251   5e-74    Nicotiana sylvestris
emb|CDY61604.1|  BnaC03g71330D                                          249   1e-73    Brassica napus [oilseed rape]
ref|XP_009130611.1|  PREDICTED: probable LRR receptor-like serine...    249   2e-73    Brassica rapa
emb|CDY57828.1|  BnaCnng32490D                                          249   2e-73    Brassica napus [oilseed rape]
gb|EYU42054.1|  hypothetical protein MIMGU_mgv1a000864mg                248   4e-73    Erythranthe guttata [common monkey flower]
ref|XP_010543142.1|  PREDICTED: probable LRR receptor-like serine...    247   7e-73    Tarenaya hassleriana [spider flower]
gb|KDO54923.1|  hypothetical protein CISIN_1g002174mg                   246   7e-73    Citrus sinensis [Valencia orange]
ref|XP_007142011.1|  hypothetical protein PHAVU_008G245000g             246   7e-73    Phaseolus vulgaris [French bean]
ref|XP_006360628.1|  PREDICTED: probable LRR receptor-like serine...    247   1e-72    Solanum tuberosum [potatoes]
ref|XP_001773507.1|  predicted protein                                  246   1e-72    Physcomitrella patens
ref|XP_010327702.1|  PREDICTED: probable LRR receptor-like serine...    244   7e-72    Solanum lycopersicum
ref|XP_001782094.1|  predicted protein                                  242   1e-71    Physcomitrella patens
ref|XP_004249703.1|  PREDICTED: probable LRR receptor-like serine...    244   1e-71    Solanum lycopersicum
ref|XP_006362355.1|  PREDICTED: probable LRR receptor-like serine...    243   4e-71    
dbj|BAB10966.1|  receptor protein kinase-like protein                   242   7e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006360624.1|  PREDICTED: probable LRR receptor-like serine...    241   1e-70    
sp|C0LGU1.1|Y5374_ARATH  RecName: Full=Probable LRR receptor-like...    241   2e-70    
ref|NP_198561.1|  probable LRR receptor-like serine/threonine-pro...    240   2e-70    
ref|XP_006286080.1|  hypothetical protein CARUB_v10007617mg             240   3e-70    
ref|XP_007140047.1|  hypothetical protein PHAVU_008G080000g             240   3e-70    
emb|CDP01074.1|  unnamed protein product                                233   8e-70    
emb|CAN80670.1|  hypothetical protein VITISV_025635                     237   1e-69    
ref|XP_002870531.1|  hypothetical protein ARALYDRAFT_493720             238   2e-69    
ref|XP_010450496.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    238   2e-69    
ref|XP_003551621.1|  PREDICTED: probable LRR receptor-like serine...    235   2e-68    
ref|XP_009130612.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    234   5e-68    
emb|CDY11169.1|  BnaA03g00050D                                          233   1e-67    
emb|CDY61605.1|  BnaC03g71340D                                          230   8e-67    
gb|KFK24692.1|  hypothetical protein AALP_AA8G012400                    230   1e-66    
ref|XP_010427010.1|  PREDICTED: putative leucine-rich repeat rece...    226   3e-65    
ref|XP_006290609.1|  hypothetical protein CARUB_v10016698mg             224   1e-64    
ref|XP_001783836.1|  predicted protein                                  224   2e-64    
ref|XP_010504126.1|  PREDICTED: LOW QUALITY PROTEIN: putative leu...    224   2e-64    
ref|XP_002968204.1|  hypothetical protein SELMODRAFT_90019              221   2e-63    
ref|XP_002976173.1|  hypothetical protein SELMODRAFT_104181             219   5e-63    
sp|Q9LFG1.2|Y3359_ARATH  RecName: Full=Putative leucine-rich repe...    219   6e-63    
ref|XP_009116056.1|  PREDICTED: putative leucine-rich repeat rece...    215   2e-61    
ref|XP_006398558.1|  hypothetical protein EUTSA_v10012735mg             214   3e-61    
emb|CDX78191.1|  BnaA09g33860D                                          216   3e-61    
ref|XP_006403671.1|  hypothetical protein EUTSA_v10010104mg             214   4e-61    
ref|XP_011001642.1|  PREDICTED: probable LRR receptor-like serine...    214   4e-61    
gb|EPS66864.1|  hypothetical protein M569_07912                         207   6e-61    
ref|XP_001770712.1|  predicted protein                                  213   1e-60    
emb|CDX73538.1|  BnaC08g24650D                                          213   3e-60    
ref|XP_007142008.1|  hypothetical protein PHAVU_008G2448001g            196   9e-60    
ref|XP_002877928.1|  hypothetical protein ARALYDRAFT_906749             207   5e-59    
ref|NP_190927.1|  putative leucine-rich repeat receptor-like seri...    205   4e-58    
ref|XP_006398557.1|  hypothetical protein EUTSA_v10012735mg             204   7e-58    
gb|EEC72206.1|  hypothetical protein OsI_05294                          181   3e-53    
gb|KHN40998.1|  Putative LRR receptor-like serine/threonine-prote...    168   9e-50    
ref|XP_006575459.1|  PREDICTED: probable LRR receptor-like serine...    168   1e-49    
ref|XP_009781542.1|  PREDICTED: probable leucine-rich repeat rece...    162   1e-45    
emb|CDY21453.1|  BnaC03g27440D                                          166   3e-45    
ref|XP_011092238.1|  PREDICTED: probable leucine-rich repeat rece...    169   1e-44    
ref|XP_006651341.1|  PREDICTED: probable leucine-rich repeat rece...    168   2e-44    
ref|XP_011092239.1|  PREDICTED: probable leucine-rich repeat rece...    168   2e-44    
gb|EEC75182.1|  hypothetical protein OsI_11410                          168   2e-44    
gb|ABF95747.1|  Protein kinase domain containing protein, expressed     168   2e-44    
gb|EYU39755.1|  hypothetical protein MIMGU_mgv1a000835mg                167   3e-44    
ref|XP_011092240.1|  PREDICTED: probable leucine-rich repeat rece...    167   4e-44    
ref|XP_002965380.1|  hypothetical protein SELMODRAFT_24884              160   4e-44    
ref|XP_002962583.1|  hypothetical protein SELMODRAFT_438263             167   4e-44    
ref|XP_006470792.1|  PREDICTED: probable leucine-rich repeat rece...    167   4e-44    
ref|XP_002977227.1|  hypothetical protein SELMODRAFT_24883              159   5e-44    
ref|XP_002993941.1|  hypothetical protein SELMODRAFT_449258             166   9e-44    
ref|XP_006279556.1|  hypothetical protein CARUB_v10025735mg             167   1e-43    
ref|XP_011028449.1|  PREDICTED: probable leucine-rich repeat rece...    165   1e-43    
ref|XP_001780578.1|  predicted protein                                  165   1e-43    
ref|XP_006431373.1|  hypothetical protein CICLE_v10000176mg             166   1e-43    
ref|XP_010252247.1|  PREDICTED: probable leucine-rich repeat rece...    165   1e-43    
ref|XP_010252245.1|  PREDICTED: probable leucine-rich repeat rece...    165   1e-43    
ref|XP_010252244.1|  PREDICTED: probable leucine-rich repeat rece...    165   2e-43    
gb|KDO40686.1|  hypothetical protein CISIN_1g002189mg                   165   2e-43    
ref|XP_010252243.1|  PREDICTED: probable leucine-rich repeat rece...    165   2e-43    
ref|XP_002519381.1|  Serine/threonine-protein kinase PBS1, putative     165   2e-43    
gb|KDO40687.1|  hypothetical protein CISIN_1g002189mg                   165   2e-43    
ref|XP_006385116.1|  leucine-rich repeat family protein                 165   3e-43    
ref|XP_006402242.1|  hypothetical protein EUTSA_v10012589mg             165   3e-43    
ref|XP_006385117.1|  hypothetical protein POPTR_0004s24080g             164   3e-43    
ref|XP_006385112.1|  hypothetical protein POPTR_0004s24030g             165   3e-43    
ref|XP_011028446.1|  PREDICTED: probable leucine-rich repeat rece...    164   3e-43    
emb|CDY70266.1|  BnaCnng67530D                                          162   4e-43    
ref|XP_011028448.1|  PREDICTED: probable leucine-rich repeat rece...    164   4e-43    
gb|KDP32456.1|  hypothetical protein JCGZ_13381                         162   4e-43    
ref|XP_009134023.1|  PREDICTED: probable leucine-rich repeat rece...    164   7e-43    
emb|CDX83184.1|  BnaA03g23220D                                          164   7e-43    
dbj|BAJ85679.1|  predicted protein                                      161   7e-43    
emb|CDY61244.1|  BnaCnng37500D                                          164   7e-43    
emb|CDY21455.1|  BnaC03g27420D                                          164   8e-43    
gb|KFK26616.1|  hypothetical protein AALP_AA8G271800                    163   8e-43    
ref|XP_006281792.1|  hypothetical protein CARUB_v10027977mg             163   9e-43    
ref|XP_010441071.1|  PREDICTED: probable leucine-rich repeat rece...    163   9e-43    
ref|XP_009134024.1|  PREDICTED: probable leucine-rich repeat rece...    163   1e-42    
ref|XP_006358564.1|  PREDICTED: probable leucine-rich repeat rece...    163   1e-42    
gb|EPS73566.1|  hypothetical protein M569_01190                         161   1e-42    
ref|XP_010275979.1|  PREDICTED: probable leucine-rich repeat rece...    163   1e-42    
ref|XP_010442444.1|  PREDICTED: probable leucine-rich repeat rece...    163   1e-42    
dbj|BAA98164.1|  receptor protein kinase-like                           163   1e-42    
emb|CDY21452.1|  BnaC03g27450D                                          163   1e-42    
ref|XP_009128375.1|  PREDICTED: probable leucine-rich repeat rece...    162   2e-42    
ref|XP_010314124.1|  PREDICTED: probable leucine-rich repeat rece...    161   2e-42    
ref|XP_009600216.1|  PREDICTED: probable leucine-rich repeat rece...    162   2e-42    
ref|XP_006282275.1|  hypothetical protein CARUB_v10028556mg             162   2e-42    
dbj|BAF79988.1|  receptor-like kinase                                   157   2e-42    
dbj|BAJ89467.1|  predicted protein                                      162   2e-42    
ref|XP_011028445.1|  PREDICTED: probable leucine-rich repeat rece...    162   2e-42    
ref|XP_008793425.1|  PREDICTED: probable leucine-rich repeat rece...    162   2e-42    
ref|XP_009761326.1|  PREDICTED: probable leucine-rich repeat rece...    162   2e-42    
dbj|BAJ94480.1|  predicted protein                                      162   2e-42    
gb|AAF68126.1|AC010793_21  F20B17.5                                     162   2e-42    
emb|CDY49740.1|  BnaA02g19320D                                          163   3e-42    
ref|NP_178080.2|  putative serine/threonine kinase                      162   3e-42    
ref|NP_199787.2|  leucine-rich repeat protein kinase-like protein       162   3e-42    
ref|XP_010682075.1|  PREDICTED: probable leucine-rich repeat rece...    162   3e-42    
ref|XP_006402241.1|  hypothetical protein EUTSA_v10012584mg             162   4e-42    
ref|XP_009391655.1|  PREDICTED: probable leucine-rich repeat rece...    162   4e-42    
ref|XP_010482269.1|  PREDICTED: probable leucine-rich repeat rece...    162   4e-42    
ref|XP_009118911.1|  PREDICTED: probable leucine-rich repeat rece...    161   4e-42    
ref|XP_010314121.1|  PREDICTED: probable leucine-rich repeat rece...    162   4e-42    
ref|XP_010682076.1|  PREDICTED: probable leucine-rich repeat rece...    161   4e-42    
gb|EMT31021.1|  Putative LRR receptor-like serine/threonine-prote...    161   5e-42    
ref|XP_002303228.2|  hypothetical protein POPTR_0003s03690g             158   5e-42    
ref|XP_010252434.1|  PREDICTED: probable leucine-rich repeat rece...    159   6e-42    
ref|XP_006279961.1|  hypothetical protein CARUB_v10025827mg             161   6e-42    
ref|XP_009416032.1|  PREDICTED: probable leucine-rich repeat rece...    161   6e-42    
ref|XP_010252250.1|  PREDICTED: probable leucine-rich repeat rece...    161   7e-42    
gb|KDP21809.1|  hypothetical protein JCGZ_00596                         158   7e-42    
gb|KFK31438.1|  hypothetical protein AALP_AA6G111800                    160   8e-42    
ref|XP_008245810.1|  PREDICTED: probable leucine-rich repeat rece...    156   8e-42    
gb|KFK42372.1|  hypothetical protein AALP_AA2G247300                    161   8e-42    
ref|XP_011088111.1|  PREDICTED: probable leucine-rich repeat rece...    160   8e-42    
ref|XP_011084699.1|  PREDICTED: probable leucine-rich repeat rece...    160   9e-42    
ref|XP_007023751.1|  Leucine-rich repeat family protein / protein...    155   9e-42    
gb|KJB68016.1|  hypothetical protein B456_010G221900                    160   1e-41    
gb|KJB68014.1|  hypothetical protein B456_010G221900                    160   1e-41    
ref|XP_009417851.1|  PREDICTED: probable leucine-rich repeat rece...    160   1e-41    
ref|XP_009417853.1|  PREDICTED: probable leucine-rich repeat rece...    160   1e-41    
ref|XP_009364692.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-41    
ref|XP_002864014.1|  leucine-rich repeat family protein                 160   1e-41    
gb|KJB57522.1|  hypothetical protein B456_009G167900                    160   1e-41    
ref|XP_009417852.1|  PREDICTED: probable leucine-rich repeat rece...    160   1e-41    
gb|KJB57523.1|  hypothetical protein B456_009G167900                    160   1e-41    
ref|XP_009417849.1|  PREDICTED: probable leucine-rich repeat rece...    160   1e-41    
ref|XP_002889259.1|  hypothetical protein ARALYDRAFT_477135             160   1e-41    
gb|KHG12756.1|  hypothetical protein F383_03913                         160   1e-41    
ref|XP_010537840.1|  PREDICTED: probable leucine-rich repeat rece...    160   1e-41    
ref|XP_002519985.1|  receptor protein kinase, putative                  160   1e-41    
ref|XP_006836951.1|  hypothetical protein AMTR_s00099p00159710          160   2e-41    
ref|XP_003561670.2|  PREDICTED: probable leucine-rich repeat rece...    160   2e-41    
ref|XP_003578779.1|  PREDICTED: probable leucine-rich repeat rece...    160   2e-41    
ref|XP_010441081.1|  PREDICTED: probable leucine-rich repeat rece...    159   2e-41    
gb|EPS73565.1|  hypothetical protein M569_01189                         159   2e-41    
ref|XP_006852584.1|  hypothetical protein AMTR_s00021p00213800          159   2e-41    
ref|XP_010521415.1|  PREDICTED: probable leucine-rich repeat rece...    159   2e-41    
ref|XP_011466378.1|  PREDICTED: probable leucine-rich repeat rece...    159   2e-41    
gb|EYU33312.1|  hypothetical protein MIMGU_mgv1a0019072mg               157   2e-41    
ref|XP_009605195.1|  PREDICTED: probable leucine-rich repeat rece...    159   2e-41    
ref|XP_006853763.1|  hypothetical protein AMTR_s00056p00191650          153   2e-41    
ref|XP_006429976.1|  hypothetical protein CICLE_v100110351mg            157   3e-41    
ref|XP_008366451.1|  PREDICTED: probable leucine-rich repeat rece...    159   3e-41    
ref|XP_010417632.1|  PREDICTED: probable leucine-rich repeat rece...    159   3e-41    
ref|XP_010233531.1|  PREDICTED: probable leucine-rich repeat rece...    157   3e-41    
ref|XP_006300598.1|  hypothetical protein CARUB_v10019721mg             159   3e-41    
ref|XP_007023743.1|  Leucine-rich repeat protein kinase family pr...    159   3e-41    
ref|XP_004230391.1|  PREDICTED: probable leucine-rich repeat rece...    159   3e-41    
ref|XP_008793424.1|  PREDICTED: probable leucine-rich repeat rece...    159   3e-41    
ref|XP_010065203.1|  PREDICTED: probable leucine-rich repeat rece...    159   3e-41    
ref|NP_001242669.1|  probable leucine-rich repeat receptor-like p...    157   4e-41    
gb|KCW62545.1|  hypothetical protein EUGRSUZ_G00037                     159   4e-41    
ref|XP_010233532.1|  PREDICTED: probable leucine-rich repeat rece...    159   4e-41    
gb|KCW62546.1|  hypothetical protein EUGRSUZ_G00038                     159   4e-41    
ref|XP_007023744.1|  Leucine-rich repeat protein kinase family pr...    159   4e-41    
ref|XP_010533231.1|  PREDICTED: probable leucine-rich repeat rece...    159   4e-41    
ref|XP_010429861.1|  PREDICTED: probable leucine-rich repeat rece...    159   4e-41    
ref|XP_001760085.1|  predicted protein                                  159   5e-41    
ref|XP_010065206.1|  PREDICTED: probable leucine-rich repeat rece...    158   5e-41    
ref|XP_010065202.1|  PREDICTED: probable leucine-rich repeat rece...    159   5e-41    
ref|XP_006358482.1|  PREDICTED: probable leucine-rich repeat rece...    158   5e-41    
emb|CDO97682.1|  unnamed protein product                                158   6e-41    
ref|XP_009364675.1|  PREDICTED: probable leucine-rich repeat rece...    158   6e-41    
ref|XP_008366209.1|  PREDICTED: probable LRR receptor-like serine...    157   6e-41    
gb|KHN48167.1|  Putative leucine-rich repeat receptor-like protei...    158   6e-41    
ref|XP_008782739.1|  PREDICTED: probable leucine-rich repeat rece...    158   6e-41    
gb|KCW62551.1|  hypothetical protein EUGRSUZ_G00043                     158   6e-41    
ref|XP_003541454.1|  PREDICTED: probable leucine-rich repeat rece...    158   6e-41    
ref|XP_010482273.1|  PREDICTED: probable leucine-rich repeat rece...    158   7e-41    
ref|XP_010065204.1|  PREDICTED: probable leucine-rich repeat rece...    158   7e-41    
ref|XP_010252252.1|  PREDICTED: probable leucine-rich repeat rece...    158   7e-41    
ref|XP_010482271.1|  PREDICTED: probable leucine-rich repeat rece...    158   8e-41    
ref|XP_010482272.1|  PREDICTED: probable leucine-rich repeat rece...    158   8e-41    
emb|CDP08081.1|  unnamed protein product                                158   8e-41    
ref|XP_008643846.1|  PREDICTED: uncharacterized protein LOC100382...    158   9e-41    
ref|XP_003593682.1|  Somatic embryogenesis receptor-like kinase         157   9e-41    
ref|XP_008643850.1|  PREDICTED: uncharacterized protein LOC100382...    158   1e-40    
emb|CDY12940.1|  BnaA09g13340D                                          157   1e-40    
ref|XP_002980407.1|  hypothetical protein SELMODRAFT_12987              150   1e-40    
ref|XP_011461109.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
ref|XP_003593681.1|  Somatic embryogenesis receptor-like kinase         157   1e-40    
ref|XP_011092237.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
ref|XP_006588460.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
ref|XP_010484994.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
ref|XP_011018905.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
ref|XP_010038738.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
ref|XP_011461108.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
ref|XP_010441118.1|  PREDICTED: probable leucine-rich repeat rece...    153   1e-40    
ref|XP_011461106.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
gb|KCW47574.1|  hypothetical protein EUGRSUZ_K01321                     157   1e-40    
ref|XP_004295860.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
ref|XP_011012973.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
ref|XP_006481666.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
ref|XP_011012970.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
gb|KDO70764.1|  hypothetical protein CISIN_1g002121mg                   157   1e-40    
ref|XP_011461107.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
gb|EMT33703.1|  Putative LRR receptor-like serine/threonine-prote...    157   1e-40    
ref|XP_010688349.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
ref|XP_009593371.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
ref|XP_010088710.1|  putative leucine-rich repeat receptor-like p...    157   1e-40    
ref|XP_006358481.1|  PREDICTED: probable leucine-rich repeat rece...    157   1e-40    
ref|XP_002323702.2|  leucine-rich repeat transmembrane protein ki...    157   2e-40    
ref|XP_002864016.1|  predicted protein                                  157   2e-40    
ref|NP_001055877.1|  Os05g0486100                                       157   2e-40    
ref|XP_010113026.1|  putative leucine-rich repeat receptor-like p...    157   2e-40    
ref|XP_007156284.1|  hypothetical protein PHAVU_003G273700g             157   2e-40    
ref|XP_010938089.1|  PREDICTED: probable leucine-rich repeat rece...    157   2e-40    
gb|EPS73567.1|  hypothetical protein M569_01191                         148   2e-40    
emb|CDM81495.1|  unnamed protein product                                157   2e-40    
gb|EEC79423.1|  hypothetical protein OsI_20395                          157   2e-40    
ref|XP_011077100.1|  PREDICTED: probable leucine-rich repeat rece...    157   2e-40    
emb|CDY22287.1|  BnaC02g25910D                                          158   2e-40    
emb|CDM84720.1|  unnamed protein product                                157   2e-40    
gb|AFW78432.1|  putative leucine-rich repeat receptor-like protei...    155   2e-40    
ref|XP_003566120.1|  PREDICTED: probable leucine-rich repeat rece...    157   2e-40    
ref|XP_006338928.1|  PREDICTED: probable leucine-rich repeat rece...    157   2e-40    
dbj|BAF79978.1|  receptor-like kinase                                   157   2e-40    
gb|KDO54924.1|  hypothetical protein CISIN_1g002174mg                   155   2e-40    
gb|EMT20930.1|  Putative LRR receptor-like serine/threonine-prote...    157   2e-40    



>gb|KGN63923.1| hypothetical protein Csa_1G027520 [Cucumis sativus]
Length=258

 Score =   310 bits (794),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V S +PL+FA RL+ ALG+AKGILYLHTEADPPIFHRDIK+SNILLD+K+ AKVADFGL
Sbjct  17   SVNSAEPLSFATRLKAALGAAKGILYLHTEADPPIFHRDIKSSNILLDSKYVAKVADFGL  76

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP+P+ EG+VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTG HP
Sbjct  77   SRLAPLPNAEGDVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGRHP  136

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN AY SG IFS+ID R+GSYP+ECVEKF+TLALKCCQDDTD
Sbjct  137  ISHGKNIVREVNSAYQSGKIFSIIDGRLGSYPAECVEKFVTLALKCCQDDTD  188



>ref|XP_007017105.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY34724.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
Length=944

 Score =   327 bits (839),  Expect = 2e-102, Method: Composition-based stats.
 Identities = 153/172 (89%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK+PL+FA+RLRV+LGSAKGILYLHTEADPPIFHRDIKASNILLD+KFTAKVADFGL
Sbjct  702  SAKSKEPLSFAMRLRVSLGSAKGILYLHTEADPPIFHRDIKASNILLDSKFTAKVADFGL  761

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  762  SRLAPVPDVEGALPTHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  821

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVNVAY SG IFSV+D RMGSYPSECVEKF+TLALKCCQD+TD
Sbjct  822  ISHGKNIVREVNVAYHSGMIFSVVDGRMGSYPSECVEKFVTLALKCCQDETD  873



>emb|CAN75549.1| hypothetical protein VITISV_043541 [Vitis vinifera]
Length=782

 Score =   324 bits (830),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  +  N TL    +  KSK+PL+FA+RL +ALGS+KGILYLHTEA+PPIFHRD+KAS
Sbjct  522  MLVYEFMPNGTLRDHLSAAKSKEPLSFAMRLSIALGSSKGILYLHTEANPPIFHRDVKAS  581

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD+KF AKVADFGLSRLAPVPD+EG  PAHVSTVVKGTPG+LDPEYFLTHKLTDKSD
Sbjct  582  NILLDSKFIAKVADFGLSRLAPVPDIEGSTPAHVSTVVKGTPGYLDPEYFLTHKLTDKSD  641

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGMHPISHGKNIVREVNV+Y SG IFSVID RMGSYPSECVEKF+ LA
Sbjct  642  VYSLGVVFLELLTGMHPISHGKNIVREVNVSYQSGMIFSVIDNRMGSYPSECVEKFVKLA  701

Query  28   LKCCQDDTD  2
            LKCCQ+DTD
Sbjct  702  LKCCQEDTD  710



>ref|XP_007017104.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY34723.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=967

 Score =   328 bits (840),  Expect = 2e-102, Method: Composition-based stats.
 Identities = 153/172 (89%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK+PL+FA+RLRV+LGSAKGILYLHTEADPPIFHRDIKASNILLD+KFTAKVADFGL
Sbjct  725  SAKSKEPLSFAMRLRVSLGSAKGILYLHTEADPPIFHRDIKASNILLDSKFTAKVADFGL  784

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  785  SRLAPVPDVEGALPTHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  844

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVNVAY SG IFSV+D RMGSYPSECVEKF+TLALKCCQD+TD
Sbjct  845  ISHGKNIVREVNVAYHSGMIFSVVDGRMGSYPSECVEKFVTLALKCCQDETD  896



>emb|CBI15799.3| unnamed protein product [Vitis vinifera]
Length=960

 Score =   325 bits (832),  Expect = 3e-101, Method: Composition-based stats.
 Identities = 153/189 (81%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  +  N TL    +  KSK+PL+FA+RL +ALGS+KGILYLHTEA+PPIFHRD+KAS
Sbjct  700  MLVYEFMPNGTLRDHLSAAKSKEPLSFAMRLSIALGSSKGILYLHTEANPPIFHRDVKAS  759

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD+KF AKVADFGLSRLAPVPD+EG  PAHVSTVVKGTPG+LDPEYFLTHKLTDKSD
Sbjct  760  NILLDSKFIAKVADFGLSRLAPVPDIEGSTPAHVSTVVKGTPGYLDPEYFLTHKLTDKSD  819

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGMHPISHGKNIVREVNV+Y SG IFSVID RMGSYPSECVEKF+ LA
Sbjct  820  VYSLGVVFLELLTGMHPISHGKNIVREVNVSYQSGMIFSVIDNRMGSYPSECVEKFVKLA  879

Query  28   LKCCQDDTD  2
            LKCCQ+DTD
Sbjct  880  LKCCQEDTD  888



>ref|XP_002276020.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Vitis vinifera]
 ref|XP_010650800.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Vitis vinifera]
 ref|XP_010650801.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Vitis vinifera]
 ref|XP_010650802.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Vitis vinifera]
 ref|XP_010650804.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Vitis vinifera]
Length=959

 Score =   324 bits (831),  Expect = 3e-101, Method: Composition-based stats.
 Identities = 153/189 (81%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  +  N TL    +  KSK+PL+FA+RL +ALGS+KGILYLHTEA+PPIFHRD+KAS
Sbjct  699  MLVYEFMPNGTLRDHLSAAKSKEPLSFAMRLSIALGSSKGILYLHTEANPPIFHRDVKAS  758

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD+KF AKVADFGLSRLAPVPD+EG  PAHVSTVVKGTPG+LDPEYFLTHKLTDKSD
Sbjct  759  NILLDSKFIAKVADFGLSRLAPVPDIEGSTPAHVSTVVKGTPGYLDPEYFLTHKLTDKSD  818

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGMHPISHGKNIVREVNV+Y SG IFSVID RMGSYPSECVEKF+ LA
Sbjct  819  VYSLGVVFLELLTGMHPISHGKNIVREVNVSYQSGMIFSVIDNRMGSYPSECVEKFVKLA  878

Query  28   LKCCQDDTD  2
            LKCCQ+DTD
Sbjct  879  LKCCQEDTD  887



>ref|XP_008239253.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Prunus mume]
 ref|XP_008239322.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Prunus mume]
 ref|XP_008239390.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Prunus mume]
 ref|XP_008239465.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Prunus mume]
Length=952

 Score =   323 bits (829),  Expect = 6e-101, Method: Composition-based stats.
 Identities = 151/172 (88%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V+SK+PL F +RLR+ALGSAKGILYLHTEA+PPIFHRDIKASNILLD+KF AKVADFGL
Sbjct  708  SVRSKEPLGFEMRLRIALGSAKGILYLHTEANPPIFHRDIKASNILLDSKFIAKVADFGL  767

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPDLEG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  768  SRLAPVPDLEGAVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  827

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+A+ SG IFSVID RMGSYPSECVEKF++LALKCCQD+TD
Sbjct  828  ISHGKNIVREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALKCCQDETD  879



>ref|XP_007206440.1| hypothetical protein PRUPE_ppa000952mg [Prunus persica]
 gb|EMJ07639.1| hypothetical protein PRUPE_ppa000952mg [Prunus persica]
Length=952

 Score =   323 bits (829),  Expect = 6e-101, Method: Composition-based stats.
 Identities = 150/172 (87%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V+SK+PL F +RLR+ALGSAKGILYLHTEA+PPIFHRDIKASNILLD+KF AKVADFGL
Sbjct  708  SVRSKEPLGFEMRLRIALGSAKGILYLHTEANPPIFHRDIKASNILLDSKFIAKVADFGL  767

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPDLEG VPAH+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  768  SRLAPVPDLEGAVPAHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  827

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+A+ SG IFSVID RMGSYPSECVEKF++LALKCCQD+TD
Sbjct  828  ISHGKNIVREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALKCCQDETD  879



>ref|XP_009768306.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nicotiana sylvestris]
Length=952

 Score =   322 bits (824),  Expect = 3e-100, Method: Composition-based stats.
 Identities = 151/170 (89%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K K+PL+FA+RLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKF AKVADFGLSR
Sbjct  711  KCKEPLSFAMRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFIAKVADFGLSR  770

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVP+LEG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  771  LAPVPNLEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPIS  830

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+AY SG IF+VID+RMGSYPSECVEKFI LALKCCQ++T+
Sbjct  831  HGKNIVREVNLAYRSGMIFNVIDDRMGSYPSECVEKFINLALKCCQEETE  880



>ref|XP_008782698.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Phoenix dactylifera]
Length=841

 Score =   319 bits (817),  Expect = 4e-100, Method: Composition-based stats.
 Identities = 146/172 (85%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + +SK+PL F++RLR+ALGSA+GILYLHTEADPPIFHRDIKA+NILLD KF AKVADFGL
Sbjct  598  SARSKEPLNFSMRLRIALGSARGILYLHTEADPPIFHRDIKATNILLDPKFIAKVADFGL  657

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP
Sbjct  658  SRLAPVPDTEGTVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  717

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREV+ AY SG +FSVID RMGSYPSEC+EKF++LAL+CCQD+TD
Sbjct  718  ISHGKNIVREVSTAYQSGMMFSVIDSRMGSYPSECIEKFVSLALRCCQDETD  769



>gb|KHG15448.1| hypothetical protein F383_00176 [Gossypium arboreum]
Length=960

 Score =   321 bits (823),  Expect = 5e-100, Method: Composition-based stats.
 Identities = 151/170 (89%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            +SK+P  FA+RL++ALGSAKGILYLHTEADPPIFHRDIKASNILLD++FTAKVADFGLSR
Sbjct  717  QSKEPPNFAMRLKIALGSAKGILYLHTEADPPIFHRDIKASNILLDSRFTAKVADFGLSR  776

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPD+EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  777  LAPVPDMEGAVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPIS  836

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVNVAY SG IFSVID RMGSYPSECVEKF+TLALKC QD+TD
Sbjct  837  HGKNIVREVNVAYHSGMIFSVIDGRMGSYPSECVEKFVTLALKCSQDETD  886



>ref|XP_008366212.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Malus domestica]
Length=953

 Score =   321 bits (822),  Expect = 7e-100, Method: Composition-based stats.
 Identities = 149/172 (87%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + +SK+PL F +RLR+ALGSAKGILYLHTEA+PPIFHRDIKASNILLD+KF AKVADFGL
Sbjct  709  SARSKEPLGFEMRLRIALGSAKGILYLHTEANPPIFHRDIKASNILLDSKFIAKVADFGL  768

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  769  SRLAPVPDFEGTVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  828

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+A+ SG IFSVID RMGSYPSECVEKF++LALKCC+DDTD
Sbjct  829  ISHGKNIVREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALKCCEDDTD  880



>ref|XP_010094444.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB56025.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=983

 Score =   321 bits (822),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK+PL+F+LR+R+ALGSAKGILYLHTEA+PPIFHRDIKA+NILLD+KFTAKVADFGL
Sbjct  739  SAKSKEPLSFSLRVRIALGSAKGILYLHTEANPPIFHRDIKATNILLDSKFTAKVADFGL  798

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVP++EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP
Sbjct  799  SRLAPVPEIEGNVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  858

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I+HGKN+VREVN A+ SGTIFSVIDERMGSYPS+CVEKF++LALKCC DD D
Sbjct  859  ITHGKNLVREVNSAFQSGTIFSVIDERMGSYPSDCVEKFLSLALKCCHDDPD  910



>gb|KJB83922.1| hypothetical protein B456_013G271600 [Gossypium raimondii]
 gb|KJB83923.1| hypothetical protein B456_013G271600 [Gossypium raimondii]
Length=959

 Score =   320 bits (821),  Expect = 1e-99, Method: Composition-based stats.
 Identities = 150/172 (87%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK+P  FA+RL++ALGSAKGILYLHTEADPPIFHRDIKASNILLD++F AKVADFGL
Sbjct  714  SAKSKEPPNFAMRLKIALGSAKGILYLHTEADPPIFHRDIKASNILLDSRFIAKVADFGL  773

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  774  SRLAPVPDMEGAVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  833

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVNVAY SG IFSVID RMGSYPSECVEKF+TLALKC  D+TD
Sbjct  834  ISHGKNIVREVNVAYHSGMIFSVIDGRMGSYPSECVEKFVTLALKCSHDETD  885



>ref|XP_008782697.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Phoenix dactylifera]
Length=945

 Score =   320 bits (820),  Expect = 1e-99, Method: Composition-based stats.
 Identities = 146/172 (85%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + +SK+PL F++RLR+ALGSA+GILYLHTEADPPIFHRDIKA+NILLD KF AKVADFGL
Sbjct  702  SARSKEPLNFSMRLRIALGSARGILYLHTEADPPIFHRDIKATNILLDPKFIAKVADFGL  761

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP
Sbjct  762  SRLAPVPDTEGTVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  821

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREV+ AY SG +FSVID RMGSYPSEC+EKF++LAL+CCQD+TD
Sbjct  822  ISHGKNIVREVSTAYQSGMMFSVIDSRMGSYPSECIEKFVSLALRCCQDETD  873



>ref|XP_011461391.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Fragaria vesca subsp. vesca]
Length=958

 Score =   320 bits (821),  Expect = 1e-99, Method: Composition-based stats.
 Identities = 148/172 (86%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V+SK+PL F +RLR+ALGSA+GILYLHTEA+PPIFHRDIKASNILLD+KF AKVADFGL
Sbjct  713  SVRSKEPLGFEMRLRIALGSARGILYLHTEANPPIFHRDIKASNILLDSKFVAKVADFGL  772

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPDLEG  PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  773  SRLAPVPDLEGATPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  832

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+A+ SG IFSVID RMGSYPS+CVEKF++LALKCCQD+TD
Sbjct  833  ISHGKNIVREVNIAFQSGMIFSVIDARMGSYPSDCVEKFLSLALKCCQDETD  884



>gb|KDO54930.1| hypothetical protein CISIN_1g002174mg [Citrus sinensis]
 gb|KDO54931.1| hypothetical protein CISIN_1g002174mg [Citrus sinensis]
Length=707

 Score =   315 bits (806),  Expect = 1e-99, Method: Composition-based stats.
 Identities = 148/172 (86%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK+PL FA+RL +ALGS++GILYLHTEADPP+FHRDIKASNILLD KFTAKVADFGL
Sbjct  463  SAKSKEPLGFAMRLSIALGSSRGILYLHTEADPPVFHRDIKASNILLDHKFTAKVADFGL  522

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  523  SRLAPVPDIEGIVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  582

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+AY S  +FSVID  MGSYPSECVEKFI LALKCCQD+TD
Sbjct  583  ISHGKNIVREVNIAYQSSMMFSVIDGNMGSYPSECVEKFIKLALKCCQDETD  634



>ref|XP_011461389.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Fragaria vesca subsp. vesca]
 ref|XP_011461390.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Fragaria vesca subsp. vesca]
Length=959

 Score =   320 bits (820),  Expect = 1e-99, Method: Composition-based stats.
 Identities = 148/173 (86%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -3

Query  520  TTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFG  341
            + V+SK+PL F +RLR+ALGSA+GILYLHTEA+PPIFHRDIKASNILLD+KF AKVADFG
Sbjct  713  SAVRSKEPLGFEMRLRIALGSARGILYLHTEANPPIFHRDIKASNILLDSKFVAKVADFG  772

Query  340  LSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMH  161
            LSRLAPVPDLEG  PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM 
Sbjct  773  LSRLAPVPDLEGATPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQ  832

Query  160  PISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            PISHGKNIVREVN+A+ SG IFSVID RMGSYPS+CVEKF++LALKCCQD+TD
Sbjct  833  PISHGKNIVREVNIAFQSGMIFSVIDARMGSYPSDCVEKFLSLALKCCQDETD  885



>ref|XP_002533344.1| protein with unknown function [Ricinus communis]
 gb|EEF29043.1| protein with unknown function [Ricinus communis]
Length=844

 Score =   317 bits (813),  Expect = 2e-99, Method: Composition-based stats.
 Identities = 148/172 (86%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+K+PL+FA+R+RVALGSAKGILYLHTEADPPIFHRDIKASNILL + +TAKVADFGL
Sbjct  600  SAKAKEPLSFAMRVRVALGSAKGILYLHTEADPPIFHRDIKASNILLGSNYTAKVADFGL  659

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VPA VSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  660  SRLAPVPDVEGAVPAQVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  719

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVNV+Y SG IFSVIDERMGSYPS+CVEKF+ LAL+CCQD+TD
Sbjct  720  ISHGKNIVREVNVSYQSGMIFSVIDERMGSYPSDCVEKFLNLALRCCQDETD  771



>ref|XP_009374400.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009374401.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009374403.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009374404.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009374405.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =   319 bits (818),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  +  N TL    +  +SK+PL F +RLR+ALGSAKGILYLHTEA+PPIFHRDIKAS
Sbjct  693  MLVYEFMSNGTLRDHLSAARSKEPLGFEMRLRIALGSAKGILYLHTEANPPIFHRDIKAS  752

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD+KF AKVADFGLSRLAPVPD EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSD
Sbjct  753  NILLDSKFIAKVADFGLSRLAPVPDFEGTVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSD  812

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGM PISHGKNIVREVN+A+ SG IFSVID RMGSYPSECVEKF++LA
Sbjct  813  VYSLGVVFLELLTGMQPISHGKNIVREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLA  872

Query  28   LKCCQDDTD  2
            L+CC+DDTD
Sbjct  873  LRCCEDDTD  881



>ref|XP_010326255.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Solanum lycopersicum]
Length=928

 Score =   318 bits (816),  Expect = 3e-99, Method: Composition-based stats.
 Identities = 149/170 (88%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K K+PL+FA+RL+VALGSAKGILYLHTEADPPIFHRDIKASNILLD+KF AKVADFGLSR
Sbjct  687  KCKEPLSFAMRLKVALGSAKGILYLHTEADPPIFHRDIKASNILLDSKFIAKVADFGLSR  746

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPDLEG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  747  LAPVPDLEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPIS  806

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+AY SG IF+VID++MGSYPSECVEKFI LALKCCQ++T+
Sbjct  807  HGKNIVREVNLAYRSGMIFNVIDDQMGSYPSECVEKFINLALKCCQEETE  856



>ref|XP_004247017.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Solanum lycopersicum]
Length=953

 Score =   318 bits (816),  Expect = 4e-99, Method: Composition-based stats.
 Identities = 149/170 (88%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K K+PL+FA+RL+VALGSAKGILYLHTEADPPIFHRDIKASNILLD+KF AKVADFGLSR
Sbjct  712  KCKEPLSFAMRLKVALGSAKGILYLHTEADPPIFHRDIKASNILLDSKFIAKVADFGLSR  771

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPDLEG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  772  LAPVPDLEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPIS  831

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+AY SG IF+VID++MGSYPSECVEKFI LALKCCQ++T+
Sbjct  832  HGKNIVREVNLAYRSGMIFNVIDDQMGSYPSECVEKFINLALKCCQEETE  881



>ref|XP_009374406.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Pyrus x bretschneideri]
Length=953

 Score =   318 bits (816),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + +SK+PL F +RLR+ALGSAKGILYLHTEA+PPIFHRDIKASNILLD+KF AKVADFGL
Sbjct  709  SARSKEPLGFEMRLRIALGSAKGILYLHTEANPPIFHRDIKASNILLDSKFIAKVADFGL  768

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  769  SRLAPVPDFEGTVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  828

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+A+ SG IFSVID RMGSYPSECVEKF++LAL+CC+DDTD
Sbjct  829  ISHGKNIVREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALRCCEDDTD  880



>emb|CDP04034.1| unnamed protein product [Coffea canephora]
Length=955

 Score =   318 bits (815),  Expect = 6e-99, Method: Composition-based stats.
 Identities = 149/170 (88%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            KSK+P TFA+RLR+ALGSAKGILYLHTEA+PPIFHRDIKASNILLD+K TAKVADFGLSR
Sbjct  712  KSKEPRTFAMRLRIALGSAKGILYLHTEANPPIFHRDIKASNILLDSKLTAKVADFGLSR  771

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS
Sbjct  772  LAPVPDVEGMLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  831

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+AY SG IFSVID+ MGSYPSECVEKFI LALKCC ++ D
Sbjct  832  HGKNIVREVNIAYRSGMIFSVIDDSMGSYPSECVEKFINLALKCCLEEPD  881



>ref|XP_010032944.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Eucalyptus grandis]
 ref|XP_010032945.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Eucalyptus grandis]
 gb|KCW52449.1| hypothetical protein EUGRSUZ_J01846 [Eucalyptus grandis]
Length=963

 Score =   318 bits (815),  Expect = 7e-99, Method: Composition-based stats.
 Identities = 146/170 (86%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            +SK+PL+F +R+R+ALG+AKGILYLHTEADPPIFHRDIKASNILLD KFTAKVADFGLSR
Sbjct  722  RSKEPLSFGMRMRIALGAAKGILYLHTEADPPIFHRDIKASNILLDPKFTAKVADFGLSR  781

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPD+EG VP HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  782  LAPVPDIEGVVPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPIS  841

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVNVAY SGT FS++D  MGSYPSEC+EKF+ LALKCCQD+TD
Sbjct  842  HGKNIVREVNVAYQSGTTFSIVDGSMGSYPSECIEKFLMLALKCCQDETD  891



>ref|XP_006344368.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Solanum tuberosum]
Length=953

 Score =   318 bits (815),  Expect = 7e-99, Method: Composition-based stats.
 Identities = 149/170 (88%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K K+PL+FA+RL+VALGSAKGILYLHTEADPPIFHRDIKASNILLD+KF AKVADFGLSR
Sbjct  712  KCKEPLSFAMRLKVALGSAKGILYLHTEADPPIFHRDIKASNILLDSKFIAKVADFGLSR  771

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPDLEG +PA+VSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  772  LAPVPDLEGTLPAYVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPIS  831

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+AY SG IF+VID+RMGSYPSECVEKFI LALKCCQ++T+
Sbjct  832  HGKNIVREVNLAYRSGMIFNVIDDRMGSYPSECVEKFINLALKCCQEETE  881



>ref|XP_009628064.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nicotiana tomentosiformis]
Length=952

 Score =   318 bits (815),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K K+PL+FA+RLRVALGSAKGILYLHTEADPPIFHRDIKASNILLD+KF AKVADFGLSR
Sbjct  711  KCKEPLSFAMRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDSKFIAKVADFGLSR  770

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPDLEG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  771  LAPVPDLEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPIS  830

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+AY SG IF+V D+RMGSYPSECVEKFI LALKCCQ++T+
Sbjct  831  HGKNIVREVNLAYRSGMIFNVFDDRMGSYPSECVEKFINLALKCCQEETE  880



>ref|XP_006464963.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X3 [Citrus sinensis]
 gb|KDO54929.1| hypothetical protein CISIN_1g002174mg [Citrus sinensis]
Length=843

 Score =   315 bits (807),  Expect = 1e-98, Method: Composition-based stats.
 Identities = 148/172 (86%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK+PL FA+RL +ALGS++GILYLHTEADPP+FHRDIKASNILLD KFTAKVADFGL
Sbjct  599  SAKSKEPLGFAMRLSIALGSSRGILYLHTEADPPVFHRDIKASNILLDHKFTAKVADFGL  658

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  659  SRLAPVPDIEGIVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  718

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+AY S  +FSVID  MGSYPSECVEKFI LALKCCQD+TD
Sbjct  719  ISHGKNIVREVNIAYQSSMMFSVIDGNMGSYPSECVEKFIKLALKCCQDETD  770



>ref|XP_008354310.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Malus domestica]
Length=597

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + +SK+PL F +RLR+A GSAKGILYLHTEA+PPIFHRDIKA+NILLD+KF AKVADFGL
Sbjct  353  SARSKEPLGFXMRLRIAQGSAKGILYLHTEANPPIFHRDIKATNILLDSKFXAKVADFGL  412

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD EG  PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  413  SRLAPVPDFEGTXPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  472

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+A+ SG IFSVID RMGSYPSECVEKF++LALKCC+ +TD
Sbjct  473  ISHGKNIVREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALKCCKXETD  524



>gb|AFW78405.1| putative leucine-rich repeat receptor-like protein kinase family 
protein, partial [Zea mays]
Length=245

 Score =   296 bits (758),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            T KSK PL+F LRL++ALG+AKGILYLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  1    TAKSKRPLSFGLRLKIALGAAKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGL  60

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM P
Sbjct  61   SRLAPVPDVEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKP  120

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN A  SG +  +ID RMG YP EC+++F++LA KCCQD+TD
Sbjct  121  IEHGKNIVREVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQDETD  172



>gb|KDP45677.1| hypothetical protein JCGZ_17284 [Jatropha curcas]
Length=955

 Score =   316 bits (809),  Expect = 5e-98, Method: Composition-based stats.
 Identities = 147/172 (85%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK+PL+FA+RLR+ALGSAKGI YLHTEA+PPIFHRDIKASNILLD+ F AKVADFGL
Sbjct  712  SAKSKEPLSFAMRLRIALGSAKGISYLHTEANPPIFHRDIKASNILLDSSFNAKVADFGL  771

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  772  SRLAPVPDTEGSVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  831

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVNV+Y SG IFSVID RMGSYPS+CVEKF+ LA+KCCQ++TD
Sbjct  832  ISHGKNIVREVNVSYQSGMIFSVIDGRMGSYPSDCVEKFLNLAIKCCQEETD  883



>ref|XP_009355132.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Pyrus x bretschneideri]
Length=952

 Score =   316 bits (809),  Expect = 5e-98, Method: Composition-based stats.
 Identities = 149/189 (79%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  +  N TL    +  +SK+PL F +RLR+ALGSAKGILYLHTEA+PPIFHRDIKA+
Sbjct  691  MLVYEFMSNGTLRDHLSAARSKEPLGFEMRLRIALGSAKGILYLHTEANPPIFHRDIKAT  750

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD+KF AKVADFGLSR APVPD EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSD
Sbjct  751  NILLDSKFIAKVADFGLSRFAPVPDFEGTVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSD  810

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGM PISHGKNIVREVN+A+ SG IFSVID RMGSYPSECVEKF++LA
Sbjct  811  VYSLGVVFLELLTGMQPISHGKNIVREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLA  870

Query  28   LKCCQDDTD  2
            LKCC+++TD
Sbjct  871  LKCCKEETD  879



>gb|KDO54922.1| hypothetical protein CISIN_1g002174mg [Citrus sinensis]
Length=941

 Score =   315 bits (808),  Expect = 6e-98, Method: Composition-based stats.
 Identities = 148/172 (86%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK+PL FA+RL +ALGS++GILYLHTEADPP+FHRDIKASNILLD KFTAKVADFGL
Sbjct  697  SAKSKEPLGFAMRLSIALGSSRGILYLHTEADPPVFHRDIKASNILLDHKFTAKVADFGL  756

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  757  SRLAPVPDIEGIVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  816

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+AY S  +FSVID  MGSYPSECVEKFI LALKCCQD+TD
Sbjct  817  ISHGKNIVREVNIAYQSSMMFSVIDGNMGSYPSECVEKFIKLALKCCQDETD  868



>ref|XP_008354331.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Malus domestica]
Length=953

 Score =   315 bits (808),  Expect = 6e-98, Method: Composition-based stats.
 Identities = 145/172 (84%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + +SK+PL FA+RLR+A GSAKGILYLHTEA+PPIFHRDIKA+NILLD+KF AKVADFGL
Sbjct  709  SARSKEPLGFAMRLRIAQGSAKGILYLHTEANPPIFHRDIKATNILLDSKFIAKVADFGL  768

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  769  SRLAPVPDFEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  828

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+A+ SG IFSVID RMGSYPSECVEKF++LALKCC+++TD
Sbjct  829  ISHGKNIVREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALKCCKEETD  880



>ref|XP_010675302.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=959

 Score =   315 bits (808),  Expect = 7e-98, Method: Composition-based stats.
 Identities = 147/172 (85%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K K PL FA RLRVALGS+KGILYLHTEADPPIFHRDIKASNILLD+K+ AKVADFGL
Sbjct  717  SAKCKQPLNFASRLRVALGSSKGILYLHTEADPPIFHRDIKASNILLDSKYMAKVADFGL  776

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG  PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  777  SRLAPVPDIEGLTPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  836

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+AY +G  FSV DERMGSYPSEC EKF+ LALKCCQD+TD
Sbjct  837  ISHGKNIVREVNMAYQAGITFSVFDERMGSYPSECAEKFLNLALKCCQDETD  888



>ref|XP_010675301.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=960

 Score =   315 bits (808),  Expect = 7e-98, Method: Composition-based stats.
 Identities = 147/172 (85%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K K PL FA RLRVALGS+KGILYLHTEADPPIFHRDIKASNILLD+K+ AKVADFGL
Sbjct  718  SAKCKQPLNFASRLRVALGSSKGILYLHTEADPPIFHRDIKASNILLDSKYMAKVADFGL  777

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG  PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  778  SRLAPVPDIEGLTPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  837

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+AY +G  FSV DERMGSYPSEC EKF+ LALKCCQD+TD
Sbjct  838  ISHGKNIVREVNMAYQAGITFSVFDERMGSYPSECAEKFLNLALKCCQDETD  889



>ref|XP_009355137.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Pyrus x bretschneideri]
Length=951

 Score =   315 bits (808),  Expect = 7e-98, Method: Composition-based stats.
 Identities = 145/172 (84%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + +SK+PL F +RLR+ALGSAKGILYLHTEA+PPIFHRDIKA+NILLD+KF AKVADFGL
Sbjct  707  SARSKEPLGFEMRLRIALGSAKGILYLHTEANPPIFHRDIKATNILLDSKFIAKVADFGL  766

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SR APVPD EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  767  SRFAPVPDFEGTVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  826

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+A+ SG IFSVID RMGSYPSECVEKF++LALKCC+++TD
Sbjct  827  ISHGKNIVREVNIAFQSGMIFSVIDGRMGSYPSECVEKFLSLALKCCKEETD  878



>ref|XP_006432044.1| hypothetical protein CICLE_v10000174mg [Citrus clementina]
 ref|XP_006464961.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Citrus sinensis]
 ref|XP_006464962.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Citrus sinensis]
 gb|ESR45284.1| hypothetical protein CICLE_v10000174mg [Citrus clementina]
 gb|KDO54919.1| hypothetical protein CISIN_1g002174mg [Citrus sinensis]
 gb|KDO54920.1| hypothetical protein CISIN_1g002174mg [Citrus sinensis]
 gb|KDO54921.1| hypothetical protein CISIN_1g002174mg [Citrus sinensis]
Length=956

 Score =   315 bits (808),  Expect = 8e-98, Method: Composition-based stats.
 Identities = 148/172 (86%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK+PL FA+RL +ALGS++GILYLHTEADPP+FHRDIKASNILLD KFTAKVADFGL
Sbjct  712  SAKSKEPLGFAMRLSIALGSSRGILYLHTEADPPVFHRDIKASNILLDHKFTAKVADFGL  771

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  772  SRLAPVPDIEGIVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  831

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+AY S  +FSVID  MGSYPSECVEKFI LALKCCQD+TD
Sbjct  832  ISHGKNIVREVNIAYQSSMMFSVIDGNMGSYPSECVEKFIKLALKCCQDETD  883



>ref|XP_010921201.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Elaeis guineensis]
Length=944

 Score =   314 bits (805),  Expect = 1e-97, Method: Composition-based stats.
 Identities = 144/172 (84%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + + K+PL F++RLR+ALGSA+GILYLHTEADPPIFHRDIKA+NILLD+KF AKVADFGL
Sbjct  701  SARCKEPLKFSMRLRIALGSARGILYLHTEADPPIFHRDIKATNILLDSKFIAKVADFGL  760

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD EG VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP
Sbjct  761  SRLAPVPDTEGTVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  820

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREV  AY SG +FSVID  MGSYPSEC+EKF++LAL+CCQD+TD
Sbjct  821  ISHGKNIVREVTTAYQSGMMFSVIDSLMGSYPSECIEKFVSLALRCCQDETD  872



>ref|XP_010278952.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nelumbo nucifera]
Length=951

 Score =   314 bits (805),  Expect = 2e-97, Method: Composition-based stats.
 Identities = 146/170 (86%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K+PL+FA RL++ALGSAKGILYLHTEADPPIFHRDIKASNILLD+KFTAKVADFGLSR
Sbjct  710  KTKEPLSFATRLQIALGSAKGILYLHTEADPPIFHRDIKASNILLDSKFTAKVADFGLSR  769

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAP PD+EG VP HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  770  LAPAPDIEGIVPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPIS  829

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREV++AY SG I SV+D RMGSYPSEC+EKF+TLALKCCQD+T+
Sbjct  830  HGKNIVREVSMAYQSGMILSVVDGRMGSYPSECIEKFLTLALKCCQDETE  879



>ref|XP_004137372.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Cucumis sativus]
Length=952

 Score =   314 bits (805),  Expect = 2e-97, Method: Composition-based stats.
 Identities = 145/172 (84%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V S +PL+FA RL+ ALG+AKGILYLHTEADPPIFHRDIK+SNILLD+K+ AKVADFGL
Sbjct  711  SVNSAEPLSFATRLKAALGAAKGILYLHTEADPPIFHRDIKSSNILLDSKYVAKVADFGL  770

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP+P+ EG+VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTG HP
Sbjct  771  SRLAPLPNAEGDVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGRHP  830

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN AY SG IFS+ID R+GSYP+ECVEKF+TLALKCCQDDTD
Sbjct  831  ISHGKNIVREVNSAYQSGKIFSIIDGRLGSYPAECVEKFVTLALKCCQDDTD  882



>ref|XP_011089544.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Sesamum indicum]
Length=957

 Score =   314 bits (805),  Expect = 2e-97, Method: Composition-based stats.
 Identities = 145/170 (85%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            KSK  LTFA+R+++ALGSA+GILYLHTEA+PPIFHRDIKA+NILLD+KFTAKVADFGLSR
Sbjct  716  KSKVLLTFAMRVKIALGSARGILYLHTEANPPIFHRDIKATNILLDSKFTAKVADFGLSR  775

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVP+LEG++P+HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGMHPIS
Sbjct  776  LAPVPELEGDIPSHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMHPIS  835

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN AY SG IFS+IDE MGSYPSECVEKF+ LALKCCQ++TD
Sbjct  836  HGKNIVREVNNAYRSGMIFSIIDEHMGSYPSECVEKFVNLALKCCQEETD  885



>ref|XP_003537371.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Glycine max]
 ref|XP_006591270.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Glycine max]
 gb|KHN24716.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=954

 Score =   313 bits (801),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V +KDPLTFA+RL++ALG+AKG++YLHTEADPPIFHRD+KASNILLD+KF+AKVADFGL
Sbjct  705  SVTAKDPLTFAMRLKIALGAAKGLMYLHTEADPPIFHRDVKASNILLDSKFSAKVADFGL  764

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP
Sbjct  765  SRLAPVPDMEGVVPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  824

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVNVAY SG IFS+ID RMGSYPSE VEKF+TLA+KCC+D+ +
Sbjct  825  ISHGKNIVREVNVAYQSGVIFSIIDGRMGSYPSEHVEKFLTLAMKCCEDEPE  876



>gb|KCW52448.1| hypothetical protein EUGRSUZ_J01846 [Eucalyptus grandis]
Length=967

 Score =   313 bits (801),  Expect = 9e-97, Method: Composition-based stats.
 Identities = 146/174 (84%), Positives = 160/174 (92%), Gaps = 4/174 (2%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            +SK+PL+F +R+R+ALG+AKGILYLHTEADPPIFHRDIKASNILLD KFTAKVADFGLSR
Sbjct  722  RSKEPLSFGMRMRIALGAAKGILYLHTEADPPIFHRDIKASNILLDPKFTAKVADFGLSR  781

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPD+EG VP HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  782  LAPVPDIEGVVPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPIS  841

Query  151  HGKNIVRE----VNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVRE    VNVAY SGT FS++D  MGSYPSEC+EKF+ LALKCCQD+TD
Sbjct  842  HGKNIVRELAWQVNVAYQSGTTFSIVDGSMGSYPSECIEKFLMLALKCCQDETD  895



>ref|XP_008649785.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
Length=338

 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK PL+F LRL++ALG+AKGILYLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  94   SAKSKRPLSFGLRLKIALGAAKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGL  153

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM P
Sbjct  154  SRLAPVPDVEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKP  213

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN A  SG +  +ID RMG YP EC+++F++LA KCCQD+TD
Sbjct  214  IEHGKNIVREVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQDETD  265



>ref|XP_008457284.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Cucumis melo]
Length=952

 Score =   311 bits (797),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V S +PL+FA RL+ ALG+AKGILYLHTEADPPIFHRDIK+SNILLD+K+ AKVADFGL
Sbjct  711  SVNSAEPLSFATRLKAALGAAKGILYLHTEADPPIFHRDIKSSNILLDSKYVAKVADFGL  770

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP+P+ EG+VPAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTG HP
Sbjct  771  SRLAPLPNAEGDVPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGRHP  830

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN AY SG IFS+ID R+GSYP+ECVEKF+TLALKCCQDDTD
Sbjct  831  ISHGKNIVREVNGAYQSGKIFSIIDGRLGSYPAECVEKFVTLALKCCQDDTD  882



>gb|KHN18646.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=953

 Score =   310 bits (793),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V +KDPLTFA+RL++ALG+AKG+LYLH+EADPPIFHRD+KASNILLD+KF+AKVADFGL
Sbjct  704  SVTAKDPLTFAMRLKMALGAAKGLLYLHSEADPPIFHRDVKASNILLDSKFSAKVADFGL  763

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLELLTGMHP
Sbjct  764  SRLAPVPDMEGVVPGHVSTVVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLELLTGMHP  823

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVNVAY SG IFS+ID RMGSYPSE VEKF+TLA+KCC+D+ +
Sbjct  824  ISHGKNIVREVNVAYQSGVIFSIIDGRMGSYPSEHVEKFLTLAMKCCEDEPE  875



>ref|XP_003552905.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Glycine max]
Length=953

 Score =   310 bits (793),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V +KDPLTFA+RL++ALG+AKG+LYLH+EADPPIFHRD+KASNILLD+KF+AKVADFGL
Sbjct  704  SVTAKDPLTFAMRLKMALGAAKGLLYLHSEADPPIFHRDVKASNILLDSKFSAKVADFGL  763

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLELLTGMHP
Sbjct  764  SRLAPVPDMEGVVPGHVSTVVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLELLTGMHP  823

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVNVAY SG IFS+ID RMGSYPSE VEKF+TLA+KCC+D+ +
Sbjct  824  ISHGKNIVREVNVAYQSGVIFSIIDGRMGSYPSEHVEKFLTLAMKCCEDEPE  875



>ref|XP_002319433.2| hypothetical protein POPTR_0013s15520g [Populus trichocarpa]
 gb|EEE95356.2| hypothetical protein POPTR_0013s15520g [Populus trichocarpa]
Length=965

 Score =   310 bits (793),  Expect = 1e-95, Method: Composition-based stats.
 Identities = 138/172 (80%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+K+PL+FA RL +AL SAKGILYLHTEADPPIFHRD+KASNILLD+++ AKVADFGL
Sbjct  722  SAKAKEPLSFATRLGIALASAKGILYLHTEADPPIFHRDVKASNILLDSRYNAKVADFGL  781

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            S+LAPVPD+EG+VP H+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  782  SKLAPVPDIEGDVPGHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  841

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+AY +G IFS++D RMGSYPS+CV+KF+TLA+KCC D+TD
Sbjct  842  ISHGKNIVREVNIAYQTGMIFSIVDGRMGSYPSDCVDKFLTLAMKCCNDETD  893



>ref|XP_004500393.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Cicer arietinum]
 ref|XP_004500394.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Cicer arietinum]
Length=948

 Score =   308 bits (788),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +  SK+PLTFA+RL++ALG+AKG++YLHTEADPPIFHRD+KASNILLD+K +AKVADFGL
Sbjct  703  SATSKEPLTFAMRLKMALGAAKGLMYLHTEADPPIFHRDVKASNILLDSKLSAKVADFGL  762

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP
Sbjct  763  SRLAPVPDMEGIVPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  822

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN++Y SG IFS+ID RMGSYPSE VEKF++LALKCC D+ D
Sbjct  823  ISHGKNIVREVNLSYQSGVIFSIIDARMGSYPSEHVEKFLSLALKCCNDEPD  874



>dbj|BAD87127.1| receptor protein kinase-like [Oryza sativa Japonica Group]
Length=361

 Score =   292 bits (748),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + +SK+PL F  RLR+ALGS++GILYLHTEADPPIFHRDIKASNILLD+KF AKVADFGL
Sbjct  107  SARSKEPLNFPTRLRIALGSSRGILYLHTEADPPIFHRDIKASNILLDSKFVAKVADFGL  166

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP P+ EG  P HVSTV+KGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  167  SRLAPEPESEGIAPGHVSTVIKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  226

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHG+NIVREV  A  SG I SV+D RMGSYP+ECVEKF  LAL+CC+D+TD
Sbjct  227  ISHGRNIVREVVAANQSGMILSVVDSRMGSYPAECVEKFAALALRCCRDETD  278



>ref|XP_010922797.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Elaeis guineensis]
Length=891

 Score =   306 bits (784),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  +  N TL    +  KSK+PL+FA+RLR+ALGSA+GILYLH+EADPPI+HRDIKAS
Sbjct  632  MLVYEFMPNGTLRDHLSATKSKEPLSFAMRLRIALGSARGILYLHSEADPPIYHRDIKAS  691

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLDAKF AKVADFGLSRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLTHKLTDKSD
Sbjct  692  NILLDAKFNAKVADFGLSRLAPVPDVEGTVPGHVSTVVKGTPGYLDPEYFLTHKLTDKSD  751

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLEL TGM PI HGKNIVREV++   SG +FS+ID RMGSYPSEC+EKF++LA
Sbjct  752  VYSLGVVFLELSTGMRPILHGKNIVREVSMICQSGMMFSIIDNRMGSYPSECIEKFVSLA  811

Query  28   LKCCQDDTD  2
            L+CCQD+TD
Sbjct  812  LRCCQDETD  820



>ref|XP_007146906.1| hypothetical protein PHAVU_006G080500g [Phaseolus vulgaris]
 gb|ESW18900.1| hypothetical protein PHAVU_006G080500g [Phaseolus vulgaris]
Length=951

 Score =   307 bits (787),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V +K+PLTFA+RL++ALG+AKG++YLHTEADPPIFHRD+KASNILLD KF+AKVADFGL
Sbjct  704  SVTAKEPLTFAMRLKIALGAAKGLMYLHTEADPPIFHRDVKASNILLDPKFSAKVADFGL  763

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVV LELLTGMHP
Sbjct  764  SRLAPVPDMEGVVPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMHP  823

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+AY  G IFS+ID RMGSYPSE VEKF+TLALKCC+D+ +
Sbjct  824  ISHGKNIVREVNIAYQRGVIFSIIDGRMGSYPSEQVEKFLTLALKCCEDEPE  875



>ref|XP_002447392.1| hypothetical protein SORBIDRAFT_06g000230 [Sorghum bicolor]
 gb|EES11720.1| hypothetical protein SORBIDRAFT_06g000230 [Sorghum bicolor]
Length=243

 Score =   288 bits (736),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = -3

Query  484  LRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLAPVPDLEG  305
            +RLR+ALGS++GILYLHTEADPPI+HRDIKASNILLD+KF AKVADFGLSRLAP+P+ EG
Sbjct  1    MRLRIALGSSRGILYLHTEADPPIYHRDIKASNILLDSKFVAKVADFGLSRLAPLPETEG  60

Query  304  EVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNIVREV  125
              P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PISHG+NIVREV
Sbjct  61   SAPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGRNIVREV  120

Query  124  NVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
              A  SG IFSV+D RMGSYP+ECVEKF  LAL+CCQD+TD
Sbjct  121  LAANQSGMIFSVVDNRMGSYPAECVEKFSALALRCCQDETD  161



>ref|XP_003600556.1| hypothetical protein MTR_3g062590 [Medicago truncatula]
 gb|AES70807.1| LRR receptor-like kinase [Medicago truncatula]
Length=955

 Score =   307 bits (786),  Expect = 1e-94, Method: Composition-based stats.
 Identities = 141/172 (82%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V +K+PLTF +RL++ALGSAKG++YLH EADPPIFHRD+KASNILLD+K +AKVADFGL
Sbjct  708  SVSAKEPLTFIMRLKIALGSAKGLMYLHNEADPPIFHRDVKASNILLDSKLSAKVADFGL  767

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGMHP
Sbjct  768  SRLAPVPDMEGIVPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEILTGMHP  827

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN++Y SG IFS+IDERMGSYPSE VEKF+TLALKC  D+ D
Sbjct  828  ISHGKNIVREVNLSYQSGVIFSIIDERMGSYPSEHVEKFLTLALKCVNDEPD  879



>ref|XP_002326064.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF00446.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=902

 Score =   306 bits (783),  Expect = 1e-94, Method: Composition-based stats.
 Identities = 137/172 (80%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +VK K+PL+FA RL++A+ SAKGILYLHTEA+PPIFHRDIKASNIL+D+++ AKVADFGL
Sbjct  659  SVKGKEPLSFATRLKIAMTSAKGILYLHTEANPPIFHRDIKASNILVDSRYDAKVADFGL  718

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VP H+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTG  P
Sbjct  719  SRLAPVPDIEGSVPDHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGKQP  778

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREV +AY SG IFS+IDERMGSYPS+C++KF+TLA+KCC ++TD
Sbjct  779  ISHGKNIVREVKIAYQSGMIFSIIDERMGSYPSDCIDKFLTLAMKCCNEETD  830



>ref|XP_011041757.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Populus euphratica]
 ref|XP_011041758.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Populus euphratica]
Length=964

 Score =   307 bits (786),  Expect = 1e-94, Method: Composition-based stats.
 Identities = 139/172 (81%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +VK K+PL+FA RL++A+ SAKGILYLHTEADPPIFHRDIKASNIL+D+++ AKVADFGL
Sbjct  721  SVKGKEPLSFATRLKIAMTSAKGILYLHTEADPPIFHRDIKASNILVDSRYDAKVADFGL  780

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VP H+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTG  P
Sbjct  781  SRLAPVPDIEGSVPDHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGKQP  840

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREV VAY SG IFSVIDERMGSYPS+C++KF+TLA+KCC ++T+
Sbjct  841  ISHGKNIVREVKVAYQSGMIFSVIDERMGSYPSDCIDKFLTLAMKCCNEETN  892



>tpg|DAA38792.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=523

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + ++K PL F +RLR+ALGS++GILYLHTEADPPI+HRDIKASNILLD+KF AKVADFGL
Sbjct  276  SARAKVPLDFPMRLRIALGSSRGILYLHTEADPPIYHRDIKASNILLDSKFVAKVADFGL  335

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP+P+ EG  P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  336  SRLAPLPETEGSAPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  395

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHG+NIVREV  A  SG IFSV+D RMGSYP+ECVEKF  LAL+CCQD+TD
Sbjct  396  ISHGRNIVREVLAANQSGMIFSVVDNRMGSYPAECVEKFAALALRCCQDETD  447



>ref|XP_011080636.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Sesamum indicum]
Length=972

 Score =   306 bits (785),  Expect = 2e-94, Method: Composition-based stats.
 Identities = 140/170 (82%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K K P++F++R+R ALG+A+GILYLHTEA+PPIFHRDIKA+NILLD+K+TAKVADFGLSR
Sbjct  721  KFKAPMSFSMRVRTALGAARGILYLHTEANPPIFHRDIKATNILLDSKYTAKVADFGLSR  780

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAP P+L+G VPAHVSTVVKGTPG+LDPEYFLTH+LTDKSDVYSLGVVF+EL+TGMHPI 
Sbjct  781  LAPEPELDGSVPAHVSTVVKGTPGYLDPEYFLTHELTDKSDVYSLGVVFMELITGMHPIF  840

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREV  AY SG IFSVIDERMGSYPSECVEKF+ LALKCCQD+TD
Sbjct  841  HGKNIVREVKTAYRSGMIFSVIDERMGSYPSECVEKFVILALKCCQDETD  890



>ref|XP_010922796.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Elaeis guineensis]
Length=943

 Score =   306 bits (784),  Expect = 2e-94, Method: Composition-based stats.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  +  N TL    +  KSK+PL+FA+RLR+ALGSA+GILYLH+EADPPI+HRDIKAS
Sbjct  684  MLVYEFMPNGTLRDHLSATKSKEPLSFAMRLRIALGSARGILYLHSEADPPIYHRDIKAS  743

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLDAKF AKVADFGLSRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLTHKLTDKSD
Sbjct  744  NILLDAKFNAKVADFGLSRLAPVPDVEGTVPGHVSTVVKGTPGYLDPEYFLTHKLTDKSD  803

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLEL TGM PI HGKNIVREV++   SG +FS+ID RMGSYPSEC+EKF++LA
Sbjct  804  VYSLGVVFLELSTGMRPILHGKNIVREVSMICQSGMMFSIIDNRMGSYPSECIEKFVSLA  863

Query  28   LKCCQDDTD  2
            L+CCQD+TD
Sbjct  864  LRCCQDETD  872



>ref|XP_010457836.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Camelina sativa]
Length=871

 Score =   305 bits (780),  Expect = 2e-94, Method: Composition-based stats.
 Identities = 144/189 (76%), Positives = 167/189 (88%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL   + +VK K+PL FA+RLR+ALGSAKGI YLHTEADPPIFHRDIKAS
Sbjct  613  MLVYEYMENGTLRD-NISVKLKEPLDFAMRLRIALGSAKGISYLHTEADPPIFHRDIKAS  671

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD++FTAKVADFGLSRLAPVPD+EG  P HVSTVVKGTPG+LDPEYFLTH+LTDKSD
Sbjct  672  NILLDSRFTAKVADFGLSRLAPVPDMEGISPHHVSTVVKGTPGYLDPEYFLTHQLTDKSD  731

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGMHPI+HGKNIVRE+N+AY SG+I S +D+RM S P EC+EKF TLA
Sbjct  732  VYSLGVVFLELLTGMHPITHGKNIVREINIAYESGSILSAVDKRMSSVPDECLEKFATLA  791

Query  28   LKCCQDDTD  2
            L+CC+++TD
Sbjct  792  LRCCREETD  800



>ref|XP_011011783.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Populus euphratica]
Length=945

 Score =   304 bits (779),  Expect = 8e-94, Method: Composition-based stats.
 Identities = 136/172 (79%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+K+PL+F  RL +AL SAKGILYLH EADPPIFHRD+KASNILLD+K+ AKVADFGL
Sbjct  702  SAKAKEPLSFVTRLGIALASAKGILYLHREADPPIFHRDVKASNILLDSKYNAKVADFGL  761

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            S+LAPVP++EG+VP H+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  762  SKLAPVPNIEGDVPGHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  821

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+AY +G IFS++D RMGSYPS+CV+KF+TLA+KCC D+TD
Sbjct  822  ISHGKNIVREVNIAYQTGMIFSIVDGRMGSYPSDCVDKFLTLAMKCCNDETD  873



>ref|XP_011011784.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X3 [Populus euphratica]
Length=862

 Score =   303 bits (775),  Expect = 1e-93, Method: Composition-based stats.
 Identities = 136/172 (79%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+K+PL+F  RL +AL SAKGILYLH EADPPIFHRD+KASNILLD+K+ AKVADFGL
Sbjct  619  SAKAKEPLSFVTRLGIALASAKGILYLHREADPPIFHRDVKASNILLDSKYNAKVADFGL  678

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            S+LAPVP++EG+VP H+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  679  SKLAPVPNIEGDVPGHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  738

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+AY +G IFS++D RMGSYPS+CV+KF+TLA+KCC D+TD
Sbjct  739  ISHGKNIVREVNIAYQTGMIFSIVDGRMGSYPSDCVDKFLTLAMKCCNDETD  790



>ref|XP_011011778.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Populus euphratica]
 ref|XP_011011780.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Populus euphratica]
 ref|XP_011011781.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Populus euphratica]
 ref|XP_011011782.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Populus euphratica]
Length=964

 Score =   304 bits (778),  Expect = 1e-93, Method: Composition-based stats.
 Identities = 136/172 (79%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+K+PL+F  RL +AL SAKGILYLH EADPPIFHRD+KASNILLD+K+ AKVADFGL
Sbjct  721  SAKAKEPLSFVTRLGIALASAKGILYLHREADPPIFHRDVKASNILLDSKYNAKVADFGL  780

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            S+LAPVP++EG+VP H+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  781  SKLAPVPNIEGDVPGHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  840

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+AY +G IFS++D RMGSYPS+CV+KF+TLA+KCC D+TD
Sbjct  841  ISHGKNIVREVNIAYQTGMIFSIVDGRMGSYPSDCVDKFLTLAMKCCNDETD  892



>ref|XP_010475436.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Camelina sativa]
Length=871

 Score =   302 bits (774),  Expect = 2e-93, Method: Composition-based stats.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL   + +VK K+PL FA+RLR+ALGSAKGI YLHTEADPPIFHRDIKAS
Sbjct  613  MLVYEYMENGTLRD-NISVKLKEPLDFAMRLRIALGSAKGISYLHTEADPPIFHRDIKAS  671

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD++FTAKVADFGLSRLAPVPDLEG  P HVSTVVKGTPG+LDPEYFLTH+LTDKSD
Sbjct  672  NILLDSRFTAKVADFGLSRLAPVPDLEGISPHHVSTVVKGTPGYLDPEYFLTHQLTDKSD  731

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGM PI+HGKNIVRE+N+AY SG+I S +D+RM S P EC+EKF TLA
Sbjct  732  VYSLGVVFLELLTGMQPITHGKNIVREINIAYESGSILSAVDKRMSSVPDECLEKFATLA  791

Query  28   LKCCQDDTD  2
            L+CC+++TD
Sbjct  792  LRCCREETD  800



>ref|XP_002892361.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68620.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=941

 Score =   303 bits (777),  Expect = 2e-93, Method: Composition-based stats.
 Identities = 143/189 (76%), Positives = 167/189 (88%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL   + +VK K+PL FA+RLR+ALGSAKGILYLHTEA+PPIFHRDIKAS
Sbjct  683  MLVYEYMENGTLRD-NISVKLKEPLDFAMRLRIALGSAKGILYLHTEANPPIFHRDIKAS  741

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD++FTAKVADFGLSRLAPVPD+EG  P HVSTVVKGTPG+LDPEYFLTH+LTDKSD
Sbjct  742  NILLDSRFTAKVADFGLSRLAPVPDMEGISPHHVSTVVKGTPGYLDPEYFLTHQLTDKSD  801

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGM PI+HGKNIVRE+N+AY SG+I S +D+RM S P EC+EKF TLA
Sbjct  802  VYSLGVVFLELLTGMQPITHGKNIVREINIAYESGSILSAVDKRMSSVPDECLEKFATLA  861

Query  28   LKCCQDDTD  2
            L+CC+++TD
Sbjct  862  LRCCREETD  870



>ref|XP_006306699.1| hypothetical protein CARUB_v10008222mg [Capsella rubella]
 gb|EOA39597.1| hypothetical protein CARUB_v10008222mg [Capsella rubella]
Length=951

 Score =   303 bits (777),  Expect = 2e-93, Method: Composition-based stats.
 Identities = 144/189 (76%), Positives = 167/189 (88%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL   + +VK K+PL FA+RLR+ALGSAKGILYLHTEADPPIFHRDIKAS
Sbjct  693  MLVYEYMENGTLRD-NISVKLKEPLDFAMRLRIALGSAKGILYLHTEADPPIFHRDIKAS  751

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD++FTAKVADFGLSRLAPVPD+EG  P HVSTVVKGTPG+LDPEYFLTH+LTDKSD
Sbjct  752  NILLDSRFTAKVADFGLSRLAPVPDMEGISPHHVSTVVKGTPGYLDPEYFLTHQLTDKSD  811

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGM PI+HGKNIVRE+N+AY SG+I S +D+RM S P+EC+EKF TLA
Sbjct  812  VYSLGVVFLELLTGMQPITHGKNIVREINIAYESGSILSAVDKRMSSVPAECLEKFATLA  871

Query  28   LKCCQDDTD  2
            L CC+++TD
Sbjct  872  LGCCREETD  880



>ref|XP_010486768.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Camelina sativa]
Length=871

 Score =   302 bits (773),  Expect = 2e-93, Method: Composition-based stats.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL   + +VK K+PL FA+RLR+ALGSAKGI YLHTEADPPIFHRDIKAS
Sbjct  613  MLVYEYMENGTLRD-NISVKLKEPLDFAMRLRIALGSAKGISYLHTEADPPIFHRDIKAS  671

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD++FTAKVADFGLSRLAPVPD+EG  P HVSTVVKGTPG+LDPEYFLTH+LTDKSD
Sbjct  672  NILLDSRFTAKVADFGLSRLAPVPDMEGISPHHVSTVVKGTPGYLDPEYFLTHQLTDKSD  731

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGM PI+HGKNIVRE+N+AY SG+I S +D+RM S P EC+EKF TLA
Sbjct  732  VYSLGVVFLELLTGMQPITHGKNIVREINIAYESGSILSAVDKRMSSVPDECLEKFATLA  791

Query  28   LKCCQDDTD  2
            L+CC+++TD
Sbjct  792  LRCCREETD  800



>gb|KFK42998.1| hypothetical protein AALP_AA1G066200 [Arabis alpina]
Length=950

 Score =   302 bits (774),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL   + +VK +DPL FA+RLR+ALGSAKGILYLHTEADPPIFHRDIKAS
Sbjct  691  MLVYEYMENGTLRD-NISVKLRDPLDFAMRLRIALGSAKGILYLHTEADPPIFHRDIKAS  749

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD++F AKVADFGLSRLAPVPD+EG  P HVSTVVKGTPG+LDPEYFLTH+LTDKSD
Sbjct  750  NILLDSRFIAKVADFGLSRLAPVPDMEGISPHHVSTVVKGTPGYLDPEYFLTHQLTDKSD  809

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGMHPI+ GKNIVREVN+AY SG+I SV+D+RM S P EC+EKF TLA
Sbjct  810  VYSLGVVFLELLTGMHPITRGKNIVREVNIAYQSGSILSVVDKRMSSVPDECLEKFATLA  869

Query  28   LKCCQDDTD  2
            L+CC+++TD
Sbjct  870  LRCCREETD  878



>ref|XP_010457834.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Camelina sativa]
Length=1036

 Score =   303 bits (776),  Expect = 7e-93, Method: Composition-based stats.
 Identities = 144/189 (76%), Positives = 167/189 (88%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL   + +VK K+PL FA+RLR+ALGSAKGI YLHTEADPPIFHRDIKAS
Sbjct  778  MLVYEYMENGTLRD-NISVKLKEPLDFAMRLRIALGSAKGISYLHTEADPPIFHRDIKAS  836

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD++FTAKVADFGLSRLAPVPD+EG  P HVSTVVKGTPG+LDPEYFLTH+LTDKSD
Sbjct  837  NILLDSRFTAKVADFGLSRLAPVPDMEGISPHHVSTVVKGTPGYLDPEYFLTHQLTDKSD  896

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGMHPI+HGKNIVRE+N+AY SG+I S +D+RM S P EC+EKF TLA
Sbjct  897  VYSLGVVFLELLTGMHPITHGKNIVREINIAYESGSILSAVDKRMSSVPDECLEKFATLA  956

Query  28   LKCCQDDTD  2
            L+CC+++TD
Sbjct  957  LRCCREETD  965



>ref|XP_010475435.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Camelina sativa]
Length=953

 Score =   302 bits (773),  Expect = 8e-93, Method: Composition-based stats.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL   + +VK K+PL FA+RLR+ALGSAKGI YLHTEADPPIFHRDIKAS
Sbjct  695  MLVYEYMENGTLRD-NISVKLKEPLDFAMRLRIALGSAKGISYLHTEADPPIFHRDIKAS  753

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD++FTAKVADFGLSRLAPVPDLEG  P HVSTVVKGTPG+LDPEYFLTH+LTDKSD
Sbjct  754  NILLDSRFTAKVADFGLSRLAPVPDLEGISPHHVSTVVKGTPGYLDPEYFLTHQLTDKSD  813

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGM PI+HGKNIVRE+N+AY SG+I S +D+RM S P EC+EKF TLA
Sbjct  814  VYSLGVVFLELLTGMQPITHGKNIVREINIAYESGSILSAVDKRMSSVPDECLEKFATLA  873

Query  28   LKCCQDDTD  2
            L+CC+++TD
Sbjct  874  LRCCREETD  882



>ref|XP_010486760.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Camelina sativa]
Length=954

 Score =   301 bits (772),  Expect = 9e-93, Method: Composition-based stats.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL   + +VK K+PL FA+RLR+ALGSAKGI YLHTEADPPIFHRDIKAS
Sbjct  696  MLVYEYMENGTLRD-NISVKLKEPLDFAMRLRIALGSAKGISYLHTEADPPIFHRDIKAS  754

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD++FTAKVADFGLSRLAPVPD+EG  P HVSTVVKGTPG+LDPEYFLTH+LTDKSD
Sbjct  755  NILLDSRFTAKVADFGLSRLAPVPDMEGISPHHVSTVVKGTPGYLDPEYFLTHQLTDKSD  814

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGM PI+HGKNIVRE+N+AY SG+I S +D+RM S P EC+EKF TLA
Sbjct  815  VYSLGVVFLELLTGMQPITHGKNIVREINIAYESGSILSAVDKRMSSVPDECLEKFATLA  874

Query  28   LKCCQDDTD  2
            L+CC+++TD
Sbjct  875  LRCCREETD  883



>ref|XP_008803012.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Phoenix dactylifera]
Length=949

 Score =   300 bits (768),  Expect = 4e-92, Method: Composition-based stats.
 Identities = 142/189 (75%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  +  N TL    ++ KSK PL+FA+RLR+ALGSA+GI+YLH+EADPPIFHRDIKAS
Sbjct  690  MLVYEFMPNGTLRDHLSSTKSKQPLSFAMRLRIALGSARGIIYLHSEADPPIFHRDIKAS  749

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLDAKF AKVADFGLSRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLTHKLTDKSD
Sbjct  750  NILLDAKFNAKVADFGLSRLAPVPDVEGIVPGHVSTVVKGTPGYLDPEYFLTHKLTDKSD  809

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGM PI HGKNIVREV++A  SG +FS+ID  MGSYPSEC+E F++LA
Sbjct  810  VYSLGVVFLELLTGMRPILHGKNIVREVSMACQSGMMFSIIDNHMGSYPSECIENFVSLA  869

Query  28   LKCCQDDTD  2
             +CC+D+ D
Sbjct  870  RRCCRDEPD  878



>ref|XP_011466400.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Fragaria vesca subsp. vesca]
Length=265

 Score =   281 bits (720),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K K  L F++RLR+ALGSAKGILYLHTEA+PPIFHRDIKA+NILLD+ +TAKVADFGLSR
Sbjct  26   KIKGSLDFSMRLRIALGSAKGILYLHTEANPPIFHRDIKATNILLDSNYTAKVADFGLSR  85

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG  P +VSTVV+GTPG+LDPEYFLT +LTDKSDVYSLG+VFLELLTG+ PIS
Sbjct  86   LAPVQDDEGTGPGYVSTVVRGTPGYLDPEYFLTSQLTDKSDVYSLGIVFLELLTGVLPIS  145

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+A+ SG +FS+ID RMGSYPSECVE+F+ LAL+CCQD  D
Sbjct  146  HGKNIVREVNMAHQSGLMFSIIDTRMGSYPSECVERFVALALRCCQDKQD  195



>ref|XP_004974947.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Setaria italica]
Length=968

 Score =   300 bits (767),  Expect = 6e-92, Method: Composition-based stats.
 Identities = 137/172 (80%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+K PL F +RLR+ALGS++GILYLHTEADPPI+HRDIKASNILLD+KF AKVADFGL
Sbjct  714  SAKAKVPLDFPMRLRIALGSSRGILYLHTEADPPIYHRDIKASNILLDSKFVAKVADFGL  773

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP+P+ EG  P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  774  SRLAPLPETEGSAPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  833

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHG+NIVREV  A  SG IFSV+D RMGSYP+ECVE+F  LAL+CCQD+TD
Sbjct  834  ISHGRNIVREVLAANQSGMIFSVVDNRMGSYPAECVERFAALALRCCQDETD  885



>ref|XP_008669743.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
 ref|XP_008669744.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
Length=952

 Score =   300 bits (767),  Expect = 6e-92, Method: Composition-based stats.
 Identities = 137/172 (80%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + ++K PL F +RLR+ALGS++GILYLHTEADPPI+HRDIKASNILLD+KF AKVADFGL
Sbjct  705  SARAKVPLDFPMRLRIALGSSRGILYLHTEADPPIYHRDIKASNILLDSKFVAKVADFGL  764

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP+P+ EG  P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  765  SRLAPLPETEGSAPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  824

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHG+NIVREV  A  SG IFSV+D RMGSYP+ECVEKF  LAL+CCQD+TD
Sbjct  825  ISHGRNIVREVLAANQSGMIFSVVDNRMGSYPAECVEKFAALALRCCQDETD  876



>ref|NP_172169.2| probable LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
 sp|C0LGD7.2|Y1684_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase At1g06840; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE28044.1| probable LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
Length=953

 Score =   300 bits (767),  Expect = 6e-92, Method: Composition-based stats.
 Identities = 141/189 (75%), Positives = 165/189 (87%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL   + +VK K+PL FA+RLR+ALGSAKGILYLHTEA+PPIFHRDIKAS
Sbjct  695  MLVYEYMENGTLRD-NISVKLKEPLDFAMRLRIALGSAKGILYLHTEANPPIFHRDIKAS  753

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD++FTAKVADFGLSRLAPVPD+EG  P HVSTVVKGTPG+LDPEYFLTH+LTDKSD
Sbjct  754  NILLDSRFTAKVADFGLSRLAPVPDMEGISPQHVSTVVKGTPGYLDPEYFLTHQLTDKSD  813

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVV LEL TGM PI+HGKNIVRE+N+AY SG+I S +D+RM S P EC+EKF TLA
Sbjct  814  VYSLGVVLLELFTGMQPITHGKNIVREINIAYESGSILSTVDKRMSSVPDECLEKFATLA  873

Query  28   LKCCQDDTD  2
            L+CC+++TD
Sbjct  874  LRCCREETD  882



>ref|XP_006417874.1| hypothetical protein EUTSA_v10006712mg [Eutrema salsugineum]
 gb|ESQ36227.1| hypothetical protein EUTSA_v10006712mg [Eutrema salsugineum]
Length=950

 Score =   300 bits (767),  Expect = 6e-92, Method: Composition-based stats.
 Identities = 142/189 (75%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL   + +VK KDPL FA+R+R+ALGSAKGILYLHTEA+PPIFHRDIKAS
Sbjct  690  MLVYEYMENGTLRD-NISVKLKDPLDFAMRMRIALGSAKGILYLHTEANPPIFHRDIKAS  748

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD++F AKVADFGLSRLAPVPD+EG  P HVSTVVKGTPG+LDPEYFLTH+LTDKSD
Sbjct  749  NILLDSRFIAKVADFGLSRLAPVPDMEGISPHHVSTVVKGTPGYLDPEYFLTHQLTDKSD  808

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGM PI+HGKNIVREVN+AY SG+I S +D+RM S P+EC+EKF TLA
Sbjct  809  VYSLGVVFLELLTGMQPITHGKNIVREVNIAYQSGSILSAVDKRMSSVPAECIEKFATLA  868

Query  28   LKCCQDDTD  2
            L+ C+++TD
Sbjct  869  LRSCREETD  877



>ref|XP_009406863.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Musa acuminata subsp. malaccensis]
Length=943

 Score =   299 bits (766),  Expect = 7e-92, Method: Composition-based stats.
 Identities = 136/172 (79%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + +SK+PL F  RLR+ALG+A+GILYLHTEADPPIFHRDIKASNILLD++FTAKVADFGL
Sbjct  700  SARSKEPLNFPTRLRIALGAARGILYLHTEADPPIFHRDIKASNILLDSRFTAKVADFGL  759

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVP+ EG  P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVV LE+LTGM P
Sbjct  760  SRLAPVPESEGTAPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVLLEILTGMQP  819

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREV +A  S  +FS+ID RMGSYPSEC+EKF++LAL+CC D+TD
Sbjct  820  ISHGKNIVREVTMACQSSMVFSIIDNRMGSYPSECIEKFVSLALRCCLDETD  871



>gb|AFW78403.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=835

 Score =   297 bits (760),  Expect = 8e-92, Method: Composition-based stats.
 Identities = 136/172 (79%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK PL+F LRL++ALG+AKGILYLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  591  SAKSKRPLSFGLRLKIALGAAKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGL  650

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM P
Sbjct  651  SRLAPVPDVEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKP  710

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN A  SG +  +ID RMG YP EC+++F++LA KCCQD+TD
Sbjct  711  IEHGKNIVREVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQDETD  762



>gb|AAF63151.1|AC011001_21 Hypothetical protein [Arabidopsis thaliana]
Length=860

 Score =   297 bits (760),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  523  DTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADF  344
            + +VK K+PL FA+RLR+ALGSAKGILYLHTEA+PPIFHRDIKASNILLD++FTAKVADF
Sbjct  616  NISVKLKEPLDFAMRLRIALGSAKGILYLHTEANPPIFHRDIKASNILLDSRFTAKVADF  675

Query  343  GLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM  164
            GLSRLAPVPD+EG  P HVSTVVKGTPG+LDPEYFLTH+LTDKSDVYSLGVV LEL TGM
Sbjct  676  GLSRLAPVPDMEGISPQHVSTVVKGTPGYLDPEYFLTHQLTDKSDVYSLGVVLLELFTGM  735

Query  163  HPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
             PI+HGKNIVRE+N+AY SG+I S +D+RM S P EC+EKF TLAL+CC+++TD
Sbjct  736  QPITHGKNIVREINIAYESGSILSTVDKRMSSVPDECLEKFATLALRCCREETD  789



>emb|CDY10230.1| BnaC05g04730D [Brassica napus]
Length=953

 Score =   298 bits (764),  Expect = 2e-91, Method: Composition-based stats.
 Identities = 136/174 (78%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  523  DTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADF  344
            + +VK + PL FA+R+RVA+GSAKGILYLHTEA+PPIFHRDIKASNILLD++F AKVADF
Sbjct  707  NISVKLEKPLDFAMRMRVAIGSAKGILYLHTEANPPIFHRDIKASNILLDSRFIAKVADF  766

Query  343  GLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM  164
            GLSRLAPVPD+EG  P HVSTVVKGTPG+LDPEYFLTH+LTDKSDVYSLGVVFLELLTGM
Sbjct  767  GLSRLAPVPDMEGISPHHVSTVVKGTPGYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGM  826

Query  163  HPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
             PI+HGKNIVRE N+AY SG+I SV+D RM S P+EC+EKF TLAL+CC+++TD
Sbjct  827  QPITHGKNIVRETNIAYQSGSISSVVDARMSSVPAECIEKFATLALRCCREETD  880



>ref|XP_009119026.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Brassica rapa]
Length=949

 Score =   298 bits (763),  Expect = 2e-91, Method: Composition-based stats.
 Identities = 135/174 (78%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  523  DTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADF  344
            + +VK + PL FA+R+R+A+GSAKGILYLHTEA+PPIFHRDIKASNILLD++F AKVADF
Sbjct  703  NISVKLEKPLDFAMRMRIAIGSAKGILYLHTEANPPIFHRDIKASNILLDSRFIAKVADF  762

Query  343  GLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM  164
            GLSRLAPVPD+EG  P HVSTVVKGTPG+LDPEYFLTH+LTDKSDVYSLGVVFLELLTGM
Sbjct  763  GLSRLAPVPDMEGISPHHVSTVVKGTPGYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGM  822

Query  163  HPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
             PI+HGKNIVRE N+AY SG+I SV+D+RM S P+EC+EKF TLAL+CC+++TD
Sbjct  823  QPITHGKNIVRETNIAYQSGSISSVVDKRMSSVPAECIEKFATLALRCCREETD  876



>ref|XP_009783324.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X3 [Nicotiana sylvestris]
Length=878

 Score =   297 bits (760),  Expect = 2e-91, Method: Composition-based stats.
 Identities = 137/169 (81%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK  L F  RLR+ALG+AKGILYLHTEADPPIFHRDIKASNILLD+K TAKVADFGL
Sbjct  635  SAKSKQNLKFGARLRIALGAAKGILYLHTEADPPIFHRDIKASNILLDSKLTAKVADFGL  694

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV D EG +P HVST+VKGTPG+LDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHP
Sbjct  695  SRLAPVQDDEGVLPNHVSTMVKGTPGYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHP  754

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHGKNIVREVN+++ SGT+FS++D RMGSYP+ECVEKF+ LALKCCQD
Sbjct  755  ISHGKNIVREVNMSHKSGTMFSIMDNRMGSYPAECVEKFVALALKCCQD  803



>ref|XP_002319436.2| hypothetical protein POPTR_0013s15550g [Populus trichocarpa]
 gb|EEE95359.2| hypothetical protein POPTR_0013s15550g [Populus trichocarpa]
Length=687

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+K+PL+FA RL +AL SAKGILYLHTEADPPIFHRD+KASNILLD+++ AKVADFGL
Sbjct  444  SAKAKEPLSFATRLGIALDSAKGILYLHTEADPPIFHRDVKASNILLDSRYNAKVADFGL  503

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            S+LAPVPD+EG+VP H+STVVKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLELLTGM P
Sbjct  504  SKLAPVPDIEGDVPGHISTVVKGTPGYLDPEYFLTGKLTDKSDVYSLGVVFLELLTGMQP  563

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIV+EVN+AY +G IFSV+D RM SYPS+CV+KF TLA+KCC  +TD
Sbjct  564  ISHGKNIVKEVNIAYQTGIIFSVVDGRMRSYPSDCVDKFSTLAMKCCNYETD  615



>emb|CDY54882.1| BnaA10g27950D [Brassica napus]
Length=949

 Score =   298 bits (763),  Expect = 2e-91, Method: Composition-based stats.
 Identities = 135/174 (78%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  523  DTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADF  344
            + +VK + PL FA+R+R+A+GSAKGILYLHTEA+PPIFHRDIKASNILLD++F AKVADF
Sbjct  703  NISVKLEKPLDFAMRMRIAIGSAKGILYLHTEANPPIFHRDIKASNILLDSRFIAKVADF  762

Query  343  GLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGM  164
            GLSRLAPVPD+EG  P HVSTVVKGTPG+LDPEYFLTH+LTDKSDVYSLGVVFLELLTGM
Sbjct  763  GLSRLAPVPDMEGISPHHVSTVVKGTPGYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGM  822

Query  163  HPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
             PI+HGKNIVRE N+AY SG+I SV+D+RM S P+EC+EKF TLAL+CC+++TD
Sbjct  823  QPITHGKNIVRETNIAYQSGSISSVVDKRMSSVPAECIEKFATLALRCCREETD  876



>ref|XP_010278958.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nelumbo nucifera]
Length=837

 Score =   296 bits (757),  Expect = 2e-91, Method: Composition-based stats.
 Identities = 139/167 (83%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            KSK+  +F++RLR ALGSAKGILYLHTEA+PPIFHRDIKASNILLD+KFTAKVADFGLSR
Sbjct  584  KSKEGPSFSMRLRTALGSAKGILYLHTEANPPIFHRDIKASNILLDSKFTAKVADFGLSR  643

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAP+PD EG VP HVST+VKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  644  LAPIPDDEGIVPGHVSTIVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMPPIS  703

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            HGKNIVREVN AY S    S++D RMGSYPSECVEKF+ LAL+CCQD
Sbjct  704  HGKNIVREVNAAYRSDMTHSILDNRMGSYPSECVEKFVVLALRCCQD  750



>ref|XP_002439970.1| hypothetical protein SORBIDRAFT_09g023620 [Sorghum bicolor]
 gb|EES18400.1| hypothetical protein SORBIDRAFT_09g023620 [Sorghum bicolor]
Length=943

 Score =   297 bits (761),  Expect = 3e-91, Method: Composition-based stats.
 Identities = 136/172 (79%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK PL+F LRL++ALG+AKGILYLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  699  SAKSKRPLSFGLRLKIALGAAKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGL  758

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM P
Sbjct  759  SRLAPVPDVEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKP  818

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN A  SG++  +ID RMG YP EC+ +F++LA KCCQD+TD
Sbjct  819  IEHGKNIVREVNSACQSGSVSEIIDGRMGLYPPECIRRFLSLATKCCQDETD  870



>ref|XP_008649777.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
 ref|XP_008649778.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
 ref|XP_008649779.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
 ref|XP_008649780.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
 ref|XP_008649781.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Zea mays]
Length=943

 Score =   297 bits (761),  Expect = 4e-91, Method: Composition-based stats.
 Identities = 136/172 (79%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK PL+F LRL++ALG+AKGILYLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  699  SAKSKRPLSFGLRLKIALGAAKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGL  758

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM P
Sbjct  759  SRLAPVPDVEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKP  818

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN A  SG +  +ID RMG YP EC+++F++LA KCCQD+TD
Sbjct  819  IEHGKNIVREVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQDETD  870



>ref|XP_006842574.1| hypothetical protein AMTR_s00077p00152440 [Amborella trichopoda]
 gb|ERN04249.1| hypothetical protein AMTR_s00077p00152440 [Amborella trichopoda]
Length=901

 Score =   296 bits (758),  Expect = 5e-91, Method: Composition-based stats.
 Identities = 137/169 (81%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            KSK+PL FA RLR+ALGSA+GILYLH EA+PPIFHRDIKASNILLD+KF AKVADFGLSR
Sbjct  669  KSKEPLGFARRLRIALGSARGILYLHNEANPPIFHRDIKASNILLDSKFVAKVADFGLSR  728

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV DL+G  P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PIS
Sbjct  729  LAPVSDLDGSAPDHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEILTGMRPIS  788

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            HGKNIVREVN AY SGT+ S+ID++MGSYPSEC+++F+ LAL+CC +DT
Sbjct  789  HGKNIVREVNTAYQSGTLSSIIDQQMGSYPSECLDQFMKLALRCCLEDT  837



>gb|KEH34525.1| LRR receptor-like kinase [Medicago truncatula]
Length=685

 Score =   291 bits (745),  Expect = 8e-91, Method: Composition-based stats.
 Identities = 137/172 (80%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V S  PLTFA+RL++AL SAKG++YLHTEADPPIFHRD+K+SNILLD+KFTAKVADFGL
Sbjct  455  SVTSNKPLTFAMRLKIALESAKGLMYLHTEADPPIFHRDVKSSNILLDSKFTAKVADFGL  514

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLTH LTDKSDV+SLGVVFLELLTGM P
Sbjct  515  SRLAPVPDMEGIVPGHVSTVVKGTPGYLDPEYFLTHTLTDKSDVFSLGVVFLELLTGMQP  574

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREV+VAY S  I S IDERMGSYP E  EKF+ LALKCC+D+ +
Sbjct  575  ISHGKNIVREVSVAYESSEISSFIDERMGSYPFEHAEKFLNLALKCCEDEPE  626



>gb|AFW78415.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=835

 Score =   295 bits (754),  Expect = 8e-91, Method: Composition-based stats.
 Identities = 135/172 (78%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK PL+F LRL++ALG+AKGILYLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  591  SAKSKRPLSFGLRLKIALGAAKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGL  650

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM P
Sbjct  651  SRLAPVPDVEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKP  710

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN A  SG +  +ID RMG YP EC+++F++LA KCCQ +TD
Sbjct  711  IEHGKNIVREVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQHETD  762



>gb|EMT18733.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=461

 Score =   285 bits (729),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+++  +F +RLR+ALGS++GILYLHTEADPPIFHRDIKASNILLD+KF AKVADFGL
Sbjct  213  SAKARESPSFPMRLRIALGSSRGILYLHTEADPPIFHRDIKASNILLDSKFVAKVADFGL  272

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP+PD EG  P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  273  SRLAPLPDTEGSAPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  332

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKN+VREV  A  SG I SV+D RMGS P ECVE+F  L L+CC+D+TD
Sbjct  333  ISHGKNLVREVVAANQSGMILSVVDLRMGSVPGECVERFAALGLRCCRDETD  384



>ref|XP_006376568.1| hypothetical protein POPTR_0013s15550g [Populus trichocarpa]
 gb|ERP54365.1| hypothetical protein POPTR_0013s15550g [Populus trichocarpa]
Length=825

 Score =   293 bits (751),  Expect = 2e-90, Method: Composition-based stats.
 Identities = 135/172 (78%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+K+PL+FA RL +AL SAKGILYLHTEADPPIFHRD+KASNILLD+++ AKVADFGL
Sbjct  582  SAKAKEPLSFATRLGIALDSAKGILYLHTEADPPIFHRDVKASNILLDSRYNAKVADFGL  641

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            S+LAPVPD+EG+VP H+STVVKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLELLTGM P
Sbjct  642  SKLAPVPDIEGDVPGHISTVVKGTPGYLDPEYFLTGKLTDKSDVYSLGVVFLELLTGMQP  701

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIV+EVN+AY +G IFSV+D RM SYPS+CV+KF TLA+KCC  +TD
Sbjct  702  ISHGKNIVKEVNIAYQTGIIFSVVDGRMRSYPSDCVDKFSTLAMKCCNYETD  753



>gb|EEC72208.1| hypothetical protein OsI_05296 [Oryza sativa Indica Group]
Length=906

 Score =   295 bits (754),  Expect = 2e-90, Method: Composition-based stats.
 Identities = 137/172 (80%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + +SK+PL F  RLR+ALGS++GILYLHTEADPPIFHRDIKASNILLD+KF AKVADFGL
Sbjct  652  SARSKEPLNFPTRLRIALGSSRGILYLHTEADPPIFHRDIKASNILLDSKFVAKVADFGL  711

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP P+ EG  P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  712  SRLAPEPESEGIAPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  771

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHG+NIVREV  A  SG I SV+D RMGSYP+ECVEKF  LAL+CC+D+TD
Sbjct  772  ISHGRNIVREVVAANQSGMILSVVDSRMGSYPAECVEKFAALALRCCRDETD  823



>ref|NP_001045466.1| Os01g0960400 [Oryza sativa Japonica Group]
 dbj|BAD87126.1| putative receptor-like protein kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAF07380.1| Os01g0960400 [Oryza sativa Japonica Group]
 dbj|BAG99288.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56045.1| hypothetical protein OsJ_04842 [Oryza sativa Japonica Group]
Length=952

 Score =   295 bits (756),  Expect = 2e-90, Method: Composition-based stats.
 Identities = 136/172 (79%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + +SK+PL F  RLR+ALGS++GILYLHTEADPPIFHRDIKASNILLD+KF AKVADFGL
Sbjct  698  SARSKEPLNFPTRLRIALGSSRGILYLHTEADPPIFHRDIKASNILLDSKFVAKVADFGL  757

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP P+ EG  P HVSTV+KGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  758  SRLAPEPESEGIAPGHVSTVIKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  817

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHG+NIVREV  A  SG I SV+D RMGSYP+ECVEKF  LAL+CC+D+TD
Sbjct  818  ISHGRNIVREVVAANQSGMILSVVDSRMGSYPAECVEKFAALALRCCRDETD  869



>ref|XP_006842576.1| hypothetical protein AMTR_s00077p00154750 [Amborella trichopoda]
 gb|ERN04251.1| hypothetical protein AMTR_s00077p00154750 [Amborella trichopoda]
Length=948

 Score =   295 bits (756),  Expect = 2e-90, Method: Composition-based stats.
 Identities = 136/170 (80%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K K+PL FA+RLR+ALGSA+GI YLH EA+PPIFHRDIKASNILLD+KF AKVADFGLSR
Sbjct  710  KVKEPLNFAMRLRLALGSARGISYLHNEANPPIFHRDIKASNILLDSKFIAKVADFGLSR  769

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVP+LEG+ P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVF ELLTGMHPIS
Sbjct  770  LAPVPELEGDAPEHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFHELLTGMHPIS  829

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN AY SG + S++D  MGSYPSEC+E+F  LA +CC DDT+
Sbjct  830  HGKNIVREVNNAYQSGMLCSIVDPHMGSYPSECIEQFARLAFRCCLDDTE  879



>ref|XP_006645416.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Oryza brachyantha]
 ref|XP_006645417.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Oryza brachyantha]
 ref|XP_006645418.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X3 [Oryza brachyantha]
Length=949

 Score =   295 bits (756),  Expect = 2e-90, Method: Composition-based stats.
 Identities = 137/172 (80%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V+SK+PL F +RLR+ALGS++GILYLHTEADPPIFHRDIKASNILLD+KF AKVADFGL
Sbjct  699  SVRSKEPLNFPMRLRIALGSSRGILYLHTEADPPIFHRDIKASNILLDSKFVAKVADFGL  758

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP P+ EG  P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM P
Sbjct  759  SRLAPEPETEGTAPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQP  818

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHG+NIVREV  A  SG I SV+D RMGSYP+E VEKF  LAL+CC+D+TD
Sbjct  819  ISHGRNIVREVVAANQSGMILSVVDNRMGSYPAESVEKFAALALRCCRDETD  870



>ref|XP_006376567.1| hypothetical protein POPTR_0013s15550g [Populus trichocarpa]
 gb|ERP54364.1| hypothetical protein POPTR_0013s15550g [Populus trichocarpa]
Length=862

 Score =   293 bits (751),  Expect = 3e-90, Method: Composition-based stats.
 Identities = 135/172 (78%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+K+PL+FA RL +AL SAKGILYLHTEADPPIFHRD+KASNILLD+++ AKVADFGL
Sbjct  619  SAKAKEPLSFATRLGIALDSAKGILYLHTEADPPIFHRDVKASNILLDSRYNAKVADFGL  678

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            S+LAPVPD+EG+VP H+STVVKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLELLTGM P
Sbjct  679  SKLAPVPDIEGDVPGHISTVVKGTPGYLDPEYFLTGKLTDKSDVYSLGVVFLELLTGMQP  738

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIV+EVN+AY +G IFSV+D RM SYPS+CV+KF TLA+KCC  +TD
Sbjct  739  ISHGKNIVKEVNIAYQTGIIFSVVDGRMRSYPSDCVDKFSTLAMKCCNYETD  790



>ref|XP_009621388.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Nicotiana tomentosiformis]
Length=878

 Score =   293 bits (751),  Expect = 3e-90, Method: Composition-based stats.
 Identities = 136/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK  L F  RLR+ALG+AKGILYLHTEADPPIFHRDIKASNILLD+K +AKVADFGL
Sbjct  635  SAKSKQNLKFGARLRIALGAAKGILYLHTEADPPIFHRDIKASNILLDSKLSAKVADFGL  694

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV D EG +P HVST+VKGTPG+LDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHP
Sbjct  695  SRLAPVQDDEGVLPNHVSTMVKGTPGYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHP  754

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHGKNIVREVN+A+ SGT+FS++D RMGSYP+E VEKF+ LALKCCQD
Sbjct  755  ISHGKNIVREVNMAHKSGTVFSIMDNRMGSYPAEWVEKFVALALKCCQD  803



>dbj|BAG94134.1| unnamed protein product [Oryza sativa Japonica Group]
Length=285

 Score =   277 bits (709),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 153/185 (83%), Gaps = 9/185 (5%)
 Frame = -3

Query  529  PCDTTV---------KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILL  377
            PC T++         KSK PL F LRL +ALG++KGILYLHT+ADPPIFHRD+KASNILL
Sbjct  21   PCSTSISSFYFSIAGKSKPPLGFGLRLHIALGASKGILYLHTDADPPIFHRDVKASNILL  80

Query  376  DAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSL  197
            D+K+ AKVADFGLSRLAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSL
Sbjct  81   DSKYVAKVADFGLSRLAPVPDVEGALPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSL  140

Query  196  GVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCC  17
            GVVFLELLTGM PI HGKNIVREV  AY SG I  ++D RMG    ECV+ F+ LA+KC 
Sbjct  141  GVVFLELLTGMKPIEHGKNIVREVKKAYRSGNISEIMDTRMGLCSPECVDSFLQLAMKCS  200

Query  16   QDDTD  2
            +D+TD
Sbjct  201  RDETD  205



>ref|XP_010522022.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Tarenaya hassleriana]
Length=877

 Score =   293 bits (751),  Expect = 4e-90, Method: Composition-based stats.
 Identities = 137/170 (81%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+++ ++FA+RLR+A+GSAKGI YLHTEADPPIFHRDIKASNILLD+KF AKVADFGLSR
Sbjct  628  KTRESMSFAMRLRIAIGSAKGISYLHTEADPPIFHRDIKASNILLDSKFVAKVADFGLSR  687

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPD+EG  P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMH IS
Sbjct  688  LAPVPDMEGIAPNHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHAIS  747

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
             GKN+VREVN AY SG I SVID+RMGS P+ECVEKF TLAL+C +D+T+
Sbjct  748  RGKNLVREVNAAYQSGMILSVIDKRMGSIPTECVEKFATLALRCSRDETE  797



>ref|XP_011001645.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Populus euphratica]
Length=961

 Score =   295 bits (754),  Expect = 4e-90, Method: Composition-based stats.
 Identities = 135/170 (79%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K  L F  RLR+ALGSAKGILYLHTEA PP+FHRDIKA+NILLD K TAKVADFGLSR
Sbjct  713  KAKGTLNFGTRLRIALGSAKGILYLHTEAQPPVFHRDIKATNILLDCKLTAKVADFGLSR  772

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG +P HVSTVV+GTPG+LDPEYFLTHKLTDKSDVYSLG+VFLELLTGMHPIS
Sbjct  773  LAPVLDDEGNLPNHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMHPIS  832

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+A+ SG +FS+ID RMG+YPSECVE+F+ LAL CCQD  +
Sbjct  833  HGKNIVREVNMAHQSGIMFSIIDNRMGAYPSECVERFVALALSCCQDKQE  882



>ref|XP_008649789.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Zea mays]
 ref|XP_008649790.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Zea mays]
 ref|XP_008649791.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Zea mays]
 ref|XP_008649792.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Zea mays]
 ref|XP_008649793.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Zea mays]
 gb|AFW78416.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=943

 Score =   295 bits (754),  Expect = 4e-90, Method: Composition-based stats.
 Identities = 135/172 (78%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK PL+F LRL++ALG+AKGILYLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  699  SAKSKRPLSFGLRLKIALGAAKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGL  758

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM P
Sbjct  759  SRLAPVPDVEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKP  818

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN A  SG +  +ID RMG YP EC+++F++LA KCCQ +TD
Sbjct  819  IEHGKNIVREVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQHETD  870



>gb|KEH34526.1| LRR receptor-like kinase [Medicago truncatula]
Length=821

 Score =   292 bits (748),  Expect = 5e-90, Method: Composition-based stats.
 Identities = 137/172 (80%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V S  PLTFA+RL++AL SAKG++YLHTEADPPIFHRD+K+SNILLD+KFTAKVADFGL
Sbjct  591  SVTSNKPLTFAMRLKIALESAKGLMYLHTEADPPIFHRDVKSSNILLDSKFTAKVADFGL  650

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLTH LTDKSDV+SLGVVFLELLTGM P
Sbjct  651  SRLAPVPDMEGIVPGHVSTVVKGTPGYLDPEYFLTHTLTDKSDVFSLGVVFLELLTGMQP  710

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREV+VAY S  I S IDERMGSYP E  EKF+ LALKCC+D+ +
Sbjct  711  ISHGKNIVREVSVAYESSEISSFIDERMGSYPFEHAEKFLNLALKCCEDEPE  762



>ref|XP_008649788.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Zea mays]
Length=984

 Score =   295 bits (755),  Expect = 5e-90, Method: Composition-based stats.
 Identities = 135/172 (78%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK PL+F LRL++ALG+AKGILYLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  740  SAKSKRPLSFGLRLKIALGAAKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGL  799

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM P
Sbjct  800  SRLAPVPDVEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKP  859

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN A  SG +  +ID RMG YP EC+++F++LA KCCQ +TD
Sbjct  860  IEHGKNIVREVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQHETD  911



>ref|XP_011001644.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Populus euphratica]
Length=971

 Score =   295 bits (754),  Expect = 5e-90, Method: Composition-based stats.
 Identities = 135/170 (79%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K  L F  RLR+ALGSAKGILYLHTEA PP+FHRDIKA+NILLD K TAKVADFGLSR
Sbjct  723  KAKGTLNFGTRLRIALGSAKGILYLHTEAQPPVFHRDIKATNILLDCKLTAKVADFGLSR  782

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG +P HVSTVV+GTPG+LDPEYFLTHKLTDKSDVYSLG+VFLELLTGMHPIS
Sbjct  783  LAPVLDDEGNLPNHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMHPIS  842

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+A+ SG +FS+ID RMG+YPSECVE+F+ LAL CCQD  +
Sbjct  843  HGKNIVREVNMAHQSGIMFSIIDNRMGAYPSECVERFVALALSCCQDKQE  892



>ref|XP_009783321.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Nicotiana sylvestris]
 ref|XP_009783322.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Nicotiana sylvestris]
 ref|XP_009783323.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Nicotiana sylvestris]
Length=950

 Score =   294 bits (752),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK  L F  RLR+ALG+AKGILYLHTEADPPIFHRDIKASNILLD+K TAKVADFGL
Sbjct  707  SAKSKQNLKFGARLRIALGAAKGILYLHTEADPPIFHRDIKASNILLDSKLTAKVADFGL  766

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV D EG +P HVST+VKGTPG+LDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHP
Sbjct  767  SRLAPVQDDEGVLPNHVSTMVKGTPGYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHP  826

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHGKNIVREVN+++ SGT+FS++D RMGSYP+ECVEKF+ LALKCCQD
Sbjct  827  ISHGKNIVREVNMSHKSGTMFSIMDNRMGSYPAECVEKFVALALKCCQD  875



>ref|XP_009783320.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nicotiana sylvestris]
Length=960

 Score =   294 bits (752),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK  L F  RLR+ALG+AKGILYLHTEADPPIFHRDIKASNILLD+K TAKVADFGL
Sbjct  717  SAKSKQNLKFGARLRIALGAAKGILYLHTEADPPIFHRDIKASNILLDSKLTAKVADFGL  776

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV D EG +P HVST+VKGTPG+LDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHP
Sbjct  777  SRLAPVQDDEGVLPNHVSTMVKGTPGYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHP  836

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHGKNIVREVN+++ SGT+FS++D RMGSYP+ECVEKF+ LALKCCQD
Sbjct  837  ISHGKNIVREVNMSHKSGTMFSIMDNRMGSYPAECVEKFVALALKCCQD  885



>gb|AFW78404.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=724

 Score =   289 bits (740),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 155/177 (88%), Gaps = 5/177 (3%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK PL+F LRL++ALG+AKGILYLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  475  SAKSKRPLSFGLRLKIALGAAKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGL  534

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM P
Sbjct  535  SRLAPVPDVEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKP  594

Query  157  ISHGKNIVRE-----VNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVRE     VN A  SG +  +ID RMG YP EC+++F++LA KCCQD+TD
Sbjct  595  IEHGKNIVREVCTSSVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQDETD  651



>ref|XP_010522021.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Tarenaya hassleriana]
Length=968

 Score =   294 bits (752),  Expect = 9e-90, Method: Composition-based stats.
 Identities = 137/170 (81%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+++ ++FA+RLR+A+GSAKGI YLHTEADPPIFHRDIKASNILLD+KF AKVADFGLSR
Sbjct  719  KTRESMSFAMRLRIAIGSAKGISYLHTEADPPIFHRDIKASNILLDSKFVAKVADFGLSR  778

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPD+EG  P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMH IS
Sbjct  779  LAPVPDMEGIAPNHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHAIS  838

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
             GKN+VREVN AY SG I SVID+RMGS P+ECVEKF TLAL+C +D+T+
Sbjct  839  RGKNLVREVNAAYQSGMILSVIDKRMGSIPTECVEKFATLALRCSRDETE  888



>ref|XP_004961725.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Setaria italica]
 ref|XP_004961726.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Setaria italica]
Length=945

 Score =   293 bits (751),  Expect = 1e-89, Method: Composition-based stats.
 Identities = 136/172 (79%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK PL+F LRL++ALG++KGILYLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  701  SAKSKRPLSFGLRLKIALGASKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGL  760

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM P
Sbjct  761  SRLAPVPDVEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKP  820

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN A  SG I  +ID RMG  P ECV +F++LA KCCQD+TD
Sbjct  821  IEHGKNIVREVNSACQSGNISGIIDGRMGLCPPECVSRFLSLATKCCQDETD  872



>ref|XP_009621385.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009621386.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009621387.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nicotiana tomentosiformis]
Length=950

 Score =   293 bits (751),  Expect = 1e-89, Method: Composition-based stats.
 Identities = 136/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK  L F  RLR+ALG+AKGILYLHTEADPPIFHRDIKASNILLD+K +AKVADFGL
Sbjct  707  SAKSKQNLKFGARLRIALGAAKGILYLHTEADPPIFHRDIKASNILLDSKLSAKVADFGL  766

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV D EG +P HVST+VKGTPG+LDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHP
Sbjct  767  SRLAPVQDDEGVLPNHVSTMVKGTPGYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHP  826

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHGKNIVREVN+A+ SGT+FS++D RMGSYP+E VEKF+ LALKCCQD
Sbjct  827  ISHGKNIVREVNMAHKSGTVFSIMDNRMGSYPAEWVEKFVALALKCCQD  875



>ref|XP_003600554.1| hypothetical protein MTR_3g062570 [Medicago truncatula]
Length=977

 Score =   293 bits (751),  Expect = 1e-89, Method: Composition-based stats.
 Identities = 137/172 (80%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V S  PLTFA+RL++AL SAKG++YLHTEADPPIFHRD+K+SNILLD+KFTAKVADFGL
Sbjct  747  SVTSNKPLTFAMRLKIALESAKGLMYLHTEADPPIFHRDVKSSNILLDSKFTAKVADFGL  806

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLTH LTDKSDV+SLGVVFLELLTGM P
Sbjct  807  SRLAPVPDMEGIVPGHVSTVVKGTPGYLDPEYFLTHTLTDKSDVFSLGVVFLELLTGMQP  866

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREV+VAY S  I S IDERMGSYP E  EKF+ LALKCC+D+ +
Sbjct  867  ISHGKNIVREVSVAYESSEISSFIDERMGSYPFEHAEKFLNLALKCCEDEPE  918



>gb|AES70805.2| LRR receptor-like kinase [Medicago truncatula]
Length=936

 Score =   293 bits (749),  Expect = 2e-89, Method: Composition-based stats.
 Identities = 137/172 (80%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V S  PLTFA+RL++AL SAKG++YLHTEADPPIFHRD+K+SNILLD+KFTAKVADFGL
Sbjct  706  SVTSNKPLTFAMRLKIALESAKGLMYLHTEADPPIFHRDVKSSNILLDSKFTAKVADFGL  765

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLTH LTDKSDV+SLGVVFLELLTGM P
Sbjct  766  SRLAPVPDMEGIVPGHVSTVVKGTPGYLDPEYFLTHTLTDKSDVFSLGVVFLELLTGMQP  825

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREV+VAY S  I S IDERMGSYP E  EKF+ LALKCC+D+ +
Sbjct  826  ISHGKNIVREVSVAYESSEISSFIDERMGSYPFEHAEKFLNLALKCCEDEPE  877



>gb|KDP21843.1| hypothetical protein JCGZ_00630 [Jatropha curcas]
Length=966

 Score =   293 bits (749),  Expect = 3e-89, Method: Composition-based stats.
 Identities = 133/169 (79%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+KD L F+ RL +ALGSAKGILYLHTEA PP+FHRD+KA+NILLD+K TAKVADFGL
Sbjct  712  SAKAKDKLNFSTRLNIALGSAKGILYLHTEASPPVFHRDVKATNILLDSKLTAKVADFGL  771

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV D EG +P H+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLG+VFLELLTG+ P
Sbjct  772  SRLAPVLDDEGNLPNHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGLQP  831

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHGKNI REVN+AY SG +FS+ID RMGSYPSECVE+FI LAL CC D
Sbjct  832  ISHGKNIAREVNMAYQSGIVFSIIDSRMGSYPSECVERFIALALACCHD  880



>ref|XP_003565200.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Brachypodium distachyon]
Length=946

 Score =   292 bits (748),  Expect = 3e-89, Method: Composition-based stats.
 Identities = 138/189 (73%), Positives = 160/189 (85%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL   + + K+K+PL F +RLR+ALGS++GILYLHTEADPPIFHRDIKAS
Sbjct  684  MLVYEYMPNGTLRD-NLSAKAKEPLNFPMRLRIALGSSRGILYLHTEADPPIFHRDIKAS  742

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD+KF +KVADFGLSRLAP+P++EG  P HVSTVVKGTPG+LDPEYFLTHKLTDKSD
Sbjct  743  NILLDSKFVSKVADFGLSRLAPLPEIEGSAPGHVSTVVKGTPGYLDPEYFLTHKLTDKSD  802

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGM PISHGKN+VREV  A  SG I SV+D RMG  P ECVE+F  LA
Sbjct  803  VYSLGVVFLELLTGMQPISHGKNLVREVVAANQSGMILSVVDRRMGPCPGECVERFAALA  862

Query  28   LKCCQDDTD  2
            L+CC+D+TD
Sbjct  863  LRCCRDETD  871



>ref|XP_002531806.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF30563.1| ATP binding protein, putative [Ricinus communis]
Length=961

 Score =   292 bits (747),  Expect = 4e-89, Method: Composition-based stats.
 Identities = 132/172 (77%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K K+ L FA+RL++ALGSAKGILYLH EA+PP+FHRDIKA+NILLD+K TAKVADFGL
Sbjct  710  SAKGKEKLNFAMRLKIALGSAKGILYLHAEANPPVFHRDIKATNILLDSKLTAKVADFGL  769

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV D EG +P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLG+VFLELLTGM P
Sbjct  770  SRLAPVLDDEGNLPNHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMQP  829

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I+HGKNIVREV +A+ SG +FS+ID RMG+YPSECVE+FI LAL CC D+ +
Sbjct  830  ITHGKNIVREVTMAHQSGIMFSIIDSRMGAYPSECVERFIALALGCCHDNPE  881



>ref|XP_010043831.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Eucalyptus grandis]
Length=952

 Score =   291 bits (746),  Expect = 5e-89, Method: Composition-based stats.
 Identities = 136/170 (80%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K+ L F++RLR+ALGSAKGILYLHTEA PP+FHRDIKASNILLD+K TAKVADFGLSR
Sbjct  712  KTKEYLNFSMRLRIALGSAKGILYLHTEAHPPVFHRDIKASNILLDSKLTAKVADFGLSR  771

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG VP HVST+VKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  772  LAPVLDDEGTVPHHVSTIVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPIS  831

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+A+ +G +FS+ID RMGSYPSECVE+F+ LAL CC D+ +
Sbjct  832  HGKNIVREVNMAHRAGMMFSIIDSRMGSYPSECVERFVALALLCCYDNPE  881



>ref|XP_010542705.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
Length=987

 Score =   292 bits (748),  Expect = 5e-89, Method: Composition-based stats.
 Identities = 137/170 (81%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            +S + L+FA R+R+ALGSAKGI+YLHTEADPPIFHRDIKASNILLD+K  AKVADFGLSR
Sbjct  742  RSGESLSFATRMRIALGSAKGIMYLHTEADPPIFHRDIKASNILLDSKLVAKVADFGLSR  801

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPD+EG  P HVSTVVKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLELLTGMH IS
Sbjct  802  LAPVPDMEGVAPDHVSTVVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLELLTGMHAIS  861

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREV  AY SGTI SV+D+RMGS P+ECVEKF TLAL+CC+ +T+
Sbjct  862  HGKNIVREVKTAYQSGTILSVVDKRMGSCPAECVEKFATLALRCCRVETE  911



>ref|XP_004490733.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X4 [Cicer arietinum]
Length=860

 Score =   290 bits (742),  Expect = 5e-89, Method: Composition-based stats.
 Identities = 136/189 (72%), Positives = 164/189 (87%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL     +  SK+PL+F++RL++ALGSAKG++YLHTEADPPIFHRD+KAS
Sbjct  600  MLVYEYMPNGTL-KDHISAHSKEPLSFSMRLKIALGSAKGLVYLHTEADPPIFHRDVKAS  658

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD+KF AKVADFGLSRLAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKL+DKSD
Sbjct  659  NILLDSKFIAKVADFGLSRLAPVPDVEGNLPAHVSTVVKGTPGYLDPEYFLTHKLSDKSD  718

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLE++TG  PI HG+NI+R+V +A+ SG IFS++D RMG Y SECVEKF+TLA
Sbjct  719  VYSLGVVFLEVVTGKPPIFHGENIIRQVKLAFESGGIFSIVDNRMGFYSSECVEKFLTLA  778

Query  28   LKCCQDDTD  2
            LKCC+D  D
Sbjct  779  LKCCKDVPD  787



>ref|XP_010043840.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Eucalyptus grandis]
 gb|KCW88418.1| hypothetical protein EUGRSUZ_A00805 [Eucalyptus grandis]
Length=946

 Score =   291 bits (746),  Expect = 6e-89, Method: Composition-based stats.
 Identities = 136/170 (80%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K+ L F++RLR+ALGSAKGILYLHTEA PP+FHRDIKASNILLD+K TAKVADFGLSR
Sbjct  706  KTKEYLNFSMRLRIALGSAKGILYLHTEAHPPVFHRDIKASNILLDSKLTAKVADFGLSR  765

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG VP HVST+VKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  766  LAPVLDDEGTVPHHVSTIVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPIS  825

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+A+ +G +FS+ID RMGSYPSECVE+F+ LAL CC D+ +
Sbjct  826  HGKNIVREVNMAHRAGMMFSIIDSRMGSYPSECVERFVALALLCCYDNPE  875



>ref|XP_010043852.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Eucalyptus grandis]
 ref|XP_010043858.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Eucalyptus grandis]
Length=959

 Score =   291 bits (746),  Expect = 7e-89, Method: Composition-based stats.
 Identities = 136/170 (80%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K+ L F++RLR+ALGSAKGILYLHTEA PP+FHRDIKASNILLD+K TAKVADFGLSR
Sbjct  719  KTKEYLNFSMRLRIALGSAKGILYLHTEAHPPVFHRDIKASNILLDSKLTAKVADFGLSR  778

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG VP HVST+VKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  779  LAPVLDDEGTVPHHVSTIVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPIS  838

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+A+ +G +FS+ID RMGSYPSECVE+F+ LAL CC D+ +
Sbjct  839  HGKNIVREVNMAHRAGMMFSIIDSRMGSYPSECVERFVALALLCCYDNPE  888



>tpg|DAA57081.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein, partial [Zea mays]
Length=742

 Score =   287 bits (735),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K++ PL+F  R+ +ALG+AKG+LYLHTEA+PPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  497  SAKTERPLSFGQRVHIALGAAKGLLYLHTEANPPIFHRDVKASNILLDSKFVAKVADFGL  556

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAH+STVVKGTPG+LDPEYFLTHKLT++SDVYSLGVVFLELLTGM P
Sbjct  557  SRLAPVPDIEGTLPAHISTVVKGTPGYLDPEYFLTHKLTERSDVYSLGVVFLELLTGMKP  616

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN+AY SG +  +ID RM SYP ECV++F++LA++CC+DDT+
Sbjct  617  IQHGKNIVREVNIAYQSGDVSGIIDSRMSSYPPECVKRFLSLAIRCCRDDTE  668



>gb|AFW78402.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=948

 Score =   291 bits (745),  Expect = 7e-89, Method: Composition-based stats.
 Identities = 136/177 (77%), Positives = 155/177 (88%), Gaps = 5/177 (3%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK PL+F LRL++ALG+AKGILYLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  699  SAKSKRPLSFGLRLKIALGAAKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGL  758

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM P
Sbjct  759  SRLAPVPDVEGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKP  818

Query  157  ISHGKNIVRE-----VNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVRE     VN A  SG +  +ID RMG YP EC+++F++LA KCCQD+TD
Sbjct  819  IEHGKNIVREVCTSSVNSACQSGAVSGIIDGRMGLYPPECIKRFLSLATKCCQDETD  875



>ref|XP_004490730.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Cicer arietinum]
 ref|XP_004490731.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Cicer arietinum]
 ref|XP_004490732.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X3 [Cicer arietinum]
Length=947

 Score =   291 bits (744),  Expect = 9e-89, Method: Composition-based stats.
 Identities = 136/189 (72%), Positives = 164/189 (87%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL     +  SK+PL+F++RL++ALGSAKG++YLHTEADPPIFHRD+KAS
Sbjct  687  MLVYEYMPNGTL-KDHISAHSKEPLSFSMRLKIALGSAKGLVYLHTEADPPIFHRDVKAS  745

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD+KF AKVADFGLSRLAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKL+DKSD
Sbjct  746  NILLDSKFIAKVADFGLSRLAPVPDVEGNLPAHVSTVVKGTPGYLDPEYFLTHKLSDKSD  805

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLE++TG  PI HG+NI+R+V +A+ SG IFS++D RMG Y SECVEKF+TLA
Sbjct  806  VYSLGVVFLEVVTGKPPIFHGENIIRQVKLAFESGGIFSIVDNRMGFYSSECVEKFLTLA  865

Query  28   LKCCQDDTD  2
            LKCC+D  D
Sbjct  866  LKCCKDVPD  874



>ref|XP_010244582.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X3 [Nelumbo nucifera]
Length=812

 Score =   288 bits (737),  Expect = 1e-88, Method: Composition-based stats.
 Identities = 132/168 (79%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = -3

Query  514  VKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLS  335
            VK+K+ L+F +RL +ALGSA+GILYLHTEA+PPI+HRDIKASNILLD+K  AKVADFGLS
Sbjct  570  VKAKERLSFGMRLHIALGSARGILYLHTEANPPIYHRDIKASNILLDSKLNAKVADFGLS  629

Query  334  RLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI  155
            RLAPVPD EG +P H+ST+VKGTPG+LDPEY LTHKLTDKSDVYSLGVVFLELLTGM PI
Sbjct  630  RLAPVPDEEGMMPGHISTIVKGTPGYLDPEYLLTHKLTDKSDVYSLGVVFLELLTGMRPI  689

Query  154  SHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            SHGKNIVREVNVAY SG   S++D+ MGSYPS+C+EKF+ LALKCC D
Sbjct  690  SHGKNIVREVNVAYQSGMTHSILDKCMGSYPSKCIEKFVVLALKCCMD  737



>ref|XP_011006277.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Populus euphratica]
Length=961

 Score =   291 bits (744),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K  L F  RLR+ALGSAKGILYLHTEA PP+FHRDIKA+NILLD K TAKVADFGLSR
Sbjct  713  KAKGTLNFGTRLRIALGSAKGILYLHTEAQPPVFHRDIKATNILLDCKLTAKVADFGLSR  772

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG +P HVSTVV+GTPG+LDPEYFLTHKLTDKSDVYSLG+VFLELLTGMHPIS
Sbjct  773  LAPVLDDEGNLPNHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMHPIS  832

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+A+ SG +FS+ID RMG+YPSECVE+F+ LAL CC D  D
Sbjct  833  HGKNIVREVNMAHQSGIMFSIIDNRMGAYPSECVERFVVLALDCCHDKQD  882



>gb|KDO64177.1| hypothetical protein CISIN_1g002158mg [Citrus sinensis]
Length=958

 Score =   290 bits (743),  Expect = 1e-88, Method: Composition-based stats.
 Identities = 135/167 (81%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            ++K+ L FA+RLRVAL SAKGILYLHTEA PP+FHRDIKASNILLD+   AKVADFGLSR
Sbjct  715  RTKENLNFAMRLRVALDSAKGILYLHTEAHPPVFHRDIKASNILLDSNLNAKVADFGLSR  774

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG +P HVST+VKGTPG+LDPEYFLTHKLTDKSDVYSLGVV LELLTGM PIS
Sbjct  775  LAPVLDDEGTMPTHVSTIVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMQPIS  834

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            HGKNIVREVNVA  SG +FS+ID RMGSYPSECVE+F+TLAL+CC D
Sbjct  835  HGKNIVREVNVARDSGMVFSIIDNRMGSYPSECVERFVTLALRCCHD  881



>ref|XP_006481245.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X4 [Citrus sinensis]
Length=864

 Score =   289 bits (739),  Expect = 2e-88, Method: Composition-based stats.
 Identities = 135/167 (81%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            ++K+ L FA+RLRVAL SAKGILYLHTEA PP+FHRDIKASNILLD+   AKVADFGLSR
Sbjct  621  RTKENLNFAMRLRVALDSAKGILYLHTEAHPPVFHRDIKASNILLDSNLNAKVADFGLSR  680

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG +P HVST+VKGTPG+LDPEYFLTHKLTDKSDVYSLGVV LELLTGM PIS
Sbjct  681  LAPVLDDEGTMPTHVSTIVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMQPIS  740

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            HGKNIVREVNVA  SG +FS+ID RMGSYPSECVE+F+TLAL+CC D
Sbjct  741  HGKNIVREVNVARDSGMVFSIIDNRMGSYPSECVERFVTLALRCCHD  787



>ref|XP_011006276.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Populus euphratica]
Length=971

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K  L F  RLR+ALGSAKGILYLHTEA PP+FHRDIKA+NILLD K TAKVADFGLSR
Sbjct  723  KAKGTLNFGTRLRIALGSAKGILYLHTEAQPPVFHRDIKATNILLDCKLTAKVADFGLSR  782

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG +P HVSTVV+GTPG+LDPEYFLTHKLTDKSDVYSLG+VFLELLTGMHPIS
Sbjct  783  LAPVLDDEGNLPNHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMHPIS  842

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+A+ SG +FS+ID RMG+YPSECVE+F+ LAL CC D  D
Sbjct  843  HGKNIVREVNMAHQSGIMFSIIDNRMGAYPSECVERFVVLALDCCHDKQD  892



>ref|XP_010043866.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Eucalyptus grandis]
 gb|KCW88416.1| hypothetical protein EUGRSUZ_A00803 [Eucalyptus grandis]
Length=948

 Score =   290 bits (742),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K+ L F++RLR+ALGSAKGILYLHTEA PP+FHRDIKASNILLD+K TAKVADFGLSR
Sbjct  708  KTKEYLNFSMRLRIALGSAKGILYLHTEAHPPVFHRDIKASNILLDSKLTAKVADFGLSR  767

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG VP HVST+VKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  768  LAPVLDDEGTVPHHVSTIVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPIS  827

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+A+ +G +FS+ID RMGSYPSECVE+F+ LAL CC D+ +
Sbjct  828  HGKNIVREVNMAHRAGMMFSIIDSRMGSYPSECVERFVALALLCCYDNPE  877



>dbj|BAD73350.1| protein kinase-like [Oryza sativa Japonica Group]
Length=478

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 151/173 (87%), Gaps = 1/173 (1%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KS+ PL F+ R+ +ALG+AKGILYLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  228  SAKSRRPLNFSQRIHIALGAAKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGL  287

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD++G +PAH+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVV LELLTGM P
Sbjct  288  SRLAPVPDVDGTMPAHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMKP  347

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPS-ECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN AY SG I  VIDER+ S  S ECV +  +LA+KCC+D+TD
Sbjct  348  IQHGKNIVREVNTAYQSGEIAGVIDERISSSSSPECVARLASLAVKCCKDETD  400



>ref|XP_002323098.2| hypothetical protein POPTR_0016s14720g [Populus trichocarpa]
 gb|EEF04859.2| hypothetical protein POPTR_0016s14720g [Populus trichocarpa]
Length=961

 Score =   290 bits (743),  Expect = 2e-88, Method: Composition-based stats.
 Identities = 133/170 (78%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K  L F  RL +ALGSAKGILYLHTEA PP+FHRDIKA+NILLD+K TAKVADFGLSR
Sbjct  713  KAKGTLNFGTRLSIALGSAKGILYLHTEAQPPVFHRDIKATNILLDSKLTAKVADFGLSR  772

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG +P HVSTVV+GTPG+LDPEYFLTHKLTDKSDVYSLG+VFLELLTGMHPIS
Sbjct  773  LAPVLDDEGNLPNHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMHPIS  832

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+A+ SG +FS+ID RMG+YPSECVE+F+ LAL CC D  +
Sbjct  833  HGKNIVREVNMAHQSGIMFSIIDNRMGAYPSECVERFVALALSCCHDKQE  882



>ref|XP_006481243.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Citrus sinensis]
 ref|XP_006481244.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X3 [Citrus sinensis]
Length=959

 Score =   290 bits (741),  Expect = 3e-88, Method: Composition-based stats.
 Identities = 135/167 (81%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            ++K+ L FA+RLRVAL SAKGILYLHTEA PP+FHRDIKASNILLD+   AKVADFGLSR
Sbjct  716  RTKENLNFAMRLRVALDSAKGILYLHTEAHPPVFHRDIKASNILLDSNLNAKVADFGLSR  775

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG +P HVST+VKGTPG+LDPEYFLTHKLTDKSDVYSLGVV LELLTGM PIS
Sbjct  776  LAPVLDDEGTMPTHVSTIVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMQPIS  835

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            HGKNIVREVNVA  SG +FS+ID RMGSYPSECVE+F+TLAL+CC D
Sbjct  836  HGKNIVREVNVARDSGMVFSIIDNRMGSYPSECVERFVTLALRCCHD  882



>ref|XP_006481242.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Citrus sinensis]
Length=961

 Score =   290 bits (741),  Expect = 3e-88, Method: Composition-based stats.
 Identities = 135/167 (81%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            ++K+ L FA+RLRVAL SAKGILYLHTEA PP+FHRDIKASNILLD+   AKVADFGLSR
Sbjct  718  RTKENLNFAMRLRVALDSAKGILYLHTEAHPPVFHRDIKASNILLDSNLNAKVADFGLSR  777

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG +P HVST+VKGTPG+LDPEYFLTHKLTDKSDVYSLGVV LELLTGM PIS
Sbjct  778  LAPVLDDEGTMPTHVSTIVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMQPIS  837

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            HGKNIVREVNVA  SG +FS+ID RMGSYPSECVE+F+TLAL+CC D
Sbjct  838  HGKNIVREVNVARDSGMVFSIIDNRMGSYPSECVERFVTLALRCCHD  884



>ref|XP_008652670.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Zea mays]
 ref|XP_008674889.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Zea mays]
Length=859

 Score =   288 bits (737),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K++ PL+F  R+ +ALG+AKG+LYLHTEA+PPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  614  SAKTERPLSFGQRVHIALGAAKGLLYLHTEANPPIFHRDVKASNILLDSKFVAKVADFGL  673

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAH+STVVKGTPG+LDPEYFLTHKLT++SDVYSLGVVFLELLTGM P
Sbjct  674  SRLAPVPDIEGTLPAHISTVVKGTPGYLDPEYFLTHKLTERSDVYSLGVVFLELLTGMKP  733

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN+AY SG +  +ID RM SYP ECV++F++LA++CC+DDT+
Sbjct  734  IQHGKNIVREVNIAYQSGDVSGIIDSRMSSYPPECVKRFLSLAIRCCRDDTE  785



>ref|XP_006842575.1| hypothetical protein AMTR_s00077p00153450 [Amborella trichopoda]
 gb|ERN04250.1| hypothetical protein AMTR_s00077p00153450 [Amborella trichopoda]
Length=853

 Score =   288 bits (736),  Expect = 3e-88, Method: Composition-based stats.
 Identities = 133/170 (78%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            KSK+PL+FA+RLR+ALGSA+GILYLH +A+P IFHRDIKASNILLD+KF AKVADFGLSR
Sbjct  618  KSKEPLSFAMRLRIALGSARGILYLHNDANPAIFHRDIKASNILLDSKFVAKVADFGLSR  677

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAP+PDLEG +P HVSTVVKGTPG+LDPEYFLTH+LTDKSDVYSLGVVFLELLTGMHPIS
Sbjct  678  LAPLPDLEGTIPDHVSTVVKGTPGYLDPEYFLTHQLTDKSDVYSLGVVFLELLTGMHPIS  737

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
             G+NIVREVN AY SG + S+ID +M S P EC+E+F  LAL+CC D TD
Sbjct  738  QGRNIVREVNNAYRSGLLLSIIDGQMDSCPLECIEQFTKLALQCCLDHTD  787



>ref|XP_006575460.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Glycine max]
Length=880

 Score =   288 bits (737),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL   + +  SK PLTF++RL++ALGSAKG+LYLHTE D PIFHRD+KAS
Sbjct  621  MLVYEYMPNGTLRD-NLSAYSKKPLTFSMRLKIALGSAKGLLYLHTEVDSPIFHRDVKAS  679

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD+KFTAKVADFGLSRLAPVPD+EG VP H+STVVKGTPG+LDPEYFLT KLTDKSD
Sbjct  680  NILLDSKFTAKVADFGLSRLAPVPDIEGNVPGHISTVVKGTPGYLDPEYFLTRKLTDKSD  739

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLEL+TG  PI HGKNI+R+VN  Y SG +FSV+D+R+ SYPSEC +KF+TLA
Sbjct  740  VYSLGVVFLELVTGRPPIFHGKNIIRQVNEEYQSGGVFSVVDKRIESYPSECADKFLTLA  799

Query  28   LKCCQDDTD  2
            LKCC+D+ D
Sbjct  800  LKCCKDEPD  808



>ref|XP_007033464.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04390.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=952

 Score =   289 bits (740),  Expect = 4e-88, Method: Composition-based stats.
 Identities = 135/169 (80%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K K+ L F +RLRVALGSAKGILYLHTEA PP+FHRDIKASNILLD+K  AKVADFGL
Sbjct  710  SAKVKETLNFGMRLRVALGSAKGILYLHTEAHPPVFHRDIKASNILLDSKLNAKVADFGL  769

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV + EG VP HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVF+ELLTGM P
Sbjct  770  SRLAPVLEDEGTVPDHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFMELLTGMQP  829

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHGKNIVREVN+A+ SG +FS+ID RMGSYPSEC+E+F+ LAL CC D
Sbjct  830  ISHGKNIVREVNMAHQSGMMFSLIDGRMGSYPSECIERFVGLALSCCHD  878



>ref|XP_006429640.1| hypothetical protein CICLE_v10013792mg [Citrus clementina]
 gb|ESR42880.1| hypothetical protein CICLE_v10013792mg [Citrus clementina]
Length=1003

 Score =   290 bits (742),  Expect = 4e-88, Method: Composition-based stats.
 Identities = 135/167 (81%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            ++K+ L FA+RLRVAL SAKGILYLHTEA PP+FHRDIKASNILLD+   AKVADFGLSR
Sbjct  760  RTKENLNFAMRLRVALDSAKGILYLHTEAHPPVFHRDIKASNILLDSNLNAKVADFGLSR  819

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG +P HVST+VKGTPG+LDPEYFLTHKLTDKSDVYSLGVV LELLTGM PIS
Sbjct  820  LAPVLDDEGTMPTHVSTIVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMQPIS  879

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            HGKNIVREVNVA  SG +FS+ID RMGSYPSECVE+F+TLAL+CC D
Sbjct  880  HGKNIVREVNVARDSGMVFSIIDNRMGSYPSECVERFVTLALRCCHD  926



>ref|XP_010244581.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Nelumbo nucifera]
Length=866

 Score =   287 bits (735),  Expect = 7e-88, Method: Composition-based stats.
 Identities = 132/168 (79%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = -3

Query  514  VKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLS  335
            VK+K+ L+F +RL +ALGSA+GILYLHTEA+PPI+HRDIKASNILLD+K  AKVADFGLS
Sbjct  624  VKAKERLSFGMRLHIALGSARGILYLHTEANPPIYHRDIKASNILLDSKLNAKVADFGLS  683

Query  334  RLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI  155
            RLAPVPD EG +P H+ST+VKGTPG+LDPEY LTHKLTDKSDVYSLGVVFLELLTGM PI
Sbjct  684  RLAPVPDEEGMMPGHISTIVKGTPGYLDPEYLLTHKLTDKSDVYSLGVVFLELLTGMRPI  743

Query  154  SHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            SHGKNIVREVNVAY SG   S++D+ MGSYPS+C+EKF+ LALKCC D
Sbjct  744  SHGKNIVREVNVAYQSGMTHSILDKCMGSYPSKCIEKFVVLALKCCMD  791



>ref|XP_006575461.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Glycine max]
Length=879

 Score =   287 bits (735),  Expect = 8e-88, Method: Composition-based stats.
 Identities = 137/189 (72%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL   + +  SK PLTF++RL++ALGSAKG+LYLHTE D PIFHRD+KAS
Sbjct  620  MLVYEYMPNGTLRD-NLSAYSKKPLTFSMRLKIALGSAKGLLYLHTEVDSPIFHRDVKAS  678

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD+KFTAKVADFGLSRLAPVPD+EG VP H+STVVKGTPG+LDPEYFLT KLTDKSD
Sbjct  679  NILLDSKFTAKVADFGLSRLAPVPDIEGNVPGHISTVVKGTPGYLDPEYFLTRKLTDKSD  738

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLEL+TG  PI HGKNI+R+VN  Y SG +FSV+D+R+ SYPSEC +KF+TLA
Sbjct  739  VYSLGVVFLELVTGRPPIFHGKNIIRQVNEEYQSGGVFSVVDKRIESYPSECADKFLTLA  798

Query  28   LKCCQDDTD  2
            LKCC+D+ D
Sbjct  799  LKCCKDEPD  807



>ref|XP_008652663.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Zea mays]
 ref|XP_008674888.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Zea mays]
 tpg|DAA44069.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
 tpg|DAA57080.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=946

 Score =   288 bits (737),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K++ PL+F  R+ +ALG+AKG+LYLHTEA+PPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  701  SAKTERPLSFGQRVHIALGAAKGLLYLHTEANPPIFHRDVKASNILLDSKFVAKVADFGL  760

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAH+STVVKGTPG+LDPEYFLTHKLT++SDVYSLGVVFLELLTGM P
Sbjct  761  SRLAPVPDIEGTLPAHISTVVKGTPGYLDPEYFLTHKLTERSDVYSLGVVFLELLTGMKP  820

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN+AY SG +  +ID RM SYP ECV++F++LA++CC+DDT+
Sbjct  821  IQHGKNIVREVNIAYQSGDVSGIIDSRMSSYPPECVKRFLSLAIRCCRDDTE  872



>gb|KHN40999.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=942

 Score =   288 bits (737),  Expect = 9e-88, Method: Composition-based stats.
 Identities = 137/189 (72%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  Y  N TL   + +  SK PLTF++RL++ALGSAKG+LYLHTE D PIFHRD+KAS
Sbjct  683  MLVYEYMPNGTLRD-NLSAYSKKPLTFSMRLKIALGSAKGLLYLHTEVDSPIFHRDVKAS  741

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD+KFTAKVADFGLSRLAPVPD+EG VP H+STVVKGTPG+LDPEYFLT KLTDKSD
Sbjct  742  NILLDSKFTAKVADFGLSRLAPVPDIEGNVPGHISTVVKGTPGYLDPEYFLTRKLTDKSD  801

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLEL+TG  PI HGKNI+R+VN  Y SG +FSV+D+R+ SYPSEC +KF+TLA
Sbjct  802  VYSLGVVFLELVTGRPPIFHGKNIIRQVNEEYQSGGVFSVVDKRIESYPSECADKFLTLA  861

Query  28   LKCCQDDTD  2
            LKCC+D+ D
Sbjct  862  LKCCKDEPD  870



>ref|XP_010244577.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nelumbo nucifera]
 ref|XP_010244578.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nelumbo nucifera]
 ref|XP_010244579.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nelumbo nucifera]
 ref|XP_010244580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Nelumbo nucifera]
Length=954

 Score =   288 bits (737),  Expect = 1e-87, Method: Composition-based stats.
 Identities = 132/168 (79%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = -3

Query  514  VKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLS  335
            VK+K+ L+F +RL +ALGSA+GILYLHTEA+PPI+HRDIKASNILLD+K  AKVADFGLS
Sbjct  712  VKAKERLSFGMRLHIALGSARGILYLHTEANPPIYHRDIKASNILLDSKLNAKVADFGLS  771

Query  334  RLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI  155
            RLAPVPD EG +P H+ST+VKGTPG+LDPEY LTHKLTDKSDVYSLGVVFLELLTGM PI
Sbjct  772  RLAPVPDEEGMMPGHISTIVKGTPGYLDPEYLLTHKLTDKSDVYSLGVVFLELLTGMRPI  831

Query  154  SHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            SHGKNIVREVNVAY SG   S++D+ MGSYPS+C+EKF+ LALKCC D
Sbjct  832  SHGKNIVREVNVAYQSGMTHSILDKCMGSYPSKCIEKFVVLALKCCMD  879



>gb|KJB27626.1| hypothetical protein B456_005G002700 [Gossypium raimondii]
Length=639

 Score =   280 bits (717),  Expect = 4e-87, Method: Composition-based stats.
 Identities = 127/172 (74%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+K+ L F +RLR+ALGSAKGILYLHTEA+PP+FHRDIKA+NILLD+   AKV+DFGL
Sbjct  392  SAKAKNTLNFGMRLRIALGSAKGILYLHTEANPPVFHRDIKATNILLDSNLNAKVSDFGL  451

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV + +G VP HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP
Sbjct  452  SRLAPVLEEDGTVPDHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  511

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREV  AY SG + S+ID RMG YP+EC+E+ ++LAL CC D+ +
Sbjct  512  IWHGKNIVREVKTAYESGMVLSIIDSRMGWYPAECMERMVSLALSCCNDEPE  563



>ref|XP_003616057.1| Protein kinase-like protein [Medicago truncatula]
 gb|AES99015.1| LRR receptor-like kinase [Medicago truncatula]
Length=947

 Score =   286 bits (733),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK+PL+FA+RL++ALGSAKG++YLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  702  SAKSKEPLSFAMRLKIALGSAKGLVYLHTEADPPIFHRDVKASNILLDSKFIAKVADFGL  761

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +P HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLEL+TG  P
Sbjct  762  SRLAPVPDIEGNLPGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELVTGKPP  821

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HG+NI+R+V +A+ SG +FS++D RMG Y SECVEK + L LKCC+D  D
Sbjct  822  IFHGENIIRQVKLAFESGGVFSIVDNRMGFYTSECVEKLLKLGLKCCKDSPD  873



>gb|KHN30616.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=834

 Score =   284 bits (726),  Expect = 7e-87, Method: Composition-based stats.
 Identities = 130/172 (76%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +  SK+PL+F++RL++ALGSAKG+LYLHTEA+PPIFHRD+KASNILLD+++TAKVADFGL
Sbjct  590  SANSKEPLSFSMRLKIALGSAKGLLYLHTEANPPIFHRDVKASNILLDSRYTAKVADFGL  649

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLT+KLTDKSDVYSLGVVFLEL+TG  P
Sbjct  650  SRLAPVPDIEGNVPGHVSTVVKGTPGYLDPEYFLTYKLTDKSDVYSLGVVFLELVTGRPP  709

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HG+NI+R V VAY SG I  V+D+R+ SYPSE  EKF+TLALKCC+D+ D
Sbjct  710  IFHGENIIRHVYVAYQSGGISLVVDKRIESYPSEYAEKFLTLALKCCKDEPD  761



>ref|XP_004500392.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Cicer arietinum]
Length=933

 Score =   285 bits (730),  Expect = 9e-87, Method: Composition-based stats.
 Identities = 132/172 (77%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V S+ PL F++RL++AL SAKG++YLHTEADPPIFHRD+K++NILLD+KFTAKVADFGL
Sbjct  702  SVTSEKPLPFSMRLKIALESAKGLMYLHTEADPPIFHRDVKSTNILLDSKFTAKVADFGL  761

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD++G VP HVSTVVKGTPG+LDPEYFLTH LTDKSDVYS+GVVFLELLTGMHP
Sbjct  762  SRLAPVPDVQGIVPGHVSTVVKGTPGYLDPEYFLTHTLTDKSDVYSIGVVFLELLTGMHP  821

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN+A  SG I SV DE MGSYP +  +KF TLALKCC+D+ +
Sbjct  822  ISHGKNIVREVNLACQSGDISSVTDEHMGSYPFDHADKFFTLALKCCEDEPE  873



>gb|EPS60654.1| hypothetical protein M569_14148, partial [Genlisea aurea]
Length=849

 Score =   284 bits (726),  Expect = 1e-86, Method: Composition-based stats.
 Identities = 132/170 (78%), Positives = 153/170 (90%), Gaps = 1/170 (1%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            KSK PL+F +R+++ALG+A+G+LYLHTEA+PPI HRDIKA+NILLD+ FTAKVADFGLSR
Sbjct  599  KSKVPLSFPMRIKIALGAARGVLYLHTEANPPIIHRDIKATNILLDSNFTAKVADFGLSR  658

Query  331  LAPVPDLEG-EVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI  155
            LAPV D EG EVP+HVST VKGTPG+LDPEYFLT KLTDKSDVYSLGVV LE++TGMHPI
Sbjct  659  LAPVADFEGDEVPSHVSTAVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVLLEMITGMHPI  718

Query  154  SHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            SHGKNIVREVN AY SG IFS+ID+RMG YPS CVEKF+ +ALKCC ++T
Sbjct  719  SHGKNIVREVNNAYRSGIIFSIIDDRMGPYPSFCVEKFVNIALKCCLEET  768



>ref|XP_006596482.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X3 [Glycine max]
Length=858

 Score =   284 bits (726),  Expect = 1e-86, Method: Composition-based stats.
 Identities = 130/172 (76%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +  SK+PL+F++RL++ALGSAKG+LYLHTEA+PPIFHRD+KASNILLD+++TAKVADFGL
Sbjct  614  SANSKEPLSFSMRLKIALGSAKGLLYLHTEANPPIFHRDVKASNILLDSRYTAKVADFGL  673

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLT+KLTDKSDVYSLGVVFLEL+TG  P
Sbjct  674  SRLAPVPDIEGNVPGHVSTVVKGTPGYLDPEYFLTYKLTDKSDVYSLGVVFLELVTGRPP  733

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HG+NI+R V VAY SG I  V+D+R+ SYPSE  EKF+TLALKCC+D+ D
Sbjct  734  IFHGENIIRHVYVAYQSGGISLVVDKRIESYPSEYAEKFLTLALKCCKDEPD  785



>ref|XP_004970379.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Setaria italica]
Length=947

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K++ PLTF  R+ +ALG+AKGILYLHTEA+PPI+HRD+KASNILLD+KF AKVADFGL
Sbjct  703  SAKTERPLTFGRRVHIALGAAKGILYLHTEANPPIYHRDVKASNILLDSKFVAKVADFGL  762

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAH+STVVKGTPG+LDPEYFLTHKLT++SDVYSLGVV LELLTGM P
Sbjct  763  SRLAPVPDVEGTLPAHISTVVKGTPGYLDPEYFLTHKLTERSDVYSLGVVLLELLTGMRP  822

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN+AY SG I  +ID RM SYP ECV +F++LA+KCC+D+T+
Sbjct  823  IQHGKNIVREVNMAYQSGDISRIIDSRMPSYPPECVTRFLSLAIKCCRDETE  874



>ref|XP_006596480.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Glycine max]
 ref|XP_006596481.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Glycine max]
Length=947

 Score =   284 bits (727),  Expect = 3e-86, Method: Composition-based stats.
 Identities = 130/172 (76%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +  SK+PL+F++RL++ALGSAKG+LYLHTEA+PPIFHRD+KASNILLD+++TAKVADFGL
Sbjct  703  SANSKEPLSFSMRLKIALGSAKGLLYLHTEANPPIFHRDVKASNILLDSRYTAKVADFGL  762

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG VP HVSTVVKGTPG+LDPEYFLT+KLTDKSDVYSLGVVFLEL+TG  P
Sbjct  763  SRLAPVPDIEGNVPGHVSTVVKGTPGYLDPEYFLTYKLTDKSDVYSLGVVFLELVTGRPP  822

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HG+NI+R V VAY SG I  V+D+R+ SYPSE  EKF+TLALKCC+D+ D
Sbjct  823  IFHGENIIRHVYVAYQSGGISLVVDKRIESYPSEYAEKFLTLALKCCKDEPD  874



>ref|XP_007142004.1| hypothetical protein PHAVU_008G244400g [Phaseolus vulgaris]
 gb|ESW13998.1| hypothetical protein PHAVU_008G244400g [Phaseolus vulgaris]
Length=942

 Score =   284 bits (726),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V S+ PLTF++RL++ALGSAKG++YLHTE DPPIFHRD+KA+NILLD+KFTAKVADFGL
Sbjct  699  SVYSEKPLTFSMRLKIALGSAKGLVYLHTEVDPPIFHRDVKATNILLDSKFTAKVADFGL  758

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD +G VP HVSTVV GTPG++DPEYFLTHKLTDKSDVYSLGVVFLEL+TG  P
Sbjct  759  SRLAPVPDTQGNVPGHVSTVVMGTPGYIDPEYFLTHKLTDKSDVYSLGVVFLELVTGRPP  818

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HG+NI+R V++AY SG +FSVID+R+GSYPSE VEKF+TLALKCC+D  D
Sbjct  819  IFHGENIIRHVSMAYESGGLFSVIDKRIGSYPSEYVEKFLTLALKCCKDAPD  870



>ref|XP_011018958.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Populus euphratica]
Length=939

 Score =   283 bits (724),  Expect = 7e-86, Method: Composition-based stats.
 Identities = 131/170 (77%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K +  L F  RL +ALGSAKGILYLHTEA PP+FHRDIKA+NILLD+K  AKVADFGLS 
Sbjct  710  KGRGTLKFGTRLSIALGSAKGILYLHTEAQPPVFHRDIKATNILLDSKLNAKVADFGLSL  769

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG +P HVSTVV+GTPG+LDPEYFLTHKLTDKSDVYSLG+VFLELLTGM PIS
Sbjct  770  LAPVLDDEGNLPNHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMQPIS  829

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+AY SG +FS+ID RMG+YPSECVE+F+ LAL CCQD  +
Sbjct  830  HGKNIVREVNMAYKSGIMFSIIDNRMGAYPSECVERFVALALSCCQDKQE  879



>ref|XP_011018957.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Populus euphratica]
Length=951

 Score =   283 bits (724),  Expect = 8e-86, Method: Composition-based stats.
 Identities = 131/170 (77%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K +  L F  RL +ALGSAKGILYLHTEA PP+FHRDIKA+NILLD+K  AKVADFGLS 
Sbjct  722  KGRGTLKFGTRLSIALGSAKGILYLHTEAQPPVFHRDIKATNILLDSKLNAKVADFGLSL  781

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG +P HVSTVV+GTPG+LDPEYFLTHKLTDKSDVYSLG+VFLELLTGM PIS
Sbjct  782  LAPVLDDEGNLPNHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMQPIS  841

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+AY SG +FS+ID RMG+YPSECVE+F+ LAL CCQD  +
Sbjct  842  HGKNIVREVNMAYKSGIMFSIIDNRMGAYPSECVERFVALALSCCQDKQE  891



>gb|EPS63348.1| hypothetical protein M569_11437, partial [Genlisea aurea]
Length=877

 Score =   281 bits (720),  Expect = 1e-85, Method: Composition-based stats.
 Identities = 130/188 (69%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            +L+  +  N TL    ++ K K PL F  R+++ALG+A+GILYLHTEADPPIFHRDIK++
Sbjct  629  MLVYEFMPNGTLRQHLSSEKCKMPLPFDTRVKIALGAARGILYLHTEADPPIFHRDIKSA  688

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD+ FTAKVADFGLSRLAP+P+LEG++P+HVSTVVKGTPG+LDPEYF T+KLTDKSD
Sbjct  689  NILLDSNFTAKVADFGLSRLAPLPELEGDIPSHVSTVVKGTPGYLDPEYFRTYKLTDKSD  748

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVV LE++TGMHPI HGKNIVREVNVA+  G I S+ID+RMGS+P++C  KF+ LA
Sbjct  749  VYSLGVVLLEMMTGMHPIFHGKNIVREVNVAHQLGAIRSIIDDRMGSFPTDCASKFVELA  808

Query  28   LKCCQDDT  5
            LKCC+++T
Sbjct  809  LKCCREET  816



>ref|XP_004247008.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Solanum lycopersicum]
Length=951

 Score =   282 bits (721),  Expect = 2e-85, Method: Composition-based stats.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K K  L F  RL +ALG++KGILYLHTEADPPIFHRDIKASNILLD+K TAKVADFGL
Sbjct  707  SAKCKKKLKFGARLGIALGASKGILYLHTEADPPIFHRDIKASNILLDSKLTAKVADFGL  766

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV D EG +P HVST+VKGTPG+LDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHP
Sbjct  767  SRLAPVQDDEGLLPNHVSTMVKGTPGYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHP  826

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHGKNIVREV +A+ SG +FS++D+ MGSYPSEC E+ + LALKCCQD
Sbjct  827  ISHGKNIVREVKIAHKSGVMFSIMDKSMGSYPSECAERLMELALKCCQD  875



>ref|XP_003567224.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Brachypodium distachyon]
 ref|XP_010232490.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Brachypodium distachyon]
Length=952

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V SK PL F+ RL +ALG++KGILYLHTEADPPIFHRD+KA+NILLD+KF AKVADFGL
Sbjct  703  SVTSKIPLNFSQRLHIALGASKGILYLHTEADPPIFHRDVKATNILLDSKFVAKVADFGL  762

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAH+STVVKGTPG+LDPEYFLTHKLT+KSDVYSLG+V LELLTGM P
Sbjct  763  SRLAPVPDIEGTLPAHISTVVKGTPGYLDPEYFLTHKLTEKSDVYSLGIVLLELLTGMKP  822

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN AY SG I  +ID R+ S   EC+ +F++LALKCCQD+TD
Sbjct  823  IQHGKNIVREVNTAYRSGDISGIIDSRISSCSPECITRFLSLALKCCQDETD  874



>ref|XP_010326251.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Solanum lycopersicum]
 ref|XP_010326252.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Solanum lycopersicum]
Length=933

 Score =   281 bits (720),  Expect = 2e-85, Method: Composition-based stats.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K K  L F  RL +ALG++KGILYLHTEADPPIFHRDIKASNILLD+K TAKVADFGL
Sbjct  689  SAKCKKKLKFGARLGIALGASKGILYLHTEADPPIFHRDIKASNILLDSKLTAKVADFGL  748

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV D EG +P HVST+VKGTPG+LDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHP
Sbjct  749  SRLAPVQDDEGLLPNHVSTMVKGTPGYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHP  808

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHGKNIVREV +A+ SG +FS++D+ MGSYPSEC E+ + LALKCCQD
Sbjct  809  ISHGKNIVREVKIAHKSGVMFSIMDKSMGSYPSECAERLMELALKCCQD  857



>ref|XP_006359984.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Solanum tuberosum]
 ref|XP_006359985.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Solanum tuberosum]
 ref|XP_006359986.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X3 [Solanum tuberosum]
Length=951

 Score =   282 bits (721),  Expect = 2e-85, Method: Composition-based stats.
 Identities = 131/169 (78%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K K  L F  RL +ALG++KGILYLHTEADPPIFHRDIKASNILLD+K TAKVADFGL
Sbjct  707  SAKCKKNLKFGARLGIALGASKGILYLHTEADPPIFHRDIKASNILLDSKLTAKVADFGL  766

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV D EG +P HVST+VKGTPG+LDPEYFLT K+TDKSDVYSLGVVFLE+LTGMHP
Sbjct  767  SRLAPVQDDEGLLPNHVSTMVKGTPGYLDPEYFLTRKMTDKSDVYSLGVVFLEILTGMHP  826

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHGKNIVREV +A+ SG +FS++D+ MGSYPSEC EK + LALKCCQD
Sbjct  827  ISHGKNIVREVKMAHKSGVMFSIMDKNMGSYPSECAEKMVELALKCCQD  875



>ref|XP_006644909.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Oryza brachyantha]
Length=948

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KS+ PL F+ R+ +ALG+AKGILYLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  703  SAKSRRPLNFSQRVHIALGAAKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGL  762

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD++G +PAH+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVV LELLTGM P
Sbjct  763  SRLAPVPDVDGTMPAHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMKP  822

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN AY SG I  VIDER+ S P ECV +   LA+KCC+D+TD
Sbjct  823  IQHGKNIVREVNTAYQSGDIARVIDERIISSPPECVARLAALAVKCCRDETD  874



>ref|XP_007205469.1| hypothetical protein PRUPE_ppa008002mg [Prunus persica]
 gb|EMJ06668.1| hypothetical protein PRUPE_ppa008002mg [Prunus persica]
Length=349

 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -3

Query  514  VKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLS  335
            V +K  L+F  RL++ALGSAKGILYLH EA+PPIFHRDIK +NILLD+   AKVADFGLS
Sbjct  108  VTAKGSLSFGTRLQIALGSAKGILYLHNEANPPIFHRDIKTTNILLDSNLMAKVADFGLS  167

Query  334  RLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI  155
            RLAP+ D  G  P++VSTVVKGTPG+LDPEY LT+KLTDKSDVYSLG+VFLELLTG+ PI
Sbjct  168  RLAPLQDDAGTGPSYVSTVVKGTPGYLDPEYLLTNKLTDKSDVYSLGIVFLELLTGVLPI  227

Query  154  SHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            SHGKNIVREVN+A+ +G +FS+ID RMGSYPSECVE+F+ LAL+CC +  D
Sbjct  228  SHGKNIVREVNLAHQAGLMFSIIDSRMGSYPSECVERFLALALRCCYEKQD  278



>gb|EMT12400.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=995

 Score =   281 bits (720),  Expect = 4e-85, Method: Composition-based stats.
 Identities = 127/172 (74%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + ++K+ L+F +RLR+ALGS++GILYLHTEADPPI+HRDIK+SNILLD+KF AKVADFGL
Sbjct  743  SAQAKEALSFPMRLRIALGSSRGILYLHTEADPPIYHRDIKSSNILLDSKFVAKVADFGL  802

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP+P +EG  P HVSTVVKGTPG+LDPEYFLTH LTDKSDVYSLGVVFLELLTGM P
Sbjct  803  SRLAPLPAMEGVAPGHVSTVVKGTPGYLDPEYFLTHNLTDKSDVYSLGVVFLELLTGMQP  862

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKN+VREV  A  SG I SV+D RMG  P EC+E+F  L L+CC+D+TD
Sbjct  863  ISHGKNLVREVVAANQSGMILSVVDTRMGPCPGECLERFAALGLRCCRDETD  914



>ref|XP_008366925.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Malus domestica]
Length=334

 Score =   266 bits (679),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -3

Query  514  VKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLS  335
            VK+K  L F +RLR+ALGSAKGILYLHTEA+PPIFHRDIKASNILLD+   AKVADFGLS
Sbjct  92   VKAKGSLDFTMRLRIALGSAKGILYLHTEANPPIFHRDIKASNILLDSNLVAKVADFGLS  151

Query  334  RLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI  155
            R AP  D EG   ++VSTVV+GTPG++DPEYFLT+KLTDKSDVYSLG+VFLELLTG  PI
Sbjct  152  RPAPPQDDEGTGSSYVSTVVRGTPGYVDPEYFLTNKLTDKSDVYSLGIVFLELLTGDQPI  211

Query  154  SHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            SHGKNIVREVN+AY +G +FS+ID+RM SYPS+CVE+F+ LAL+CC +  D
Sbjct  212  SHGKNIVREVNLAYQAGLVFSIIDKRMRSYPSKCVERFLDLALRCCNEKPD  262



>gb|KJB27625.1| hypothetical protein B456_005G002700 [Gossypium raimondii]
Length=959

 Score =   281 bits (718),  Expect = 6e-85, Method: Composition-based stats.
 Identities = 127/172 (74%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+K+ L F +RLR+ALGSAKGILYLHTEA+PP+FHRDIKA+NILLD+   AKV+DFGL
Sbjct  712  SAKAKNTLNFGMRLRIALGSAKGILYLHTEANPPVFHRDIKATNILLDSNLNAKVSDFGL  771

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV + +G VP HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP
Sbjct  772  SRLAPVLEEDGTVPDHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  831

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREV  AY SG + S+ID RMG YP+EC+E+ ++LAL CC D+ +
Sbjct  832  IWHGKNIVREVKTAYESGMVLSIIDSRMGWYPAECMERMVSLALSCCNDEPE  883



>gb|EEC79410.1| hypothetical protein OsI_20362 [Oryza sativa Indica Group]
Length=952

 Score =   281 bits (718),  Expect = 6e-85, Method: Composition-based stats.
 Identities = 131/170 (77%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            KSK PL F LRL +ALG++KGILYLHT+ADPPIFHRD+KASNILLD+K+ AKVADFGLSR
Sbjct  703  KSKQPLGFGLRLHIALGASKGILYLHTDADPPIFHRDVKASNILLDSKYVAKVADFGLSR  762

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PI 
Sbjct  763  LAPVPDVEGALPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMKPIE  822

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREV  AY SG I  ++D RMG    ECV+ F+ LA+KC +D+TD
Sbjct  823  HGKNIVREVKKAYRSGNISEIMDTRMGLCSPECVDSFLQLAMKCSRDETD  872



>ref|XP_002458681.1| hypothetical protein SORBIDRAFT_03g038090 [Sorghum bicolor]
 gb|EES03801.1| hypothetical protein SORBIDRAFT_03g038090 [Sorghum bicolor]
Length=970

 Score =   281 bits (718),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 156/183 (85%), Gaps = 11/183 (6%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K++ PL+F  R+ +ALG+AKGILYLHTEA+PPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  713  SAKTERPLSFGQRVHIALGAAKGILYLHTEANPPIFHRDVKASNILLDSKFVAKVADFGL  772

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +PAH+STVVKGTPG+LDPEYFLTHKLT++SDVYSLGVVFLELLTGM P
Sbjct  773  SRLAPVPDIEGTLPAHISTVVKGTPGYLDPEYFLTHKLTERSDVYSLGVVFLELLTGMKP  832

Query  157  ISHGKNIVR-----------EVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            I HGKNIVR           EVN+AY SG +  +ID RM SYP ECV++F++LA++CCQD
Sbjct  833  IQHGKNIVREEFNIVWKGLLEVNIAYHSGDVSGIIDSRMSSYPPECVKRFLSLAIRCCQD  892

Query  10   DTD  2
            +T+
Sbjct  893  ETE  895



>ref|XP_006381260.1| hypothetical protein POPTR_0006s11180g [Populus trichocarpa]
 gb|ERP59057.1| hypothetical protein POPTR_0006s11180g [Populus trichocarpa]
Length=936

 Score =   280 bits (716),  Expect = 8e-85, Method: Composition-based stats.
 Identities = 131/170 (77%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K K  L F  RL +ALGSAKGILYLHTEA PP+FHRDIKA+NILLD+   AKVADFGLS 
Sbjct  688  KGKGTLKFGTRLSIALGSAKGILYLHTEAQPPVFHRDIKATNILLDSILNAKVADFGLSL  747

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG +P HVSTVV+GTPG+LDPEYFLTHKLTDKSDVYSLG+VFLELLTGM PIS
Sbjct  748  LAPVLDDEGNLPNHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSLGIVFLELLTGMQPIS  807

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+AY SG +FS+ID RMG+YPSECVE+F+ LAL CC D  D
Sbjct  808  HGKNIVREVNMAYQSGIMFSIIDNRMGAYPSECVERFVVLALDCCHDKQD  857



>gb|EYU46036.1| hypothetical protein MIMGU_mgv1a021178mg, partial [Erythranthe 
guttata]
Length=906

 Score =   280 bits (715),  Expect = 8e-85, Method: Composition-based stats.
 Identities = 129/170 (76%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            ++K  L F+ R+R+ALG+A+GI YLH EA+PPIFHRDIKA+NILLD+K TAKVADFGLSR
Sbjct  655  ENKVALDFSTRVRIALGAARGIYYLHAEANPPIFHRDIKATNILLDSKLTAKVADFGLSR  714

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LA +P+LEG VP HVSTVVKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLELLTG+HPI 
Sbjct  715  LATMPELEGAVPGHVSTVVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLELLTGLHPIF  774

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
             GKNIVREVN AY  G IFS+ID++MGSYPSECV +F+TLALKCC+++T+
Sbjct  775  RGKNIVREVNTAYRLGMIFSIIDDKMGSYPSECVGRFLTLALKCCKNETE  824



>ref|NP_001240130.1| probable LRR receptor-like serine/threonine-protein kinase At1g06840-like 
[Glycine max]
 gb|ACJ37407.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
Length=786

 Score =   277 bits (709),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -3

Query  508  SKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRL  329
            SK+PL+F+LRL++ALGSAKG+LYLHTEA+PPIFHRD+KASNILLD+++TAKVADFGLSRL
Sbjct  544  SKEPLSFSLRLKIALGSAKGLLYLHTEANPPIFHRDVKASNILLDSRYTAKVADFGLSRL  603

Query  328  APVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISH  149
            APVPD EG VP HVSTVVKGTPG+LDPEYFLT  LTDKSDVYSLGVV LELLTG  PI H
Sbjct  604  APVPDTEGNVPGHVSTVVKGTPGYLDPEYFLTRNLTDKSDVYSLGVVLLELLTGRPPIFH  663

Query  148  GKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            G+NI+R+VN+AY+SG I  V+D+R+ SYP+EC EKF+ LALKCC+D  D
Sbjct  664  GENIIRQVNMAYNSGGISLVVDKRIESYPTECAEKFLALALKCCKDTPD  712



>ref|NP_001174468.1| Os05g0481100 [Oryza sativa Japonica Group]
 gb|AAW56867.1| unkown protein [Oryza sativa Japonica Group]
 dbj|BAH93196.1| Os05g0481100 [Oryza sativa Japonica Group]
Length=952

 Score =   280 bits (716),  Expect = 1e-84, Method: Composition-based stats.
 Identities = 131/170 (77%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            KSK PL F LRL +ALG++KGILYLHT+ADPPIFHRD+KASNILLD+K+ AKVADFGLSR
Sbjct  703  KSKPPLGFGLRLHIALGASKGILYLHTDADPPIFHRDVKASNILLDSKYVAKVADFGLSR  762

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PI 
Sbjct  763  LAPVPDVEGALPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMKPIE  822

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREV  AY SG I  ++D RMG    ECV+ F+ LA+KC +D+TD
Sbjct  823  HGKNIVREVKKAYRSGNISEIMDTRMGLCSPECVDSFLQLAMKCSRDETD  872



>ref|XP_010098600.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB75311.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=945

 Score =   280 bits (715),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K++  L F++RL +ALGSAKGILYLHTEA+PPIFHRDIKA+NILLD+  TAKVADFGL
Sbjct  703  SAKAERTLNFSMRLSIALGSAKGILYLHTEAEPPIFHRDIKATNILLDSHLTAKVADFGL  762

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP+ D EG VP +VSTVVKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLELLTGMHP
Sbjct  763  SRLAPLLDAEGTVPEYVSTVVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLELLTGMHP  822

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREV  A  SGT+FSVID RMGSYPSEC+E+F  LAL CC + T+
Sbjct  823  ISHGKNIVREVMTANHSGTMFSVIDSRMGSYPSECLERFAALALSCCDEKTE  874



>gb|EEC71706.1| hypothetical protein OsI_04218 [Oryza sativa Indica Group]
Length=905

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 151/173 (87%), Gaps = 1/173 (1%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KS+ PL F+ R+ +ALG+AKGILYLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  655  SAKSRRPLNFSQRIHIALGAAKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGL  714

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD++G +PAH+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVV LELLTGM P
Sbjct  715  SRLAPVPDVDGTMPAHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMKP  774

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPS-ECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN AY SG I  VIDER+ S  S ECV +  +LA+KCC+D+TD
Sbjct  775  IQHGKNIVREVNTAYQSGEIAGVIDERISSSSSPECVARLASLAVKCCKDETD  827



>gb|KHN29480.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=955

 Score =   280 bits (715),  Expect = 2e-84, Method: Composition-based stats.
 Identities = 129/170 (76%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K  L F++RLR+A+G+AKGILYLHTEA+PPIFHRDIKASNILLD+KFTAKVADFGLSR
Sbjct  708  KTKGSLNFSMRLRIAMGAAKGILYLHTEANPPIFHRDIKASNILLDSKFTAKVADFGLSR  767

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            L    D EG  P +VSTVVKGTPG+LDPEY LTHKLTDK DVYSLG+V+LELLTGM PIS
Sbjct  768  LVLDLDEEGTAPKYVSTVVKGTPGYLDPEYLLTHKLTDKCDVYSLGIVYLELLTGMQPIS  827

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN A  SGTI+S+ID RMG YPS+C++KF+TLAL+CCQD+ +
Sbjct  828  HGKNIVREVNTARQSGTIYSIIDSRMGLYPSDCLDKFLTLALRCCQDNPE  877



>gb|EEE64118.1| hypothetical protein OsJ_18950 [Oryza sativa Japonica Group]
Length=1009

 Score =   280 bits (716),  Expect = 2e-84, Method: Composition-based stats.
 Identities = 131/170 (77%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            KSK PL F LRL +ALG++KGILYLHT+ADPPIFHRD+KASNILLD+K+ AKVADFGLSR
Sbjct  703  KSKPPLGFGLRLHIALGASKGILYLHTDADPPIFHRDVKASNILLDSKYVAKVADFGLSR  762

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPD+EG +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGM PI 
Sbjct  763  LAPVPDVEGALPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMKPIE  822

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREV  AY SG I  ++D RMG    ECV+ F+ LA+KC +D+TD
Sbjct  823  HGKNIVREVKKAYRSGNISEIMDTRMGLCSPECVDSFLQLAMKCSRDETD  872



>ref|XP_006654549.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Oryza brachyantha]
 ref|XP_006654550.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Oryza brachyantha]
Length=947

 Score =   279 bits (714),  Expect = 2e-84, Method: Composition-based stats.
 Identities = 129/172 (75%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK  L+F LRL +ALG++KGILYLH EADPPIFHRD+KASNILLD+K+ AKVADFGL
Sbjct  703  SAKSKQHLSFGLRLHIALGASKGILYLHAEADPPIFHRDVKASNILLDSKYVAKVADFGL  762

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD++G +PAHVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM P
Sbjct  763  SRLAPVPDVQGTLPAHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKP  822

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREV  AY SG I  ++D RMG  P ECV+ F  LA+KC +D+TD
Sbjct  823  IEHGKNIVREVKKAYQSGNISEIMDSRMGLCPPECVQSFFVLAMKCSRDETD  874



>gb|EEE55585.1| hypothetical protein OsJ_03881 [Oryza sativa Japonica Group]
Length=953

 Score =   279 bits (714),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 151/173 (87%), Gaps = 1/173 (1%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KS+ PL F+ R+ +ALG+AKGILYLHTEADPPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  703  SAKSRRPLNFSQRIHIALGAAKGILYLHTEADPPIFHRDVKASNILLDSKFVAKVADFGL  762

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD++G +PAH+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVV LELLTGM P
Sbjct  763  SRLAPVPDVDGTMPAHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMKP  822

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPS-ECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN AY SG I  VIDER+ S  S ECV +  +LA+KCC+D+TD
Sbjct  823  IQHGKNIVREVNTAYQSGEIAGVIDERISSSSSPECVARLASLAVKCCKDETD  875



>gb|KHG06096.1| hypothetical protein F383_05597 [Gossypium arboreum]
Length=777

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+K+ L F +RLR+ALGSA+GILYLHTEA+PP+FHRDIKA+NILLD+   AKV+DFGL
Sbjct  530  SAKAKNTLNFGMRLRIALGSARGILYLHTEANPPVFHRDIKATNILLDSNLNAKVSDFGL  589

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV + EG VP HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP
Sbjct  590  SRLAPVLEEEGTVPDHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  649

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREV  A+ SG + S+ID RMG YP+EC+E+ ++LAL CC D+ +
Sbjct  650  IWHGKNIVREVKTAHESGMVLSLIDSRMGWYPAECMERMVSLALSCCNDEPE  701



>ref|XP_006587902.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X3 [Glycine max]
Length=955

 Score =   279 bits (713),  Expect = 2e-84, Method: Composition-based stats.
 Identities = 129/170 (76%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K  L F++RLR+A+G+AKGILYLHTEA+PPIFHRDIKASNILLD+KFTAKVADFGLSR
Sbjct  708  KTKGSLNFSMRLRIAMGAAKGILYLHTEANPPIFHRDIKASNILLDSKFTAKVADFGLSR  767

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            L    D EG  P +VSTVVKGTPG+LDPEY LTHKLTDK DVYSLG+V+LELLTGM PIS
Sbjct  768  LVLDLDEEGTAPKYVSTVVKGTPGYLDPEYLLTHKLTDKCDVYSLGIVYLELLTGMQPIS  827

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN A  SGTI+S+ID RMG YPS+C++KF+TLAL+CCQD+ +
Sbjct  828  HGKNIVREVNTARQSGTIYSIIDSRMGLYPSDCLDKFLTLALRCCQDNPE  877



>ref|XP_003533651.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Glycine max]
 ref|XP_006587901.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Glycine max]
Length=956

 Score =   279 bits (713),  Expect = 2e-84, Method: Composition-based stats.
 Identities = 129/170 (76%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K  L F++RLR+A+G+AKGILYLHTEA+PPIFHRDIKASNILLD+KFTAKVADFGLSR
Sbjct  709  KTKGSLNFSMRLRIAMGAAKGILYLHTEANPPIFHRDIKASNILLDSKFTAKVADFGLSR  768

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            L    D EG  P +VSTVVKGTPG+LDPEY LTHKLTDK DVYSLG+V+LELLTGM PIS
Sbjct  769  LVLDLDEEGTAPKYVSTVVKGTPGYLDPEYLLTHKLTDKCDVYSLGIVYLELLTGMQPIS  828

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN A  SGTI+S+ID RMG YPS+C++KF+TLAL+CCQD+ +
Sbjct  829  HGKNIVREVNTARQSGTIYSIIDSRMGLYPSDCLDKFLTLALRCCQDNPE  878



>dbj|BAK03216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=547

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K   +F LRL +ALG++KGILYLHT+A+PPIFHRD+KASNILLD+KF  KVADFGLSR
Sbjct  305  KAKQSPSFGLRLHIALGASKGILYLHTDANPPIFHRDVKASNILLDSKFVPKVADFGLSR  364

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPD+EG +  HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI 
Sbjct  365  LAPVPDIEGTLAGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIE  424

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN AY SG I  ++D RMG  P +C+ +F+ LA KCC+D+TD
Sbjct  425  HGKNIVREVNKAYQSGNISEIVDSRMGMCPPDCISRFLLLATKCCRDETD  474



>ref|XP_010653122.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X3 [Vitis vinifera]
Length=916

 Score =   278 bits (712),  Expect = 3e-84, Method: Composition-based stats.
 Identities = 132/169 (78%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK  L F+ RLR+ALGSAKGILYLHTEA PPIFHRDIKASNILLD+KFT KVADFGL
Sbjct  675  SAKSKT-LIFSTRLRIALGSAKGILYLHTEAQPPIFHRDIKASNILLDSKFTPKVADFGL  733

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP  + EG VP HVST+VKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLE+LTGM P
Sbjct  734  SRLAPDLEDEGAVPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMQP  793

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHGKNIVREVN+++  G +FS+ID +MGSYPSECVE+F+ LAL+CC D
Sbjct  794  ISHGKNIVREVNMSHQLGMVFSIIDNKMGSYPSECVERFLALALRCCHD  842



>ref|XP_007033468.1| LRR receptor-like serine/threonine-protein kinase, putative [Theobroma 
cacao]
 gb|EOY04394.1| LRR receptor-like serine/threonine-protein kinase, putative [Theobroma 
cacao]
Length=949

 Score =   279 bits (713),  Expect = 3e-84, Method: Composition-based stats.
 Identities = 131/168 (78%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            + +D L+F LRLR+ALGSAKGILYLH EADPPI HRDIKA+NILLD KF  KV+DFG+SR
Sbjct  707  RYRDTLSFPLRLRIALGSAKGILYLHNEADPPIIHRDIKANNILLDFKFNPKVSDFGISR  766

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPD EG   AHVSTVVKGTPG+LDPEYFLTHKLT+KSDVYSLG+VFLELLTGM PIS
Sbjct  767  LAPVPDAEG-ASAHVSTVVKGTPGYLDPEYFLTHKLTEKSDVYSLGIVFLELLTGMQPIS  825

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDD  8
            HG+NIVREV  A  SG +FS+ID+ MGSYPSEC +KF+ LALKCCQDD
Sbjct  826  HGRNIVREVYGACQSGLMFSIIDQSMGSYPSECTKKFMALALKCCQDD  873



>ref|XP_009395171.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Musa acuminata subsp. malaccensis]
Length=934

 Score =   278 bits (712),  Expect = 3e-84, Method: Composition-based stats.
 Identities = 130/172 (76%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K  +PL+F+ RL +ALGSA+GILYLH+EA+PPIFHRDIKASNILLD KF AKVADFGL
Sbjct  701  SAKCTEPLSFSKRLHIALGSARGILYLHSEANPPIFHRDIKASNILLDFKFVAKVADFGL  760

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP  D EG  P H+STVVKGTPG+LDPEY LTHKLTD+SDVYSLGVVFLELLTGM P
Sbjct  761  SRLAPGHDAEGITPGHISTVVKGTPGYLDPEYLLTHKLTDRSDVYSLGVVFLELLTGMRP  820

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREV  A   G +FS+ID RM +YPSEC+EKFI+LAL CC D+TD
Sbjct  821  ISHGKNIVREVKTACQCGLMFSIIDSRMNAYPSECMEKFISLALGCCHDETD  872



>ref|XP_006362336.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Solanum tuberosum]
Length=953

 Score =   278 bits (712),  Expect = 4e-84, Method: Composition-based stats.
 Identities = 133/178 (75%), Positives = 151/178 (85%), Gaps = 6/178 (3%)
 Frame = -3

Query  526  CDTTVKS------KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKF  365
            C+ T+++      K  L+FA RL + LG+AKGILYLHTEA PPIFHRDIKASNILLD+K 
Sbjct  698  CNGTLRNWLSANCKGTLSFATRLEIVLGAAKGILYLHTEAHPPIFHRDIKASNILLDSKM  757

Query  364  TAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVF  185
             AKVADFGLSRLAPV D EG +P HVST+VKGTPG+LDPEYFLT KLTDKSDVYSLGVVF
Sbjct  758  AAKVADFGLSRLAPVQDDEGVLPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVF  817

Query  184  LELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            LE+LTGM PISHGKNIVREVN+A+ S  +FSV+D  MGSYPSECVEKF+ LALKCC+D
Sbjct  818  LEILTGMRPISHGKNIVREVNLAHGSEKMFSVMDSTMGSYPSECVEKFVALALKCCED  875



>ref|XP_002266206.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Vitis vinifera]
 ref|XP_010653121.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Vitis vinifera]
Length=948

 Score =   278 bits (712),  Expect = 4e-84, Method: Composition-based stats.
 Identities = 132/169 (78%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK  L F+ RLR+ALGSAKGILYLHTEA PPIFHRDIKASNILLD+KFT KVADFGL
Sbjct  707  SAKSKT-LIFSTRLRIALGSAKGILYLHTEAQPPIFHRDIKASNILLDSKFTPKVADFGL  765

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP  + EG VP HVST+VKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLE+LTGM P
Sbjct  766  SRLAPDLEDEGAVPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMQP  825

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHGKNIVREVN+++  G +FS+ID +MGSYPSECVE+F+ LAL+CC D
Sbjct  826  ISHGKNIVREVNMSHQLGMVFSIIDNKMGSYPSECVERFLALALRCCHD  874



>ref|XP_010653120.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Vitis vinifera]
Length=969

 Score =   278 bits (712),  Expect = 4e-84, Method: Composition-based stats.
 Identities = 132/169 (78%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK  L F+ RLR+ALGSAKGILYLHTEA PPIFHRDIKASNILLD+KFT KVADFGL
Sbjct  728  SAKSKT-LIFSTRLRIALGSAKGILYLHTEAQPPIFHRDIKASNILLDSKFTPKVADFGL  786

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP  + EG VP HVST+VKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLE+LTGM P
Sbjct  787  SRLAPDLEDEGAVPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMQP  846

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHGKNIVREVN+++  G +FS+ID +MGSYPSECVE+F+ LAL+CC D
Sbjct  847  ISHGKNIVREVNMSHQLGMVFSIIDNKMGSYPSECVERFLALALRCCHD  895



>emb|CDP06372.1| unnamed protein product [Coffea canephora]
Length=968

 Score =   278 bits (712),  Expect = 5e-84, Method: Composition-based stats.
 Identities = 130/169 (77%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+   L F  RL +ALG+AKGILYLHTEA+PPIFHRD+KASNILLD+K TAKVADFGL
Sbjct  724  SAKTGKTLNFGARLHIALGAAKGILYLHTEANPPIFHRDVKASNILLDSKLTAKVADFGL  783

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV D EG +P +VST VKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLE+LTG  P
Sbjct  784  SRLAPVVDDEGALPEYVSTFVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGKQP  843

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            I HGKNIVREVN+A+ SG +FS+ID RMGSYPSECVE+FI L LKCCQD
Sbjct  844  ILHGKNIVREVNLAHQSGAMFSIIDTRMGSYPSECVERFIALGLKCCQD  892



>ref|XP_003552328.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoformX2 [Glycine max]
 ref|XP_006602730.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X3 [Glycine max]
 ref|XP_006602731.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X4 [Glycine max]
Length=957

 Score =   278 bits (711),  Expect = 5e-84, Method: Composition-based stats.
 Identities = 132/172 (77%), Positives = 153/172 (89%), Gaps = 4/172 (2%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K  L F++RLR+A+G+AKGILYLHTEA+PPIFHRDIKASNILLD+KFTAKVADFGLSR
Sbjct  711  KTKGSLNFSMRLRIAMGAAKGILYLHTEANPPIFHRDIKASNILLDSKFTAKVADFGLSR  770

Query  331  LAPVPDL--EGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            L  VPDL  EG  P +VSTVVKGTPG+LDPEY LTHKLTDK DVYSLG+V+LELLTGM P
Sbjct  771  L--VPDLYEEGTGPKYVSTVVKGTPGYLDPEYLLTHKLTDKCDVYSLGIVYLELLTGMQP  828

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN A  SGTI+S+ID RMG YPS+C++KF+TLAL+CCQD+ +
Sbjct  829  ISHGKNIVREVNTARQSGTIYSIIDSRMGLYPSDCLDKFLTLALRCCQDNPE  880



>ref|XP_004249029.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Solanum lycopersicum]
 ref|XP_010327701.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Solanum lycopersicum]
Length=953

 Score =   278 bits (711),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 152/178 (85%), Gaps = 6/178 (3%)
 Frame = -3

Query  526  CDTTVKS------KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKF  365
            C+ T+++      K  L+FA RL + LG+AKGILYLHTEA PPIFHRDIKASNILLD+K 
Sbjct  698  CNGTLRNWLSANCKGALSFATRLEIVLGAAKGILYLHTEAHPPIFHRDIKASNILLDSKM  757

Query  364  TAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVF  185
            TAKVADFGLSRLAPV D EG +P HVST+VKGTPG+LDPEYFLT KLTDKSDVYSLGVVF
Sbjct  758  TAKVADFGLSRLAPVQDDEGVLPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVF  817

Query  184  LELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            LE+LTGM PISHGKNIVREVN+A+ S  +FSV+D  MGSYPSECVEKF+ LALKCC+D
Sbjct  818  LEILTGMRPISHGKNIVREVNLAHGSEKMFSVMDSTMGSYPSECVEKFVALALKCCED  875



>gb|KHN30615.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=945

 Score =   278 bits (710),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -3

Query  508  SKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRL  329
            SK+PL+F+LRL++ALGSAKG+LYLHTEA+PPIFHRD+KASNILLD+++TAKVADFGLSRL
Sbjct  703  SKEPLSFSLRLKIALGSAKGLLYLHTEANPPIFHRDVKASNILLDSRYTAKVADFGLSRL  762

Query  328  APVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISH  149
            APVPD EG VP HVSTVVKGTPG+LDPEYFLT  LTDKSDVYSLGVV LELLTG  PI H
Sbjct  763  APVPDTEGNVPGHVSTVVKGTPGYLDPEYFLTRNLTDKSDVYSLGVVLLELLTGRPPIFH  822

Query  148  GKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            G+NI+R+VN+AY+SG I  V+D+R+ SYP+EC EKF+ LALKCC+D  D
Sbjct  823  GENIIRQVNMAYNSGGISLVVDKRIESYPTECAEKFLALALKCCKDTPD  871



>gb|KHN40602.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=957

 Score =   278 bits (711),  Expect = 6e-84, Method: Composition-based stats.
 Identities = 132/172 (77%), Positives = 153/172 (89%), Gaps = 4/172 (2%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K  L F++RLR+A+G+AKGILYLHTEA+PPIFHRDIKASNILLD+KFTAKVADFGLSR
Sbjct  711  KTKGSLNFSMRLRIAMGAAKGILYLHTEANPPIFHRDIKASNILLDSKFTAKVADFGLSR  770

Query  331  LAPVPDL--EGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            L  VPDL  EG  P +VSTVVKGTPG+LDPEY LTHKLTDK DVYSLG+V+LELLTGM P
Sbjct  771  L--VPDLYEEGTGPKYVSTVVKGTPGYLDPEYLLTHKLTDKCDVYSLGIVYLELLTGMQP  828

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN A  SGTI+S+ID RMG YPS+C++KF+TLAL+CCQD+ +
Sbjct  829  ISHGKNIVREVNTARQSGTIYSIIDSRMGLYPSDCLDKFLTLALRCCQDNPE  880



>ref|XP_006595541.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X1 [Glycine max]
 ref|XP_006595542.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X2 [Glycine max]
 ref|XP_006595543.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like isoform X3 [Glycine max]
Length=945

 Score =   278 bits (710),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -3

Query  508  SKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRL  329
            SK+PL+F+LRL++ALGSAKG+LYLHTEA+PPIFHRD+KASNILLD+++TAKVADFGLSRL
Sbjct  703  SKEPLSFSLRLKIALGSAKGLLYLHTEANPPIFHRDVKASNILLDSRYTAKVADFGLSRL  762

Query  328  APVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISH  149
            APVPD EG VP HVSTVVKGTPG+LDPEYFLT  LTDKSDVYSLGVV LELLTG  PI H
Sbjct  763  APVPDTEGNVPGHVSTVVKGTPGYLDPEYFLTRNLTDKSDVYSLGVVLLELLTGRPPIFH  822

Query  148  GKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            G+NI+R+VN+AY+SG I  V+D+R+ SYP+EC EKF+ LALKCC+D  D
Sbjct  823  GENIIRQVNMAYNSGGISLVVDKRIESYPTECAEKFLALALKCCKDTPD  871



>ref|XP_002323097.2| hypothetical protein POPTR_0016s14710g [Populus trichocarpa]
 gb|EEF04858.2| hypothetical protein POPTR_0016s14710g [Populus trichocarpa]
Length=664

 Score =   272 bits (696),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -3

Query  568  LLLSSYAIN*TLCPCDTTVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKAS  389
            L+++  ++N  +       K K+  +F  RL +ALGSAKGILYLHTEADPP+FHRDIKAS
Sbjct  397  LIITHMSLNAGMNIGSELAKDKEKFSFGTRLSIALGSAKGILYLHTEADPPVFHRDIKAS  456

Query  388  NILLDAKFTAKVADFGLSRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSD  209
            NILLD+K TAKVADFGLS LAPV D +G  P HVSTVVKGTPG+LDPEYFLT KLTDKSD
Sbjct  457  NILLDSKLTAKVADFGLSLLAPVMDDDGYQPNHVSTVVKGTPGYLDPEYFLTRKLTDKSD  516

Query  208  VYSLGVVFLELLTGMHPISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLA  29
            VYSLGVVFLELLTGM PI  GKNIVREVN+A  S  +FS+ID RMGSYPS+C+E+F+ LA
Sbjct  517  VYSLGVVFLELLTGMQPIYRGKNIVREVNIACESDKMFSIIDRRMGSYPSKCIERFVALA  576

Query  28   LKCCQDDTD  2
            L+CC D  D
Sbjct  577  LRCCHDKQD  585



>ref|XP_004163829.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like, partial [Cucumis sativus]
Length=581

 Score =   270 bits (691),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = -3

Query  496  LTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLAPVP  317
            L F +RLR++LGSAKGILYLHTEA+PPIFHRDIKA NILLDAKFTAKVADFGLSRLAP  
Sbjct  343  LNFRMRLRISLGSAKGILYLHTEANPPIFHRDIKARNILLDAKFTAKVADFGLSRLAPDL  402

Query  316  DLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNI  137
            + EG+VP H+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI HGKNI
Sbjct  403  NYEGDVPGHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIQHGKNI  462

Query  136  VREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            VREV +A+  GT+ S++D  +GS+  +C+E+F+ LA+ CC D+ D
Sbjct  463  VREVKLAHQMGTVLSIVDSTLGSFAPDCLERFVALAISCCHDNPD  507



>ref|XP_009395172.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Musa acuminata subsp. malaccensis]
Length=887

 Score =   276 bits (707),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K  +PL+F+ RL +ALGSA+GILYLH+EA+PPIFHRDIKASNILLD KF AKVADFGL
Sbjct  654  SAKCTEPLSFSKRLHIALGSARGILYLHSEANPPIFHRDIKASNILLDFKFVAKVADFGL  713

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP  D EG  P H+STVVKGTPG+LDPEY LTHKLTD+SDVYSLGVVFLELLTGM P
Sbjct  714  SRLAPGHDAEGITPGHISTVVKGTPGYLDPEYLLTHKLTDRSDVYSLGVVFLELLTGMRP  773

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREV  A   G +FS+ID RM +YPSEC+EKFI+LAL CC D+TD
Sbjct  774  ISHGKNIVREVKTACQCGLMFSIIDSRMNAYPSECMEKFISLALGCCHDETD  825



>ref|XP_010231258.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Brachypodium distachyon]
Length=865

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK    F LRL +ALG++KGILYLHT+A+PPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  619  SAKSKRSPGFGLRLHIALGASKGILYLHTDANPPIFHRDVKASNILLDSKFVAKVADFGL  678

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +  HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM P
Sbjct  679  SRLAPVPDIEGTLAGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKP  738

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN AY SG I  ++D RMG  P +C+ +F++LA KCC+D+TD
Sbjct  739  IEHGKNIVREVNKAYQSGNISEIVDSRMGLCPPDCISRFLSLATKCCEDETD  790



>dbj|BAJ98336.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=949

 Score =   276 bits (706),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -3

Query  505  KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLA  326
            K PL+FA RL VALG+AKGILYLHTEADPPIFHRD+KA+NILLD+KF AKVADFGLSRLA
Sbjct  708  KIPLSFAQRLHVALGAAKGILYLHTEADPPIFHRDVKATNILLDSKFVAKVADFGLSRLA  767

Query  325  PVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHG  146
            PVPD+EG++PAH+STVVKGTPG+LDPEYFLTHKLT+KSDVYSLGVV LELLTGM PI  G
Sbjct  768  PVPDIEGKLPAHISTVVKGTPGYLDPEYFLTHKLTEKSDVYSLGVVLLELLTGMKPIQFG  827

Query  145  KNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            KNIVREVN AY SG I  +ID RM   P E   +F++L LKCCQDDTD
Sbjct  828  KNIVREVNTAYRSGDISGIIDSRMTWCPPEFAMRFLSLGLKCCQDDTD  875



>dbj|BAK06660.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=967

 Score =   276 bits (706),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -3

Query  505  KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLA  326
            K PL+FA RL VALG+AKGILYLHTEADPPIFHRD+KA+NILLD+KF AKVADFGLSRLA
Sbjct  726  KIPLSFAQRLHVALGAAKGILYLHTEADPPIFHRDVKATNILLDSKFVAKVADFGLSRLA  785

Query  325  PVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHG  146
            PVPD+EG++PAH+STVVKGTPG+LDPEYFLTHKLT+KSDVYSLGVV LELLTGM PI  G
Sbjct  786  PVPDIEGKLPAHISTVVKGTPGYLDPEYFLTHKLTEKSDVYSLGVVLLELLTGMKPIQFG  845

Query  145  KNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            KNIVREVN AY SG I  +ID RM   P E   +F++L LKCCQDDTD
Sbjct  846  KNIVREVNTAYRSGDISGIIDSRMTWCPPEFAMRFLSLGLKCCQDDTD  893



>gb|KJB29851.1| hypothetical protein B456_005G121200 [Gossypium raimondii]
Length=954

 Score =   276 bits (706),  Expect = 3e-83, Method: Composition-based stats.
 Identities = 128/169 (76%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK  L F +RLR+ALGSAKGILYLHTEA PP+FHRDIKASNILLD+K  AKVADFGL
Sbjct  712  SAKSKRSLNFGMRLRIALGSAKGILYLHTEAHPPVFHRDIKASNILLDSKLNAKVADFGL  771

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP  + EG VP HVSTVV+GTPG+LDPEYFLTHKLTD+SDVYSLGVVFLE+LTGM P
Sbjct  772  SRLAPALEDEGAVPDHVSTVVRGTPGYLDPEYFLTHKLTDRSDVYSLGVVFLEMLTGMRP  831

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHG+NIVREVN A+ SG + S+ID RMG YPSEC+E+F  LAL CC +
Sbjct  832  ISHGRNIVREVNTAHQSGLMMSIIDGRMGCYPSECIERFAGLALSCCHN  880



>ref|XP_009337807.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Pyrus x bretschneideri]
Length=953

 Score =   276 bits (705),  Expect = 4e-83, Method: Composition-based stats.
 Identities = 128/171 (75%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -3

Query  514  VKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLS  335
            VK+   L F +RLR+ALGSAKGILYLHTEA+PPIFHRDIKASNILLD+   AKVADFGLS
Sbjct  712  VKAMGSLDFTMRLRIALGSAKGILYLHTEANPPIFHRDIKASNILLDSNLVAKVADFGLS  771

Query  334  RLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI  155
            RLAP+ D EG   +HVSTVV+GTPG++DPEYFLT+KLTDKSDVYSLG+VFLELLTG  PI
Sbjct  772  RLAPLQDDEGTGSSHVSTVVRGTPGYVDPEYFLTNKLTDKSDVYSLGIVFLELLTGDQPI  831

Query  154  SHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            SHGKNIVREVN+AY +G +FS+ID+RMGSYPS+CVE+F+ LAL+CC +  D
Sbjct  832  SHGKNIVREVNLAYQAGLVFSIIDKRMGSYPSKCVERFLDLALRCCNEKPD  882



>ref|XP_003568234.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Brachypodium distachyon]
 ref|XP_010231255.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Brachypodium distachyon]
 ref|XP_010231257.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Brachypodium distachyon]
Length=949

 Score =   276 bits (705),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK    F LRL +ALG++KGILYLHT+A+PPIFHRD+KASNILLD+KF AKVADFGL
Sbjct  703  SAKSKRSPGFGLRLHIALGASKGILYLHTDANPPIFHRDVKASNILLDSKFVAKVADFGL  762

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPVPD+EG +  HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM P
Sbjct  763  SRLAPVPDIEGTLAGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKP  822

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            I HGKNIVREVN AY SG I  ++D RMG  P +C+ +F++LA KCC+D+TD
Sbjct  823  IEHGKNIVREVNKAYQSGNISEIVDSRMGLCPPDCISRFLSLATKCCEDETD  874



>emb|CBI31162.3| unnamed protein product [Vitis vinifera]
Length=1821

 Score =   280 bits (715),  Expect = 6e-83, Method: Composition-based stats.
 Identities = 132/169 (78%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = -3

Query  517   TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
             + KSK  L F+ RLR+ALGSAKGILYLHTEA PPIFHRDIKASNILLD+KFT KVADFGL
Sbjct  1580  SAKSKT-LIFSTRLRIALGSAKGILYLHTEAQPPIFHRDIKASNILLDSKFTPKVADFGL  1638

Query  337   SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
             SRLAP  + EG VP HVST+VKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLE+LTGM P
Sbjct  1639  SRLAPDLEDEGAVPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMQP  1698

Query  157   ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
             ISHGKNIVREVN+++  G +FS+ID +MGSYPSECVE+F+ LAL+CC D
Sbjct  1699  ISHGKNIVREVNMSHQLGMVFSIIDNKMGSYPSECVERFLALALRCCHD  1747


 Score =   160 bits (406),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 74/104 (71%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -3

Query  316  DLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNI  137
            D E    AHVSTVVKGTPG+LDPEYF THKLT+KSDVYSLG+VFLELLTGM PIS G+NI
Sbjct  712  DGEEGATAHVSTVVKGTPGYLDPEYFFTHKLTEKSDVYSLGIVFLELLTGMQPISQGRNI  771

Query  136  VREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            VREV  A  SG +FS+ID+ MG +PS+CV++F+TLAL+C QD T
Sbjct  772  VREVTAACQSGAMFSIIDQNMGPFPSDCVKEFMTLALRCSQDLT  815



>emb|CDM84746.1| unnamed protein product [Triticum aestivum]
Length=862

 Score =   274 bits (700),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -3

Query  505  KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLA  326
            K PL FA RL +ALG+AKGILYLHTEADPPIFHRD+KA+NILLD+KF AKVADFGLSRLA
Sbjct  621  KRPLNFAQRLHIALGAAKGILYLHTEADPPIFHRDVKATNILLDSKFVAKVADFGLSRLA  680

Query  325  PVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHG  146
            P PD+EG++PAH+STVVKGTPG+LDPEYFLTHKLT+KSDVYSLGVV LELLTGM PI  G
Sbjct  681  PFPDIEGKLPAHISTVVKGTPGYLDPEYFLTHKLTEKSDVYSLGVVLLELLTGMKPIQFG  740

Query  145  KNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            KNIVREVN AY SG I  +ID RM   P E   +F++L LKCCQDDTD
Sbjct  741  KNIVREVNTAYRSGDISGIIDSRMSWCPPEFATRFLSLGLKCCQDDTD  788



>ref|XP_003623645.1| Leucine-rich repeat protein kinase [Medicago truncatula]
Length=1081

 Score =   276 bits (706),  Expect = 8e-83, Method: Composition-based stats.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K K+ L+F +RLR+A+G++KGILYLHTEA+PPI+HRDIKASNILLD KFTAKVADFGLSR
Sbjct  831  KCKEGLSFFMRLRIAMGASKGILYLHTEANPPIYHRDIKASNILLDLKFTAKVADFGLSR  890

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            L P  D EG VP +VSTVVKGTPG+LDPEY +THKLTDKSDVYSLG+VFLELLTGMHPIS
Sbjct  891  LIPYSDEEGTVPKYVSTVVKGTPGYLDPEYMMTHKLTDKSDVYSLGIVFLELLTGMHPIS  950

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
             GKNIVREVN+A  +G I S+ID+RMG YPSEC++KF+ LAL CC D
Sbjct  951  RGKNIVREVNLACQAGLIDSIIDDRMGEYPSECLDKFLALALSCCHD  997



>ref|XP_008244528.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Prunus mume]
Length=793

 Score =   272 bits (695),  Expect = 1e-82, Method: Composition-based stats.
 Identities = 126/171 (74%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -3

Query  514  VKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLS  335
            VK+K  L+F +RL++ALGSAKGILYLH EA+PPIFHRDIKA+NILLD+   AKVADFGLS
Sbjct  552  VKAKGSLSFGMRLQIALGSAKGILYLHNEANPPIFHRDIKATNILLDSNLMAKVADFGLS  611

Query  334  RLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI  155
            RLAP+ D EG  P++VST V+GTPG+LDPEYFLT KLTDKSDVYSLG+VFLELLTG+ PI
Sbjct  612  RLAPLQDDEGSGPSYVSTAVRGTPGYLDPEYFLTSKLTDKSDVYSLGIVFLELLTGVLPI  671

Query  154  SHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            SHGKNIVREVN+A+ +G +FS+ID RMGSYPSECVE+F+ LAL+CC +  D
Sbjct  672  SHGKNIVREVNLAHQAGLMFSIIDSRMGSYPSECVERFLALALRCCYEKQD  722



>ref|XP_004142673.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840-like [Cucumis sativus]
Length=905

 Score =   274 bits (700),  Expect = 1e-82, Method: Composition-based stats.
 Identities = 124/165 (75%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = -3

Query  496  LTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLAPVP  317
            L F +RLR++LGSAKGILYLHTEA+PPIFHRDIKA NILLDAKFTAKVADFGLSRLAP  
Sbjct  668  LNFRMRLRISLGSAKGILYLHTEANPPIFHRDIKARNILLDAKFTAKVADFGLSRLAPDL  727

Query  316  DLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNI  137
            + EG+VP H+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI HGKNI
Sbjct  728  NYEGDVPGHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIQHGKNI  787

Query  136  VREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            VREV +A+  GT+ S++D  +GS+  +C+E+F+ LA+ CC D+ D
Sbjct  788  VREVKLAHQMGTVLSIVDSTLGSFAPDCLERFVALAISCCHDNPD  832



>ref|XP_007140045.1| hypothetical protein PHAVU_008G079800g [Phaseolus vulgaris]
 gb|ESW12039.1| hypothetical protein PHAVU_008G079800g [Phaseolus vulgaris]
Length=956

 Score =   274 bits (701),  Expect = 1e-82, Method: Composition-based stats.
 Identities = 125/170 (74%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K++  L F++RLR+A+G+AKGILYLHTEA+PPIFHRDIKASNILLD+KFTAKVADFGLSR
Sbjct  709  KTRGSLNFSMRLRIAMGAAKGILYLHTEANPPIFHRDIKASNILLDSKFTAKVADFGLSR  768

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            L P  D EG  P +VSTVV+GTPG+LDPEY LTHKLTDK DVYSLG+V+LELLTGM PIS
Sbjct  769  LVPDLDEEGTAPKYVSTVVRGTPGYLDPEYLLTHKLTDKCDVYSLGIVYLELLTGMQPIS  828

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN+A  SGT++S+ID  +G Y SEC++KF+TLAL CCQD+ +
Sbjct  829  HGKNIVREVNMALQSGTVYSIIDSTIGLYTSECLDKFLTLALSCCQDNPE  878



>ref|XP_008244520.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Prunus mume]
Length=953

 Score =   274 bits (701),  Expect = 1e-82, Method: Composition-based stats.
 Identities = 126/171 (74%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -3

Query  514  VKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLS  335
            VK+K  L+F +RL++ALGSAKGILYLH EA+PPIFHRDIKA+NILLD+   AKVADFGLS
Sbjct  712  VKAKGSLSFGMRLQIALGSAKGILYLHNEANPPIFHRDIKATNILLDSNLMAKVADFGLS  771

Query  334  RLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI  155
            RLAP+ D EG  P++VST V+GTPG+LDPEYFLT KLTDKSDVYSLG+VFLELLTG+ PI
Sbjct  772  RLAPLQDDEGSGPSYVSTAVRGTPGYLDPEYFLTSKLTDKSDVYSLGIVFLELLTGVLPI  831

Query  154  SHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            SHGKNIVREVN+A+ +G +FS+ID RMGSYPSECVE+F+ LAL+CC +  D
Sbjct  832  SHGKNIVREVNLAHQAGLMFSIIDSRMGSYPSECVERFLALALRCCYEKQD  882



>gb|KEH23301.1| LRR receptor-like kinase [Medicago truncatula]
Length=783

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K K+ L+F +RLR+A+G++KGILYLHTEA+PPI+HRDIKASNILLD KFTAKVADFGLSR
Sbjct  533  KCKEGLSFFMRLRIAMGASKGILYLHTEANPPIYHRDIKASNILLDLKFTAKVADFGLSR  592

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            L P  D EG VP +VSTVVKGTPG+LDPEY +THKLTDKSDVYSLG+VFLELLTGMHPIS
Sbjct  593  LIPYSDEEGTVPKYVSTVVKGTPGYLDPEYMMTHKLTDKSDVYSLGIVFLELLTGMHPIS  652

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
             GKNIVREVN+A  +G I S+ID+RMG YPSEC++KF+ LAL CC D
Sbjct  653  RGKNIVREVNLACQAGLIDSIIDDRMGEYPSECLDKFLALALSCCHD  699



>gb|KHG26417.1| hypothetical protein F383_04408 [Gossypium arboreum]
Length=966

 Score =   274 bits (700),  Expect = 2e-82, Method: Composition-based stats.
 Identities = 127/169 (75%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK  L F +RLR+ALGSAKGILYLHTEA PP+FHRDIKASNILLD+K  AKVADFGL
Sbjct  724  SAKSKRSLNFGMRLRIALGSAKGILYLHTEAHPPVFHRDIKASNILLDSKLNAKVADFGL  783

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP  + EG VP HVSTVV+GTPG+LDPEYFLTHKLTD+SDVYSLGVVFLE+LTGM P
Sbjct  784  SRLAPALEDEGAVPDHVSTVVRGTPGYLDPEYFLTHKLTDRSDVYSLGVVFLEMLTGMRP  843

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHG+NIVREV +A+ SG + S+ID RMG YPSEC+E+F  LAL CC +
Sbjct  844  ISHGRNIVREVIMAHQSGMMMSIIDGRMGCYPSECIERFAGLALSCCHN  892



>ref|XP_008463287.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Cucumis melo]
Length=958

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = -3

Query  496  LTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLAPVP  317
            L F +RLR+ALGSAKGILYLHTEA+PPIFHRDIKA NILLDAKFTAKVADFGLSRLAP  
Sbjct  720  LNFRMRLRIALGSAKGILYLHTEANPPIFHRDIKARNILLDAKFTAKVADFGLSRLAPDL  779

Query  316  DLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNI  137
            + EG+VP H+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI HGKNI
Sbjct  780  NYEGDVPGHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIQHGKNI  839

Query  136  VREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            VREV +A+ +GTI S++D  +GS+  EC+E+F+ LA+ CC D+ +
Sbjct  840  VREVKLAHQTGTILSIVDTTLGSFTPECLERFVALAISCCHDNPE  884



>ref|XP_008463289.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Cucumis melo]
Length=957

 Score =   273 bits (699),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = -3

Query  496  LTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLAPVP  317
            L F +RLR+ALGSAKGILYLHTEA+PPIFHRDIKA NILLDAKFTAKVADFGLSRLAP  
Sbjct  719  LNFRMRLRIALGSAKGILYLHTEANPPIFHRDIKARNILLDAKFTAKVADFGLSRLAPDL  778

Query  316  DLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNI  137
            + EG+VP H+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI HGKNI
Sbjct  779  NYEGDVPGHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIQHGKNI  838

Query  136  VREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            VREV +A+ +GTI S++D  +GS+  EC+E+F+ LA+ CC D+ +
Sbjct  839  VREVKLAHQTGTILSIVDTTLGSFTPECLERFVALAISCCHDNPE  883



>ref|XP_009614147.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nicotiana tomentosiformis]
Length=951

 Score =   273 bits (699),  Expect = 3e-82, Method: Composition-based stats.
 Identities = 129/169 (76%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V  K+ L F  RL++ALG+AKGILYLHTEA PPIFHRDIKASNILLD+K TAKVADFGL
Sbjct  706  SVTCKESLKFGARLQIALGAAKGILYLHTEAHPPIFHRDIKASNILLDSKMTAKVADFGL  765

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV D EG +P HVST+VKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLE+LTGM P
Sbjct  766  SRLAPVQDDEGVLPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMRP  825

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHGKNIVREV++A  S  ++SV+D  MG YPSEC+EKF  LALKCC+D
Sbjct  826  ISHGKNIVREVHLAQDSEKMYSVMDSTMGPYPSECMEKFAALALKCCED  874



>gb|KHG26416.1| hypothetical protein F383_04408 [Gossypium arboreum]
Length=982

 Score =   273 bits (699),  Expect = 3e-82, Method: Composition-based stats.
 Identities = 127/169 (75%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + KSK  L F +RLR+ALGSAKGILYLHTEA PP+FHRDIKASNILLD+K  AKVADFGL
Sbjct  740  SAKSKRSLNFGMRLRIALGSAKGILYLHTEAHPPVFHRDIKASNILLDSKLNAKVADFGL  799

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAP  + EG VP HVSTVV+GTPG+LDPEYFLTHKLTD+SDVYSLGVVFLE+LTGM P
Sbjct  800  SRLAPALEDEGAVPDHVSTVVRGTPGYLDPEYFLTHKLTDRSDVYSLGVVFLEMLTGMRP  859

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHG+NIVREV +A+ SG + S+ID RMG YPSEC+E+F  LAL CC +
Sbjct  860  ISHGRNIVREVIMAHQSGMMMSIIDGRMGCYPSECIERFAGLALSCCHN  908



>ref|XP_010683436.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=923

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K +  L F +RLR+ALG+AKGI YLHTEA+PPIFHRDIKASNILLD   TAKVADFGLS 
Sbjct  683  KCERNLNFVMRLRIALGAAKGISYLHTEANPPIFHRDIKASNILLDTNLTAKVADFGLSH  742

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG  P H+ST+VKGTPG+LDPEYFLTH+LTDKSDVYSLGVVFLELLT + PIS
Sbjct  743  LAPVMDDEGSAPHHISTIVKGTPGYLDPEYFLTHQLTDKSDVYSLGVVFLELLTAVPPIS  802

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKN+VREVN A  SG++F +ID RMG+YPSECVEKFI LA++CCQD  D
Sbjct  803  HGKNLVREVNTAQKSGSLFGIIDSRMGTYPSECVEKFIALAVRCCQDKPD  852



>ref|XP_009780438.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Nicotiana sylvestris]
Length=952

 Score =   273 bits (697),  Expect = 4e-82, Method: Composition-based stats.
 Identities = 129/169 (76%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            +V  K+ L F  RL++ALG+AKGILYLHTEA PPIFHRDIKASNILLD+K TAKVADFGL
Sbjct  707  SVTCKESLKFGARLQIALGAAKGILYLHTEAHPPIFHRDIKASNILLDSKMTAKVADFGL  766

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV D EG +P HVST+VKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLE+LTGM P
Sbjct  767  SRLAPVQDDEGVLPNHVSTIVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLEILTGMRP  826

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            ISHGKNIVREV++A+ S  ++SV+D  MG YPSEC+EKF  LALKCC+D
Sbjct  827  ISHGKNIVREVHLAHDSEKMYSVMDSTMGPYPSECMEKFAALALKCCED  875



>ref|XP_010683435.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=948

 Score =   273 bits (697),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K +  L F +RLR+ALG+AKGI YLHTEA+PPIFHRDIKASNILLD   TAKVADFGLS 
Sbjct  708  KCERNLNFVMRLRIALGAAKGISYLHTEANPPIFHRDIKASNILLDTNLTAKVADFGLSH  767

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG  P H+ST+VKGTPG+LDPEYFLTH+LTDKSDVYSLGVVFLELLT + PIS
Sbjct  768  LAPVMDDEGSAPHHISTIVKGTPGYLDPEYFLTHQLTDKSDVYSLGVVFLELLTAVPPIS  827

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKN+VREVN A  SG++F +ID RMG+YPSECVEKFI LA++CCQD  D
Sbjct  828  HGKNLVREVNTAQKSGSLFGIIDSRMGTYPSECVEKFIALAVRCCQDKPD  877



>ref|XP_008350579.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Malus domestica]
Length=845

 Score =   271 bits (693),  Expect = 6e-82, Method: Composition-based stats.
 Identities = 128/171 (75%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -3

Query  514  VKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLS  335
            VK+K  L F +RLR+ALGSAKGILYLHTEA+PPIFHRDIKASNILLD+   AKVADFGLS
Sbjct  603  VKAKGSLDFTMRLRIALGSAKGILYLHTEANPPIFHRDIKASNILLDSNLVAKVADFGLS  662

Query  334  RLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI  155
            RLAP  D EG   ++VSTVVKGTPG++DPEYFLT+KLTDKSDVYSLG+VFLELLTG  PI
Sbjct  663  RLAPPQDDEGTGSSYVSTVVKGTPGYIDPEYFLTNKLTDKSDVYSLGIVFLELLTGGQPI  722

Query  154  SHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            SHGKNIVREVN+AY +G +FS+ID+RM SYPS+CVE+F+ LAL+CC +  D
Sbjct  723  SHGKNIVREVNLAYQAGLVFSIIDKRMRSYPSKCVERFLDLALRCCNEKPD  773



>gb|EMT05020.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=922

 Score =   272 bits (695),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K    F LRL +ALG++KGILYLHT+A+PPIFHRD+KASNILLD+KF  KVADFGLSR
Sbjct  680  KAKLSPGFGLRLHIALGASKGILYLHTDANPPIFHRDVKASNILLDSKFVPKVADFGLSR  739

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPVPD+EG +  HVSTVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLE+LTGM PI 
Sbjct  740  LAPVPDIEGTLAGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEMLTGMKPIE  799

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREVN AY SG I  ++D RMG  P +C+ +F+ LA KCCQD+TD
Sbjct  800  HGKNIVREVNKAYQSGNISEIVDSRMGMCPPDCINRFLLLATKCCQDETD  849



>gb|KEH23302.1| LRR receptor-like kinase [Medicago truncatula]
Length=917

 Score =   271 bits (694),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K K+ L+F +RLR+A+G++KGILYLHTEA+PPI+HRDIKASNILLD KFTAKVADFGLSR
Sbjct  667  KCKEGLSFFMRLRIAMGASKGILYLHTEANPPIYHRDIKASNILLDLKFTAKVADFGLSR  726

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            L P  D EG VP +VSTVVKGTPG+LDPEY +THKLTDKSDVYSLG+VFLELLTGMHPIS
Sbjct  727  LIPYSDEEGTVPKYVSTVVKGTPGYLDPEYMMTHKLTDKSDVYSLGIVFLELLTGMHPIS  786

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
             GKNIVREVN+A  +G I S+ID+RMG YPSEC++KF+ LAL CC D
Sbjct  787  RGKNIVREVNLACQAGLIDSIIDDRMGEYPSECLDKFLALALSCCHD  833



>gb|KGN54467.1| hypothetical protein Csa_4G336750 [Cucumis sativus]
Length=953

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = -3

Query  496  LTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLAPVP  317
            L F +RLR++LGSAKGILYLHTEA+PPIFHRDIKA NILLDAKFTAKVADFGLSRLAP  
Sbjct  715  LNFRMRLRISLGSAKGILYLHTEANPPIFHRDIKARNILLDAKFTAKVADFGLSRLAPDL  774

Query  316  DLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHGKNI  137
            + EG+VP H+STVVKGTPG+LDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI HGKNI
Sbjct  775  NYEGDVPGHISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIQHGKNI  834

Query  136  VREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            VREV +A+  GT+ S++D  +GS+  +C+E+F+ LA+ CC D+ D
Sbjct  835  VREVKLAHQMGTVLSIVDSTLGSFAPDCLERFVALAISCCHDNPD  879



>ref|XP_008350578.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Malus domestica]
Length=953

 Score =   272 bits (695),  Expect = 1e-81, Method: Composition-based stats.
 Identities = 128/171 (75%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -3

Query  514  VKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLS  335
            VK+K  L F +RLR+ALGSAKGILYLHTEA+PPIFHRDIKASNILLD+   AKVADFGLS
Sbjct  711  VKAKGSLDFTMRLRIALGSAKGILYLHTEANPPIFHRDIKASNILLDSNLVAKVADFGLS  770

Query  334  RLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI  155
            RLAP  D EG   ++VSTVVKGTPG++DPEYFLT+KLTDKSDVYSLG+VFLELLTG  PI
Sbjct  771  RLAPPQDDEGTGSSYVSTVVKGTPGYIDPEYFLTNKLTDKSDVYSLGIVFLELLTGGQPI  830

Query  154  SHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            SHGKNIVREVN+AY +G +FS+ID+RM SYPS+CVE+F+ LAL+CC +  D
Sbjct  831  SHGKNIVREVNLAYQAGLVFSIIDKRMRSYPSKCVERFLDLALRCCNEKPD  881



>ref|XP_009370883.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Pyrus x bretschneideri]
 ref|XP_009370884.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Pyrus x bretschneideri]
Length=951

 Score =   271 bits (694),  Expect = 1e-81, Method: Composition-based stats.
 Identities = 127/170 (75%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K+K  L F +RLR+ALGSAKGILYLHTEA+PPIFHRDIKASNILLD+   AKVADFGLSR
Sbjct  711  KAKGSLDFTMRLRIALGSAKGILYLHTEANPPIFHRDIKASNILLDSNLVAKVADFGLSR  770

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAP+ D  G  PA+VSTVV+GTPG+LDPEYFLT+KLTDKSDVYSLG+VFLELLTG  PIS
Sbjct  771  LAPLQDDAGIGPAYVSTVVRGTPGYLDPEYFLTNKLTDKSDVYSLGIVFLELLTGNQPIS  830

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            HGKNIVREV++A+ +G +FS+ID RMGSYPSECVE+ + LAL+CC +  D
Sbjct  831  HGKNIVREVSLAHQAGLVFSIIDSRMGSYPSECVERLLDLALRCCNEKQD  880



>ref|XP_007142017.1| hypothetical protein PHAVU_008G245600g [Phaseolus vulgaris]
 ref|XP_007142018.1| hypothetical protein PHAVU_008G245600g [Phaseolus vulgaris]
 gb|ESW14011.1| hypothetical protein PHAVU_008G245600g [Phaseolus vulgaris]
 gb|ESW14012.1| hypothetical protein PHAVU_008G245600g [Phaseolus vulgaris]
Length=944

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = -3

Query  508  SKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRL  329
            SKD L+F+LRL++ALGSAKG++YLHTEA+PPIFHRD+KASNILLD+++TAKVADFGLSRL
Sbjct  703  SKDVLSFSLRLKIALGSAKGLVYLHTEANPPIFHRDVKASNILLDSRYTAKVADFGLSRL  762

Query  328  APVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISH  149
            APVPD+EG VPAHVSTVVKGTPG+LDPEYFLT  LTDKSDVYSLGVVFLELLTG  PI H
Sbjct  763  APVPDIEGNVPAHVSTVVKGTPGYLDPEYFLTRNLTDKSDVYSLGVVFLELLTGRPPIFH  822

Query  148  GKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            G+NI+R+VN+AY SG I  V+D+R+ SYP E   +F+TLALKCC+D  D
Sbjct  823  GENIIRQVNMAYQSGGISLVVDKRIESYPFEYAVRFLTLALKCCKDLPD  871



>gb|AES79863.2| LRR receptor-like kinase [Medicago truncatula]
Length=962

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K K+ L+F +RLR+A+G++KGILYLHTEA+PPI+HRDIKASNILLD KFTAKVADFGLSR
Sbjct  712  KCKEGLSFFMRLRIAMGASKGILYLHTEANPPIYHRDIKASNILLDLKFTAKVADFGLSR  771

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            L P  D EG VP +VSTVVKGTPG+LDPEY +THKLTDKSDVYSLG+VFLELLTGMHPIS
Sbjct  772  LIPYSDEEGTVPKYVSTVVKGTPGYLDPEYMMTHKLTDKSDVYSLGIVFLELLTGMHPIS  831

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
             GKNIVREVN+A  +G I S+ID+RMG YPSEC++KF+ LAL CC D
Sbjct  832  RGKNIVREVNLACQAGLIDSIIDDRMGEYPSECLDKFLALALSCCHD  878



>ref|XP_007206541.1| hypothetical protein PRUPE_ppa018820mg [Prunus persica]
 gb|EMJ07740.1| hypothetical protein PRUPE_ppa018820mg [Prunus persica]
Length=931

 Score =   271 bits (692),  Expect = 2e-81, Method: Composition-based stats.
 Identities = 125/171 (73%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -3

Query  514  VKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLS  335
            VK+K  L+F +RL++ALGSAKGILYLH EA+PPIFHRDIKA+NILLD+   AKVADFGLS
Sbjct  690  VKAKGSLSFGMRLQIALGSAKGILYLHNEANPPIFHRDIKATNILLDSNLMAKVADFGLS  749

Query  334  RLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI  155
            RLAP+ D EG  P++VST V+GTPG+LDPEYFLT KLTDKSDVYSLG+VFLELLT + PI
Sbjct  750  RLAPLQDDEGTGPSYVSTAVRGTPGYLDPEYFLTSKLTDKSDVYSLGIVFLELLTSVLPI  809

Query  154  SHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            SHGKNIVREVN+A+ +G +FS+ID RMGSYPSECVE+F+ LAL+CC +  D
Sbjct  810  SHGKNIVREVNLAHQAGLMFSIIDSRMGSYPSECVERFLALALRCCYEKQD  860



>gb|EMT31232.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=918

 Score =   270 bits (691),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 145/172 (84%), Gaps = 4/172 (2%)
 Frame = -3

Query  505  KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLA  326
            K PL FA RL +ALG+AKGILYLHTEADPPIFHRD+KA+NILLD+KF AKVADFGLSRLA
Sbjct  673  KRPLNFAQRLHIALGAAKGILYLHTEADPPIFHRDVKATNILLDSKFVAKVADFGLSRLA  732

Query  325  PVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHG  146
            PVPD+EG++PAH+STVVKGTPG+LDPEYFLTHKLT+KSDVYSLGVV LELLTGM PI  G
Sbjct  733  PVPDIEGKLPAHISTVVKGTPGYLDPEYFLTHKLTEKSDVYSLGVVLLELLTGMKPIQFG  792

Query  145  KNIVRE----VNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            KNIVRE    VN AY SG I  +ID RM   P E   +F++L LKCCQDDTD
Sbjct  793  KNIVREVTNRVNTAYRSGDISGIIDSRMSWCPPEFATRFLSLGLKCCQDDTD  844



>emb|CDM84748.1| unnamed protein product [Triticum aestivum]
Length=682

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -3

Query  505  KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLA  326
            K PL FA RL VALG+AKGILYLHTEADPPIFHRD+K +NILLD+KF AKVADFGLS+LA
Sbjct  436  KRPLNFAKRLNVALGAAKGILYLHTEADPPIFHRDVKTTNILLDSKFVAKVADFGLSKLA  495

Query  325  PVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHG  146
            P+PDLEG +P H+STVVKGTPG+LDPEYFLT+KLT+KSDVYSLGVV LELLTGM PI  G
Sbjct  496  PIPDLEGTLPEHISTVVKGTPGYLDPEYFLTNKLTEKSDVYSLGVVLLELLTGMKPIQFG  555

Query  145  KNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            KNIVREV  AY SG I  +ID RM   P E   +F++LALKCCQDDTD
Sbjct  556  KNIVREVKAAYQSGDISRIIDSRMFWCPPEFATRFLSLALKCCQDDTD  603



>ref|XP_011001647.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g37450 [Populus euphratica]
Length=950

 Score =   267 bits (683),  Expect = 5e-80, Method: Composition-based stats.
 Identities = 123/168 (73%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K K P +F++R+ +ALGSAKGILYLHTEA+PPI HRDIKA+NILLD KFTAKV+DFG+S+
Sbjct  712  KFKRPASFSMRMNIALGSAKGILYLHTEAEPPIIHRDIKANNILLDFKFTAKVSDFGISK  771

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG   +H+ST+VKGTPG+LDPEYFLT+KLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  772  LAPVQDCEGGA-SHISTIVKGTPGYLDPEYFLTNKLTDKSDVYSLGVVFLELLTGMEPIS  830

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDD  8
            HGK IVRE+N A  SG +FS++D++MG YPS+CV+KF+ LALKCC D+
Sbjct  831  HGKYIVREINAACQSGIMFSIVDQKMGPYPSDCVKKFMALALKCCHDE  878



>ref|XP_010067119.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g37450 [Eucalyptus grandis]
Length=799

 Score =   265 bits (677),  Expect = 6e-80, Method: Composition-based stats.
 Identities = 123/167 (74%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = -3

Query  505  KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLA  326
            + PL+FA+RL +ALGSAKGILYLHTEADPPI HRDIKA+NILLD++  AKVADFG+SRLA
Sbjct  560  RSPLSFAVRLSIALGSAKGILYLHTEADPPIIHRDIKANNILLDSRLNAKVADFGISRLA  619

Query  325  PVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHG  146
            P P+ +G V AH+ST VKGTPG+LDP YFLTHKLT+KSDVYSLG+VFLELLT M PISHG
Sbjct  620  PSPNTDGFVTAHISTNVKGTPGYLDPAYFLTHKLTEKSDVYSLGIVFLELLTRMPPISHG  679

Query  145  KNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            +NIVREV  A  SG++FS+ID  MG YPSEC++KF+ LALKCC D T
Sbjct  680  RNIVREVLQACQSGSMFSIIDRSMGPYPSECIKKFMALALKCCDDQT  726



>ref|XP_008244509.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Prunus mume]
Length=939

 Score =   267 bits (682),  Expect = 7e-80, Method: Composition-based stats.
 Identities = 124/171 (73%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -3

Query  514  VKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLS  335
            VK+K  L+F  RL++ALGSAKGILYLH EA+PP+FHRDIKA+NILLD+   AKVADFGLS
Sbjct  713  VKAKGSLSFGTRLQIALGSAKGILYLHNEANPPVFHRDIKATNILLDSNLMAKVADFGLS  772

Query  334  RLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI  155
            RLAP+ D EG  P++VST V+GTPG+LDPEYFLT KLTDKSDVYSLG+VFLELLTG  PI
Sbjct  773  RLAPLQDDEGTGPSYVSTAVRGTPGYLDPEYFLTSKLTDKSDVYSLGIVFLELLTGALPI  832

Query  154  SHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            SHGK IVREVN+A  +G +FS+ID RMGSYPSECVE+F+ LAL+CC +  D
Sbjct  833  SHGKYIVREVNLARQAGLMFSIIDSRMGSYPSECVERFLALALRCCCEKQD  883



>gb|KCW88415.1| hypothetical protein EUGRSUZ_A00802 [Eucalyptus grandis]
Length=933

 Score =   266 bits (681),  Expect = 7e-80, Method: Composition-based stats.
 Identities = 124/167 (74%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -3

Query  505  KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLA  326
            + PL+FA+RL +ALGSAKGILYLHTEADPPI HRDIKA+NILLD++  AKVADFG+SRLA
Sbjct  694  RSPLSFAVRLSIALGSAKGILYLHTEADPPIIHRDIKANNILLDSRLNAKVADFGISRLA  753

Query  325  PVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHG  146
            P P+ +G V AH+ST VKGTPG+LDPEYFLTHKLT+KSDVYSLG+VFLELLT M PISHG
Sbjct  754  PSPNTDGFVTAHISTNVKGTPGYLDPEYFLTHKLTEKSDVYSLGIVFLELLTRMPPISHG  813

Query  145  KNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            +NIVREV  A  SG++FS+ID  MG YPSEC++KF+ LALKCC D T
Sbjct  814  RNIVREVLQACQSGSMFSIIDRSMGPYPSECIKKFMALALKCCDDQT  860



>gb|EMT31233.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=882

 Score =   266 bits (679),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -3

Query  505  KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLA  326
            K PL F+ RL VALG+AKGILYLHTEADPPIFHRD+K +NILLD+KF AKVADFGLS+LA
Sbjct  636  KRPLNFSQRLNVALGAAKGILYLHTEADPPIFHRDVKTTNILLDSKFAAKVADFGLSKLA  695

Query  325  PVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHG  146
            P+PD+EG +P H+STVVKGTPG+LDPEYFLT+KLT+KSDVYSLGVV LELLTGM PI  G
Sbjct  696  PIPDVEGTLPEHISTVVKGTPGYLDPEYFLTNKLTEKSDVYSLGVVLLELLTGMKPIQFG  755

Query  145  KNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            KNIVREV  AY SG I  +ID RM   P E   +F++LALKCCQ DTD
Sbjct  756  KNIVREVKAAYQSGAISRIIDSRMSWCPPELATRFLSLALKCCQGDTD  803



>ref|XP_002323095.2| hypothetical protein POPTR_0016s14690g [Populus trichocarpa]
 gb|EEF04856.2| hypothetical protein POPTR_0016s14690g [Populus trichocarpa]
Length=824

 Score =   265 bits (676),  Expect = 9e-80, Method: Composition-based stats.
 Identities = 124/168 (74%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K K P +F++R+ +ALGSAKGILYLHTEA+PPI HRDIKA+NILLD KFTAKV+DFG+S+
Sbjct  586  KFKRPASFSMRMNIALGSAKGILYLHTEAEPPIIHRDIKANNILLDFKFTAKVSDFGISK  645

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAPV D EG   +H+ST+VKGTPG+LDPEYFLT+KLTDKSDVYSLGVVFLELLTGM PIS
Sbjct  646  LAPVQDCEGGA-SHISTIVKGTPGYLDPEYFLTNKLTDKSDVYSLGVVFLELLTGMEPIS  704

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDD  8
            HGK IVREVN A  SG +FS++D++MG YPS+CV+KF+ LALKCC D+
Sbjct  705  HGKYIVREVNAACQSGIMFSIVDQKMGPYPSDCVKKFMALALKCCHDE  752



>ref|XP_008388895.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Malus domestica]
Length=941

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -3

Query  514  VKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLS  335
            VK+K  L F +RLR+ALGSAKGILYLHTEA+PPIFHRDIKASNILLD+   AKVADFGLS
Sbjct  699  VKAKGSLDFTMRLRIALGSAKGILYLHTEANPPIFHRDIKASNILLDSNLVAKVADFGLS  758

Query  334  RLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI  155
            R AP  D EG   ++VSTVV GTPG+ DPEYFLT+KLTDKSDVYSLG+VFLELLTG  PI
Sbjct  759  RXAPPQDDEGTGSSYVSTVVXGTPGYXDPEYFLTNKLTDKSDVYSLGIVFLELLTGXQPI  818

Query  154  SHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            SHGKNIVREVN+AY +G +FS+ID+RM SYPS+CVE+F+ LAL+CC +  D
Sbjct  819  SHGKNIVREVNLAYQAGLVFSIIDKRMXSYPSKCVERFLDLALRCCNEKPD  869



>ref|XP_011001639.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X1 [Populus euphratica]
Length=961

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -3

Query  505  KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLA  326
            K+ L+F  RL +ALGSAKGILYLHTEADPP+FHRDIKASNILLD+K TAKVADFGLS LA
Sbjct  715  KEKLSFGTRLSIALGSAKGILYLHTEADPPVFHRDIKASNILLDSKLTAKVADFGLSLLA  774

Query  325  PVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHG  146
            PV D +G  P HVSTVVKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLELLTGM PI  G
Sbjct  775  PVMDDDGYQPNHVSTVVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLELLTGMQPIYRG  834

Query  145  KNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            KN+VREVN+A  S  +FS+ID RM SYPS+C+E+F+ LAL CC D+ D
Sbjct  835  KNLVREVNIACESDKMFSIIDRRMVSYPSKCIERFVPLALNCCHDEQD  882



>ref|XP_011001640.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X2 [Populus euphratica]
Length=958

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -3

Query  505  KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLA  326
            K+ L+F  RL +ALGSAKGILYLHTEADPP+FHRDIKASNILLD+K TAKVADFGLS LA
Sbjct  712  KEKLSFGTRLSIALGSAKGILYLHTEADPPVFHRDIKASNILLDSKLTAKVADFGLSLLA  771

Query  325  PVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHG  146
            PV D +G  P HVSTVVKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLELLTGM PI  G
Sbjct  772  PVMDDDGYQPNHVSTVVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLELLTGMQPIYRG  831

Query  145  KNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            KN+VREVN+A  S  +FS+ID RM SYPS+C+E+F+ LAL CC D+ D
Sbjct  832  KNLVREVNIACESDKMFSIIDRRMVSYPSKCIERFVPLALNCCHDEQD  879



>ref|XP_002987562.1| hypothetical protein SELMODRAFT_10265, partial [Selaginella moellendorffii]
 gb|EFJ11398.1| hypothetical protein SELMODRAFT_10265, partial [Selaginella moellendorffii]
Length=870

 Score =   265 bits (676),  Expect = 2e-79, Method: Composition-based stats.
 Identities = 121/168 (72%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -3

Query  505  KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLA  326
            K PL FA RLR+ALGSA+GILYLHTEA+PPIFHRDIKASNILLD K   KVADFGLSRLA
Sbjct  678  KLPLDFATRLRIALGSARGILYLHTEANPPIFHRDIKASNILLDGKNIPKVADFGLSRLA  737

Query  325  PVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHG  146
            P PDL+G  P HVSTVVKGTPG+LDPEYFLT KLTDKSDVYS GVV +EL+TGMHPIS G
Sbjct  738  PSPDLDGVTPGHVSTVVKGTPGYLDPEYFLTRKLTDKSDVYSFGVVLMELVTGMHPISQG  797

Query  145  KNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            KN+VREV   Y +G + S++D+RMGSYPSE +E  + LAL C +++ +
Sbjct  798  KNLVREVTATYQAGMVLSIVDQRMGSYPSEGLEPMLRLALSCVKENPN  845



>ref|XP_007142006.1| hypothetical protein PHAVU_008G244600g, partial [Phaseolus vulgaris]
 gb|ESW14000.1| hypothetical protein PHAVU_008G244600g, partial [Phaseolus vulgaris]
Length=439

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -3

Query  508  SKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRL  329
            SKD L F+LRL++AL SAKG++YLHTEA+ PIFHR++KASNILLD+++T KVADFGLSRL
Sbjct  217  SKDVLRFSLRLKMALESAKGLVYLHTEANRPIFHRNVKASNILLDSRYTEKVADFGLSRL  276

Query  328  APVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISH  149
            APVPD+EG VPAHVSTVVKGTPG+LDPEYFLT  LT KSDVYSLGVVFLELLTG  PI H
Sbjct  277  APVPDIEGNVPAHVSTVVKGTPGYLDPEYFLTRNLTHKSDVYSLGVVFLELLTGRPPIFH  336

Query  148  GKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            G+NI+R+VN+ Y SG I  V+D+R+ SYP E   +F+TLALKCC+D  D
Sbjct  337  GENIIRQVNMVYQSGGISLVVDKRIESYPFEYAVRFLTLALKCCKDLPD  385



>ref|XP_011001641.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 isoform X3 [Populus euphratica]
Length=932

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -3

Query  505  KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLA  326
            K+ L+F  RL +ALGSAKGILYLHTEADPP+FHRDIKASNILLD+K TAKVADFGLS LA
Sbjct  686  KEKLSFGTRLSIALGSAKGILYLHTEADPPVFHRDIKASNILLDSKLTAKVADFGLSLLA  745

Query  325  PVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHG  146
            PV D +G  P HVSTVVKGTPG+LDPEYFLT KLTDKSDVYSLGVVFLELLTGM PI  G
Sbjct  746  PVMDDDGYQPNHVSTVVKGTPGYLDPEYFLTRKLTDKSDVYSLGVVFLELLTGMQPIYRG  805

Query  145  KNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            KN+VREVN+A  S  +FS+ID RM SYPS+C+E+F+ LAL CC D+ D
Sbjct  806  KNLVREVNIACESDKMFSIIDRRMVSYPSKCIERFVPLALNCCHDEQD  853



>ref|XP_010043804.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Eucalyptus grandis]
Length=979

 Score =   265 bits (678),  Expect = 3e-79, Method: Composition-based stats.
 Identities = 124/167 (74%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -3

Query  505  KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLA  326
            + PL+FA+RL +ALGSAKGILYLHTEADPPI HRDIKA+NILLD++  AKVADFG+SRLA
Sbjct  740  RSPLSFAVRLSIALGSAKGILYLHTEADPPIIHRDIKANNILLDSRLNAKVADFGISRLA  799

Query  325  PVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHG  146
            P P+ +G V AH+ST VKGTPG+LDPEYFLTHKLT+KSDVYSLG+VFLELLT M PISHG
Sbjct  800  PSPNTDGFVTAHISTNVKGTPGYLDPEYFLTHKLTEKSDVYSLGIVFLELLTRMPPISHG  859

Query  145  KNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDT  5
            +NIVREV  A  SG++FS+ID  MG YPSEC++KF+ LALKCC D T
Sbjct  860  RNIVREVLQACQSGSMFSIIDRSMGPYPSECIKKFMALALKCCDDQT  906



>ref|XP_010553166.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553168.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553169.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553170.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553171.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553172.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553173.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553174.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
 ref|XP_010553175.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Tarenaya hassleriana]
Length=948

 Score =   265 bits (676),  Expect = 4e-79, Method: Composition-based stats.
 Identities = 122/169 (72%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K+K+ L+F  RL +ALG+A+G+LYLHTEADPP+FHRD+KASNIL+DAK  AKVADFGL
Sbjct  712  SAKAKETLSFGARLSIALGAARGLLYLHTEADPPVFHRDVKASNILIDAKLNAKVADFGL  771

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV + E +VP HVSTVV+GTPG LDPEYFLTHKLTDKSDVYSLGVVF+ELLTGMH 
Sbjct  772  SRLAPVLEDEEDVPKHVSTVVRGTPGDLDPEYFLTHKLTDKSDVYSLGVVFMELLTGMHA  831

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
            I+HGKNIVREV  A+ +G I S +D+RMG+   ECVEKF  LAL+CC D
Sbjct  832  ITHGKNIVREVKAAHQTGRIVSWVDKRMGTCSLECVEKFAALALRCCHD  880



>gb|AES77893.2| LRR receptor-like kinase [Medicago truncatula]
Length=963

 Score =   265 bits (676),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K  D L+F +RLR+A+ +AKGILYLHTEA+PP++HRDIKA+NILLD+KFTAKVADFGLSR
Sbjct  713  KCNDGLSFFMRLRIAMDAAKGILYLHTEANPPVYHRDIKATNILLDSKFTAKVADFGLSR  772

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAP  D EG VP ++STVVKGTPG+LDPEY +TH LTDKSDVYSLG+VFLELLTGMH I+
Sbjct  773  LAPYSDEEGNVPKYISTVVKGTPGYLDPEYMMTHMLTDKSDVYSLGIVFLELLTGMHAIT  832

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
             GKNIVREVN+A  SG + S+ID RMG YPSEC +KF+ LAL CC D
Sbjct  833  RGKNIVREVNLACRSGIMDSIIDNRMGEYPSECTDKFLALALSCCHD  879



>ref|XP_003621675.1| Receptor protein kinase-like protein [Medicago truncatula]
Length=988

 Score =   265 bits (676),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = -3

Query  511  KSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSR  332
            K  D L+F +RLR+A+ +AKGILYLHTEA+PP++HRDIKA+NILLD+KFTAKVADFGLSR
Sbjct  738  KCNDGLSFFMRLRIAMDAAKGILYLHTEANPPVYHRDIKATNILLDSKFTAKVADFGLSR  797

Query  331  LAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPIS  152
            LAP  D EG VP ++STVVKGTPG+LDPEY +TH LTDKSDVYSLG+VFLELLTGMH I+
Sbjct  798  LAPYSDEEGNVPKYISTVVKGTPGYLDPEYMMTHMLTDKSDVYSLGIVFLELLTGMHAIT  857

Query  151  HGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQD  11
             GKNIVREVN+A  SG + S+ID RMG YPSEC +KF+ LAL CC D
Sbjct  858  RGKNIVREVNLACRSGIMDSIIDNRMGEYPSECTDKFLALALSCCHD  904



>ref|XP_002992827.1| hypothetical protein SELMODRAFT_136038, partial [Selaginella 
moellendorffii]
 gb|EFJ06117.1| hypothetical protein SELMODRAFT_136038, partial [Selaginella 
moellendorffii]
Length=926

 Score =   263 bits (673),  Expect = 1e-78, Method: Composition-based stats.
 Identities = 121/168 (72%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -3

Query  505  KDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLSRLA  326
            K PL FA RLR+ALGSA+GILYLHTEA+PPIFHRDIKASNILLD K   KVADFGLSRLA
Sbjct  685  KLPLDFATRLRIALGSARGILYLHTEANPPIFHRDIKASNILLDGKNIPKVADFGLSRLA  744

Query  325  PVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPISHG  146
            P PDL+G  P HVSTVVKGTPG+LDPEYFLT KLTDKSDVYS GVV +EL+TGMHPIS G
Sbjct  745  PSPDLDGVTPGHVSTVVKGTPGYLDPEYFLTRKLTDKSDVYSFGVVLMELVTGMHPISQG  804

Query  145  KNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            KN+VREV   Y +G + S++D+RMGSYPSE +E  + LAL C +++ +
Sbjct  805  KNLVREVTATYQAGMVLSIVDQRMGSYPSEGLEPMLRLALNCVKENPN  852



>ref|XP_007208638.1| hypothetical protein PRUPE_ppa020089mg [Prunus persica]
 gb|EMJ09837.1| hypothetical protein PRUPE_ppa020089mg [Prunus persica]
Length=934

 Score =   263 bits (672),  Expect = 1e-78, Method: Composition-based stats.
 Identities = 121/171 (71%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -3

Query  514  VKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGLS  335
            VK+K  L+F +RL++ALGSAKGILYLH EA+PP+FHRDIKA+NILLD+   AKVADFGLS
Sbjct  690  VKAKGSLSFGMRLQIALGSAKGILYLHNEANPPVFHRDIKATNILLDSNLMAKVADFGLS  749

Query  334  RLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHPI  155
            RLAP+ D  G  P++VST V+GTPG+LDPEYFLT KLTDKSDVYSLG+VFLELLTG+ PI
Sbjct  750  RLAPLQDDAGTGPSYVSTAVRGTPGYLDPEYFLTSKLTDKSDVYSLGIVFLELLTGVLPI  809

Query  154  SHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            SHGK IVREV +A+ +G +FS+ID RMGSYPSECV++F+ LAL+CC +  D
Sbjct  810  SHGKYIVREVKLAHQAGLMFSIIDSRMGSYPSECVQRFLALALRCCYEKQD  860



>ref|XP_011095176.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g06840 [Sesamum indicum]
Length=977

 Score =   263 bits (671),  Expect = 3e-78, Method: Composition-based stats.
 Identities = 125/172 (73%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  517  TVKSKDPLTFALRLRVALGSAKGILYLHTEADPPIFHRDIKASNILLDAKFTAKVADFGL  338
            + K   PL FA RL VALG+A+GILYLHTEADPPI HRDIKA+NILLD+K+TAKV+DFG+
Sbjct  734  SAKYTGPLNFATRLHVALGAARGILYLHTEADPPIIHRDIKANNILLDSKWTAKVSDFGI  793

Query  337  SRLAPVPDLEGEVPAHVSTVVKGTPGHLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMHP  158
            SRLAPV D +G   AHVST VKGTPG++DPEYFLTHKLT+KSDVYSLG+VFLELLTGM P
Sbjct  794  SRLAPVSDAKGVATAHVSTNVKGTPGYVDPEYFLTHKLTEKSDVYSLGIVFLELLTGMQP  853

Query  157  ISHGKNIVREVNVAYSSGTIFSVIDERMGSYPSECVEKFITLALKCCQDDTD  2
            ISHGKNIVREVN A  SG +FS+ID  MG YPS+ V+KF+ LAL+C  D+T+
Sbjct  854  ISHGKNIVREVNTACQSGMMFSIIDRSMGVYPSDSVKKFMALALRCSLDETN  905



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985