BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP001E11 616 bp,:Filtered

Length=557
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003596211.1|  Ubiquitin carboxyl-terminal hydrolase              150   3e-38   
ref|XP_007022154.1|  Ubiquitin-specific protease 15, putative iso...    147   2e-37   Theobroma cacao [chocolate]
ref|XP_007022155.1|  Ubiquitin-specific protease 15, putative iso...    147   3e-37   Theobroma cacao [chocolate]
ref|XP_007022153.1|  Ubiquitin-specific protease 15, putative iso...    147   3e-37   Theobroma cacao [chocolate]
ref|XP_007149328.1|  hypothetical protein PHAVU_005G061400g             147   4e-37   Phaseolus vulgaris [French bean]
emb|CDP06086.1|  unnamed protein product                                146   7e-37   Coffea canephora [robusta coffee]
ref|XP_011077821.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   9e-37   Sesamum indicum [beniseed]
gb|AES66462.2|  ubiquitin carboxy-terminal hydrolase                    145   2e-36   Medicago truncatula
ref|XP_006598161.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-36   Glycine max [soybeans]
ref|XP_006598163.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   3e-36   Glycine max [soybeans]
gb|KHN29845.1|  Ubiquitin carboxyl-terminal hydrolase 15                144   4e-36   Glycine soja [wild soybean]
ref|XP_003541793.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   4e-36   Glycine max [soybeans]
gb|KHN47474.1|  Ubiquitin carboxyl-terminal hydrolase 15                144   4e-36   Glycine soja [wild soybean]
ref|XP_006594689.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   4e-36   Glycine max [soybeans]
ref|XP_010092717.1|  Ubiquitin carboxyl-terminal hydrolase 15           144   4e-36   Morus notabilis
gb|KHG25224.1|  Ubiquitin carboxyl-terminal hydrolase 15 -like pr...    144   6e-36   Gossypium arboreum [tree cotton]
gb|EYU28912.1|  hypothetical protein MIMGU_mgv1a001776mg                142   8e-36   Erythranthe guttata [common monkey flower]
ref|XP_010324419.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   1e-35   Solanum lycopersicum
ref|XP_009609977.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   1e-35   Nicotiana tomentosiformis
ref|XP_006348364.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   1e-35   
ref|XP_004244319.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   1e-35   Solanum lycopersicum
gb|KJB12847.1|  hypothetical protein B456_002G039300                    143   1e-35   Gossypium raimondii
gb|KJB12846.1|  hypothetical protein B456_002G039300                    143   1e-35   Gossypium raimondii
gb|KJB45883.1|  hypothetical protein B456_007G335200                    142   2e-35   Gossypium raimondii
gb|KJB45884.1|  hypothetical protein B456_007G335200                    142   2e-35   Gossypium raimondii
ref|XP_011044935.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   2e-35   Populus euphratica
ref|XP_010694568.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-35   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|KHF97895.1|  Ubiquitin carboxyl-terminal hydrolase 15 -like pr...    142   3e-35   Gossypium arboreum [tree cotton]
ref|XP_010539169.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   3e-35   Tarenaya hassleriana [spider flower]
ref|XP_011465542.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   3e-35   Fragaria vesca subsp. vesca
ref|XP_011465545.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   3e-35   Fragaria vesca subsp. vesca
ref|XP_011465544.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   3e-35   Fragaria vesca subsp. vesca
ref|XP_009776208.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   4e-35   Nicotiana sylvestris
ref|XP_011044931.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-35   Populus euphratica
ref|XP_011044933.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-35   Populus euphratica
ref|XP_011044934.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   5e-35   Populus euphratica
ref|XP_002317364.2|  UBIQUITIN-SPECIFIC PROTEASE 15 family protein      141   5e-35   Populus trichocarpa [western balsam poplar]
ref|XP_010644793.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   6e-35   Vitis vinifera
ref|XP_011045595.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   7e-35   Populus euphratica
emb|CAN68406.1|  hypothetical protein VITISV_035043                     140   8e-35   Vitis vinifera
ref|XP_011045594.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   9e-35   Populus euphratica
emb|CBI33027.3|  unnamed protein product                                140   1e-34   Vitis vinifera
ref|XP_010540128.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_002298917.2|  hypothetical protein POPTR_0001s38800g             138   2e-34   Populus trichocarpa [western balsam poplar]
emb|CDX96790.1|  BnaA08g23330D                                          139   2e-34   Brassica napus [oilseed rape]
ref|XP_004488653.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   2e-34   Cicer arietinum [garbanzo]
emb|CDX83925.1|  BnaC08g17200D                                          139   2e-34   Brassica napus [oilseed rape]
ref|XP_010476847.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010459276.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010498051.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010476845.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010459274.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006306123.1|  hypothetical protein CARUB_v10011568mg             139   2e-34   Capsella rubella
emb|CDY48465.1|  BnaC05g13250D                                          139   2e-34   Brassica napus [oilseed rape]
ref|XP_009149147.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   2e-34   Brassica rapa
emb|CDY65125.1|  BnaA06g38410D                                          139   2e-34   Brassica napus [oilseed rape]
ref|XP_006477933.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   2e-34   Citrus sinensis [Valencia orange]
ref|XP_006477929.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   2e-34   Citrus sinensis [Valencia orange]
ref|XP_006442255.1|  hypothetical protein CICLE_v10018666mg             139   2e-34   Citrus clementina
ref|XP_009110426.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   3e-34   Brassica rapa
ref|XP_006416743.1|  hypothetical protein EUTSA_v10006749mg             139   3e-34   Eutrema salsugineum
gb|KDO45638.1|  hypothetical protein CISIN_1g0014791mg                  138   5e-34   Citrus sinensis [Valencia orange]
gb|AAD50020.1|AC007651_15  Unknown protein                              137   7e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KDO45637.1|  hypothetical protein CISIN_1g0014791mg                  137   8e-34   Citrus sinensis [Valencia orange]
gb|AAG42756.1|AF302665_1  ubiquitin-specific protease 15                137   8e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564014.1|  ubiquitin carboxyl-terminal hydrolase 15              137   8e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892935.1|  ubiquitin-specific protease 15                     137   8e-34   Arabidopsis lyrata subsp. lyrata
ref|NP_001185019.1|  ubiquitin carboxyl-terminal hydrolase 15           137   8e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002530131.1|  conserved hypothetical protein                     137   9e-34   
ref|XP_010279646.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    137   1e-33   Nelumbo nucifera [Indian lotus]
ref|XP_008781931.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    137   1e-33   Phoenix dactylifera
ref|XP_008782751.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    136   1e-33   Phoenix dactylifera
ref|XP_006477932.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    137   1e-33   Citrus sinensis [Valencia orange]
ref|XP_008226232.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    137   2e-33   Prunus mume [ume]
ref|XP_008226235.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    137   2e-33   Prunus mume [ume]
ref|XP_007211338.1|  hypothetical protein PRUPE_ppa000901mg             137   2e-33   Prunus persica
ref|XP_008782673.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    136   2e-33   
gb|AFW65941.1|  putative ubiquitin carboxyl-terminal hydrolase su...    125   3e-33   Zea mays [maize]
ref|XP_010062748.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    136   3e-33   Eucalyptus grandis [rose gum]
ref|XP_010062747.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    136   3e-33   Eucalyptus grandis [rose gum]
ref|XP_010062746.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    136   3e-33   Eucalyptus grandis [rose gum]
ref|XP_010062745.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    136   3e-33   Eucalyptus grandis [rose gum]
ref|XP_010062743.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    136   3e-33   Eucalyptus grandis [rose gum]
ref|XP_008382966.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    136   3e-33   Malus domestica [apple tree]
ref|XP_009354862.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    136   4e-33   Pyrus x bretschneideri [bai li]
ref|XP_009354860.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    135   4e-33   Pyrus x bretschneideri [bai li]
ref|XP_008382965.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    135   5e-33   Malus domestica [apple tree]
ref|XP_009367759.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    135   5e-33   Pyrus x bretschneideri [bai li]
ref|XP_009354861.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    135   6e-33   Pyrus x bretschneideri [bai li]
ref|XP_009354859.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    135   6e-33   Pyrus x bretschneideri [bai li]
ref|XP_008356195.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    135   6e-33   Malus domestica [apple tree]
ref|XP_009354863.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    135   6e-33   Pyrus x bretschneideri [bai li]
ref|XP_008356196.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    135   6e-33   
ref|XP_009367758.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    135   7e-33   Pyrus x bretschneideri [bai li]
ref|XP_008356197.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    135   7e-33   
ref|XP_010915558.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    135   7e-33   Elaeis guineensis
ref|XP_008783949.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    134   2e-32   Phoenix dactylifera
ref|XP_010925671.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    134   2e-32   Elaeis guineensis
ref|XP_009390669.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    133   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010274759.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    133   3e-32   Nelumbo nucifera [Indian lotus]
ref|XP_006840775.1|  hypothetical protein AMTR_s00096p00170210          130   1e-31   
gb|AFW71122.1|  putative ubiquitin carboxyl-terminal hydrolase su...    129   8e-31   Zea mays [maize]
ref|XP_010234088.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    129   8e-31   Brachypodium distachyon [annual false brome]
ref|XP_003571975.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    129   9e-31   Brachypodium distachyon [annual false brome]
gb|AFW71123.1|  putative ubiquitin carboxyl-terminal hydrolase su...    129   1e-30   Zea mays [maize]
ref|XP_008645575.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    128   2e-30   Zea mays [maize]
ref|XP_002453597.1|  hypothetical protein SORBIDRAFT_04g008750          128   2e-30   Sorghum bicolor [broomcorn]
ref|XP_008679796.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    128   2e-30   Zea mays [maize]
ref|XP_006647115.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    127   4e-30   Oryza brachyantha
dbj|BAJ87234.1|  predicted protein                                      127   4e-30   Hordeum vulgare subsp. vulgare [barley]
gb|EEE56641.1|  hypothetical protein OsJ_06049                          127   4e-30   Oryza sativa Japonica Group [Japonica rice]
gb|AFW65940.1|  putative ubiquitin carboxyl-terminal hydrolase su...    124   6e-30   Zea mays [maize]
gb|EMS59305.1|  Ubiquitin carboxyl-terminal hydrolase 15                127   6e-30   Triticum urartu
gb|EEC72815.1|  hypothetical protein OsI_06524                          126   7e-30   Oryza sativa Indica Group [Indian rice]
ref|NP_001046415.1|  Os02g0244300                                       126   8e-30   
dbj|BAD28270.1|  putative ubiquitin-specific protease                   126   1e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004951331.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    126   1e-29   
gb|EMT09965.1|  Ubiquitin carboxyl-terminal hydrolase 15                124   2e-29   Aegilops tauschii
ref|XP_006841208.1|  hypothetical protein AMTR_s00135p00021060          113   4e-25   Amborella trichopoda
ref|XP_002970813.1|  hypothetical protein SELMODRAFT_171601             108   2e-24   Selaginella moellendorffii
ref|XP_003613074.1|  Ubiquitin carboxyl-terminal hydrolase              110   3e-24   
emb|CBI19252.3|  unnamed protein product                                110   3e-24   Vitis vinifera
ref|XP_010916668.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    110   5e-24   Elaeis guineensis
ref|XP_010664385.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    110   5e-24   Vitis vinifera
ref|XP_010664383.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    110   5e-24   Vitis vinifera
gb|KJB64168.1|  hypothetical protein B456_010G035400                    109   5e-24   Gossypium raimondii
ref|XP_007158378.1|  hypothetical protein PHAVU_002G148100g             109   7e-24   Phaseolus vulgaris [French bean]
ref|XP_002969545.1|  hypothetical protein SELMODRAFT_91996              106   8e-24   Selaginella moellendorffii
ref|XP_002514028.1|  conserved hypothetical protein                     109   9e-24   
ref|XP_001772702.1|  predicted protein                                  105   1e-23   Physcomitrella patens
ref|XP_008795170.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   1e-23   Phoenix dactylifera
ref|XP_008795169.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   1e-23   Phoenix dactylifera
ref|XP_008802270.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   2e-23   Phoenix dactylifera
ref|XP_009387155.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010916667.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   2e-23   Elaeis guineensis
gb|KHN14516.1|  Ubiquitin carboxyl-terminal hydrolase 17                108   2e-23   Glycine soja [wild soybean]
ref|XP_010939750.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   2e-23   Elaeis guineensis
ref|XP_001774704.1|  predicted protein                                  105   2e-23   Physcomitrella patens
ref|XP_010277575.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    107   2e-23   Nelumbo nucifera [Indian lotus]
ref|XP_011013097.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   2e-23   Populus euphratica
ref|XP_011013096.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   2e-23   Populus euphratica
ref|XP_011016915.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   2e-23   Populus euphratica
ref|XP_011016914.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    108   2e-23   Populus euphratica
ref|XP_002301091.2|  UBIQUITIN-SPECIFIC PROTEASE 16 family protein      108   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_002307344.2|  hypothetical protein POPTR_0005s17820g             107   3e-23   Populus trichocarpa [western balsam poplar]
gb|AES96032.2|  ubiquitin carboxy-terminal hydrolase                    107   3e-23   Medicago truncatula
gb|KHG13290.1|  Ubiquitin carboxyl-terminal hydrolase 16 -like pr...    107   3e-23   Gossypium arboreum [tree cotton]
gb|KDP41469.1|  hypothetical protein JCGZ_15876                         107   5e-23   Jatropha curcas
ref|XP_008795168.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    107   6e-23   Phoenix dactylifera
ref|XP_008795167.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    107   6e-23   Phoenix dactylifera
ref|XP_009761470.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    106   7e-23   Nicotiana sylvestris
emb|CDP11495.1|  unnamed protein product                                106   7e-23   Coffea canephora [robusta coffee]
ref|XP_004489806.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    106   7e-23   
ref|XP_004301361.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    106   8e-23   Fragaria vesca subsp. vesca
ref|XP_007018207.1|  Ubiquitin-specific protease 16, putative iso...    106   9e-23   Theobroma cacao [chocolate]
ref|XP_007018208.1|  Ubiquitin-specific protease 16, putative iso...    106   9e-23   Theobroma cacao [chocolate]
ref|XP_010525922.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    105   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_007137649.1|  hypothetical protein PHAVU_009G144200g             105   1e-22   Phaseolus vulgaris [French bean]
ref|XP_010942663.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    105   1e-22   Elaeis guineensis
gb|KDO81148.1|  hypothetical protein CISIN_1g0011341mg                  102   2e-22   Citrus sinensis [Valencia orange]
ref|XP_006472486.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    105   2e-22   Citrus sinensis [Valencia orange]
ref|XP_008219286.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    105   2e-22   Prunus mume [ume]
ref|XP_007225419.1|  hypothetical protein PRUPE_ppa000527mg             105   2e-22   Prunus persica
gb|KJB64167.1|  hypothetical protein B456_010G035400                    105   2e-22   Gossypium raimondii
gb|KJB64166.1|  hypothetical protein B456_010G035400                    105   2e-22   Gossypium raimondii
gb|KJB29358.1|  hypothetical protein B456_005G096600                    105   2e-22   Gossypium raimondii
ref|XP_004237986.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    105   2e-22   Solanum lycopersicum
ref|XP_006338134.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    105   2e-22   Solanum tuberosum [potatoes]
ref|XP_006433843.1|  hypothetical protein CICLE_v10000079mg             105   3e-22   Citrus clementina
gb|KJB29359.1|  hypothetical protein B456_005G096600                    105   3e-22   Gossypium raimondii
ref|XP_010646974.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    104   3e-22   Vitis vinifera
ref|XP_004501631.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    104   4e-22   Cicer arietinum [garbanzo]
ref|XP_009609184.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    104   5e-22   Nicotiana tomentosiformis
gb|EMT11184.1|  Ubiquitin carboxyl-terminal hydrolase 16                103   7e-22   Aegilops tauschii
ref|XP_003635052.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    103   8e-22   Vitis vinifera
ref|XP_010548553.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   1e-21   Tarenaya hassleriana [spider flower]
ref|XP_003519843.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    103   1e-21   Glycine max [soybeans]
ref|XP_009359053.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_002980323.1|  hypothetical protein SELMODRAFT_420048             102   1e-21   Selaginella moellendorffii
ref|XP_009359054.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_003523774.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   1e-21   Glycine max [soybeans]
ref|XP_006578260.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   1e-21   Glycine max [soybeans]
ref|XP_004973705.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   1e-21   
gb|KHN08238.1|  Ubiquitin carboxyl-terminal hydrolase 16                102   1e-21   Glycine soja [wild soybean]
ref|XP_006578259.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   1e-21   Glycine max [soybeans]
emb|CBI18698.3|  unnamed protein product                                102   1e-21   Vitis vinifera
ref|XP_004973704.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   1e-21   Setaria italica
ref|NP_565576.1|  ubiquitin carboxyl-terminal hydrolase 19              102   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008378636.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    100   2e-21   
ref|XP_008789702.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   2e-21   Phoenix dactylifera
ref|XP_010928622.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   2e-21   Elaeis guineensis
ref|XP_003602929.1|  Ubiquitin carboxyl-terminal hydrolase              102   2e-21   Medicago truncatula
gb|KEH35732.1|  ubiquitin carboxy-terminal hydrolase                    102   2e-21   Medicago truncatula
ref|XP_009396938.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009376247.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   2e-21   Pyrus x bretschneideri [bai li]
ref|XP_010266094.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    102   2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_007047805.1|  Ubiquitin-specific protease 17, putative iso...    102   3e-21   Theobroma cacao [chocolate]
emb|CAN77546.1|  hypothetical protein VITISV_025214                     102   3e-21   Vitis vinifera
ref|XP_009410122.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    101   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401442.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    101   4e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009373969.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    101   5e-21   Pyrus x bretschneideri [bai li]
emb|CBI35523.3|  unnamed protein product                                100   5e-21   Vitis vinifera
ref|XP_008352731.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.4    5e-21   Malus domestica [apple tree]
gb|KGN60255.1|  hypothetical protein Csa_3G890110                       101   5e-21   Cucumis sativus [cucumbers]
ref|XP_008466167.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    101   5e-21   
ref|XP_003518257.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    101   6e-21   Glycine max [soybeans]
ref|XP_003544242.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    101   6e-21   Glycine max [soybeans]
gb|EPS72742.1|  hypothetical protein M569_02015                       98.2    6e-21   Genlisea aurea
ref|XP_011031394.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    100   6e-21   Populus euphratica
ref|NP_001189593.1|  ubiquitin carboxyl-terminal hydrolase 19         99.4    6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293755.1|  hypothetical protein CARUB_v10022714mg             100   7e-21   Capsella rubella
ref|XP_003527871.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    100   7e-21   
ref|XP_011100001.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    100   7e-21   Sesamum indicum [beniseed]
ref|XP_009363067.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    100   9e-21   Pyrus x bretschneideri [bai li]
ref|XP_003615274.1|  Ubiquitin carboxyl-terminal hydrolase              100   1e-20   
gb|KHN26130.1|  Ubiquitin carboxyl-terminal hydrolase 16                100   1e-20   Glycine soja [wild soybean]
ref|XP_008377533.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.0    1e-20   
tpg|DAA48490.1|  TPA: putative ubiquitin carboxyl-terminal hydrol...    100   1e-20   Zea mays [maize]
ref|XP_008338940.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    100   1e-20   Malus domestica [apple tree]
ref|XP_008664540.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    100   1e-20   Zea mays [maize]
ref|XP_007223115.1|  hypothetical protein PRUPE_ppa005433mg           98.2    1e-20   Prunus persica
ref|XP_008220608.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.4    1e-20   Prunus mume [ume]
gb|ACF84178.1|  unknown                                               97.1    1e-20   Zea mays [maize]
ref|XP_010429445.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  99.4    1e-20   Camelina sativa [gold-of-pleasure]
dbj|BAD44466.1|  unknown protein                                      99.0    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194895.1|  ubiquitin carboxyl-terminal hydrolase 18            99.0    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010060095.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.8    2e-20   Eucalyptus grandis [rose gum]
ref|XP_006845518.1|  hypothetical protein AMTR_s00019p00164720        99.4    2e-20   Amborella trichopoda
gb|EYU30946.1|  hypothetical protein MIMGU_mgv1a004116mg              98.6    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_010417220.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.0    2e-20   Camelina sativa [gold-of-pleasure]
gb|AES98232.2|  ubiquitin carboxy-terminal hydrolase                  99.4    2e-20   Medicago truncatula
ref|XP_006355189.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.0    2e-20   Solanum tuberosum [potatoes]
ref|XP_008359211.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.4    2e-20   Malus domestica [apple tree]
ref|XP_008385675.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.4    2e-20   Malus domestica [apple tree]
ref|XP_011044972.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.0    2e-20   Populus euphratica
ref|NP_001063411.2|  Os09g0464400                                     99.4    2e-20   
gb|EEC84719.1|  hypothetical protein OsI_31685                        99.4    2e-20   Oryza sativa Indica Group [Indian rice]
dbj|BAD33960.1|  putative ubiquitin-specific protease                 99.4    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002308728.2|  hypothetical protein POPTR_0006s28540g           98.6    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010675222.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.4    2e-20   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_007011632.1|  Ubiquitin carboxyl-terminal hydrolase 19, pu...  98.6    3e-20   Theobroma cacao [chocolate]
ref|XP_008678623.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.0    3e-20   Zea mays [maize]
ref|XP_008678622.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.0    3e-20   Zea mays [maize]
ref|XP_002445647.1|  hypothetical protein SORBIDRAFT_07g023330        99.0    3e-20   Sorghum bicolor [broomcorn]
ref|XP_002324377.2|  hypothetical protein POPTR_0018s03350g           98.6    3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_004498826.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  98.6    3e-20   Cicer arietinum [garbanzo]
gb|KDP33469.1|  hypothetical protein JCGZ_07040                       98.6    3e-20   Jatropha curcas
ref|XP_009381476.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  99.0    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006283326.1|  hypothetical protein CARUB_v10004366mg           98.2    3e-20   Capsella rubella
ref|XP_006660217.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  98.6    3e-20   
ref|XP_002880603.1|  ubiquitin carboxyl-terminal hydrolase family...  98.2    4e-20   Arabidopsis lyrata subsp. lyrata
emb|CDX75188.1|  BnaA01g05140D                                        97.8    4e-20   Brassica napus [oilseed rape]
ref|XP_010432837.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.8    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009126746.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.8    4e-20   Brassica rapa
ref|XP_010432836.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.8    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010447529.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.8    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_007208087.1|  hypothetical protein PRUPE_ppa001429mg           98.2    4e-20   Prunus persica
ref|XP_008452810.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.8    4e-20   Cucumis melo [Oriental melon]
ref|XP_006412571.1|  hypothetical protein EUTSA_v10024675mg           97.8    4e-20   Eutrema salsugineum
ref|XP_003574640.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  98.2    5e-20   
ref|XP_008393558.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.8    5e-20   Malus domestica [apple tree]
gb|ACF83022.1|  unknown                                               96.7    5e-20   Zea mays [maize]
gb|EMT33844.1|  Ubiquitin carboxyl-terminal hydrolase 17              98.2    5e-20   Aegilops tauschii
ref|XP_009117107.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.4    5e-20   Brassica rapa
ref|XP_010472472.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.4    5e-20   Camelina sativa [gold-of-pleasure]
gb|EMS47345.1|  Ubiquitin carboxyl-terminal hydrolase 17              98.2    5e-20   Triticum urartu
ref|XP_011074220.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  98.2    6e-20   Sesamum indicum [beniseed]
ref|XP_006405001.1|  hypothetical protein EUTSA_v10000088mg           97.4    6e-20   Eutrema salsugineum
ref|XP_010438014.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.4    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_003523663.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.4    6e-20   Glycine max [soybeans]
gb|KEH39885.1|  ubiquitin carboxy-terminal hydrolase                  97.8    6e-20   Medicago truncatula
gb|KHN29656.1|  Ubiquitin carboxyl-terminal hydrolase 19              97.4    7e-20   Glycine soja [wild soybean]
ref|XP_006483493.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.4    7e-20   Citrus sinensis [Valencia orange]
ref|XP_003545417.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.4    7e-20   Glycine max [soybeans]
ref|XP_008235462.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.4    7e-20   Prunus mume [ume]
gb|KDO67336.1|  hypothetical protein CISIN_1g004724mg                 97.4    7e-20   Citrus sinensis [Valencia orange]
gb|KHG26104.1|  Ubiquitin carboxyl-terminal hydrolase 17              97.8    7e-20   Gossypium arboreum [tree cotton]
gb|KHG26103.1|  Ubiquitin carboxyl-terminal hydrolase 17              97.8    8e-20   Gossypium arboreum [tree cotton]
ref|XP_004245303.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.4    8e-20   Solanum lycopersicum
emb|CDX68773.1|  BnaC01g06800D                                        97.1    8e-20   
ref|XP_006483492.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.4    8e-20   
ref|XP_006466293.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.4    8e-20   
gb|KHN19658.1|  Ubiquitin carboxyl-terminal hydrolase 19              97.1    8e-20   
ref|XP_002867287.1|  ubiquitin carboxyl-terminal hydrolase family...  97.1    8e-20   
ref|XP_006450208.1|  hypothetical protein CICLE_v10007658mg           97.1    9e-20   
ref|XP_003527768.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  97.1    9e-20   
gb|KFK32657.1|  hypothetical protein AALP_AA6G271600                  97.1    9e-20   
emb|CDY34761.1|  BnaA09g41280D                                        97.1    9e-20   
gb|KJB18261.1|  hypothetical protein B456_003G043300                  97.1    9e-20   
emb|CDX76801.1|  BnaC08g33870D                                        97.1    9e-20   
ref|XP_006426286.1|  hypothetical protein CICLE_v10024864mg           97.4    1e-19   
gb|KHN37220.1|  Ubiquitin carboxyl-terminal hydrolase 19              97.1    1e-19   
dbj|BAD43230.1|  unknown protein                                      96.7    1e-19   
gb|KJB18262.1|  hypothetical protein B456_003G043300                  97.1    1e-19   
gb|EYU39312.1|  hypothetical protein MIMGU_mgv1a001469mg              97.1    1e-19   
gb|KJB18260.1|  hypothetical protein B456_003G043300                  97.1    1e-19   
ref|XP_004157412.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  96.7    1e-19   
ref|XP_004141442.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  96.7    1e-19   
ref|XP_010107689.1|  Ubiquitin carboxyl-terminal hydrolase 16         97.1    1e-19   
gb|EYU22051.1|  hypothetical protein MIMGU_mgv1a001964mg              96.7    1e-19   
gb|KDO60602.1|  hypothetical protein CISIN_1g039539mg                 95.5    1e-19   
ref|XP_010049833.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  96.3    1e-19   
ref|XP_006466294.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  96.7    1e-19   
ref|XP_007136918.1|  hypothetical protein PHAVU_009G084800g           96.3    2e-19   
ref|XP_002530694.1|  cysteine-type endopeptidase, putative            96.3    2e-19   
ref|XP_003550229.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  96.3    2e-19   
gb|KFK29759.1|  hypothetical protein AALP_AA7G175300                  95.9    2e-19   
ref|XP_010061517.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  96.3    2e-19   
ref|XP_002271840.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...  96.3    3e-19   
ref|XP_004965693.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  96.3    3e-19   
ref|XP_007141259.1|  hypothetical protein PHAVU_008G181000g           95.9    3e-19   
emb|CBI23999.3|  unnamed protein product                              95.9    3e-19   
gb|KCW68483.1|  hypothetical protein EUGRSUZ_F02136                   95.9    3e-19   
gb|EEE68872.1|  hypothetical protein OsJ_27681                        95.9    3e-19   
gb|KHG15081.1|  Ubiquitin carboxyl-terminal hydrolase 19 -like pr...  94.7    4e-19   
ref|NP_001062051.1|  Os08g0478500                                     95.9    4e-19   
gb|KJB07712.1|  hypothetical protein B456_001G040200                  94.7    4e-19   
ref|XP_009408046.1|  PREDICTED: uncharacterized protein LOC103990...  95.1    6e-19   
gb|EPS64787.1|  hypothetical protein M569_09988                       92.0    6e-19   
ref|XP_010523321.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.7    7e-19   
gb|KJB65934.1|  hypothetical protein B456_010G120800                  94.4    7e-19   
ref|XP_011070235.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.7    7e-19   
gb|KDP29752.1|  hypothetical protein JCGZ_18687                       94.7    7e-19   
ref|XP_008444940.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.7    7e-19   
ref|XP_010259741.1|  PREDICTED: uncharacterized protein LOC104599075  95.1    8e-19   
ref|XP_006601204.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.4    9e-19   
ref|XP_004148434.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.7    9e-19   
ref|XP_008444939.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.7    9e-19   
ref|XP_004163959.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  94.7    9e-19   
ref|XP_009340982.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.4    9e-19   
ref|XP_004291227.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.4    9e-19   
ref|XP_010098405.1|  Ubiquitin carboxyl-terminal hydrolase 19         94.0    1e-18   
ref|XP_011082032.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.4    1e-18   
ref|XP_004957062.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.4    1e-18   
ref|XP_004957061.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.4    1e-18   
ref|XP_009772698.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  94.0    1e-18   
ref|XP_009140568.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  93.6    1e-18   
ref|XP_007161112.1|  hypothetical protein PHAVU_001G043700g           93.6    1e-18   
emb|CDY20330.1|  BnaC04g36260D                                        93.6    1e-18   
ref|XP_011097488.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  93.2    2e-18   
gb|EYU36471.1|  hypothetical protein MIMGU_mgv1a000653mg              93.2    3e-18   
ref|XP_002515370.1|  cysteine-type endopeptidase, putative            92.4    3e-18   
ref|XP_010520756.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  93.2    3e-18   
ref|XP_008649027.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  92.8    4e-18   
ref|XP_010239389.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  92.4    5e-18   
ref|XP_004490438.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  92.0    6e-18   
ref|XP_006657202.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  92.0    7e-18   
ref|NP_001058243.1|  Os06g0654000                                     91.7    8e-18   
ref|XP_011468537.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  91.7    9e-18   
gb|EAZ01926.1|  hypothetical protein OsI_23952                        91.7    1e-17   
gb|EAZ37856.1|  hypothetical protein OsJ_22202                        91.7    1e-17   
ref|XP_010693053.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  91.7    1e-17   
ref|XP_008653981.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  91.3    1e-17   
dbj|BAD37420.1|  putative ubiquitin-specific protease 15              91.3    1e-17   
ref|XP_010049834.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  89.7    1e-17   
emb|CDX92643.1|  BnaC07g39010D                                        91.3    1e-17   
ref|XP_002438776.1|  hypothetical protein SORBIDRAFT_10g026010        90.9    1e-17   
ref|XP_009607564.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  90.5    2e-17   
dbj|BAJ97014.1|  predicted protein                                    90.9    2e-17   
ref|XP_006394032.1|  hypothetical protein EUTSA_v10003706mg           90.5    2e-17   
emb|CDY11021.1|  BnaA03g46800D                                        90.5    2e-17   
ref|XP_009137457.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  90.5    2e-17   
emb|CDY45587.1|  BnaA04g14540D                                        89.4    3e-17   
ref|XP_010525656.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  89.7    4e-17   
gb|EMS56666.1|  Ubiquitin carboxyl-terminal hydrolase 19              89.0    8e-17   
ref|XP_002462507.1|  hypothetical protein SORBIDRAFT_02g026980        89.0    8e-17   
gb|EMT03019.1|  Ubiquitin carboxyl-terminal hydrolase 19              89.0    8e-17   
ref|XP_006282127.1|  hypothetical protein CARUB_v10028379mg           88.2    9e-17   
ref|XP_010681055.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  88.6    9e-17   
ref|XP_002864957.1|  hypothetical protein ARALYDRAFT_332761           88.2    1e-16   
ref|XP_010444522.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  87.8    2e-16   
ref|XP_010484359.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  87.8    2e-16   
ref|XP_003560376.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  87.8    2e-16   
gb|KFK28246.1|  hypothetical protein AALP_AA8G491300                  87.4    2e-16   
emb|CDY03441.1|  BnaC01g16410D                                        87.4    3e-16   
ref|XP_009138224.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  87.4    3e-16   
emb|CDY34291.1|  BnaA01g13940D                                        87.4    3e-16   
gb|KFK28990.1|  hypothetical protein AALP_AA7G074400                  87.4    3e-16   
ref|XP_010444523.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  86.7    3e-16   
ref|XP_010484360.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  86.7    3e-16   
ref|XP_010240068.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  86.7    4e-16   
gb|EPS59868.1|  hypothetical protein M569_14935                       83.6    8e-16   
gb|EPS68694.1|  hypothetical protein M569_06073                       85.5    9e-16   
ref|NP_201348.1|  ubiquitin-specific protease 17                      85.1    1e-15   
ref|XP_006413414.1|  hypothetical protein EUTSA_v10024307mg           85.5    1e-15   
emb|CDY08792.1|  BnaA06g24320D                                        84.7    2e-15   
gb|AAG42757.1|AF302666_1  ubiquitin-specific protease 16              84.7    2e-15   
ref|NP_567705.1|  ubiquitin carboxyl-terminal hydrolase 16            84.7    2e-15   
emb|CDY14564.1|  BnaC03g48950D                                        84.3    2e-15   
ref|XP_009150635.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  84.3    2e-15   
ref|XP_002867659.1|  ubiquitin-specific protease 16                   84.3    2e-15   
ref|XP_010463054.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  84.0    3e-15   
ref|XP_001771280.1|  predicted protein                                81.6    3e-15   
ref|XP_010448548.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  84.0    3e-15   
ref|XP_010439011.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  84.0    3e-15   
ref|XP_010433753.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  83.6    5e-15   
gb|EAZ07363.1|  hypothetical protein OsI_29613                        80.9    3e-14   
ref|XP_001758249.1|  predicted protein                                78.2    1e-13   
ref|XP_006342461.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  73.9    6e-12   
ref|XP_010314797.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  73.2    9e-12   
ref|XP_002872343.1|  hypothetical protein ARALYDRAFT_911001           67.4    8e-11   
ref|XP_002509019.1|  predicted protein                                68.6    2e-10   
emb|CAG04439.1|  unnamed protein product                              64.7    2e-09   
ref|NP_001243823.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  66.2    2e-09   
ref|NP_001243789.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  65.9    2e-09   
ref|XP_004046713.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.5    2e-09   
ref|NP_001243788.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  65.9    2e-09   
ref|NP_001243783.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  65.9    2e-09   
ref|XP_003310296.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.5    3e-09   
ref|XP_004046711.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.5    3e-09   
ref|XP_006710304.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.3    4e-09   
ref|XP_009094882.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.5    4e-09   
ref|XP_009234205.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  63.9    4e-09   
gb|EAW92671.1|  hCG1807742                                            64.3    4e-09   
ref|XP_008301807.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  65.5    4e-09   
ref|XP_009037330.1|  hypothetical protein AURANDRAFT_64568            64.7    4e-09   
ref|XP_005372438.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.7    5e-09   
ref|XP_006418757.1|  hypothetical protein EUTSA_v10002775mg           64.7    6e-09   
ref|XP_008070649.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.3    6e-09   
ref|XP_007606438.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  61.2    6e-09   
ref|XP_003973109.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.7    8e-09   
sp|Q6QN14.2|U17L6_HUMAN  RecName: Full=Ubiquitin carboxyl-termina...  63.9    8e-09   
ref|XP_006726474.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  63.5    8e-09   
gb|AAS59847.1|  deubiquitinating enzyme DUB4                          63.5    8e-09   
ref|XP_010733623.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  64.7    8e-09   
emb|CBN80949.1|  Ubiquitin carboxyl-terminal hydrolase 48             64.7    8e-09   
ref|NP_001243784.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  63.9    9e-09   
ref|NP_958804.2|  ubiquitin carboxyl-terminal hydrolase 17            63.9    9e-09   
ref|XP_001175011.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.2    1e-08   
ref|XP_005562623.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.9    1e-08   
gb|AAQ11741.1|  deubiquitinating enzyme DUB1                          63.9    1e-08   
ref|XP_005562625.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  63.9    1e-08   
ref|NP_001243786.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  63.9    1e-08   
ref|NP_001243792.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  63.9    1e-08   
ref|XP_006991849.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.9    1e-08   
ref|XP_006991847.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.9    1e-08   
gb|AAQ11742.1|  deubiquitinating enzyme DUB2                          63.9    1e-08   
gb|KFO52666.1|  Ubiquitin carboxyl-terminal hydrolase 42              63.2    1e-08   
ref|NP_001229255.1|  ubiquitin specific peptidase 17-like family ...  63.5    1e-08   
ref|NP_001229258.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  63.5    1e-08   
ref|XP_004046661.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.5    1e-08   
ref|XP_004046718.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.2    1e-08   
emb|CAF94665.1|  unnamed protein product                              63.9    1e-08   
ref|NP_001243782.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  63.5    1e-08   
ref|NP_001243791.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  63.5    1e-08   
ref|NP_001243790.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  63.5    1e-08   
gb|AAO38845.1|  deubiquitinating enzyme 3                             63.5    1e-08   
ref|XP_005508434.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.9    1e-08   
ref|NP_001243781.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  63.5    1e-08   
ref|XP_010879236.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.5    1e-08   
ref|XP_009238035.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  63.2    2e-08   
ref|XP_010879235.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.5    2e-08   
ref|XP_004992408.1|  hypothetical protein PTSG_07000                  63.2    2e-08   
sp|C9J2P7.1|U17LF_HUMAN  RecName: Full=Ubiquitin carboxyl-termina...  63.2    2e-08   
ref|XP_004046717.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  62.8    2e-08   
ref|XP_003061744.1|  predicted protein                                62.8    2e-08   
gb|AAR91701.1|  deubiquitinating enzyme 3                             63.2    2e-08   
ref|XP_009438375.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  63.2    2e-08   
ref|XP_003462100.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...  62.8    2e-08   
ref|XP_003271501.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  62.8    2e-08   
ref|XP_003271421.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  62.8    2e-08   
ref|XP_008971387.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  61.6    2e-08   
ref|NP_001243800.1|  ubiquitin carboxyl-terminal hydrolase 17-lik...  62.4    3e-08   
ref|XP_001082678.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  62.4    3e-08   
ref|XP_004916402.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  62.8    3e-08   
ref|XP_003289130.1|  hypothetical protein DICPUDRAFT_15497            62.8    3e-08   
gb|EGW13659.1|  Ubiquitin carboxyl-terminal hydrolase DUB-1           61.2    4e-08   
gb|ETE59661.1|  Ubiquitin carboxyl-terminal hydrolase 42              62.4    4e-08   
ref|XP_007662335.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  62.4    4e-08   
ref|XP_007662334.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  62.4    4e-08   
gb|KFU93838.1|  Ubiquitin carboxyl-terminal hydrolase 42              61.2    4e-08   
gb|AAB94636.1|  hematopoietic-specific IL-2 deubiquitinating enzyme   62.0    4e-08   
ref|XP_007633624.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  62.0    4e-08   
gb|EMP34977.1|  Ubiquitin carboxyl-terminal hydrolase 42              62.4    4e-08   
ref|XP_003227691.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...  62.4    4e-08   
gb|AAB95194.1|  hematopoietic-specific IL-2 deubiquitinating enzyme   62.0    4e-08   
ref|NP_034219.3|  deubiquitinating enzyme 2                           62.0    4e-08   
ref|XP_002806114.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  61.2    4e-08   
ref|XP_007425215.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  62.4    5e-08   
ref|XP_007667480.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  62.4    5e-08   
ref|XP_007060712.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...  62.4    5e-08   
ref|XP_005304763.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  62.4    5e-08   
ref|XP_005998431.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  62.4    5e-08   
ref|XP_011404784.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  62.0    5e-08   
ref|XP_007607798.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  60.8    5e-08   
ref|XP_007896003.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  61.6    5e-08   
emb|CDQ74510.1|  unnamed protein product                              62.0    5e-08   
ref|XP_005848077.1|  hypothetical protein CHLNCDRAFT_145319           62.0    5e-08   
gb|AAK84135.1|AF393637_1  deubiquitinating enzyme 2A                  61.6    6e-08   
ref|NP_001001559.2|  deubiquitinating enzyme 2a                       61.6    6e-08   
ref|XP_008758066.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  61.6    6e-08   
gb|AAK77003.1|  deubiquitinating enzyme 2A                            61.6    6e-08   
ref|XP_008772019.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  61.2    6e-08   
ref|XP_008772857.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  61.2    6e-08   
ref|XP_008772907.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  61.2    6e-08   
ref|XP_001084204.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  61.2    6e-08   
ref|XP_006979158.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  61.2    6e-08   
ref|XP_007091537.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  61.6    6e-08   
ref|XP_011287718.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  61.6    7e-08   
ref|XP_011287717.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  61.6    7e-08   



>ref|XP_003596211.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=983

 Score =   150 bits (379),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 78/150 (52%), Positives = 89/150 (59%), Gaps = 49/150 (33%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLY+LYAV VHLDTLNASFSGHY+SYVKD
Sbjct  704  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYVLYAVVVHLDTLNASFSGHYVSYVKD  763

Query  365  MQGNWFGIDDTKVKFYIKLYCFCFSNCRGKIQTel**lgklneekGI*klllmcalslls  186
            +QGNWF IDDT+V     L C                                       
Sbjct  764  LQGNWFRIDDTEVML---LPCL--------------------------------------  782

Query  185  gktglsk*QVEQVPMSRVMTEGAYILFYMR  96
                    QV+ V +++VM+EGAYILFY R
Sbjct  783  --------QVQPVLVNQVMSEGAYILFYTR  804



>ref|XP_007022154.1| Ubiquitin-specific protease 15, putative isoform 2 [Theobroma 
cacao]
 gb|EOY13679.1| Ubiquitin-specific protease 15, putative isoform 2 [Theobroma 
cacao]
Length=851

 Score =   147 bits (372),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+PYMTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  680  QEGKYGKINKCITFPEMLDMVPYMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  739

Query  365  MQGNWFGIDDTKV  327
            +QGNWF IDDT+V
Sbjct  740  LQGNWFRIDDTEV  752



>ref|XP_007022155.1| Ubiquitin-specific protease 15, putative isoform 3 [Theobroma 
cacao]
 gb|EOY13680.1| Ubiquitin-specific protease 15, putative isoform 3 [Theobroma 
cacao]
Length=990

 Score =   147 bits (372),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+PYMTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  674  QEGKYGKINKCITFPEMLDMVPYMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  733

Query  365  MQGNWFGIDDTKV  327
            +QGNWF IDDT+V
Sbjct  734  LQGNWFRIDDTEV  746



>ref|XP_007022153.1| Ubiquitin-specific protease 15, putative isoform 1 [Theobroma 
cacao]
 gb|EOY13678.1| Ubiquitin-specific protease 15, putative isoform 1 [Theobroma 
cacao]
Length=1000

 Score =   147 bits (372),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+PYMTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  680  QEGKYGKINKCITFPEMLDMVPYMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  739

Query  365  MQGNWFGIDDTKV  327
            +QGNWF IDDT+V
Sbjct  740  LQGNWFRIDDTEV  752



>ref|XP_007149328.1| hypothetical protein PHAVU_005G061400g [Phaseolus vulgaris]
 gb|ESW21322.1| hypothetical protein PHAVU_005G061400g [Phaseolus vulgaris]
Length=978

 Score =   147 bits (371),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  672  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  731

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF IDDT+V+
Sbjct  732  LQGNWFRIDDTEVQ  745



>emb|CDP06086.1| unnamed protein product [Coffea canephora]
Length=936

 Score =   146 bits (369),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTGTDD+PPLYMLYAV VHLDTLNASFSGHYI+Y+KD
Sbjct  617  QEGRYGKINKCITFPDMLDMVPFMTGTDDIPPLYMLYAVVVHLDTLNASFSGHYIAYIKD  676

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF IDDT+V+
Sbjct  677  LQGNWFRIDDTEVQ  690



>ref|XP_011077821.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Sesamum 
indicum]
Length=979

 Score =   146 bits (369),  Expect = 9e-37, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGTDD+PPLYMLY V VHLDT NASFSGHYISYVKD
Sbjct  673  QEGNYGKINKCITFPEMLDMIPFMTGTDDIPPLYMLYGVVVHLDTSNASFSGHYISYVKD  732

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF +DDT+V+
Sbjct  733  LQGNWFRVDDTEVQ  746



>gb|AES66462.2| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=948

 Score =   145 bits (366),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLY+LYAV VHLDTLNASFSGHY+SYVKD
Sbjct  677  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYVLYAVVVHLDTLNASFSGHYVSYVKD  736

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF IDDT+V+
Sbjct  737  LQGNWFRIDDTEVQ  750



>ref|XP_006598161.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Glycine max]
 ref|XP_006598162.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Glycine max]
Length=989

 Score =   145 bits (365),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  682  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  741

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF IDD +V+
Sbjct  742  LQGNWFRIDDAEVQ  755



>ref|XP_006598163.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Glycine max]
Length=988

 Score =   144 bits (364),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  681  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  740

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF IDD +V+
Sbjct  741  LQGNWFRIDDAEVQ  754



>gb|KHN29845.1| Ubiquitin carboxyl-terminal hydrolase 15 [Glycine soja]
Length=989

 Score =   144 bits (364),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  682  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  741

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF IDD +V+
Sbjct  742  LQGNWFRIDDAEVQ  755



>ref|XP_003541793.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Glycine max]
 ref|XP_006594688.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Glycine max]
Length=990

 Score =   144 bits (364),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  684  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  743

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF IDD +V+
Sbjct  744  LQGNWFRIDDIEVQ  757



>gb|KHN47474.1| Ubiquitin carboxyl-terminal hydrolase 15 [Glycine soja]
Length=986

 Score =   144 bits (364),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  680  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  739

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF IDD +V+
Sbjct  740  LQGNWFRIDDIEVQ  753



>ref|XP_006594689.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Glycine max]
Length=989

 Score =   144 bits (364),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  683  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  742

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF IDD +V+
Sbjct  743  LQGNWFRIDDIEVQ  756



>ref|XP_010092717.1| Ubiquitin carboxyl-terminal hydrolase 15 [Morus notabilis]
 gb|EXB52062.1| Ubiquitin carboxyl-terminal hydrolase 15 [Morus notabilis]
Length=1009

 Score =   144 bits (364),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LYAV VHLDTLNASFSGHY+SYVKD
Sbjct  701  QEGRYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYAVVVHLDTLNASFSGHYVSYVKD  760

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF IDDT+V+
Sbjct  761  LQGNWFRIDDTEVQ  774



>gb|KHG25224.1| Ubiquitin carboxyl-terminal hydrolase 15 -like protein [Gossypium 
arboreum]
Length=954

 Score =   144 bits (362),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  643  QEGKYGKINKCITFPDMLDMVPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  702

Query  365  MQGNWFGIDDTKVK  324
            ++GNWF IDDT+V+
Sbjct  703  LRGNWFRIDDTEVR  716



>gb|EYU28912.1| hypothetical protein MIMGU_mgv1a001776mg [Erythranthe guttata]
Length=760

 Score =   142 bits (359),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGTDD+PPLY+LYAV VHLD+ NASFSGHYISYVKD
Sbjct  501  QEGNYGKINKCITFPEMLDMIPFMTGTDDIPPLYVLYAVVVHLDSYNASFSGHYISYVKD  560

Query  365  MQGNWFGIDDTKVK  324
            + GNWF +DDT+V+
Sbjct  561  LHGNWFRVDDTEVQ  574



>ref|XP_010324419.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Solanum lycopersicum]
Length=954

 Score =   143 bits (360),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 2/75 (3%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGTDD+PPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  642  QEGSYGKINKCITFPDMLDMIPFMTGTDDIPPLYMLYAVVVHLDTLNASFSGHYISYVKD  701

Query  365  --MQGNWFGIDDTKV  327
              ++GNWF IDDT+V
Sbjct  702  LHLRGNWFRIDDTEV  716



>ref|XP_009609977.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Nicotiana 
tomentosiformis]
Length=996

 Score =   143 bits (360),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 63/76 (83%), Positives = 69/76 (91%), Gaps = 2/76 (3%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MT TDD+PPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  673  QEGSYGKINKCITFPDMLDMIPFMTATDDIPPLYMLYAVVVHLDTLNASFSGHYISYVKD  732

Query  365  M--QGNWFGIDDTKVK  324
            +  QGNWF IDDT+V+
Sbjct  733  LHRQGNWFRIDDTEVQ  748



>ref|XP_006348364.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006348365.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Solanum tuberosum]
Length=966

 Score =   143 bits (360),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 2/75 (3%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGTDD+PPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  654  QEGSYGKINKCITFPDMLDMIPFMTGTDDIPPLYMLYAVVVHLDTLNASFSGHYISYVKD  713

Query  365  --MQGNWFGIDDTKV  327
              ++GNWF IDDT+V
Sbjct  714  LHLRGNWFRIDDTEV  728



>ref|XP_004244319.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Solanum lycopersicum]
 ref|XP_010324418.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Solanum lycopersicum]
Length=966

 Score =   143 bits (360),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 2/75 (3%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGTDD+PPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  654  QEGSYGKINKCITFPDMLDMIPFMTGTDDIPPLYMLYAVVVHLDTLNASFSGHYISYVKD  713

Query  365  --MQGNWFGIDDTKV  327
              ++GNWF IDDT+V
Sbjct  714  LHLRGNWFRIDDTEV  728



>gb|KJB12847.1| hypothetical protein B456_002G039300 [Gossypium raimondii]
 gb|KJB12848.1| hypothetical protein B456_002G039300 [Gossypium raimondii]
Length=988

 Score =   143 bits (360),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  668  QEGKYGKINKCITFPDMLDMVPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  727

Query  365  MQGNWFGIDDTKV  327
            ++GNWF IDDT+V
Sbjct  728  LRGNWFRIDDTEV  740



>gb|KJB12846.1| hypothetical protein B456_002G039300 [Gossypium raimondii]
Length=994

 Score =   143 bits (360),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  674  QEGKYGKINKCITFPDMLDMVPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  733

Query  365  MQGNWFGIDDTKV  327
            ++GNWF IDDT+V
Sbjct  734  LRGNWFRIDDTEV  746



>gb|KJB45883.1| hypothetical protein B456_007G335200 [Gossypium raimondii]
 gb|KJB45886.1| hypothetical protein B456_007G335200 [Gossypium raimondii]
Length=985

 Score =   142 bits (359),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  672  QEGKYGKINKCITFPDMLDMVPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  731

Query  365  MQGNWFGIDDTKV  327
            ++GNWF IDDT+V
Sbjct  732  LRGNWFRIDDTEV  744



>gb|KJB45884.1| hypothetical protein B456_007G335200 [Gossypium raimondii]
 gb|KJB45885.1| hypothetical protein B456_007G335200 [Gossypium raimondii]
Length=984

 Score =   142 bits (359),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  671  QEGKYGKINKCITFPDMLDMVPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  730

Query  365  MQGNWFGIDDTKV  327
            ++GNWF IDDT+V
Sbjct  731  LRGNWFRIDDTEV  743



>ref|XP_011044935.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X4 [Populus euphratica]
Length=700

 Score =   141 bits (355),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP+MTGT DVPPLYMLYAV VHLDTLNASFSGHY++YVKD
Sbjct  463  QEGKYGKINKCVTFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  522

Query  365  MQGNWFGIDDTKV  327
            +QG+WF IDDT+V
Sbjct  523  LQGSWFRIDDTEV  535



>ref|XP_010694568.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Beta vulgaris 
subsp. vulgaris]
Length=939

 Score =   142 bits (358),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+P+MTGT+D PPLYMLY V VH+DTLNASFSGHY+SYVKD
Sbjct  649  QEGNYGKINKCITFPEMLDMVPFMTGTNDSPPLYMLYGVVVHVDTLNASFSGHYVSYVKD  708

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF IDDT V+
Sbjct  709  LQGNWFRIDDTVVQ  722



>gb|KHF97895.1| Ubiquitin carboxyl-terminal hydrolase 15 -like protein [Gossypium 
arboreum]
Length=988

 Score =   142 bits (358),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTGT D+PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  668  QEGKYGKINKCITFPDMLDMVPFMTGTCDIPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  727

Query  365  MQGNWFGIDDTKV  327
            ++GNWF IDDT+V
Sbjct  728  LRGNWFRIDDTEV  740



>ref|XP_010539169.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Tarenaya 
hassleriana]
Length=901

 Score =   142 bits (357),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM P+MTGT D+PPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  632  QEGRYGKINKCITFPEMLDMTPFMTGTGDIPPLYMLYAVVVHLDTLNASFSGHYISYVKD  691

Query  365  MQGNWFGIDDTKV  327
            ++GNWF IDD+++
Sbjct  692  LRGNWFRIDDSEI  704



>ref|XP_011465542.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011465543.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Fragaria vesca subsp. vesca]
Length=938

 Score =   142 bits (357),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLY+LYAV VHLDT NASFSGHYI+YVKD
Sbjct  681  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYLLYAVVVHLDTQNASFSGHYIAYVKD  740

Query  365  MQGNWFGIDDTKVK  324
            M+GNWF IDDT+V+
Sbjct  741  MRGNWFRIDDTEVQ  754



>ref|XP_011465545.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X3 
[Fragaria vesca subsp. vesca]
Length=936

 Score =   142 bits (357),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLY+LYAV VHLDT NASFSGHYI+YVKD
Sbjct  679  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYLLYAVVVHLDTQNASFSGHYIAYVKD  738

Query  365  MQGNWFGIDDTKVK  324
            M+GNWF IDDT+V+
Sbjct  739  MRGNWFRIDDTEVQ  752



>ref|XP_011465544.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Fragaria vesca subsp. vesca]
Length=937

 Score =   142 bits (357),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT D+PPLY+LYAV VHLDT NASFSGHYI+YVKD
Sbjct  680  QEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYLLYAVVVHLDTQNASFSGHYIAYVKD  739

Query  365  MQGNWFGIDDTKVK  324
            M+GNWF IDDT+V+
Sbjct  740  MRGNWFRIDDTEVQ  753



>ref|XP_009776208.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Nicotiana 
sylvestris]
Length=996

 Score =   142 bits (357),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 63/76 (83%), Positives = 68/76 (89%), Gaps = 2/76 (3%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI FP+MLDMIP+MTGTDD PPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  673  QEGSYGKINKCIAFPDMLDMIPFMTGTDDSPPLYMLYAVVVHLDTLNASFSGHYISYVKD  732

Query  365  M--QGNWFGIDDTKVK  324
            +  QGNWF IDDT+V+
Sbjct  733  LHRQGNWFRIDDTEVQ  748



>ref|XP_011044931.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Populus euphratica]
 ref|XP_011044932.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Populus euphratica]
Length=831

 Score =   141 bits (355),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP+MTGT DVPPLYMLYAV VHLDTLNASFSGHY++YVKD
Sbjct  594  QEGKYGKINKCVTFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  653

Query  365  MQGNWFGIDDTKV  327
            +QG+WF IDDT+V
Sbjct  654  LQGSWFRIDDTEV  666



>ref|XP_011044933.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Populus euphratica]
Length=830

 Score =   141 bits (355),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP+MTGT DVPPLYMLYAV VHLDTLNASFSGHY++YVKD
Sbjct  593  QEGKYGKINKCVTFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  652

Query  365  MQGNWFGIDDTKV  327
            +QG+WF IDDT+V
Sbjct  653  LQGSWFRIDDTEV  665



>ref|XP_011044934.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Populus euphratica]
Length=803

 Score =   140 bits (354),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP+MTGT DVPPLYMLYAV VHLDTLNASFSGHY++YVKD
Sbjct  566  QEGKYGKINKCVTFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  625

Query  365  MQGNWFGIDDTKV  327
            +QG+WF IDDT+V
Sbjct  626  LQGSWFRIDDTEV  638



>ref|XP_002317364.2| UBIQUITIN-SPECIFIC PROTEASE 15 family protein [Populus trichocarpa]
 gb|EEE97976.2| UBIQUITIN-SPECIFIC PROTEASE 15 family protein [Populus trichocarpa]
Length=831

 Score =   141 bits (355),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT DVPPLYMLYAV VHLDTLNASFSGHY++YVKD
Sbjct  594  QEGKYGKINKCITFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  653

Query  365  MQGNWFGIDDTKV  327
            +QG+WF IDDT+V
Sbjct  654  LQGSWFRIDDTEV  666



>ref|XP_010644793.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Vitis vinifera]
Length=997

 Score =   141 bits (355),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT DVPPLYMLYAV VH+DTLNASFSGHY++YVKD
Sbjct  683  QEGRYGKINKCITFPDMLDMIPFMTGTYDVPPLYMLYAVVVHMDTLNASFSGHYVAYVKD  742

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF +DD +V+
Sbjct  743  LQGNWFRVDDAEVQ  756



>ref|XP_011045595.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Populus euphratica]
Length=922

 Score =   140 bits (354),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT DVPPLYMLYAV VHLDTLNASFSGHY++YVKD
Sbjct  644  QEGKYGKINKCITFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  703

Query  365  MQGNWFGIDDTKV  327
            ++G+WF IDDT+V
Sbjct  704  LRGSWFKIDDTEV  716



>emb|CAN68406.1| hypothetical protein VITISV_035043 [Vitis vinifera]
Length=945

 Score =   140 bits (354),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT DVPPLYMLYAV VH+DTLNASFSGHY++YVKD
Sbjct  631  QEGRYGKINKCITFPDMLDMIPFMTGTYDVPPLYMLYAVVVHMDTLNASFSGHYVAYVKD  690

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF +DD +V+
Sbjct  691  LQGNWFRVDDAEVQ  704



>ref|XP_011045594.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Populus euphratica]
Length=937

 Score =   140 bits (354),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT DVPPLYMLYAV VHLDTLNASFSGHY++YVKD
Sbjct  644  QEGKYGKINKCITFPDMLDMIPFMTGTGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  703

Query  365  MQGNWFGIDDTKV  327
            ++G+WF IDDT+V
Sbjct  704  LRGSWFKIDDTEV  716



>emb|CBI33027.3| unnamed protein product [Vitis vinifera]
Length=894

 Score =   140 bits (353),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT DVPPLYMLYAV VH+DTLNASFSGHY++YVKD
Sbjct  621  QEGRYGKINKCITFPDMLDMIPFMTGTYDVPPLYMLYAVVVHMDTLNASFSGHYVAYVKD  680

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF +DD +V+
Sbjct  681  LQGNWFRVDDAEVQ  694



>ref|XP_010540128.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Tarenaya 
hassleriana]
Length=888

 Score =   140 bits (352),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MTGT DVPPLY+LYAV VHLDTLNASFSGHYISYVKD
Sbjct  631  QEGRYGKINKCITFPEMLDMIPFMTGTGDVPPLYVLYAVVVHLDTLNASFSGHYISYVKD  690

Query  365  MQGNWFGIDDTKV  327
            ++G+WF IDD+++
Sbjct  691  LRGSWFRIDDSEI  703



>ref|XP_002298917.2| hypothetical protein POPTR_0001s38800g [Populus trichocarpa]
 gb|EEE83722.2| hypothetical protein POPTR_0001s38800g [Populus trichocarpa]
Length=665

 Score =   138 bits (347),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTG  DVPPLYMLYAV VHLDTLNASFSGHY++YVKD
Sbjct  564  QEGKYGKINKCITFPDMLDMIPFMTGMGDVPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  623

Query  365  MQGNWFGIDDTKV  327
            ++G+WF IDDT+V
Sbjct  624  LRGSWFKIDDTEV  636



>emb|CDX96790.1| BnaA08g23330D [Brassica napus]
Length=835

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  589  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  648

Query  365  MQGNWFGIDDTKV  327
            ++GNWF IDD+++
Sbjct  649  LRGNWFRIDDSEI  661



>ref|XP_004488653.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Cicer 
arietinum]
Length=936

 Score =   139 bits (351),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPE LDMIP+MTGT D+PPLY LYAV VHLDTLNASFSGHY+SYVKD
Sbjct  669  QEGRYGKINKCITFPENLDMIPFMTGTGDIPPLYALYAVVVHLDTLNASFSGHYVSYVKD  728

Query  365  MQGNWFGIDDTKVK  324
            + GNWF IDDT+V+
Sbjct  729  LHGNWFRIDDTEVQ  742



>emb|CDX83925.1| BnaC08g17200D [Brassica napus]
Length=847

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  581  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  640

Query  365  MQGNWFGIDDTKV  327
            ++GNWF IDD+++
Sbjct  641  LRGNWFRIDDSEI  653



>ref|XP_010476847.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Camelina sativa]
Length=919

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  641  QEGKYGKINKCITFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  700

Query  365  MQGNWFGIDDTKV  327
            ++GNW+ IDD+++
Sbjct  701  LRGNWYRIDDSEI  713



>ref|XP_010459276.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Camelina sativa]
Length=921

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  643  QEGKYGKINKCITFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  702

Query  365  MQGNWFGIDDTKV  327
            ++GNW+ IDD+++
Sbjct  703  LRGNWYRIDDSEI  715



>ref|XP_010498051.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Camelina 
sativa]
Length=926

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  648  QEGKYGKINKCITFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  707

Query  365  MQGNWFGIDDTKV  327
            ++GNW+ IDD+++
Sbjct  708  LRGNWYRIDDSEI  720



>ref|XP_010476845.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Camelina sativa]
 ref|XP_010476846.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Camelina sativa]
Length=931

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  653  QEGKYGKINKCITFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  712

Query  365  MQGNWFGIDDTKV  327
            ++GNW+ IDD+++
Sbjct  713  LRGNWYRIDDSEI  725



>ref|XP_010459274.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Camelina sativa]
 ref|XP_010459275.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Camelina sativa]
Length=931

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  653  QEGKYGKINKCITFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  712

Query  365  MQGNWFGIDDTKV  327
            ++GNW+ IDD+++
Sbjct  713  LRGNWYRIDDSEI  725



>ref|XP_006306123.1| hypothetical protein CARUB_v10011568mg [Capsella rubella]
 gb|EOA39021.1| hypothetical protein CARUB_v10011568mg [Capsella rubella]
Length=938

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  656  QEGKYGKINKCITFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  715

Query  365  MQGNWFGIDDTKV  327
            ++GNW+ IDD+++
Sbjct  716  LRGNWYRIDDSEI  728



>emb|CDY48465.1| BnaC05g13250D [Brassica napus]
Length=876

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  611  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  670

Query  365  MQGNWFGIDDTKV  327
            ++GNWF IDD+++
Sbjct  671  LRGNWFRIDDSEI  683



>ref|XP_009149147.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Brassica 
rapa]
 ref|XP_009149148.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Brassica 
rapa]
Length=877

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  615  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  674

Query  365  MQGNWFGIDDTKV  327
            ++GNWF IDD+++
Sbjct  675  LRGNWFRIDDSEI  687



>emb|CDY65125.1| BnaA06g38410D [Brassica napus]
Length=877

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  614  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  673

Query  365  MQGNWFGIDDTKV  327
            ++GNWF IDD+++
Sbjct  674  LRGNWFRIDDSEI  686



>ref|XP_006477933.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X5 [Citrus sinensis]
Length=1013

 Score =   139 bits (351),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+P+MTGT D PPLYMLY+V VHLDT NASFSGHY+SY+KD
Sbjct  689  QEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVHLDTQNASFSGHYVSYIKD  748

Query  365  MQGNWFGIDDTKV  327
            MQG WF IDDT+V
Sbjct  749  MQGTWFRIDDTQV  761



>ref|XP_006477929.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477930.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Citrus sinensis]
 ref|XP_006477931.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Citrus sinensis]
Length=1015

 Score =   139 bits (351),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+P+MTGT D PPLYMLY+V VHLDT NASFSGHY+SY+KD
Sbjct  691  QEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVHLDTQNASFSGHYVSYIKD  750

Query  365  MQGNWFGIDDTKV  327
            MQG WF IDDT+V
Sbjct  751  MQGTWFRIDDTQV  763



>ref|XP_006442255.1| hypothetical protein CICLE_v10018666mg [Citrus clementina]
 ref|XP_006442256.1| hypothetical protein CICLE_v10018666mg [Citrus clementina]
 gb|ESR55495.1| hypothetical protein CICLE_v10018666mg [Citrus clementina]
 gb|ESR55496.1| hypothetical protein CICLE_v10018666mg [Citrus clementina]
Length=1016

 Score =   139 bits (351),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+P+MTGT D PPLYMLY+V VHLDT NASFSGHY+SY+KD
Sbjct  691  QEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVHLDTQNASFSGHYVSYIKD  750

Query  365  MQGNWFGIDDTKV  327
            MQG WF IDDT+V
Sbjct  751  MQGTWFRIDDTQV  763



>ref|XP_009110426.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Brassica 
rapa]
 ref|XP_009110427.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Brassica 
rapa]
Length=892

 Score =   139 bits (350),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  626  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  685

Query  365  MQGNWFGIDDTKV  327
            ++GNWF IDD+++
Sbjct  686  LRGNWFRIDDSEI  698



>ref|XP_006416743.1| hypothetical protein EUTSA_v10006749mg [Eutrema salsugineum]
 gb|ESQ35096.1| hypothetical protein EUTSA_v10006749mg [Eutrema salsugineum]
Length=900

 Score =   139 bits (350),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  636  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  695

Query  365  MQGNWFGIDDTKV  327
            ++GNWF IDD+++
Sbjct  696  LRGNWFRIDDSEI  708



>gb|KDO45638.1| hypothetical protein CISIN_1g0014791mg, partial [Citrus sinensis]
 gb|KDO45639.1| hypothetical protein CISIN_1g0014791mg, partial [Citrus sinensis]
 gb|KDO45640.1| hypothetical protein CISIN_1g0014791mg, partial [Citrus sinensis]
Length=762

 Score =   138 bits (347),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+P+MTGT D PPLYMLY+V VHLDT NASFSGHY+SY+KD
Sbjct  691  QEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVHLDTQNASFSGHYVSYIKD  750

Query  365  MQGNWFGIDDTK  330
            MQG WF IDDT+
Sbjct  751  MQGTWFRIDDTQ  762



>gb|AAD50020.1|AC007651_15 Unknown protein [Arabidopsis thaliana]
Length=891

 Score =   137 bits (346),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  618  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  677

Query  365  MQGNWFGIDDTKV  327
            ++GNW+ IDD+++
Sbjct  678  LRGNWYRIDDSEI  690



>gb|KDO45637.1| hypothetical protein CISIN_1g0014791mg, partial [Citrus sinensis]
Length=818

 Score =   137 bits (346),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+P+MTGT D PPLYMLY+V VHLDT NASFSGHY+SY+KD
Sbjct  747  QEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVHLDTQNASFSGHYVSYIKD  806

Query  365  MQGNWFGIDDTK  330
            MQG WF IDDT+
Sbjct  807  MQGTWFRIDDTQ  818



>gb|AAG42756.1|AF302665_1 ubiquitin-specific protease 15 [Arabidopsis thaliana]
Length=924

 Score =   137 bits (346),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  651  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  710

Query  365  MQGNWFGIDDTKV  327
            ++GNW+ IDD+++
Sbjct  711  LRGNWYRIDDSEI  723



>ref|NP_564014.1| ubiquitin carboxyl-terminal hydrolase 15 [Arabidopsis thaliana]
 sp|Q9FPS9.2|UBP15_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 15; AltName: 
Full=Deubiquitinating enzyme 15; Short=AtUBP15; AltName: 
Full=Ubiquitin thioesterase 15; AltName: Full=Ubiquitin-specific-processing 
protease 15 [Arabidopsis thaliana]
 gb|AEE29542.1| ubiquitin carboxyl-terminal hydrolase 15 [Arabidopsis thaliana]
Length=924

 Score =   137 bits (346),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  651  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  710

Query  365  MQGNWFGIDDTKV  327
            ++GNW+ IDD+++
Sbjct  711  LRGNWYRIDDSEI  723



>ref|XP_002892935.1| ubiquitin-specific protease 15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69194.1| ubiquitin-specific protease 15 [Arabidopsis lyrata subsp. lyrata]
Length=926

 Score =   137 bits (346),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  655  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  714

Query  365  MQGNWFGIDDTKV  327
            ++GNW+ IDD+++
Sbjct  715  LRGNWYRIDDSEI  727



>ref|NP_001185019.1| ubiquitin carboxyl-terminal hydrolase 15 [Arabidopsis thaliana]
 gb|AEE29543.1| ubiquitin carboxyl-terminal hydrolase 15 [Arabidopsis thaliana]
Length=928

 Score =   137 bits (346),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCI+FPEMLDMIP+MT T DVPPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  655  QEGRYGKINKCISFPEMLDMIPFMTRTGDVPPLYMLYAVIVHLDTLNASFSGHYISYVKD  714

Query  365  MQGNWFGIDDTKV  327
            ++GNW+ IDD+++
Sbjct  715  LRGNWYRIDDSEI  727



>ref|XP_002530131.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32247.1| conserved hypothetical protein [Ricinus communis]
Length=870

 Score =   137 bits (346),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK ITFP+MLDMIPYMTGT D+PPLYMLYAV VHLDTLNASFSGHY++YVKD
Sbjct  581  QEGKHGKINKYITFPDMLDMIPYMTGTIDIPPLYMLYAVVVHLDTLNASFSGHYVAYVKD  640

Query  365  MQGNWFGIDDTKVK  324
            +QGNWF +DDT+V+
Sbjct  641  LQGNWFRVDDTEVR  654



>ref|XP_010279646.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
 ref|XP_010279647.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
 ref|XP_010279649.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
 ref|XP_010279650.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
 ref|XP_010279651.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
Length=1013

 Score =   137 bits (346),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D PPLYMLY V VHLDTLNASFSGHY+SYVKD
Sbjct  689  QKGKYGKINKCITFPDMLDMIPFMTGTGDSPPLYMLYGVVVHLDTLNASFSGHYVSYVKD  748

Query  365  MQGNWFGIDDTKVK  324
            M G W  IDDT+V+
Sbjct  749  MHGTWLRIDDTEVQ  762



>ref|XP_008781931.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782004.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782081.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782141.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782218.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782299.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782368.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782443.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782523.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782596.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Phoenix dactylifera]
Length=966

 Score =   137 bits (345),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP++TGT D PPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  671  QTGNYGKINKCVTFPDMLDMIPFVTGTADNPPLYMLYAVVVHLDTLNASFSGHYISYVKD  730

Query  365  MQGNWFGIDDTKVK  324
            +QG WF IDD++V+
Sbjct  731  LQGTWFRIDDSEVQ  744



>ref|XP_008782751.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Phoenix dactylifera]
Length=797

 Score =   136 bits (343),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP++TGT D PPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  502  QTGNYGKINKCVTFPDMLDMIPFVTGTADNPPLYMLYAVVVHLDTLNASFSGHYISYVKD  561

Query  365  MQGNWFGIDDTKVK  324
            +QG WF IDD++V+
Sbjct  562  LQGTWFRIDDSEVQ  575



>ref|XP_006477932.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X4 [Citrus sinensis]
Length=1015

 Score =   137 bits (345),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 58/73 (79%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFPEMLDM+P+MTGT D PPLYMLY+V VHLDT NASFSGHY+SY+KD
Sbjct  691  QEGRYGKINKCITFPEMLDMMPFMTGTGDTPPLYMLYSVVVHLDTQNASFSGHYVSYIKD  750

Query  365  MQGNWFGIDDTKV  327
            MQG WF IDD +V
Sbjct  751  MQGTWFRIDDMQV  763



>ref|XP_008226232.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Prunus mume]
 ref|XP_008226233.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Prunus mume]
 ref|XP_008226234.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Prunus mume]
Length=1003

 Score =   137 bits (344),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTG  D+PPLY+LYAV VHLDT NASFSGHY++YVKD
Sbjct  683  QEGKYGKINKCITFPDMLDMVPFMTGKGDIPPLYLLYAVVVHLDTQNASFSGHYVAYVKD  742

Query  365  MQGNWFGIDDTKVK  324
            M+GNWF IDDT+V+
Sbjct  743  MRGNWFRIDDTQVQ  756



>ref|XP_008226235.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Prunus mume]
Length=1002

 Score =   137 bits (344),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTG  D+PPLY+LYAV VHLDT NASFSGHY++YVKD
Sbjct  682  QEGKYGKINKCITFPDMLDMVPFMTGKGDIPPLYLLYAVVVHLDTQNASFSGHYVAYVKD  741

Query  365  MQGNWFGIDDTKVK  324
            M+GNWF IDDT+V+
Sbjct  742  MRGNWFRIDDTQVQ  755



>ref|XP_007211338.1| hypothetical protein PRUPE_ppa000901mg [Prunus persica]
 gb|EMJ12537.1| hypothetical protein PRUPE_ppa000901mg [Prunus persica]
Length=966

 Score =   137 bits (344),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDM+P+MTG  D+PPLY+LYAV VHLDT NASFSGHY++YVKD
Sbjct  646  QEGKYGKINKCITFPDMLDMVPFMTGKGDIPPLYLLYAVVVHLDTQNASFSGHYVAYVKD  705

Query  365  MQGNWFGIDDTKVK  324
            M+GNWF IDDT+V+
Sbjct  706  MRGNWFRIDDTQVQ  719



>ref|XP_008782673.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Phoenix dactylifera]
Length=888

 Score =   136 bits (343),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP++TGT D PPLYMLYAV VHLDTLNASFSGHYISYVKD
Sbjct  593  QTGNYGKINKCVTFPDMLDMIPFVTGTADNPPLYMLYAVVVHLDTLNASFSGHYISYVKD  652

Query  365  MQGNWFGIDDTKVK  324
            +QG WF IDD++V+
Sbjct  653  LQGTWFRIDDSEVQ  666



>gb|AFW65941.1| putative ubiquitin carboxyl-terminal hydrolase superfamily protein 
[Zea mays]
Length=90

 Score =   125 bits (313),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  8    QSGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  67

Query  365  MQGNWFGIDDTKVKFYIK  312
            MQG W  IDD++V+F  +
Sbjct  68   MQGTWLRIDDSEVRFTTR  85



>ref|XP_010062748.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X5 
[Eucalyptus grandis]
Length=947

 Score =   136 bits (342),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKI KCITFPEMLDMIPYMTG  D+PPLYMLYAV VHLDT NASFSGHY+SYV++
Sbjct  620  QEGRYGKITKCITFPEMLDMIPYMTGKGDMPPLYMLYAVVVHLDTQNASFSGHYVSYVRN  679

Query  365  MQGNWFGIDDTKVK  324
            ++GNWF IDDT+V+
Sbjct  680  LRGNWFRIDDTEVQ  693



>ref|XP_010062747.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X4 
[Eucalyptus grandis]
 gb|KCW69874.1| hypothetical protein EUGRSUZ_F03211 [Eucalyptus grandis]
Length=965

 Score =   136 bits (342),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKI KCITFPEMLDMIPYMTG  D+PPLYMLYAV VHLDT NASFSGHY+SYV++
Sbjct  638  QEGRYGKITKCITFPEMLDMIPYMTGKGDMPPLYMLYAVVVHLDTQNASFSGHYVSYVRN  697

Query  365  MQGNWFGIDDTKVK  324
            ++GNWF IDDT+V+
Sbjct  698  LRGNWFRIDDTEVQ  711



>ref|XP_010062746.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X3 
[Eucalyptus grandis]
 gb|KCW69873.1| hypothetical protein EUGRSUZ_F03211 [Eucalyptus grandis]
Length=966

 Score =   136 bits (342),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKI KCITFPEMLDMIPYMTG  D+PPLYMLYAV VHLDT NASFSGHY+SYV++
Sbjct  639  QEGRYGKITKCITFPEMLDMIPYMTGKGDMPPLYMLYAVVVHLDTQNASFSGHYVSYVRN  698

Query  365  MQGNWFGIDDTKVK  324
            ++GNWF IDDT+V+
Sbjct  699  LRGNWFRIDDTEVQ  712



>ref|XP_010062745.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Eucalyptus grandis]
Length=970

 Score =   136 bits (342),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKI KCITFPEMLDMIPYMTG  D+PPLYMLYAV VHLDT NASFSGHY+SYV++
Sbjct  643  QEGRYGKITKCITFPEMLDMIPYMTGKGDMPPLYMLYAVVVHLDTQNASFSGHYVSYVRN  702

Query  365  MQGNWFGIDDTKVK  324
            ++GNWF IDDT+V+
Sbjct  703  LRGNWFRIDDTEVQ  716



>ref|XP_010062743.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Eucalyptus grandis]
Length=972

 Score =   136 bits (342),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/74 (78%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKI KCITFPEMLDMIPYMTG  D+PPLYMLYAV VHLDT NASFSGHY+SYV++
Sbjct  645  QEGRYGKITKCITFPEMLDMIPYMTGKGDMPPLYMLYAVVVHLDTQNASFSGHYVSYVRN  704

Query  365  MQGNWFGIDDTKVK  324
            ++GNWF IDDT+V+
Sbjct  705  LRGNWFRIDDTEVQ  718



>ref|XP_008382966.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Malus domestica]
Length=1008

 Score =   136 bits (342),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY V VHLDT NASFSGHY++YVKD
Sbjct  688  QEGNYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  747

Query  365  MQGNWFGIDDTKV  327
            M+G+WF IDDT+V
Sbjct  748  MRGDWFRIDDTEV  760



>ref|XP_009354862.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X4 [Pyrus x bretschneideri]
Length=1004

 Score =   136 bits (342),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY V VHLDT NASFSGHY++YVKD
Sbjct  682  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  741

Query  365  MQGNWFGIDDTKV  327
            M+G+WF IDDT+V
Sbjct  742  MRGDWFRIDDTEV  754



>ref|XP_009354860.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Pyrus x bretschneideri]
Length=1010

 Score =   135 bits (341),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY V VHLDT NASFSGHY++YVKD
Sbjct  688  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  747

Query  365  MQGNWFGIDDTKV  327
            M+G+WF IDDT+V
Sbjct  748  MRGDWFRIDDTEV  760



>ref|XP_008382965.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Malus domestica]
Length=1032

 Score =   135 bits (341),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY V VHLDT NASFSGHY++YVKD
Sbjct  712  QEGNYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  771

Query  365  MQGNWFGIDDTKV  327
            M+G+WF IDDT+V
Sbjct  772  MRGDWFRIDDTEV  784



>ref|XP_009367759.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Pyrus x bretschneideri]
Length=1009

 Score =   135 bits (341),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY V VHLDT NASFSGHY++YVKD
Sbjct  688  QEGNYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  747

Query  365  MQGNWFGIDDTKV  327
            M+G+WF IDDT+V
Sbjct  748  MRGDWFRIDDTEV  760



>ref|XP_009354861.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Pyrus x bretschneideri]
Length=1010

 Score =   135 bits (340),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY V VHLDT NASFSGHY++YVKD
Sbjct  682  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  741

Query  365  MQGNWFGIDDTKV  327
            M+G+WF IDDT+V
Sbjct  742  MRGDWFRIDDTEV  754



>ref|XP_009354859.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Pyrus x bretschneideri]
Length=1016

 Score =   135 bits (340),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY V VHLDT NASFSGHY++YVKD
Sbjct  688  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  747

Query  365  MQGNWFGIDDTKV  327
            M+G+WF IDDT+V
Sbjct  748  MRGDWFRIDDTEV  760



>ref|XP_008356195.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Malus domestica]
Length=1005

 Score =   135 bits (340),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY V VHLDT NASFSGHY++YVKD
Sbjct  682  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  741

Query  365  MQGNWFGIDDTKV  327
            M+G+WF IDDT+V
Sbjct  742  MRGDWFRIDDTEV  754



>ref|XP_009354863.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X5 [Pyrus x bretschneideri]
Length=1001

 Score =   135 bits (340),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY V VHLDT NASFSGHY++YVKD
Sbjct  688  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  747

Query  365  MQGNWFGIDDTKV  327
            M+G+WF IDDT+V
Sbjct  748  MRGDWFRIDDTEV  760



>ref|XP_008356196.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Malus domestica]
Length=1004

 Score =   135 bits (340),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY V VHLDT NASFSGHY++YVKD
Sbjct  681  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  740

Query  365  MQGNWFGIDDTKV  327
            M+G+WF IDDT+V
Sbjct  741  MRGDWFRIDDTEV  753



>ref|XP_009367758.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Pyrus x bretschneideri]
Length=1032

 Score =   135 bits (340),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY V VHLDT NASFSGHY++YVKD
Sbjct  711  QEGNYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  770

Query  365  MQGNWFGIDDTKV  327
            M+G+WF IDDT+V
Sbjct  771  MRGDWFRIDDTEV  783



>ref|XP_008356197.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X3 [Malus domestica]
Length=990

 Score =   135 bits (340),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 57/73 (78%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTGT D+PPLY+LY V VHLDT NASFSGHY++YVKD
Sbjct  682  QEGKYGKINKCITFPDMLDMIPFMTGTGDIPPLYLLYGVVVHLDTQNASFSGHYVAYVKD  741

Query  365  MQGNWFGIDDTKV  327
            M+G+WF IDDT+V
Sbjct  742  MRGDWFRIDDTEV  754



>ref|XP_010915558.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Elaeis 
guineensis]
Length=952

 Score =   135 bits (339),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP++TGT D PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  670  QTGKYGKINKCVTFPDMLDMIPFVTGTADNPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  729

Query  365  MQGNWFGIDDTKVK  324
            +QG W  IDD++V+
Sbjct  730  LQGTWLRIDDSEVQ  743



>ref|XP_008783949.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Phoenix 
dactylifera]
Length=954

 Score =   134 bits (337),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP++TGT D PPLYMLYAV VHLDTLNASFSGHY+SYVKD
Sbjct  665  QTGKYGKINKCVTFPDMLDMIPFVTGTADNPPLYMLYAVVVHLDTLNASFSGHYVSYVKD  724

Query  365  MQGNWFGIDDTKVK  324
            +QG W  IDD +V+
Sbjct  725  LQGTWLRIDDCEVQ  738



>ref|XP_010925671.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
15-like [Elaeis guineensis]
Length=908

 Score =   134 bits (336),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP++TGT D PPLYMLYAV VHLD LNASFSGHY+SYVKD
Sbjct  615  QTGNYGKINKCVTFPDMLDMIPFVTGTADNPPLYMLYAVVVHLDNLNASFSGHYVSYVKD  674

Query  365  MQGNWFGIDDTKVK  324
            ++G WF IDD++V+
Sbjct  675  LEGTWFRIDDSEVQ  688



>ref|XP_009390669.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
15-like [Musa acuminata subsp. malaccensis]
Length=960

 Score =   133 bits (335),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDMIP+MTGT D PPLY+LYAV VHLD  NASFSGHY+SYVKD
Sbjct  666  QTGKYGKINKCVTFPDMLDMIPFMTGTADNPPLYLLYAVVVHLDAFNASFSGHYVSYVKD  725

Query  365  MQGNWFGIDDTKVK  324
            ++G WF IDD++V+
Sbjct  726  LEGTWFKIDDSEVQ  739



>ref|XP_010274759.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
 ref|XP_010274766.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Nelumbo 
nucifera]
Length=998

 Score =   133 bits (335),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKCITFP+MLDMIP+MTG  D PPLY+LYAV VHLDTLNASFSGHY++YVKD
Sbjct  686  QTGKYGKINKCITFPDMLDMIPFMTGIGDSPPLYLLYAVVVHLDTLNASFSGHYVAYVKD  745

Query  365  MQGNWFGIDDTKVK  324
            +QG W  IDDT+V+
Sbjct  746  LQGIWLRIDDTEVQ  759



>ref|XP_006840775.1| hypothetical protein AMTR_s00096p00170210 [Amborella trichopoda]
 gb|ERN02450.1| hypothetical protein AMTR_s00096p00170210 [Amborella trichopoda]
Length=765

 Score =   130 bits (328),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -1

Query  533  YGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKDMQGN  354
            YGK+NKC+TFP+MLDMIPYMTGT D PPLYMLY V VHLD+ NASFSGHY+SYVKD+QG 
Sbjct  474  YGKLNKCVTFPDMLDMIPYMTGTGDSPPLYMLYGVVVHLDSSNASFSGHYVSYVKDLQGA  533

Query  353  WFGIDDTKVK  324
            WF IDDT+V+
Sbjct  534  WFRIDDTEVE  543



>gb|AFW71122.1| putative ubiquitin carboxyl-terminal hydrolase superfamily protein 
[Zea mays]
Length=821

 Score =   129 bits (323),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  567  QSGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  626

Query  365  MQGNWFGIDDTKVK  324
            MQG W  IDD++V+
Sbjct  627  MQGTWLRIDDSEVQ  640



>ref|XP_010234088.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X2 
[Brachypodium distachyon]
Length=940

 Score =   129 bits (324),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFPEMLDM+P++TG  D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  617  QTGKYGKINKCVTFPEMLDMVPFVTGAGDHPPLYFLYAVVVHVDTENASFSGHYISYVKD  676

Query  365  MQGNWFGIDDTKVK  324
            MQG W  IDD++VK
Sbjct  677  MQGTWLRIDDSEVK  690



>ref|XP_003571975.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 isoform X1 
[Brachypodium distachyon]
Length=971

 Score =   129 bits (324),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFPEMLDM+P++TG  D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  648  QTGKYGKINKCVTFPEMLDMVPFVTGAGDHPPLYFLYAVVVHVDTENASFSGHYISYVKD  707

Query  365  MQGNWFGIDDTKVK  324
            MQG W  IDD++VK
Sbjct  708  MQGTWLRIDDSEVK  721



>gb|AFW71123.1| putative ubiquitin carboxyl-terminal hydrolase superfamily protein 
[Zea mays]
Length=890

 Score =   129 bits (323),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  567  QSGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  626

Query  365  MQGNWFGIDDTKVK  324
            MQG W  IDD++V+
Sbjct  627  MQGTWLRIDDSEVQ  640



>ref|XP_008645575.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Zea 
mays]
Length=973

 Score =   128 bits (322),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  650  QSGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  709

Query  365  MQGNWFGIDDTKVK  324
            MQG W  IDD++V+
Sbjct  710  MQGTWLRIDDSEVQ  723



>ref|XP_002453597.1| hypothetical protein SORBIDRAFT_04g008750 [Sorghum bicolor]
 gb|EES06573.1| hypothetical protein SORBIDRAFT_04g008750 [Sorghum bicolor]
Length=966

 Score =   128 bits (321),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  650  QSGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  709

Query  365  MQGNWFGIDDTKVK  324
            MQG W  IDD++V+
Sbjct  710  MQGTWLRIDDSEVQ  723



>ref|XP_008679796.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Zea 
mays]
Length=970

 Score =   128 bits (321),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  650  QSGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  709

Query  365  MQGNWFGIDDTKVK  324
            MQG W  IDD++V+
Sbjct  710  MQGTWLRIDDSEVQ  723



>ref|XP_006647115.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like [Oryza 
brachyantha]
Length=973

 Score =   127 bits (319),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  651  QSGKYGKINKCVTFPDMLDMVPFVTGAGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  710

Query  365  MQGNWFGIDDTKVK  324
            MQG W  IDD++V+
Sbjct  711  MQGTWLRIDDSEVQ  724



>dbj|BAJ87234.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=979

 Score =   127 bits (319),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  656  QTGKYGKINKCVTFPDMLDMVPFVTGAGDHPPLYFLYAVVVHVDTENASFSGHYISYVKD  715

Query  365  MQGNWFGIDDTKVK  324
            MQG W  IDD++VK
Sbjct  716  MQGTWLRIDDSEVK  729



>gb|EEE56641.1| hypothetical protein OsJ_06049 [Oryza sativa Japonica Group]
Length=897

 Score =   127 bits (318),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  562  QTGKYGKINKCVTFPDMLDMVPFVTGAGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  621

Query  365  MQGNWFGIDDTKVK  324
            MQG W  IDD++V+
Sbjct  622  MQGTWLRIDDSEVQ  635



>gb|AFW65940.1| putative ubiquitin carboxyl-terminal hydrolase superfamily protein 
[Zea mays]
Length=489

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  169  QSGKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  228

Query  365  MQGNWFGIDDTKVK  324
            MQG W  IDD++V+
Sbjct  229  MQGTWLRIDDSEVQ  242



>gb|EMS59305.1| Ubiquitin carboxyl-terminal hydrolase 15 [Triticum urartu]
Length=962

 Score =   127 bits (318),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  587  QTGKYGKINKCVTFPDMLDMVPFVTGAGDHPPLYFLYAVVVHVDTENASFSGHYISYVKD  646

Query  365  MQGNWFGIDDTKVK  324
            MQG W  IDD++VK
Sbjct  647  MQGTWLRIDDSEVK  660



>gb|EEC72815.1| hypothetical protein OsI_06524 [Oryza sativa Indica Group]
Length=808

 Score =   126 bits (316),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  487  QTGKYGKINKCVTFPDMLDMVPFVTGAGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  546

Query  365  MQGNWFGIDDTKVK  324
            MQG W  IDD++V+
Sbjct  547  MQGTWLRIDDSEVQ  560



>ref|NP_001046415.1| Os02g0244300 [Oryza sativa Japonica Group]
 dbj|BAF08329.1| Os02g0244300 [Oryza sativa Japonica Group]
Length=975

 Score =   126 bits (317),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  654  QTGKYGKINKCVTFPDMLDMVPFVTGAGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  713

Query  365  MQGNWFGIDDTKVK  324
            MQG W  IDD++V+
Sbjct  714  MQGTWLRIDDSEVQ  727



>dbj|BAD28270.1| putative ubiquitin-specific protease [Oryza sativa Japonica Group]
Length=919

 Score =   126 bits (316),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  598  QTGKYGKINKCVTFPDMLDMVPFVTGAGDNPPLYFLYAVVVHVDTENASFSGHYISYVKD  657

Query  365  MQGNWFGIDDTKVK  324
            MQG W  IDD++V+
Sbjct  658  MQGTWLRIDDSEVQ  671



>ref|XP_004951331.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X1 [Setaria italica]
 ref|XP_004951332.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15-like isoform 
X2 [Setaria italica]
Length=976

 Score =   126 bits (316),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -1

Query  539  GCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKDMQ  360
            G YGKINKC+TFP+MLDM+P++TG+ D PPLY LYAV VH+DT NASFSGHYISYVKDMQ
Sbjct  656  GKYGKINKCVTFPDMLDMVPFVTGSGDNPPLYFLYAVVVHVDTENASFSGHYISYVKDMQ  715

Query  359  GNWFGIDDTKVK  324
            G W  IDD++V+
Sbjct  716  GTWLRIDDSEVQ  727



>gb|EMT09965.1| Ubiquitin carboxyl-terminal hydrolase 15 [Aegilops tauschii]
Length=664

 Score =   124 bits (312),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 54/73 (74%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGKINKC+TFP+MLDM+P++TG  D PPLY LYAV VH+DT NASFSGHYISYVKD
Sbjct  584  QTGKYGKINKCVTFPDMLDMVPFVTGAGDHPPLYFLYAVVVHVDTENASFSGHYISYVKD  643

Query  365  MQGNWFGIDDTKV  327
            MQG W  IDD++V
Sbjct  644  MQGTWLRIDDSEV  656



>ref|XP_006841208.1| hypothetical protein AMTR_s00135p00021060 [Amborella trichopoda]
 gb|ERN02883.1| hypothetical protein AMTR_s00135p00021060 [Amborella trichopoda]
Length=1083

 Score =   113 bits (282),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE LD+ PYMTG  D  PLY LYAV VHLD +NASFSGHY+ YV+ 
Sbjct  745  QSGKFGKLNKSVRFPETLDLSPYMTGESDKSPLYKLYAVVVHLDIMNASFSGHYVCYVRS  804

Query  365  MQGNWFGIDDTKVK  324
            +QG W+ IDD+KVK
Sbjct  805  LQGKWYKIDDSKVK  818



>ref|XP_002970813.1| hypothetical protein SELMODRAFT_171601 [Selaginella moellendorffii]
 gb|EFJ28139.1| hypothetical protein SELMODRAFT_171601 [Selaginella moellendorffii]
Length=419

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            QGG +GKINK +TFPE LDM+PYM+GT D PP Y LYAV VH+D LNAS+ GHY+ YV+ 
Sbjct  327  QGGKFGKINKKVTFPEELDMVPYMSGTVDTPPAYKLYAVVVHVDMLNASYFGHYVCYVRA  386

Query  365  MQGNWFGIDDTKVK  324
              G WF +DD+KVK
Sbjct  387  GNGAWFKVDDSKVK  400



>ref|XP_003613074.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=1096

 Score =   110 bits (275),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 62/154 (40%), Positives = 85/154 (55%), Gaps = 22/154 (14%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G + K+NK + FPE+LDM PYM+G  D  P Y LYAV VHLD +NASFSGHY+ YVK+
Sbjct  746  QSGNFEKLNKSVQFPEVLDMTPYMSGRKDKSPFYSLYAVVVHLDIMNASFSGHYVCYVKN  805

Query  365  MQGNWFGIDDTKVKFYIKLYCFC---FSNCRGKIQTel**lgklneekGI*klllmcals  195
            +QG WF  DD++V+ +  ++      FS    K++                   L     
Sbjct  806  IQGEWFRTDDSRVRTFKHIFFVSEGLFSLLPPKMR-------------------LYKLKK  846

Query  194  llsgktglsk*QVEQVPMSRVMTEGAYILFYMRY  93
            L   +  L    VE V +SRV++E AY+L Y R+
Sbjct  847  LWHYRDALKATCVEPVELSRVLSESAYMLLYARH  880



>emb|CBI19252.3| unnamed protein product [Vitis vinifera]
Length=841

 Score =   110 bits (274),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P+M+GT D  P+Y LYAV VHLD +NA+FSGHY+ YVK+
Sbjct  683  QSGKFGKLNKSIRFPEILDLAPFMSGTSDKSPIYRLYAVVVHLDIMNAAFSGHYVCYVKN  742

Query  365  MQGNWFGIDDTKVK  324
            +Q  WF IDD+ VK
Sbjct  743  IQNKWFKIDDSTVK  756



>ref|XP_010916668.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X2 [Elaeis guineensis]
Length=1022

 Score =   110 bits (274),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE LD+ PYM+GT+D  PLY LYAV VHLD +NA+FSGHY+ YVK 
Sbjct  731  QSGKFGKLNKAVKFPEYLDLAPYMSGTNDKSPLYRLYAVVVHLDVMNAAFSGHYVCYVKS  790

Query  365  MQGNWFGIDDTKVK  324
             QG W+  DD+ VK
Sbjct  791  TQGKWYKTDDSMVK  804



>ref|XP_010664385.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 isoform X2 
[Vitis vinifera]
Length=1207

 Score =   110 bits (274),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P+M+GT D  P+Y LYAV VHLD +NA+FSGHY+ YVK+
Sbjct  855  QSGKFGKLNKSIRFPEILDLAPFMSGTSDKSPIYRLYAVVVHLDIMNAAFSGHYVCYVKN  914

Query  365  MQGNWFGIDDTKVK  324
            +Q  WF IDD+ VK
Sbjct  915  IQNKWFKIDDSTVK  928



>ref|XP_010664383.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 isoform X1 
[Vitis vinifera]
 ref|XP_010664384.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 isoform X1 
[Vitis vinifera]
 emb|CAN74012.1| hypothetical protein VITISV_003549 [Vitis vinifera]
Length=1225

 Score =   110 bits (274),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P+M+GT D  P+Y LYAV VHLD +NA+FSGHY+ YVK+
Sbjct  873  QSGKFGKLNKSIRFPEILDLAPFMSGTSDKSPIYRLYAVVVHLDIMNAAFSGHYVCYVKN  932

Query  365  MQGNWFGIDDTKVK  324
            +Q  WF IDD+ VK
Sbjct  933  IQNKWFKIDDSTVK  946



>gb|KJB64168.1| hypothetical protein B456_010G035400 [Gossypium raimondii]
Length=914

 Score =   109 bits (273),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PY +GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  803  QSGKFGKLNKAIQFPEILNLAPYTSGTSDNSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  862

Query  365  MQGNWFGIDDTKVKFYIKLYCFCFS  291
             Q  WF IDD+KV + I + C  +S
Sbjct  863  AQNKWFKIDDSKVMYSIIIICIFWS  887



>ref|XP_007158378.1| hypothetical protein PHAVU_002G148100g [Phaseolus vulgaris]
 gb|ESW30372.1| hypothetical protein PHAVU_002G148100g [Phaseolus vulgaris]
Length=925

 Score =   109 bits (272),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G + K+NK + FPE+LDM PYM+GT D  PLY LYAV VHLD +NA+FSGHY+ YVK+
Sbjct  615  QSGNFEKLNKSVQFPEVLDMAPYMSGTKDKSPLYSLYAVVVHLDIMNAAFSGHYVCYVKN  674

Query  365  MQGNWFGIDDTKVK  324
            +QG WF  DD++V+
Sbjct  675  IQGEWFRTDDSRVE  688



>ref|XP_002969545.1| hypothetical protein SELMODRAFT_91996, partial [Selaginella moellendorffii]
 gb|EFJ29633.1| hypothetical protein SELMODRAFT_91996, partial [Selaginella moellendorffii]
Length=374

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            QGG +GKINK +TFPE LDM+PYM+GT D PP Y LYAV VH+D LNAS+ GHY+ YV+ 
Sbjct  296  QGGKFGKINKKVTFPEELDMVPYMSGTVDTPPAYELYAVVVHVDMLNASYFGHYVCYVRA  355

Query  365  MQGNWFGIDDTKVKFYIKL  309
              G WF +DD+KV    K 
Sbjct  356  GNGAWFKVDDSKVSRRWKF  374



>ref|XP_002514028.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48611.1| conserved hypothetical protein [Ricinus communis]
Length=1060

 Score =   109 bits (272),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V VHLD +NASFSGHY+ YVK+
Sbjct  735  QSGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVVVHLDIMNASFSGHYVCYVKN  794

Query  365  MQGNWFGIDDTKV  327
            +Q  WF IDD+ V
Sbjct  795  VQNKWFKIDDSTV  807



>ref|XP_001772702.1| predicted protein [Physcomitrella patens]
 gb|EDQ62416.1| predicted protein, partial [Physcomitrella patens]
Length=428

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFP+ LDM PYM+GT+D  PLY LYAV VH+D LNASF GHYI YVKD
Sbjct  336  QSGKFGKLNKRVTFPKTLDMSPYMSGTNDDSPLYGLYAVVVHVDLLNASFFGHYICYVKD  395

Query  365  MQGNWFGIDDTKVK  324
              G W+ IDD+KVK
Sbjct  396  SNGVWYKIDDSKVK  409



>ref|XP_008795170.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X4 [Phoenix dactylifera]
Length=1019

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE LD+ PYM+GT+D  P+Y LYAV VHLD +NA+FSGHY+ YVK 
Sbjct  728  QSGKFGKLNKAVRFPEYLDLAPYMSGTNDKSPVYRLYAVVVHLDVMNAAFSGHYVCYVKS  787

Query  365  MQGNWFGIDDTKVK  324
             QG W+  DD+ VK
Sbjct  788  TQGKWYKTDDSMVK  801



>ref|XP_008795169.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X3 [Phoenix dactylifera]
Length=1024

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE LD+ PYM+GT+D  P+Y LYAV VHLD +NA+FSGHY+ YVK 
Sbjct  733  QSGKFGKLNKAVRFPEYLDLAPYMSGTNDKSPVYRLYAVVVHLDVMNAAFSGHYVCYVKS  792

Query  365  MQGNWFGIDDTKVK  324
             QG W+  DD+ VK
Sbjct  793  TQGKWYKTDDSMVK  806



>ref|XP_008802270.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Phoenix 
dactylifera]
Length=1046

 Score =   108 bits (270),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE LD+  YM+GTDD  P+Y LYAV VHLD +NASFSGHY+ YV+D
Sbjct  721  QSGKFGKLNKSIRFPEYLDLARYMSGTDDKFPVYRLYAVVVHLDIMNASFSGHYVCYVRD  780

Query  365  MQGNWFGIDDTKVK  324
             QG W+  DD+ VK
Sbjct  781  TQGKWYKTDDSTVK  794



>ref|XP_009387155.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Musa 
acuminata subsp. malaccensis]
Length=1015

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE LD+ PYM G++D  P+Y LYAV VHLD +NASFSGHY+ YVK+
Sbjct  695  QSGKFGKLNKAVCFPEYLDLAPYMHGSNDKSPMYKLYAVVVHLDVMNASFSGHYVCYVKN  754

Query  365  MQGNWFGIDDTKVK  324
             QG W+  DD+ VK
Sbjct  755  RQGKWYKTDDSTVK  768



>ref|XP_010916667.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X1 [Elaeis guineensis]
Length=1027

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            + G +GK+NK + FPE LD+ PYM+GT+D  PLY LYAV VHLD +NA+FSGHY+ YVK 
Sbjct  736  KSGKFGKLNKAVKFPEYLDLAPYMSGTNDKSPLYRLYAVVVHLDVMNAAFSGHYVCYVKS  795

Query  365  MQGNWFGIDDTKVK  324
             QG W+  DD+ VK
Sbjct  796  TQGKWYKTDDSMVK  809



>gb|KHN14516.1| Ubiquitin carboxyl-terminal hydrolase 17 [Glycine soja]
Length=874

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G + K+NK + FPE+L+M PYM+GT D  PLY LYAV VHLD +NA+FSGHY+ YVK+
Sbjct  569  QSGNFEKLNKSVQFPEVLNMAPYMSGTKDKSPLYSLYAVVVHLDIMNAAFSGHYVCYVKN  628

Query  365  MQGNWFGIDDTKVK  324
            +QG WF  DD++V+
Sbjct  629  IQGEWFRTDDSRVE  642



>ref|XP_010939750.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 15 [Elaeis guineensis]
Length=1046

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/74 (64%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q   +GK+NK I FPE LD+  YM+GTDD  P+Y LYAV VHLD +NASFSGHY+ YVKD
Sbjct  728  QSDKFGKLNKSIRFPEYLDLARYMSGTDDKFPVYRLYAVVVHLDIMNASFSGHYVCYVKD  787

Query  365  MQGNWFGIDDTKVK  324
             QG W+ IDD+ VK
Sbjct  788  TQGKWYKIDDSMVK  801



>ref|XP_001774704.1| predicted protein [Physcomitrella patens]
 gb|EDQ60519.1| predicted protein [Physcomitrella patens]
Length=411

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE+LDM PYM+G +D P LY LYAV VH+D LNASF GHYI +VKD
Sbjct  330  QSGKFGKLNKRVTFPEVLDMSPYMSGANDHPLLYRLYAVVVHVDMLNASFFGHYICFVKD  389

Query  365  MQGNWFGIDDTKV-KFYIKLYC  303
              G W+ IDD KV + Y++  C
Sbjct  390  SNGVWYKIDDRKVQRHYLRAVC  411



>ref|XP_010277575.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Nelumbo 
nucifera]
Length=742

 Score =   107 bits (267),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE+L++ PYM  T D  P+Y LYAV VHLD +NA+FSGHYI Y+K+
Sbjct  381  QTGKFGKLNKLVRFPEVLNLTPYMNATSDKSPVYTLYAVVVHLDIMNAAFSGHYICYIKN  440

Query  365  MQGNWFGIDDTKVK  324
             QG WF IDD+ VK
Sbjct  441  FQGKWFKIDDSMVK  454



>ref|XP_011013097.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X2 [Populus euphratica]
Length=1103

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  779  QSGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKN  838

Query  365  MQGNWFGIDDTKV  327
            +Q  WF IDD+ V
Sbjct  839  IQNKWFKIDDSTV  851



>ref|XP_011013096.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X1 [Populus euphratica]
Length=1127

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  803  QSGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKN  862

Query  365  MQGNWFGIDDTKV  327
            +Q  WF IDD+ V
Sbjct  863  IQNKWFKIDDSTV  875



>ref|XP_011016915.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 isoform X2 
[Populus euphratica]
Length=1137

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  811  QSGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKN  870

Query  365  MQGNWFGIDDTKV  327
            +Q  WF IDD+ V
Sbjct  871  IQNKWFKIDDSTV  883



>ref|XP_011016914.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 isoform X1 
[Populus euphratica]
Length=1139

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  813  QSGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKN  872

Query  365  MQGNWFGIDDTKV  327
            +Q  WF IDD+ V
Sbjct  873  IQNKWFKIDDSTV  885



>ref|XP_002301091.2| UBIQUITIN-SPECIFIC PROTEASE 16 family protein [Populus trichocarpa]
 gb|EEE80364.2| UBIQUITIN-SPECIFIC PROTEASE 16 family protein [Populus trichocarpa]
Length=1141

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  815  QSGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKN  874

Query  365  MQGNWFGIDDTKV  327
            +Q  WF IDD+ V
Sbjct  875  IQNKWFKIDDSTV  887



>ref|XP_002307344.2| hypothetical protein POPTR_0005s17820g [Populus trichocarpa]
 gb|EEE94340.2| hypothetical protein POPTR_0005s17820g [Populus trichocarpa]
Length=1125

 Score =   107 bits (268),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  803  QSGKFGKLNKSIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDVMNAAFSGHYVCYVKN  862

Query  365  MQGNWFGIDDTKV  327
            +Q  WF IDD+ V
Sbjct  863  IQNKWFKIDDSTV  875



>gb|AES96032.2| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=943

 Score =   107 bits (267),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G + K+NK + FPE+LDM PYM+G  D  P Y LYAV VHLD +NASFSGHY+ YVK+
Sbjct  634  QSGNFEKLNKSVQFPEVLDMTPYMSGRKDKSPFYSLYAVVVHLDIMNASFSGHYVCYVKN  693

Query  365  MQGNWFGIDDTKVK  324
            +QG WF  DD++V+
Sbjct  694  IQGEWFRTDDSRVE  707



>gb|KHG13290.1| Ubiquitin carboxyl-terminal hydrolase 16 -like protein [Gossypium 
arboreum]
Length=1070

 Score =   107 bits (267),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  804  QSGKFGKLNKAIQFPEILNLAPYMSGTSDNSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  863

Query  365  MQGNWFGIDDTKV  327
             Q  WF IDD+KV
Sbjct  864  AQNKWFKIDDSKV  876



>gb|KDP41469.1| hypothetical protein JCGZ_15876 [Jatropha curcas]
Length=1103

 Score =   107 bits (266),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PY++GT D  P+Y LY V VHLD +NASFSGHY+ Y+K+
Sbjct  794  QSGKFGKLNKSIRFPEILDLAPYISGTSDKSPIYRLYGVVVHLDIMNASFSGHYVCYIKN  853

Query  365  MQGNWFGIDDTKV  327
            +Q  WF IDD+ V
Sbjct  854  IQNKWFKIDDSTV  866



>ref|XP_008795168.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X2 [Phoenix dactylifera]
Length=1024

 Score =   107 bits (266),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            + G +GK+NK + FPE LD+ PYM+GT+D  P+Y LYAV VHLD +NA+FSGHY+ YVK 
Sbjct  733  KSGKFGKLNKAVRFPEYLDLAPYMSGTNDKSPVYRLYAVVVHLDVMNAAFSGHYVCYVKS  792

Query  365  MQGNWFGIDDTKVK  324
             QG W+  DD+ VK
Sbjct  793  TQGKWYKTDDSMVK  806



>ref|XP_008795167.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform 
X1 [Phoenix dactylifera]
Length=1029

 Score =   107 bits (266),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            + G +GK+NK + FPE LD+ PYM+GT+D  P+Y LYAV VHLD +NA+FSGHY+ YVK 
Sbjct  738  KSGKFGKLNKAVRFPEYLDLAPYMSGTNDKSPVYRLYAVVVHLDVMNAAFSGHYVCYVKS  797

Query  365  MQGNWFGIDDTKVK  324
             QG W+  DD+ VK
Sbjct  798  TQGKWYKTDDSMVK  811



>ref|XP_009761470.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Nicotiana 
sylvestris]
Length=1175

 Score =   106 bits (265),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YV++
Sbjct  847  QSGKFGKLNKTIKFPEILNLAPYMSGTSDKSPVYQLYGVVVHLDVMNAAFSGHYVCYVRN  906

Query  365  MQGNWFGIDDTKVK  324
             Q  WF +DD+ VK
Sbjct  907  FQNRWFKVDDSSVK  920



>emb|CDP11495.1| unnamed protein product [Coffea canephora]
Length=1177

 Score =   106 bits (265),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  834  QSGKFGKLNKTIRFPEILDLAPYMSGTSDKSPIYRLYGVIVHLDIMNAAFSGHYVCYVKN  893

Query  365  MQGNWFGIDDTKV  327
             Q  WF IDD+ V
Sbjct  894  TQNKWFKIDDSMV  906



>ref|XP_004489806.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Cicer 
arietinum]
Length=936

 Score =   106 bits (265),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G + K+NK + FPE+L+M PYM+GT D  PLY LYAV VHLD +NA+FSGHYI YVK+
Sbjct  633  QSGNFEKLNKSVQFPEVLNMAPYMSGTKDKSPLYSLYAVVVHLDIMNAAFSGHYICYVKN  692

Query  365  MQGNWFGIDDTKVK  324
             +G WF  DD+KV+
Sbjct  693  NRGEWFRTDDSKVE  706



>ref|XP_004301361.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 [Fragaria 
vesca subsp. vesca]
Length=1140

 Score =   106 bits (265),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE+L++ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  816  QSGKFGKINKPIRFPEILNLAPYMSGTSDKSPIYKLYGVVVHLDVMNAAFSGHYVCYVKN  875

Query  365  MQGNWFGIDDTKV  327
            +Q  WF +DD+ V
Sbjct  876  LQNKWFKVDDSTV  888



>ref|XP_007018207.1| Ubiquitin-specific protease 16, putative isoform 1 [Theobroma 
cacao]
 gb|EOY15432.1| Ubiquitin-specific protease 16, putative isoform 1 [Theobroma 
cacao]
Length=1138

 Score =   106 bits (264),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  809  QSGKFGKLNKAIRFPEILNLAPYMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  868

Query  365  MQGNWFGIDDTKV  327
            +Q  WF IDD+ V
Sbjct  869  VQNKWFKIDDSTV  881



>ref|XP_007018208.1| Ubiquitin-specific protease 16, putative isoform 2 [Theobroma 
cacao]
 gb|EOY15433.1| Ubiquitin-specific protease 16, putative isoform 2 [Theobroma 
cacao]
Length=1139

 Score =   106 bits (264),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  809  QSGKFGKLNKAIRFPEILNLAPYMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  868

Query  365  MQGNWFGIDDTKV  327
            +Q  WF IDD+ V
Sbjct  869  VQNKWFKIDDSTV  881



>ref|XP_010525922.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19 [Tarenaya 
hassleriana]
 ref|XP_010525923.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19 [Tarenaya 
hassleriana]
Length=603

 Score =   105 bits (261),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            QGG +GK+NK I+FPE LD+ PY +G  D   +YMLYAV VHLD LNASF GHYI Y+KD
Sbjct  386  QGGRFGKLNKKISFPETLDLSPYSSGGGDSTDVYMLYAVIVHLDMLNASFFGHYICYIKD  445

Query  365  MQGNWFGIDDTKVK  324
             +GNW+ IDD++V+
Sbjct  446  FRGNWYRIDDSEVE  459



>ref|XP_007137649.1| hypothetical protein PHAVU_009G144200g [Phaseolus vulgaris]
 gb|ESW09643.1| hypothetical protein PHAVU_009G144200g [Phaseolus vulgaris]
Length=1125

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ P+M+GT D  P+Y LY V VHLDT+NA+FSGHY+SYVK+
Sbjct  803  QHGKFGKLNKPIQFPEILNLAPFMSGTSDKSPVYRLYGVVVHLDTMNAAFSGHYVSYVKN  862

Query  365  MQGNWFGIDDTKV  327
            +Q  WF +DD+ V
Sbjct  863  IQNRWFKVDDSVV  875



>ref|XP_010942663.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Elaeis 
guineensis]
Length=1046

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE LD+  YM+GTDD   +Y LYAV VHLD +NASFSGHY+ YVKD
Sbjct  720  QSGKFGKLNKSIRFPEYLDLARYMSGTDDKFAVYRLYAVVVHLDIMNASFSGHYVCYVKD  779

Query  365  MQGNWFGIDDTKVK  324
             QG W+  DD+ VK
Sbjct  780  TQGKWYKTDDSMVK  793



>gb|KDO81148.1| hypothetical protein CISIN_1g0011341mg, partial [Citrus sinensis]
Length=375

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK 
Sbjct  28   QSGKFGKLNKSIQFPEILDLAPYMSGTSDKLPIYRLYGVVVHLDIMNAAFSGHYVCYVKS  87

Query  365  MQGNWFGIDDTKV  327
             Q  WF +DD+ V
Sbjct  88   TQNKWFKVDDSTV  100



>ref|XP_006472486.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Citrus 
sinensis]
Length=1128

 Score =   105 bits (262),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK 
Sbjct  798  QSGKFGKLNKSIQFPEILDLAPYMSGTSDKLPIYRLYGVVVHLDIMNAAFSGHYVCYVKS  857

Query  365  MQGNWFGIDDTKV  327
             Q  WF +DD+ V
Sbjct  858  TQNKWFKVDDSTV  870



>ref|XP_008219286.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 [Prunus mume]
Length=1109

 Score =   105 bits (262),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE+LD+ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  816  QSGKFGKINKPIRFPEILDLAPYMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  875

Query  365  MQGNWFGIDDTKV  327
                WF IDD+ V
Sbjct  876  SHNKWFKIDDSTV  888



>ref|XP_007225419.1| hypothetical protein PRUPE_ppa000527mg [Prunus persica]
 gb|EMJ26618.1| hypothetical protein PRUPE_ppa000527mg [Prunus persica]
Length=1114

 Score =   105 bits (262),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE+LD+ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  816  QSGKFGKINKPIRFPEILDLAPYMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  875

Query  365  MQGNWFGIDDTKV  327
                WF IDD+ V
Sbjct  876  SHNKWFKIDDSTV  888



>gb|KJB64167.1| hypothetical protein B456_010G035400 [Gossypium raimondii]
Length=1042

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PY +GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  776  QSGKFGKLNKAIQFPEILNLAPYTSGTSDNSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  835

Query  365  MQGNWFGIDDTKV  327
             Q  WF IDD+KV
Sbjct  836  AQNKWFKIDDSKV  848



>gb|KJB64166.1| hypothetical protein B456_010G035400 [Gossypium raimondii]
Length=1069

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PY +GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  803  QSGKFGKLNKAIQFPEILNLAPYTSGTSDNSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  862

Query  365  MQGNWFGIDDTKV  327
             Q  WF IDD+KV
Sbjct  863  AQNKWFKIDDSKV  875



>gb|KJB29358.1| hypothetical protein B456_005G096600 [Gossypium raimondii]
Length=878

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  794  QSGKFGKLNKAIRFPEILNLAPYMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYLCYVKN  853

Query  365  MQGNWFGIDDTKV  327
             Q  WF IDD+ V
Sbjct  854  AQNKWFKIDDSMV  866



>ref|XP_004237986.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Solanum 
lycopersicum]
Length=1158

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE L++ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YV++
Sbjct  846  QSGKFGKLNKTIKFPEFLNLAPYMSGTSDKSPVYQLYGVVVHLDVMNAAFSGHYVCYVRN  905

Query  365  MQGNWFGIDDTKVK  324
             Q  W+ +DD+ VK
Sbjct  906  FQNKWYKVDDSSVK  919



>ref|XP_006338134.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Solanum 
tuberosum]
Length=1165

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE L++ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YV++
Sbjct  839  QSGKFGKLNKTIKFPEFLNLAPYMSGTSDKSPVYQLYGVVVHLDVMNAAFSGHYVCYVRN  898

Query  365  MQGNWFGIDDTKVK  324
             Q  W+ +DD+ VK
Sbjct  899  FQNKWYKVDDSSVK  912



>ref|XP_006433843.1| hypothetical protein CICLE_v10000079mg [Citrus clementina]
 gb|ESR47083.1| hypothetical protein CICLE_v10000079mg [Citrus clementina]
Length=1145

 Score =   105 bits (261),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ Y+K 
Sbjct  798  QSGKFGKLNKSIQFPEILDLAPYMSGTSDKLPIYRLYGVVVHLDIMNAAFSGHYVCYIKS  857

Query  365  MQGNWFGIDDTKV  327
             Q  WF +DD+ V
Sbjct  858  TQNKWFKVDDSTV  870



>gb|KJB29359.1| hypothetical protein B456_005G096600 [Gossypium raimondii]
Length=1070

 Score =   105 bits (261),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  794  QSGKFGKLNKAIRFPEILNLAPYMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYLCYVKN  853

Query  365  MQGNWFGIDDTKV  327
             Q  WF IDD+ V
Sbjct  854  AQNKWFKIDDSMV  866



>ref|XP_010646974.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Vitis 
vinifera]
Length=857

 Score =   104 bits (260),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q   +GK+NK + FPE L+M PYM+GTDD  P+Y LYAV VHLD +NA+FSGHY+ +VK+
Sbjct  606  QSSNFGKLNKSVRFPETLNMTPYMSGTDDRYPVYSLYAVVVHLDIMNAAFSGHYVCFVKN  665

Query  365  MQGNWFGIDDTKV  327
              G+WF IDD+ V
Sbjct  666  FLGDWFRIDDSTV  678



>ref|XP_004501631.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Cicer 
arietinum]
Length=1129

 Score =   104 bits (260),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P+M+GT D  P+Y LY V VHLD +NASFSGHY+ Y+K+
Sbjct  799  QSGKFGKLNKPIQFPEILDLAPFMSGTSDKTPIYRLYGVVVHLDIMNASFSGHYVCYLKN  858

Query  365  MQGNWFGIDDTKV  327
            +Q  WF +DD+ V
Sbjct  859  IQNKWFKVDDSVV  871



>ref|XP_009609184.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Nicotiana 
tomentosiformis]
Length=1175

 Score =   104 bits (259),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM+GT D  P+Y LY V VHLD +NA+FSGHY+ YV++
Sbjct  847  QSGKFGKLNKTIKFPEILNLAPYMSGTRDKSPVYQLYGVVVHLDVMNAAFSGHYVCYVRN  906

Query  365  MQGNWFGIDDTKVK  324
             Q  WF ++D+ VK
Sbjct  907  FQNRWFKVNDSSVK  920



>gb|EMT11184.1| Ubiquitin carboxyl-terminal hydrolase 16 [Aegilops tauschii]
Length=692

 Score =   103 bits (256),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE L++  YM+ TDD  P+Y LYAV VH D +N+S SGHY+ YVKD
Sbjct  400  QSGMFGKINKAIRFPEYLNLSSYMSTTDDCSPVYRLYAVVVHRDVMNSSVSGHYVCYVKD  459

Query  365  MQGNWFGIDDTKVK  324
             QG W+ +DD++VK
Sbjct  460  SQGKWYEMDDSQVK  473



>ref|XP_003635052.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Vitis 
vinifera]
Length=942

 Score =   103 bits (257),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q   +GK+NK + FPE L++ PYM+GTDD  P+Y LYAV VHLD +NA+FSGHY+ +VK+
Sbjct  607  QSSNFGKLNKSVRFPETLNLTPYMSGTDDRYPVYSLYAVVVHLDIMNAAFSGHYVCFVKN  666

Query  365  MQGNWFGIDDTKV  327
              G+WF IDD+ V
Sbjct  667  FLGDWFRIDDSTV  679



>ref|XP_010548553.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Tarenaya 
hassleriana]
Length=604

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVK  369
            QGG +GK+NK I+FPE LD+ PYM+ G  D   +Y LYAV VHLD LNASF GHYI YVK
Sbjct  383  QGGRFGKLNKKISFPEKLDLSPYMSDGRGDGTDIYKLYAVIVHLDMLNASFFGHYICYVK  442

Query  368  DMQGNWFGIDDTKVK  324
            D++GNW+ IDD++V+
Sbjct  443  DLRGNWYRIDDSEVE  457



>ref|XP_003519843.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Glycine 
max]
Length=938

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVH--LDTLNASFSGHYISYV  372
            Q G + K+NK + FPE+L+M PYM+GT D  PLY LYAV VH  LD +NA+FSGHY+ YV
Sbjct  624  QSGNFEKLNKSVQFPEVLNMAPYMSGTKDKSPLYSLYAVVVHLDLDIMNAAFSGHYVCYV  683

Query  371  KDMQGNWFGIDDTKVK  324
            K++QG WF  DD++V+
Sbjct  684  KNIQGEWFRTDDSRVE  699



>ref|XP_009359053.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like isoform 
X1 [Pyrus x bretschneideri]
Length=716

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK +TFPE LD+ PYM+   D   +Y LYAV VH+D LNASF GHYI Y KD
Sbjct  390  QSGRFGKINKRVTFPETLDLNPYMSEAGDGTNIYKLYAVVVHIDMLNASFFGHYICYTKD  449

Query  365  MQGNWFGIDDTKV  327
              GNW+GIDD KV
Sbjct  450  FSGNWYGIDDCKV  462



>ref|XP_002980323.1| hypothetical protein SELMODRAFT_420048 [Selaginella moellendorffii]
 gb|EFJ18583.1| hypothetical protein SELMODRAFT_420048 [Selaginella moellendorffii]
Length=924

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE L++ PYM+G  D PPLY LYAV VH+D LNASF GHYI YV+D
Sbjct  445  QSGKFGKLNKRVTFPEALNISPYMSGEGDKPPLYRLYAVVVHVDMLNASFFGHYICYVRD  504

Query  365  MQGNWFGID--DTKVKFYIKLYCFCFSNCRGK  276
            M G W+ +   DT+     K Y   +S    +
Sbjct  505  MTGTWYKVKEVDTEKVMSQKAYMLMYSRSSAR  536



>ref|XP_009359054.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like isoform 
X2 [Pyrus x bretschneideri]
Length=627

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK +TFPE LD+ PYM+   D   +Y LYAV VH+D LNASF GHYI Y KD
Sbjct  390  QSGRFGKINKRVTFPETLDLNPYMSEAGDGTNIYKLYAVVVHIDMLNASFFGHYICYTKD  449

Query  365  MQGNWFGIDDTKV  327
              GNW+GIDD KV
Sbjct  450  FSGNWYGIDDCKV  462



>ref|XP_003523774.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X1 [Glycine max]
Length=1063

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ P+M+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  815  QSGKFGKLNKPIQFPEILNLAPFMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  874

Query  365  MQGNWFGIDDTKV  327
            +Q  WF +DD+ V
Sbjct  875  IQNKWFKVDDSVV  887



>ref|XP_006578260.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X3 [Glycine max]
Length=1080

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ P+M+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  815  QSGKFGKLNKPIQFPEILNLAPFMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  874

Query  365  MQGNWFGIDDTKV  327
            +Q  WF +DD+ V
Sbjct  875  IQNKWFKVDDSVV  887



>ref|XP_004973705.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X2 [Setaria italica]
Length=978

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/75 (61%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVK  369
            Q G +GKINK I FPE L+M+ YM   TDD  P+Y LYAV VH D +NA+FSGHY+ YVK
Sbjct  657  QSGKFGKINKAIRFPETLNMVRYMNPETDDRSPVYSLYAVVVHHDVMNAAFSGHYVCYVK  716

Query  368  DMQGNWFGIDDTKVK  324
            D QG WF  DD++VK
Sbjct  717  DTQGKWFKADDSQVK  731



>gb|KHN08238.1| Ubiquitin carboxyl-terminal hydrolase 16 [Glycine soja]
Length=1138

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ P+M+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  815  QSGKFGKLNKPIQFPEILNLAPFMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  874

Query  365  MQGNWFGIDDTKV  327
            +Q  WF +DD+ V
Sbjct  875  IQNKWFKVDDSVV  887



>ref|XP_006578259.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X2 [Glycine max]
Length=1138

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ P+M+GT D  P+Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  815  QSGKFGKLNKPIQFPEILNLAPFMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVKN  874

Query  365  MQGNWFGIDDTKV  327
            +Q  WF +DD+ V
Sbjct  875  IQNKWFKVDDSVV  887



>emb|CBI18698.3| unnamed protein product [Vitis vinifera]
Length=669

 Score =   102 bits (253),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q   +GK+NK + FPE L++ PYM+GTDD  P+Y LYAV VHLD +NA+FSGHY+ +VK+
Sbjct  577  QSSNFGKLNKSVRFPETLNLTPYMSGTDDRYPVYSLYAVVVHLDIMNAAFSGHYVCFVKN  636

Query  365  MQGNWFGIDDTKV  327
              G+WF IDD+ V
Sbjct  637  FLGDWFRIDDSTV  649



>ref|XP_004973704.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X1 [Setaria italica]
Length=993

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/75 (61%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVK  369
            Q G +GKINK I FPE L+M+ YM   TDD  P+Y LYAV VH D +NA+FSGHY+ YVK
Sbjct  672  QSGKFGKINKAIRFPETLNMVRYMNPETDDRSPVYSLYAVVVHHDVMNAAFSGHYVCYVK  731

Query  368  DMQGNWFGIDDTKVK  324
            D QG WF  DD++VK
Sbjct  732  DTQGKWFKADDSQVK  746



>ref|NP_565576.1| ubiquitin carboxyl-terminal hydrolase 19 [Arabidopsis thaliana]
 sp|Q9SJA1.2|UBP19_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 19; AltName: 
Full=Deubiquitinating enzyme 19; Short=AtUBP19; AltName: 
Full=Ubiquitin thioesterase 19; AltName: Full=Ubiquitin-specific-processing 
protease 19 [Arabidopsis thaliana]
 gb|AAK26025.1|AF360315_1 putative ubiquitin carboxyl terminal hydrolase [Arabidopsis thaliana]
 gb|AAL07252.1| putative ubiquitin carboxyl terminal hydrolase [Arabidopsis thaliana]
 gb|AAD23896.2| putative ubiquitin carboxyl terminal hydrolase [Arabidopsis thaliana]
 gb|AEC07607.1| ubiquitin carboxyl-terminal hydrolase 19 [Arabidopsis thaliana]
Length=672

 Score =   102 bits (253),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            QGG +GK+NK I+FPE  D+ PYM+G  +   +Y LYAV VHLD LNASF GHYI YVKD
Sbjct  387  QGGRFGKLNKRISFPETFDLGPYMSGGGEGSDVYKLYAVIVHLDMLNASFFGHYICYVKD  446

Query  365  MQGNWFGIDDTKVK  324
             +GNW+ IDD++V+
Sbjct  447  FRGNWYRIDDSEVE  460



>ref|XP_008378636.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Malus 
domestica]
Length=425

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE+LD+ P+M+GT D  P+Y LY V VHLD +NA+FSGHY+ YV++
Sbjct  126  QSGKFGKINKPIRFPEILDLAPFMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVRN  185

Query  365  MQGNWFGIDDTKV  327
                WF +DD+ V
Sbjct  186  SHNKWFKVDDSTV  198



>ref|XP_008789702.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Phoenix 
dactylifera]
Length=892

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 50/92 (54%), Positives = 58/92 (63%), Gaps = 11/92 (12%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK ITFPE LD+ PYM+G  D   LY LYAV VHLD LNASF GHY+ Y KD
Sbjct  394  QSGRFGKLNKRITFPENLDLTPYMSGNGDGTDLYSLYAVVVHLDMLNASFFGHYVCYTKD  453

Query  365  MQGNWFGIDDTKV-----------KFYIKLYC  303
              G+W+ IDD KV             Y+ LYC
Sbjct  454  YHGHWYRIDDCKVLNVEVEEVLAQGAYMLLYC  485



>ref|XP_010928622.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Elaeis 
guineensis]
Length=928

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK ITFPE LD+ PYM+G  D   LY LYAV VHLD LNASF GHY+ Y KD
Sbjct  394  QSGRFGKLNKRITFPENLDLTPYMSGNGDGTDLYSLYAVVVHLDMLNASFFGHYVCYTKD  453

Query  365  MQGNWFGIDDTKV  327
              G W+ IDD KV
Sbjct  454  YDGQWYRIDDCKV  466



>ref|XP_003602929.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
 gb|AES73180.1| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=1116

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE+LD+ P+++GT D  P+Y LY V VHLD +NASFSGHY+ Y+K+
Sbjct  796  QSGKFGKLNKPVQFPEILDLAPFVSGTSDKTPIYRLYGVVVHLDVMNASFSGHYVCYLKN  855

Query  365  MQGNWFGIDDTKV  327
            +Q  WF +DD+ V
Sbjct  856  IQNKWFKVDDSVV  868



>gb|KEH35732.1| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=1146

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE+LD+ P+++GT D  P+Y LY V VHLD +NASFSGHY+ Y+K+
Sbjct  826  QSGKFGKLNKPVQFPEILDLAPFVSGTSDKTPIYRLYGVVVHLDVMNASFSGHYVCYLKN  885

Query  365  MQGNWFGIDDTKV  327
            +Q  WF +DD+ V
Sbjct  886  IQNKWFKVDDSVV  898



>ref|XP_009396938.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Musa 
acuminata subsp. malaccensis]
Length=902

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE L++ PYM+G+ D   LY LYAV VH+D LNASF GHYI Y KD
Sbjct  401  QSGRFGKLNKRVTFPENLNLTPYMSGSSDGTDLYTLYAVVVHVDMLNASFFGHYICYTKD  460

Query  365  MQGNWFGIDDTKV  327
             QG W+ IDD KV
Sbjct  461  YQGRWYKIDDCKV  473



>ref|XP_009376247.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Pyrus 
x bretschneideri]
Length=1126

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE+LD+ P+M+GT D  P+Y LY V VHLD +NA+FSGHY+ YV++
Sbjct  818  QSGKFGKINKPIRFPEILDLAPFMSGTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVRN  877

Query  365  MQGNWFGIDDTKV  327
                WF +DD+ V
Sbjct  878  SHNKWFKVDDSTV  890



>ref|XP_010266094.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Nelumbo 
nucifera]
Length=1113

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FP +LD+ PYM+ T+D  P+Y LYAV VHLD +NA+FSGHY+ Y+K+
Sbjct  761  QSGKFGKLNKVVRFPRVLDLAPYMSTTNDKSPVYTLYAVVVHLDVMNAAFSGHYVCYIKN  820

Query  365  MQGNWFGIDDTKVK  324
             Q  W+ IDD+ V+
Sbjct  821  FQEKWYKIDDSTVE  834



>ref|XP_007047805.1| Ubiquitin-specific protease 17, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91962.1| Ubiquitin-specific protease 17, putative isoform 1 [Theobroma 
cacao]
Length=941

 Score =   102 bits (253),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +  PE+LD+ PYM+GT D   +Y LYAV VHLD +NA+FSGHY+ YVK 
Sbjct  642  QSGNFGKLNKSVQIPEVLDLAPYMSGTSDKAAVYNLYAVVVHLDVMNAAFSGHYVCYVKS  701

Query  365  MQGNWFGIDDTKV  327
              G WF IDD+ V
Sbjct  702  FHGEWFRIDDSTV  714



>emb|CAN77546.1| hypothetical protein VITISV_025214 [Vitis vinifera]
Length=1043

 Score =   102 bits (253),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q   +GK+NK + FPE L+  PYM+GTDD  P+Y LYAV VHLD +NA+FSGHY+ +VK+
Sbjct  551  QSSNFGKLNKSVRFPETLNXTPYMSGTDDRYPVYSLYAVVVHLDIMNAAFSGHYVCFVKN  610

Query  365  MQGNWFGIDDTKV  327
              G+WF IDD+ V
Sbjct  611  FLGDWFRIDDSTV  623



>ref|XP_009410122.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Musa 
acuminata subsp. malaccensis]
Length=1050

 Score =   101 bits (252),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE L++ PYM+G DD  P+Y LYAV VH+D +NASFSGHY+ YVKD
Sbjct  727  QSGKFGKLNKDVRFPEYLNLAPYMSG-DDKSPVYRLYAVIVHIDVMNASFSGHYVCYVKD  785

Query  365  MQGNWFGIDDTKVK  324
             QG W+  +D++VK
Sbjct  786  TQGKWYETNDSEVK  799



>ref|XP_009401442.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Musa 
acuminata subsp. malaccensis]
Length=857

 Score =   101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G YGK+NK + FPE L++  YM+G DD   +Y LYAV VH D +NASFSGHY+ YVKD
Sbjct  538  QSGKYGKLNKAVRFPEYLNLAHYMSG-DDASSMYQLYAVIVHKDVMNASFSGHYVCYVKD  596

Query  365  MQGNWFGIDDTKVK  324
             QG W+ IDD++VK
Sbjct  597  TQGKWYKIDDSEVK  610



>ref|XP_009373969.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Pyrus 
x bretschneideri]
Length=1050

 Score =   101 bits (251),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE+LD+ P+M+ T D  P+Y LY V VHLD +NA+FSGHY+ YV++
Sbjct  816  QSGKFGKINKPIRFPEILDLAPFMSSTSDKSPIYRLYGVVVHLDIMNAAFSGHYVCYVRN  875

Query  365  MQGNWFGIDDTKV  327
             Q  WF +DD+ V
Sbjct  876  SQNKWFMVDDSTV  888



>emb|CBI35523.3| unnamed protein product [Vitis vinifera]
Length=723

 Score =   100 bits (250),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q   +GK+NK + FPE L+M PYM+GTDD  P+Y LYAV VHLD +NA+FSGHY+ +VK+
Sbjct  576  QSSNFGKLNKSVRFPETLNMTPYMSGTDDRYPVYSLYAVVVHLDIMNAAFSGHYVCFVKN  635

Query  365  MQGNWFGIDD  336
              G+WF IDD
Sbjct  636  FLGDWFRIDD  645



>ref|XP_008352731.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Malus 
domestica]
Length=266

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE+LD+ P+M+ T D  P+Y LY V VHLD +N++FSGHY+ YV++
Sbjct  32   QSGKFGKINKPIRFPEILDLAPFMSSTSDKSPIYRLYGVVVHLDIMNSAFSGHYVCYVRN  91

Query  365  MQGNWFGIDDTKV  327
             Q  WF +DD+ V
Sbjct  92   SQNKWFMVDDSTV  104



>gb|KGN60255.1| hypothetical protein Csa_3G890110 [Cucumis sativus]
Length=978

 Score =   101 bits (251),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P++ GT D  P+Y LY V VHLD +N+SFSGHY+ YVK+
Sbjct  750  QSGNFGKLNKPIKFPEILDLAPFIRGTSDKSPIYRLYGVVVHLDVMNSSFSGHYVCYVKN  809

Query  365  MQGNWFGIDDTKV  327
             +  WF IDD+ V
Sbjct  810  AKNKWFKIDDSTV  822



>ref|XP_008466167.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
16-like [Cucumis melo]
Length=1030

 Score =   101 bits (251),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P++ GT D  P+Y LY V VHLD +N+SFSGHY+ YVK+
Sbjct  749  QSGNFGKLNKPIKFPEILDLAPFIRGTSDKSPIYRLYGVVVHLDVMNSSFSGHYVCYVKN  808

Query  365  MQGNWFGIDDTKV  327
             +  WF IDD+ V
Sbjct  809  AKNKWFKIDDSTV  821



>ref|XP_003518257.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Glycine 
max]
Length=1036

 Score =   101 bits (251),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P+M+GT D+P +Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  718  QSGKFGKLNKPIRFPEILDLAPFMSGTSDLP-IYRLYGVVVHLDIMNAAFSGHYVCYVKN  776

Query  365  MQGNWFGIDDTKV  327
             Q  WF +DD+ V
Sbjct  777  FQSRWFKVDDSVV  789



>ref|XP_003544242.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Glycine 
max]
 gb|KHN25065.1| Ubiquitin carboxyl-terminal hydrolase 16 [Glycine soja]
Length=1045

 Score =   101 bits (251),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P+M+GT D+P +Y LY V VHLD +NA+FSGHY+ YVK+
Sbjct  719  QSGKFGKLNKPIRFPEILDLAPFMSGTSDLP-IYRLYGVVVHLDIMNAAFSGHYVCYVKN  777

Query  365  MQGNWFGIDDTKV  327
             Q  WF +DD+ V
Sbjct  778  FQSRWFKVDDSVV  790



>gb|EPS72742.1| hypothetical protein M569_02015, partial [Genlisea aurea]
Length=404

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK ITFPE LD+ PY++G +D   +Y LYAV VH+D LNASF GHYI Y+KD
Sbjct  295  QSGRFGKLNKRITFPETLDLRPYVSGLEDKNNIYKLYAVIVHVDMLNASFFGHYICYIKD  354

Query  365  MQGNWFGIDDTKV  327
             +GNW+ +DD KV
Sbjct  355  FRGNWYRVDDCKV  367



>ref|XP_011031394.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Populus 
euphratica]
Length=633

 Score =   100 bits (248),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPEMLD+ PYM+   D   +Y LYAVAVH+D LNASF GHYI Y KD
Sbjct  394  QSGRFGKLNKRVTFPEMLDLSPYMSEGGDGTDVYKLYAVAVHVDMLNASFFGHYICYTKD  453

Query  365  MQGNWFGIDDTKV  327
              GNW  IDD KV
Sbjct  454  FHGNWHRIDDCKV  466



>ref|NP_001189593.1| ubiquitin carboxyl-terminal hydrolase 19 [Arabidopsis thaliana]
 dbj|BAH57217.1| AT2G24640 [Arabidopsis thaliana]
 gb|AEC07608.1| ubiquitin carboxyl-terminal hydrolase 19 [Arabidopsis thaliana]
Length=502

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            QGG +GK+NK I+FPE  D+ PYM+G  +   +Y LYAV VHLD LNASF GHYI YVKD
Sbjct  217  QGGRFGKLNKRISFPETFDLGPYMSGGGEGSDVYKLYAVIVHLDMLNASFFGHYICYVKD  276

Query  365  MQGNWFGIDDTKVK  324
             +GNW+ IDD++V+
Sbjct  277  FRGNWYRIDDSEVE  290



>ref|XP_006293755.1| hypothetical protein CARUB_v10022714mg [Capsella rubella]
 gb|EOA26653.1| hypothetical protein CARUB_v10022714mg [Capsella rubella]
Length=736

 Score =   100 bits (249),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            QGG +GK+NK I+FPE  D+ PYM+   +   +Y LYAV VHLD LNASF GHYI YVKD
Sbjct  388  QGGRFGKLNKRISFPETFDLGPYMSSGGEGSDVYKLYAVIVHLDMLNASFFGHYICYVKD  447

Query  365  MQGNWFGIDDTKVK  324
             +GNW+ IDD KV+
Sbjct  448  FRGNWYRIDDAKVE  461



>ref|XP_003527871.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Glycine 
max]
 gb|KHN09020.1| Ubiquitin carboxyl-terminal hydrolase 16 [Glycine soja]
Length=1125

 Score =   100 bits (250),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ P+M+GT D  P+Y LY V VHLD +NASFSGHY+ YVK+
Sbjct  812  QSGKFGKLNKPIQFPEILNLAPFMSGTSDKSPIYRLYGVVVHLDVMNASFSGHYVCYVKN  871

Query  365  MQGNWFGIDDTKV  327
            +Q  W  +DD+ V
Sbjct  872  IQNKWSKVDDSVV  884



>ref|XP_011100001.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Sesamum 
indicum]
Length=868

 Score =   100 bits (249),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            + G   K+NK + FPE+L++ PYM+G +D  P+Y LYAV VHL  +NA++SGHY+SYVKD
Sbjct  646  RSGNLEKLNKIVQFPEVLNLAPYMSGMNDKYPVYDLYAVVVHLGAMNAAYSGHYVSYVKD  705

Query  365  MQGNWFGIDDTKV  327
             QG+WF IDD++V
Sbjct  706  FQGDWFRIDDSRV  718



>ref|XP_009363067.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Pyrus 
x bretschneideri]
Length=716

 Score =   100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK +TFPE LD+ PYM+   D   +Y LYAV VH+D LNAS+ GHYI Y KD
Sbjct  390  QSGRFGKINKRVTFPETLDLNPYMSEAGDSTNIYKLYAVVVHIDMLNASYFGHYICYTKD  449

Query  365  MQGNWFGIDDTKV  327
              GNW+ IDD+KV
Sbjct  450  FSGNWYKIDDSKV  462



>ref|XP_003615274.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=1050

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            + G +GK+NK I FPE+LD+ P+M+GT D+  +Y LY V VHLDT+NA+FSGHY+ YVK+
Sbjct  754  RSGKFGKLNKSIRFPEILDLAPFMSGTSDLA-IYRLYGVVVHLDTMNAAFSGHYVGYVKN  812

Query  365  MQGNWFGIDDTKVK  324
             Q +WF +DD+ V+
Sbjct  813  FQNSWFKVDDSVVR  826



>gb|KHN26130.1| Ubiquitin carboxyl-terminal hydrolase 16 [Glycine soja]
Length=1054

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+LD+ P+M+GT D+P +Y LY V VH+D +NA+FSGHY+ YVK+
Sbjct  736  QSGKFGKLNKPIRFPEILDLAPFMSGTSDLP-IYRLYGVVVHMDIMNAAFSGHYVCYVKN  794

Query  365  MQGNWFGIDDTKV  327
             Q  WF +DD+ V
Sbjct  795  FQSRWFKVDDSVV  807



>ref|XP_008377533.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Malus 
domestica]
Length=569

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK +TFPE LD+ PYM+   D   +Y LYAV VH+D LNASF GHYI Y KD
Sbjct  334  QSGRFGKINKRVTFPETLDLNPYMSEAGDGTNIYKLYAVVVHIDMLNASFFGHYICYTKD  393

Query  365  MQGNWFGIDDTKV  327
              GNW+ IDD KV
Sbjct  394  FSGNWYRIDDCKV  406



>tpg|DAA48490.1| TPA: putative ubiquitin carboxyl-terminal hydrolase superfamily 
protein [Zea mays]
Length=973

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVK  369
            Q G +GKI+K I FPE L++  YM   TDD+ P+Y LYAV VH D +NA+FSGHY+ YVK
Sbjct  672  QSGKFGKISKAIRFPETLNLARYMNPDTDDISPVYSLYAVVVHHDVMNAAFSGHYVCYVK  731

Query  368  DMQGNWFGIDDTKVK  324
            D QG WF  DD++VK
Sbjct  732  DTQGKWFKADDSQVK  746



>ref|XP_008338940.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Malus domestica]
Length=1060

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK I FPE+LD+ P+M+ T D  P+Y LY V VHLD +N++FSGHY+ YV++
Sbjct  826  QSGKFGKINKPIRFPEILDLAPFMSSTSDKSPIYRLYGVVVHLDIMNSAFSGHYVCYVRN  885

Query  365  MQGNWFGIDDTKV  327
             Q  WF +DD+ V
Sbjct  886  SQNKWFMVDDSTV  898



>ref|XP_008664540.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
17-like [Zea mays]
Length=998

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVK  369
            Q G +GKI+K I FPE L++  YM   TDD+ P+Y LYAV VH D +NA+FSGHY+ YVK
Sbjct  672  QSGKFGKISKAIRFPETLNLARYMNPDTDDISPVYSLYAVVVHHDVMNAAFSGHYVCYVK  731

Query  368  DMQGNWFGIDDTKVK  324
            D QG WF  DD++VK
Sbjct  732  DTQGKWFKADDSQVK  746



>ref|XP_007223115.1| hypothetical protein PRUPE_ppa005433mg [Prunus persica]
 gb|EMJ24314.1| hypothetical protein PRUPE_ppa005433mg [Prunus persica]
Length=461

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK +TFPE LD+ PYM+ T D   +Y LYAV VH+D LNASF GHYI Y KD
Sbjct  377  QSGRFGKINKRVTFPETLDLNPYMSETGDGANIYKLYAVVVHVDMLNASFFGHYICYTKD  436

Query  365  MQGNWFGIDDTKVK  324
              GNW+ IDD KV+
Sbjct  437  FGGNWYRIDDCKVR  450



>ref|XP_008220608.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Prunus 
mume]
Length=700

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK +TFPE LD+ PYM+ T D   +Y LYAV VH+D LNASF GHYI Y KD
Sbjct  377  QSGRFGKINKRVTFPETLDLNPYMSETGDGANIYKLYAVVVHVDMLNASFFGHYICYTKD  436

Query  365  MQGNWFGIDDTKV  327
              GNW+ IDD KV
Sbjct  437  FGGNWYRIDDCKV  449



>gb|ACF84178.1| unknown [Zea mays]
 tpg|DAA48488.1| TPA: putative ubiquitin carboxyl-terminal hydrolase superfamily 
protein [Zea mays]
Length=370

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVK  369
            Q G +GKI+K I FPE L++  YM   TDD+ P+Y LYAV VH D +NA+FSGHY+ YVK
Sbjct  69   QSGKFGKISKAIRFPETLNLARYMNPDTDDISPVYSLYAVVVHHDVMNAAFSGHYVCYVK  128

Query  368  DMQGNWFGIDDTKVK  324
            D QG WF  DD++VK
Sbjct  129  DTQGKWFKADDSQVK  143



>ref|XP_010429445.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
19-like [Camelina sativa]
Length=664

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            QGG +GK+NK I FPE  D+ PYM+   +   +Y LYAV VHLD LNASF GHYI Y+KD
Sbjct  388  QGGRFGKLNKRINFPETFDLGPYMSSGGEGSDVYKLYAVIVHLDMLNASFFGHYICYIKD  447

Query  365  MQGNWFGIDDTKVK  324
             +GNW+ IDD+KV+
Sbjct  448  FRGNWYRIDDSKVE  461



>dbj|BAD44466.1| unknown protein [Arabidopsis thaliana]
Length=631

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            QGG YGK+NK I+FPE LD+ PYM+   D   +Y LYAV VHLD LNASF GHYI Y+KD
Sbjct  381  QGGRYGKLNKRISFPETLDLNPYMSEGGDGSDVYKLYAVIVHLDMLNASFFGHYICYIKD  440

Query  365  MQGNWFGIDDTKVK  324
              GNW+ IDD++++
Sbjct  441  FCGNWYRIDDSEIE  454



>ref|NP_194895.1| ubiquitin carboxyl-terminal hydrolase 18 [Arabidopsis thaliana]
 sp|Q67XW5.2|UBP18_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 18; AltName: 
Full=Deubiquitinating enzyme 18; Short=AtUBP18; AltName: 
Full=Ubiquitin thioesterase 18; AltName: Full=Ubiquitin-specific-processing 
protease 18 [Arabidopsis thaliana]
 emb|CAA19756.1| putative protein [Arabidopsis thaliana]
 emb|CAB79885.1| putative protein [Arabidopsis thaliana]
 gb|AAN13075.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85943.1| ubiquitin carboxyl-terminal hydrolase 18 [Arabidopsis thaliana]
Length=631

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            QGG YGK+NK I+FPE LD+ PYM+   D   +Y LYAV VHLD LNASF GHYI Y+KD
Sbjct  381  QGGRYGKLNKRISFPETLDLNPYMSEGGDGSDVYKLYAVIVHLDMLNASFFGHYICYIKD  440

Query  365  MQGNWFGIDDTKVK  324
              GNW+ IDD++++
Sbjct  441  FCGNWYRIDDSEIE  454



>ref|XP_010060095.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Eucalyptus 
grandis]
 gb|KCW66624.1| hypothetical protein EUGRSUZ_F00414 [Eucalyptus grandis]
Length=1065

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PY++GT D  P+Y LY V VHLD +NA+ SGHY+ YVK+
Sbjct  742  QSGKFGKLNKLIRFPEILNLAPYISGTSDKSPIYRLYGVIVHLDVMNAAVSGHYVCYVKN  801

Query  365  MQGNWFGIDDTKV  327
             Q  WF IDD+ V
Sbjct  802  PQNKWFKIDDSTV  814



>ref|XP_006845518.1| hypothetical protein AMTR_s00019p00164720 [Amborella trichopoda]
 gb|ERN07193.1| hypothetical protein AMTR_s00019p00164720 [Amborella trichopoda]
Length=751

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            QGG YGK+NK +TFPE+LD+ PYM+  +    +Y LYAV VH+D LNASF GHYI Y KD
Sbjct  389  QGGSYGKLNKRVTFPEILDLGPYMSRDNCGRDIYHLYAVVVHIDMLNASFFGHYICYTKD  448

Query  365  MQGNWFGIDDTKVK  324
             +GNW+  DD KV+
Sbjct  449  ARGNWYRTDDCKVE  462



>gb|EYU30946.1| hypothetical protein MIMGU_mgv1a004116mg [Erythranthe guttata]
Length=543

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            + G   K+NK + FPE+L++ PYM+GT+D  P+Y LYAV VHL  + A++SGHY+SYVKD
Sbjct  324  RSGNLEKLNKLVQFPEVLNLSPYMSGTNDKYPVYHLYAVVVHLGVMGAAYSGHYVSYVKD  383

Query  365  MQGNWFGIDDTKV  327
            +QG+WF IDD++V
Sbjct  384  LQGDWFRIDDSRV  396



>ref|XP_010417220.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Camelina 
sativa]
Length=664

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            QGG +GK+NK I+FPE  D+ PYM+       +Y LYAV VHLD LNASF GHYI Y+KD
Sbjct  388  QGGRFGKLNKRISFPETFDLGPYMSSGGKGSDVYKLYAVIVHLDMLNASFFGHYICYIKD  447

Query  365  MQGNWFGIDDTKVK  324
             +GNW+ IDD+KV+
Sbjct  448  FRGNWYRIDDSKVE  461



>gb|AES98232.2| ubiquitin carboxy-terminal hydrolase [Medicago truncatula]
Length=1048

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            + G +GK+NK I FPE+LD+ P+M+GT D+  +Y LY V VHLDT+NA+FSGHY+ YVK+
Sbjct  754  RSGKFGKLNKSIRFPEILDLAPFMSGTSDLA-IYRLYGVVVHLDTMNAAFSGHYVGYVKN  812

Query  365  MQGNWFGIDDTKV  327
             Q +WF +DD+ V
Sbjct  813  FQNSWFKVDDSVV  825



>ref|XP_006355189.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Solanum 
tuberosum]
Length=782

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE LD+ PYM+ T D   +Y LYAV VH+D LNASF GHYI Y+KD
Sbjct  376  QSGRFGKLNKRVTFPETLDLHPYMSETGDGNDIYKLYAVIVHVDMLNASFFGHYICYIKD  435

Query  365  MQGNWFGIDDTKV  327
             +G+W+ IDD KV
Sbjct  436  FRGSWYRIDDCKV  448



>ref|XP_008359211.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like [Malus 
domestica]
Length=839

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q   + K+NK I FPE+L+M PYM  T D  PLY LYAV VHLD +NA++SGHY+ YVK+
Sbjct  580  QSRNFEKLNKSIRFPEVLNMSPYMGETSDKSPLYSLYAVVVHLDIMNAAYSGHYVCYVKN  639

Query  365  MQGNWFGIDDTKVK  324
             QG WF IDD+ V+
Sbjct  640  NQGEWFKIDDSSVE  653



>ref|XP_008385675.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 17 [Malus domestica]
Length=839

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q   + K+NK I FPE+L+M PYM  T D  PLY LYAV VHLD +NA++SGHY+ YVK+
Sbjct  580  QSRNFEKLNKSIRFPEVLNMSPYMGETSDKSPLYSLYAVVVHLDIMNAAYSGHYVCYVKN  639

Query  365  MQGNWFGIDDTKVK  324
             QG WF IDD+ V+
Sbjct  640  NQGEWFKIDDSSVE  653



>ref|XP_011044972.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 18-like [Populus 
euphratica]
Length=725

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE LD+ PYM+   D   +Y LYAV VH+D LNASF GHYI Y KD
Sbjct  394  QSGRFGKLNKRVTFPETLDLSPYMSEKGDGADVYKLYAVVVHVDMLNASFFGHYICYTKD  453

Query  365  MQGNWFGIDDTKV  327
             +GNW  IDD+KV
Sbjct  454  FRGNWHRIDDSKV  466



>ref|NP_001063411.2| Os09g0464400 [Oryza sativa Japonica Group]
 dbj|BAF25325.2| Os09g0464400 [Oryza sativa Japonica Group]
Length=918

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK + F E L++  YM+  DD+ P+Y LYAV VH D +NA+FSGHY+ YVKD
Sbjct  607  QSGNFGKINKAVRFTEYLNLSNYMSTADDISPVYQLYAVVVHHDVMNAAFSGHYVCYVKD  666

Query  365  MQGNWFGIDDTKVK  324
             QG W  +DD++VK
Sbjct  667  TQGKWHKMDDSQVK  680



>gb|EEC84719.1| hypothetical protein OsI_31685 [Oryza sativa Indica Group]
Length=927

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK + F E L++  YM+  DD+ P+Y LYAV VH D +NA+FSGHY+ YVKD
Sbjct  594  QSGNFGKINKAVRFTEYLNLSNYMSTADDISPVYQLYAVVVHHDVMNAAFSGHYVCYVKD  653

Query  365  MQGNWFGIDDTKVK  324
             QG W  +DD++VK
Sbjct  654  TQGKWHKMDDSQVK  667



>dbj|BAD33960.1| putative ubiquitin-specific protease [Oryza sativa Japonica Group]
 gb|EEE69864.1| hypothetical protein OsJ_29670 [Oryza sativa Japonica Group]
Length=940

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GKINK + F E L++  YM+  DD+ P+Y LYAV VH D +NA+FSGHY+ YVKD
Sbjct  607  QSGNFGKINKAVRFTEYLNLSNYMSTADDISPVYQLYAVVVHHDVMNAAFSGHYVCYVKD  666

Query  365  MQGNWFGIDDTKVK  324
             QG W  +DD++VK
Sbjct  667  TQGKWHKMDDSQVK  680



>ref|XP_002308728.2| hypothetical protein POPTR_0006s28540g [Populus trichocarpa]
 gb|EEE92251.2| hypothetical protein POPTR_0006s28540g [Populus trichocarpa]
Length=633

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPEMLD+ PYM+   D   +Y LYAV VH+D LNASF GHYI Y KD
Sbjct  394  QSGRFGKLNKRVTFPEMLDLSPYMSEGGDGTDVYKLYAVVVHVDMLNASFFGHYICYTKD  453

Query  365  MQGNWFGIDDTKV  327
              GNW  IDD KV
Sbjct  454  FHGNWHRIDDCKV  466



>ref|XP_010675222.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16 [Beta vulgaris 
subsp. vulgaris]
Length=1084

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK I FPE+L++ PYM G  D  P+Y LY V VHLD +NA+FSGHY+ YV++
Sbjct  756  QSGKFGKLNKTIRFPEILNLAPYMRGGSDKTPIYRLYGVVVHLDIMNAAFSGHYVCYVRN  815

Query  365  MQGNWFGIDDTKVK  324
                W+ IDD+ VK
Sbjct  816  AHNKWYKIDDSTVK  829



>ref|XP_007011632.1| Ubiquitin carboxyl-terminal hydrolase 19, putative isoform 1 
[Theobroma cacao]
 ref|XP_007011633.1| Ubiquitin carboxyl-terminal hydrolase 19, putative isoform 1 
[Theobroma cacao]
 gb|EOY29251.1| Ubiquitin carboxyl-terminal hydrolase 19, putative isoform 1 
[Theobroma cacao]
 gb|EOY29252.1| Ubiquitin carboxyl-terminal hydrolase 19, putative isoform 1 
[Theobroma cacao]
Length=727

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK ++FPE LD+ PYM+   D   +Y LYAV VHLD LNASF GHYI Y+KD
Sbjct  368  QSGRFGKLNKRVSFPETLDLTPYMSEDGDDSNVYKLYAVVVHLDMLNASFFGHYICYIKD  427

Query  365  MQGNWFGIDDTKV  327
              GNW+ IDD KV
Sbjct  428  FCGNWYRIDDCKV  440



>ref|XP_008678623.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X2 [Zea mays]
Length=886

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVK  369
            Q G +GKI+K I FPE L+++ YM   TDD+ P+Y LYAV VH D +NA+FSGHY+ YVK
Sbjct  545  QSGKFGKISKAIRFPETLNIVCYMNPDTDDISPVYSLYAVVVHHDVMNAAFSGHYVCYVK  604

Query  368  DMQGNWFGIDDTKVK  324
            D  G WF  DD++VK
Sbjct  605  DTHGKWFKADDSQVK  619



>ref|XP_008678622.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like isoform 
X1 [Zea mays]
Length=888

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVK  369
            Q G +GKI+K I FPE L+++ YM   TDD+ P+Y LYAV VH D +NA+FSGHY+ YVK
Sbjct  547  QSGKFGKISKAIRFPETLNIVCYMNPDTDDISPVYSLYAVVVHHDVMNAAFSGHYVCYVK  606

Query  368  DMQGNWFGIDDTKVK  324
            D  G WF  DD++VK
Sbjct  607  DTHGKWFKADDSQVK  621



>ref|XP_002445647.1| hypothetical protein SORBIDRAFT_07g023330 [Sorghum bicolor]
 gb|EES15142.1| hypothetical protein SORBIDRAFT_07g023330 [Sorghum bicolor]
Length=998

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMT-GTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVK  369
            Q G +GKI+K I FP+ L+M  YM   TDD+ P+Y LYAV VH D +NA+FSGHY+ YVK
Sbjct  677  QSGKFGKISKAIRFPDTLNMGHYMNPDTDDISPVYSLYAVVVHHDVMNAAFSGHYVCYVK  736

Query  368  DMQGNWFGIDDTKVK  324
            D QG WF  DD++VK
Sbjct  737  DTQGKWFKADDSQVK  751



>ref|XP_002324377.2| hypothetical protein POPTR_0018s03350g [Populus trichocarpa]
 gb|EEF02942.2| hypothetical protein POPTR_0018s03350g [Populus trichocarpa]
Length=726

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE LD+ PYM+   D   +Y LYAV VH+D LNASF GHYI Y KD
Sbjct  394  QSGRFGKLNKRVTFPETLDLSPYMSEKGDGADVYKLYAVVVHVDMLNASFFGHYICYTKD  453

Query  365  MQGNWFGIDDTKV  327
              GNW  IDD+KV
Sbjct  454  FHGNWHRIDDSKV  466



>ref|XP_004498826.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 19-like [Cicer 
arietinum]
Length=729

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + FPE L++ PYM+   D   +Y LYAV VH+D LNAS+ GHYI Y+KD
Sbjct  392  QSGKFGKLNKRVAFPETLNLSPYMSKAGDGSDIYKLYAVVVHIDMLNASYFGHYICYIKD  451

Query  365  MQGNWFGIDDTKV  327
             QGNW+ IDD+KV
Sbjct  452  FQGNWYRIDDSKV  464



>gb|KDP33469.1| hypothetical protein JCGZ_07040 [Jatropha curcas]
Length=703

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK +TFPE LD+ PY +   D   LY LYAV VH+D LNASF GHYI YVKD
Sbjct  388  QSGRFGKLNKRVTFPETLDISPYTSEEGDGTDLYKLYAVVVHVDMLNASFFGHYICYVKD  447

Query  365  MQGNWFGIDDTKVK  324
             +GNW+ +DD KV+
Sbjct  448  FRGNWYRVDDCKVQ  461



>ref|XP_009381476.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Musa 
acuminata subsp. malaccensis]
Length=1020

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            Q G +GK+NK + F E LD+ PYM+G DD  P+Y LYA  VH+D  NASFSGHY+ YVKD
Sbjct  697  QSGMFGKLNKPVRFHEYLDLAPYMSG-DDKSPVYRLYAAIVHIDVKNASFSGHYVCYVKD  755

Query  365  MQGNWFGIDDTKV  327
             QG W+ I+D+KV
Sbjct  756  TQGKWYKINDSKV  768



>ref|XP_006283326.1| hypothetical protein CARUB_v10004366mg [Capsella rubella]
 gb|EOA16224.1| hypothetical protein CARUB_v10004366mg [Capsella rubella]
Length=630

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTGTDDVPPLYMLYAVAVHLDTLNASFSGHYISYVKD  366
            QGG YGK+NK I+FPE LD+ PYM+   +   +Y LYAV VHLD LNASF GHYI Y+KD
Sbjct  377  QGGRYGKLNKRISFPETLDLNPYMSEGGEGSDVYKLYAVVVHLDILNASFFGHYICYIKD  436

Query  365  MQGNWFGIDDTKVK  324
              GNW+ IDD++++
Sbjct  437  FCGNWYRIDDSEIE  450



>ref|XP_006660217.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 16-like [Oryza 
brachyantha]
Length=992

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -1

Query  545  QGGCYGKINKCITFPEMLDMIPYMTG-TDDVPPLYMLYAVAVHLDTLNASFSGHYISYVK  369
            Q G +GKINK I FPE L++  YM+   DD  P+Y LYAV VH D +NA+FSGHY+ YVK
Sbjct  672  QSGKFGKINKAIRFPETLNLKRYMSAKADDTSPVYSLYAVVVHHDVMNAAFSGHYVCYVK  731

Query  368  DMQGNWFGIDDTKVK  324
            D QG W+  DD++VK
Sbjct  732  DTQGKWYKTDDSQVK  746



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800