BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP001C11 305 bp,

Length=305
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007204025.1|  hypothetical protein PRUPE_ppa020272mg           68.9    1e-11   Prunus persica
ref|XP_008241887.1|  PREDICTED: zinc-finger homeodomain protein 5...  67.0    3e-11   Prunus mume [ume]
ref|XP_004287891.1|  PREDICTED: zinc-finger homeodomain protein 6...  66.6    1e-10   Fragaria vesca subsp. vesca
ref|XP_008344270.1|  PREDICTED: zinc-finger homeodomain protein 6...  65.5    2e-10   Malus domestica [apple tree]
ref|XP_010531036.1|  PREDICTED: zinc-finger homeodomain protein 6...  64.7    4e-10   Tarenaya hassleriana [spider flower]
ref|XP_010548327.1|  PREDICTED: zinc-finger homeodomain protein 6...  63.2    1e-09   Tarenaya hassleriana [spider flower]
ref|XP_009800036.1|  PREDICTED: mini zinc finger protein 3-like       59.7    3e-09   Nicotiana sylvestris
ref|XP_010547467.1|  PREDICTED: zinc-finger homeodomain protein 7...  61.2    4e-09   Tarenaya hassleriana [spider flower]
emb|CDP12305.1|  unnamed protein product                              58.9    5e-09   Coffea canephora [robusta coffee]
ref|XP_009371603.1|  PREDICTED: zinc-finger homeodomain protein 6...  61.2    8e-09   Pyrus x bretschneideri [bai li]
ref|XP_008392268.1|  PREDICTED: zinc-finger homeodomain protein 6...  60.8    9e-09   Malus domestica [apple tree]
ref|XP_004247917.1|  PREDICTED: uncharacterized protein LOC101258...  62.4    9e-09   Solanum lycopersicum
ref|XP_010326742.1|  PREDICTED: uncharacterized protein LOC101258...  62.4    9e-09   Solanum lycopersicum
ref|XP_006354529.1|  PREDICTED: uncharacterized protein LOC102604540  62.0    1e-08   Solanum tuberosum [potatoes]
gb|KJB33554.1|  hypothetical protein B456_006G017300                  58.5    1e-08   Gossypium raimondii
ref|XP_007224511.1|  hypothetical protein PRUPE_ppa023369mg           60.8    1e-08   Prunus persica
gb|ABY61019.1|  mini zinc finger 1                                    58.9    1e-08   Welwitschia mirabilis
ref|XP_010326743.1|  PREDICTED: uncharacterized protein LOC101258...  61.6    1e-08   Solanum lycopersicum
ref|XP_008440716.1|  PREDICTED: zinc-finger homeodomain protein 2     60.5    1e-08   Cucumis melo [Oriental melon]
ref|XP_008220815.1|  PREDICTED: zinc-finger homeodomain protein 5...  60.8    1e-08   Prunus mume [ume]
ref|XP_008220812.1|  PREDICTED: zinc-finger homeodomain protein 5...  60.8    2e-08   Prunus mume [ume]
gb|KJB17762.1|  hypothetical protein B456_003G014100                  60.1    2e-08   Gossypium raimondii
ref|XP_009591850.1|  PREDICTED: mini zinc finger protein 1-like       57.8    2e-08   Nicotiana tomentosiformis
ref|XP_009347543.1|  PREDICTED: zinc-finger homeodomain protein 6...  60.1    2e-08   Pyrus x bretschneideri [bai li]
ref|XP_010095248.1|  hypothetical protein L484_014588                 60.1    2e-08   Morus notabilis
ref|XP_009340741.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  60.1    2e-08   Pyrus x bretschneideri [bai li]
ref|XP_004146554.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  58.9    2e-08   
gb|ABY61018.1|  zinc finger-homeodomain protein 1                     60.1    2e-08   Welwitschia mirabilis
ref|XP_004168867.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  58.9    2e-08   
gb|KGN53304.1|  hypothetical protein Csa_4G046670                     58.9    2e-08   Cucumis sativus [cucumbers]
ref|XP_009603276.1|  PREDICTED: zinc-finger homeodomain protein 6...  59.7    3e-08   Nicotiana tomentosiformis
ref|XP_003517228.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  59.7    3e-08   Glycine max [soybeans]
gb|KHN36110.1|  ZF-HD homeobox protein                                59.7    3e-08   Glycine soja [wild soybean]
ref|XP_003537589.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  59.7    3e-08   
gb|ACU20045.1|  unknown                                               59.7    3e-08   Glycine max [soybeans]
ref|XP_008452084.1|  PREDICTED: zinc-finger homeodomain protein 6...  58.5    3e-08   Cucumis melo [Oriental melon]
ref|XP_007156949.1|  hypothetical protein PHAVU_002G031000g           59.7    4e-08   Phaseolus vulgaris [French bean]
ref|XP_009804697.1|  PREDICTED: zinc-finger homeodomain protein 6     59.3    4e-08   Nicotiana sylvestris
ref|XP_003622365.1|  Zinc finger-homeodomain protein                  57.4    4e-08   
ref|XP_007046919.1|  Homeobox protein 24, putative                    59.3    5e-08   Theobroma cacao [chocolate]
ref|XP_006409164.1|  hypothetical protein EUTSA_v10022806mg           58.2    5e-08   Eutrema salsugineum
emb|CDP02013.1|  unnamed protein product                              59.3    5e-08   Coffea canephora [robusta coffee]
ref|XP_002442725.1|  hypothetical protein SORBIDRAFT_08g001830        56.2    5e-08   Sorghum bicolor [broomcorn]
gb|KJB43477.1|  hypothetical protein B456_007G202500                  58.5    6e-08   Gossypium raimondii
emb|CDY71124.1|  BnaCnng71430D                                        57.8    7e-08   Brassica napus [oilseed rape]
ref|XP_010679737.1|  PREDICTED: zinc-finger homeodomain protein 6     58.2    7e-08   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_001777987.1|  predicted protein                                56.6    8e-08   Physcomitrella patens
ref|XP_009369300.1|  PREDICTED: mini zinc finger protein 1            55.8    8e-08   Pyrus x bretschneideri [bai li]
gb|EYU40171.1|  hypothetical protein MIMGU_mgv1a008153mg              58.5    8e-08   Erythranthe guttata [common monkey flower]
ref|XP_006827242.1|  hypothetical protein AMTR_s00010p00261620        55.5    1e-07   
gb|KJB11042.1|  hypothetical protein B456_001G239100                  55.5    1e-07   Gossypium raimondii
ref|XP_008374543.1|  PREDICTED: mini zinc finger protein 3-like       55.1    1e-07   Malus domestica [apple tree]
gb|KJB11040.1|  hypothetical protein B456_001G239100                  55.1    1e-07   Gossypium raimondii
ref|XP_010254805.1|  PREDICTED: zinc-finger homeodomain protein 5...  57.8    1e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010467646.1|  PREDICTED: zinc-finger homeodomain protein 6     57.0    1e-07   Camelina sativa [gold-of-pleasure]
gb|KJB11041.1|  hypothetical protein B456_001G239100                  55.5    1e-07   Gossypium raimondii
ref|XP_006291509.1|  hypothetical protein CARUB_v10017657mg           57.8    1e-07   Capsella rubella
ref|XP_010514025.1|  PREDICTED: zinc-finger homeodomain protein 3     57.8    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002514762.1|  transcription factor, putative                   55.1    1e-07   Ricinus communis
ref|XP_004143516.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  57.8    2e-07   Cucumis sativus [cucumbers]
gb|KHG03370.1|  hypothetical protein F383_26745                       55.5    2e-07   Gossypium arboreum [tree cotton]
ref|XP_011099626.1|  PREDICTED: zinc-finger homeodomain protein 6     57.8    2e-07   Sesamum indicum [beniseed]
ref|XP_010060955.1|  PREDICTED: zinc-finger homeodomain protein 5     57.4    2e-07   Eucalyptus grandis [rose gum]
ref|XP_010029792.1|  PREDICTED: zinc-finger homeodomain protein 6     57.8    2e-07   Eucalyptus grandis [rose gum]
gb|AFT82678.1|  ZHD9 ZF-HD type transcription factor                  55.1    2e-07   Zea mays subsp. mays [Indian corn]
ref|XP_010489538.1|  PREDICTED: zinc-finger homeodomain protein 6...  56.6    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006340630.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  57.0    2e-07   Solanum tuberosum [potatoes]
ref|XP_006425664.1|  hypothetical protein CICLE_v10025926mg           57.4    2e-07   Citrus clementina
emb|CBI22217.3|  unnamed protein product                              54.7    2e-07   Vitis vinifera
ref|XP_009392577.1|  PREDICTED: zinc-finger homeodomain protein 4...  56.6    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002875135.1|  hypothetical protein ARALYDRAFT_484166           57.0    2e-07   Arabidopsis lyrata subsp. lyrata
gb|KDP31250.1|  hypothetical protein JCGZ_11626                       54.7    2e-07   Jatropha curcas
ref|XP_004234800.1|  PREDICTED: mini zinc finger protein 2-like       54.3    2e-07   Solanum lycopersicum
ref|XP_008444722.1|  PREDICTED: zinc-finger homeodomain protein 2     57.0    2e-07   Cucumis melo [Oriental melon]
ref|XP_010037168.1|  PREDICTED: mini zinc finger protein 3-like       54.7    2e-07   Eucalyptus grandis [rose gum]
ref|XP_004165400.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  57.0    2e-07   
ref|XP_006663173.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  54.7    2e-07   Oryza brachyantha
gb|AAM10791.1|  hypothetical protein At2g02540/T822.16                57.0    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178358.1|  homeobox protein 21                                 57.0    3e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CBI19706.3|  unnamed protein product                              57.0    3e-07   Vitis vinifera
ref|XP_011003723.1|  PREDICTED: zinc-finger homeodomain protein 6     57.0    3e-07   Populus euphratica
ref|XP_009395689.1|  PREDICTED: zinc-finger homeodomain protein 5...  57.0    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010414224.1|  PREDICTED: zinc-finger homeodomain protein 6...  56.2    3e-07   Camelina sativa [gold-of-pleasure]
emb|CDP02231.1|  unnamed protein product                              54.3    3e-07   Coffea canephora [robusta coffee]
ref|XP_010552888.1|  PREDICTED: mini zinc finger protein 2            54.3    3e-07   Tarenaya hassleriana [spider flower]
gb|KFK40227.1|  hypothetical protein AALP_AA3G347100                  55.8    3e-07   Arabis alpina [alpine rockcress]
gb|ABK25649.1|  unknown                                               54.7    3e-07   Picea sitchensis
ref|XP_007032530.1|  Mini zinc finger 2 isoform 1                     54.7    3e-07   Theobroma cacao [chocolate]
ref|XP_008360844.1|  PREDICTED: mini zinc finger protein 3-like       54.3    3e-07   Malus domestica [apple tree]
ref|XP_004509268.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  55.1    3e-07   Cicer arietinum [garbanzo]
ref|XP_004236047.1|  PREDICTED: mini zinc finger protein 3            53.9    3e-07   Solanum lycopersicum
emb|CDY28987.1|  BnaC07g31930D                                        55.8    3e-07   Brassica napus [oilseed rape]
ref|XP_007032531.1|  Mini zinc finger 2 isoform 2                     54.7    3e-07   Theobroma cacao [chocolate]
ref|XP_009411228.1|  PREDICTED: zinc-finger homeodomain protein 5...  57.0    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009376269.1|  PREDICTED: mini zinc finger protein 2            53.9    4e-07   Pyrus x bretschneideri [bai li]
ref|XP_008792497.1|  PREDICTED: mini zinc finger protein 1-like       53.9    4e-07   
ref|XP_010550403.1|  PREDICTED: zinc-finger homeodomain protein 7...  55.8    4e-07   Tarenaya hassleriana [spider flower]
ref|XP_010661067.1|  PREDICTED: mini zinc finger protein 2-like       54.3    4e-07   Vitis vinifera
ref|XP_010065227.1|  PREDICTED: zinc-finger homeodomain protein 4...  56.2    4e-07   Eucalyptus grandis [rose gum]
ref|XP_009407034.1|  PREDICTED: zinc-finger homeodomain protein 2...  56.2    5e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006364600.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  53.5    5e-07   Solanum tuberosum [potatoes]
ref|XP_010425030.1|  PREDICTED: zinc-finger homeodomain protein 3...  56.2    5e-07   Camelina sativa [gold-of-pleasure]
ref|XP_007156052.1|  hypothetical protein PHAVU_003G254200g           56.2    5e-07   Phaseolus vulgaris [French bean]
ref|XP_009394611.1|  PREDICTED: zinc-finger homeodomain protein 2...  56.2    5e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB58256.1|  hypothetical protein B456_009G201300                  55.8    5e-07   Gossypium raimondii
ref|XP_010246039.1|  PREDICTED: zinc-finger homeodomain protein 1...  56.2    5e-07   Nelumbo nucifera [Indian lotus]
gb|KHG11042.1|  hypothetical protein F383_15979                       55.8    5e-07   Gossypium arboreum [tree cotton]
ref|XP_002510399.1|  transcription factor, putative                   55.8    5e-07   Ricinus communis
ref|XP_007037343.1|  Mini zinc finger                                 53.5    6e-07   Theobroma cacao [chocolate]
ref|XP_010922896.1|  PREDICTED: mini zinc finger protein 1-like       53.5    6e-07   Elaeis guineensis
ref|XP_002281371.1|  PREDICTED: zinc-finger homeodomain protein 6     55.8    6e-07   Vitis vinifera
ref|XP_010502266.1|  PREDICTED: zinc-finger homeodomain protein 3...  55.8    6e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006383190.1|  hypothetical protein POPTR_0005s12420g           55.8    6e-07   Populus trichocarpa [western balsam poplar]
ref|XP_004233925.1|  PREDICTED: mini zinc finger protein 2-like       53.5    6e-07   Solanum lycopersicum
ref|XP_004152776.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  55.5    6e-07   
ref|NP_565436.1|  homeobox protein 24                                 55.1    6e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009364948.1|  PREDICTED: zinc-finger homeodomain protein 2...  55.8    6e-07   Pyrus x bretschneideri [bai li]
gb|KHN00536.1|  ZF-HD homeobox protein                                55.8    7e-07   Glycine soja [wild soybean]
ref|XP_003520309.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  55.8    7e-07   Glycine max [soybeans]
ref|XP_008453204.1|  PREDICTED: mini zinc finger protein 3-like       53.1    7e-07   Cucumis melo [Oriental melon]
ref|XP_009365549.1|  PREDICTED: zinc-finger homeodomain protein 2...  55.8    7e-07   Pyrus x bretschneideri [bai li]
ref|XP_009336904.1|  PREDICTED: zinc-finger homeodomain protein 2...  55.8    7e-07   Pyrus x bretschneideri [bai li]
ref|XP_010088164.1|  hypothetical protein L484_013609                 53.1    7e-07   Morus notabilis
emb|CDY70108.1|  BnaCnng66730D                                        55.1    7e-07   Brassica napus [oilseed rape]
ref|XP_004138166.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  53.1    7e-07   Cucumis sativus [cucumbers]
ref|XP_006299733.1|  hypothetical protein CARUB_v10015926mg           55.1    8e-07   Capsella rubella
gb|KDO79571.1|  hypothetical protein CISIN_1g021302mg                 55.5    8e-07   Citrus sinensis [Valencia orange]
ref|XP_010693242.1|  PREDICTED: mini zinc finger protein 2-like       53.1    8e-07   Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CDY70550.1|  BnaAnng34110D                                        55.1    8e-07   Brassica napus [oilseed rape]
emb|CDY41692.1|  BnaC02g34620D                                        55.5    8e-07   Brassica napus [oilseed rape]
ref|XP_009129138.1|  PREDICTED: zinc-finger homeodomain protein 3     55.5    9e-07   Brassica rapa
ref|XP_002266577.2|  PREDICTED: zinc-finger homeodomain protein 6     55.5    9e-07   Vitis vinifera
ref|XP_007210942.1|  hypothetical protein PRUPE_ppa024260mg           52.8    9e-07   Prunus persica
ref|XP_008239948.1|  PREDICTED: mini zinc finger protein 3            52.8    9e-07   Prunus mume [ume]
ref|XP_010471631.1|  PREDICTED: zinc-finger homeodomain protein 5...  55.5    9e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010263641.1|  PREDICTED: zinc-finger homeodomain protein 5     55.5    9e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010416393.1|  PREDICTED: zinc-finger homeodomain protein 5...  55.1    9e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002886165.1|  ATHB24                                           54.7    9e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_007155312.1|  hypothetical protein PHAVU_003G190300g           52.4    9e-07   Phaseolus vulgaris [French bean]
ref|XP_009339301.1|  PREDICTED: mini zinc finger protein 3-like       52.8    1e-06   Pyrus x bretschneideri [bai li]
emb|CBI17508.3|  unnamed protein product                              55.5    1e-06   Vitis vinifera
gb|KDP34399.1|  hypothetical protein JCGZ_12803                       55.1    1e-06   Jatropha curcas
ref|XP_004168481.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  52.8    1e-06   
gb|KJB40199.1|  hypothetical protein B456_007G050500                  54.7    1e-06   Gossypium raimondii
ref|XP_004232414.1|  PREDICTED: zinc-finger homeodomain protein 5     54.7    1e-06   Solanum lycopersicum
ref|XP_009596464.1|  PREDICTED: mini zinc finger protein 2-like       52.4    1e-06   Nicotiana tomentosiformis
ref|XP_007017558.1|  Homeobox protein 33 isoform 1                    54.7    1e-06   Theobroma cacao [chocolate]
ref|XP_010550056.1|  PREDICTED: mini zinc finger protein 2-like       52.4    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_009415270.1|  PREDICTED: zinc-finger homeodomain protein 6...  55.1    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP38514.1|  hypothetical protein JCGZ_04439                       54.7    1e-06   Jatropha curcas
ref|XP_006305389.1|  hypothetical protein CARUB_v10009782mg           54.7    1e-06   Capsella rubella
ref|XP_009341012.1|  PREDICTED: mini zinc finger protein 2-like       52.4    1e-06   Pyrus x bretschneideri [bai li]
ref|XP_006385095.1|  hypothetical protein POPTR_0004s23860g           54.7    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_008353421.1|  PREDICTED: mini zinc finger protein 2-like       52.0    2e-06   Malus domestica [apple tree]
ref|XP_006473514.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  54.7    2e-06   Citrus sinensis [Valencia orange]
ref|XP_003524808.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  52.0    2e-06   Glycine max [soybeans]
ref|XP_010663359.1|  PREDICTED: mini zinc finger protein 1            52.0    2e-06   Vitis vinifera
gb|KDP27146.1|  hypothetical protein JCGZ_19845                       52.4    2e-06   Jatropha curcas
ref|XP_002267747.1|  PREDICTED: zinc-finger homeodomain protein 3     53.9    2e-06   Vitis vinifera
ref|XP_008357201.1|  PREDICTED: zinc-finger homeodomain protein 5...  54.7    2e-06   Malus domestica [apple tree]
ref|XP_006435006.1|  hypothetical protein CICLE_v10001952mg           54.7    2e-06   Citrus clementina
ref|XP_008388052.1|  PREDICTED: zinc-finger homeodomain protein 2     54.7    2e-06   Malus domestica [apple tree]
gb|KDO84585.1|  hypothetical protein CISIN_1g021941mg                 54.3    2e-06   Citrus sinensis [Valencia orange]
gb|KHG07143.1|  hypothetical protein F383_33189                       54.3    2e-06   Gossypium arboreum [tree cotton]
gb|KJB14484.1|  hypothetical protein B456_002G127500                  54.3    2e-06   Gossypium raimondii
emb|CDY09363.1|  BnaA02g26470D                                        54.3    2e-06   Brassica napus [oilseed rape]
gb|KHN11103.1|  ZF-HD homeobox protein                                54.3    2e-06   Glycine soja [wild soybean]
emb|CAN72985.1|  hypothetical protein VITISV_009036                   53.9    2e-06   Vitis vinifera
ref|XP_002521573.1|  transcription factor, putative                   54.3    2e-06   
ref|XP_006599376.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  54.3    2e-06   
ref|XP_006395776.1|  hypothetical protein EUTSA_v10004643mg           54.3    2e-06   Eutrema salsugineum
ref|XP_011087287.1|  PREDICTED: mini zinc finger protein 2            51.6    2e-06   Sesamum indicum [beniseed]
ref|XP_002892806.1|  ATHB31                                           54.3    2e-06   Arabidopsis lyrata subsp. lyrata
ref|NP_172896.1|  homeobox protein 31                                 54.3    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001752347.1|  predicted protein                                54.3    2e-06   Physcomitrella patens
ref|XP_010476498.1|  PREDICTED: zinc-finger homeodomain protein 4     54.3    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002887580.1|  hypothetical protein ARALYDRAFT_895391           54.3    2e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_010458941.1|  PREDICTED: zinc-finger homeodomain protein 4...  54.3    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009613099.1|  PREDICTED: zinc-finger homeodomain protein 4     53.9    2e-06   Nicotiana tomentosiformis
ref|XP_009762783.1|  PREDICTED: zinc-finger homeodomain protein 4...  53.9    2e-06   Nicotiana sylvestris
ref|XP_009117900.1|  PREDICTED: zinc-finger homeodomain protein 4...  53.9    2e-06   Brassica rapa
emb|CDX81638.1|  BnaC08g39630D                                        53.9    2e-06   Brassica napus [oilseed rape]
ref|XP_009408377.1|  PREDICTED: mini zinc finger protein 1-like       51.6    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY00105.1|  BnaC09g01960D                                        51.6    3e-06   Brassica napus [oilseed rape]
ref|XP_003599659.1|  Zinc finger homeodomain protein                  51.6    3e-06   Medicago truncatula
ref|XP_008782098.1|  PREDICTED: zinc-finger homeodomain protein 4...  52.4    3e-06   Phoenix dactylifera
gb|KHN05023.1|  ZF-HD homeobox protein                                52.4    3e-06   Glycine soja [wild soybean]
ref|XP_009148819.1|  PREDICTED: zinc-finger homeodomain protein 4...  53.9    3e-06   Brassica rapa
ref|XP_003555538.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  52.4    3e-06   Glycine max [soybeans]
ref|XP_010099792.1|  hypothetical protein L484_010980                 53.9    3e-06   Morus notabilis
gb|ABK23568.1|  unknown                                               52.0    3e-06   Picea sitchensis
ref|XP_006390329.1|  hypothetical protein EUTSA_v10018892mg           53.9    3e-06   Eutrema salsugineum
emb|CAN60986.1|  hypothetical protein VITISV_044469                   52.4    3e-06   Vitis vinifera
gb|ABR16776.1|  unknown                                               53.5    3e-06   Picea sitchensis
ref|XP_004148693.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  51.2    3e-06   Cucumis sativus [cucumbers]
ref|XP_008379352.1|  PREDICTED: mini zinc finger protein 2            51.2    3e-06   Malus domestica [apple tree]
gb|AEN81237.1|  AT1G75240-like protein                                52.4    3e-06   Neslia paniculata [ball mustard]
ref|NP_565106.1|  homeobox protein 33                                 53.9    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004978478.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  51.2    3e-06   Setaria italica
ref|XP_008459312.1|  PREDICTED: mini zinc finger protein 2            51.2    3e-06   
gb|ACU20724.1|  unknown                                               51.2    3e-06   Glycine max [soybeans]
ref|XP_006302600.1|  hypothetical protein CARUB_v10020705mg           53.5    3e-06   Capsella rubella
ref|XP_008378952.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  53.9    3e-06   
ref|XP_009776475.1|  PREDICTED: uncharacterized protein LOC104226...  54.7    3e-06   Nicotiana sylvestris
ref|XP_009776474.1|  PREDICTED: uncharacterized protein LOC104226...  54.7    3e-06   Nicotiana sylvestris
ref|XP_009776472.1|  PREDICTED: uncharacterized protein LOC104226...  54.7    4e-06   Nicotiana sylvestris
ref|XP_004489393.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  51.2    4e-06   Cicer arietinum [garbanzo]
ref|XP_002264250.1|  PREDICTED: zinc-finger homeodomain protein 4...  52.8    4e-06   Vitis vinifera
ref|XP_002306552.2|  hypothetical protein POPTR_0005s17620g           53.1    4e-06   Populus trichocarpa [western balsam poplar]
ref|XP_008810728.1|  PREDICTED: zinc-finger homeodomain protein 6...  53.5    4e-06   Phoenix dactylifera
ref|XP_010931461.1|  PREDICTED: mini zinc finger protein 1-like       51.2    4e-06   Elaeis guineensis
gb|ABR16769.1|  unknown                                               51.6    4e-06   Picea sitchensis
ref|XP_011010389.1|  PREDICTED: zinc-finger homeodomain protein 2...  53.1    4e-06   Populus euphratica
gb|KDO55569.1|  hypothetical protein CISIN_1g043467mg                 50.8    4e-06   Citrus sinensis [Valencia orange]
gb|AEN81229.1|  AT1G75240-like protein                                52.0    4e-06   Capsella rubella
gb|AEN81227.1|  AT1G75240-like protein                                52.0    4e-06   Capsella grandiflora
ref|XP_010912718.1|  PREDICTED: zinc-finger homeodomain protein 4...  53.1    4e-06   Elaeis guineensis
ref|XP_002534013.1|  transcription factor, putative                   50.8    4e-06   
ref|XP_004973532.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  51.2    4e-06   Setaria italica
ref|XP_007151284.1|  hypothetical protein PHAVU_004G033400g           50.8    5e-06   Phaseolus vulgaris [French bean]
ref|XP_002302028.1|  zinc finger family protein                       53.1    5e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010258353.1|  PREDICTED: mini zinc finger protein 2            50.8    5e-06   Nelumbo nucifera [Indian lotus]
ref|XP_008808961.1|  PREDICTED: zinc-finger homeodomain protein 4...  52.8    5e-06   Phoenix dactylifera
ref|XP_010428533.1|  PREDICTED: zinc-finger homeodomain protein 5     53.1    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002893018.1|  hypothetical protein ARALYDRAFT_472107           50.8    5e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_007138185.1|  hypothetical protein PHAVU_009G187500g           50.8    5e-06   Phaseolus vulgaris [French bean]
ref|XP_009782865.1|  PREDICTED: mini zinc finger protein 2            50.8    5e-06   Nicotiana sylvestris
ref|XP_009416998.1|  PREDICTED: zinc-finger homeodomain protein 4...  52.8    5e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007136351.1|  hypothetical protein PHAVU_009G037900g           53.1    6e-06   Phaseolus vulgaris [French bean]
ref|XP_001773677.1|  predicted protein                                50.4    6e-06   Physcomitrella patens
ref|XP_010539898.1|  PREDICTED: zinc-finger homeodomain protein 5...  52.8    6e-06   Tarenaya hassleriana [spider flower]
gb|KDO42061.1|  hypothetical protein CISIN_1g048741mg                 53.1    6e-06   Citrus sinensis [Valencia orange]
ref|XP_006470838.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  53.1    6e-06   Citrus sinensis [Valencia orange]
ref|XP_006431432.1|  hypothetical protein CICLE_v10003702mg           53.1    6e-06   Citrus clementina
ref|XP_011028851.1|  PREDICTED: zinc-finger homeodomain protein 5...  52.8    6e-06   Populus euphratica
ref|XP_006477452.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  50.4    6e-06   Citrus sinensis [Valencia orange]
ref|XP_008807352.1|  PREDICTED: mini zinc finger protein 1-like       50.4    6e-06   
ref|NP_001077560.1|  mini zinc finger protein                         50.4    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002525870.1|  transcription factor, putative                   52.8    6e-06   
gb|ACN31494.1|  unknown                                               50.8    6e-06   Zea mays [maize]
ref|XP_010930367.1|  PREDICTED: zinc-finger homeodomain protein 4...  52.8    6e-06   Elaeis guineensis
ref|XP_007023152.1|  Homeobox protein 31                              52.8    6e-06   Theobroma cacao [chocolate]
ref|XP_009763792.1|  PREDICTED: zinc-finger homeodomain protein 5...  52.8    6e-06   Nicotiana sylvestris
ref|XP_003574645.1|  PREDICTED: zinc-finger homeodomain protein 1...  52.8    6e-06   Brachypodium distachyon [annual false brome]
ref|XP_006440596.1|  hypothetical protein CICLE_v10023399mg           50.4    6e-06   Citrus clementina
ref|XP_011087615.1|  PREDICTED: zinc-finger homeodomain protein 4     52.8    7e-06   Sesamum indicum [beniseed]
ref|XP_006853040.1|  hypothetical protein AMTR_s00038p00027320        52.0    7e-06   Amborella trichopoda
ref|NP_001151712.1|  mini zinc finger 3                               50.8    7e-06   Zea mays [maize]
ref|XP_008800713.1|  PREDICTED: zinc-finger homeodomain protein 6...  52.8    7e-06   Phoenix dactylifera
ref|XP_010678523.1|  PREDICTED: mini zinc finger protein 1            50.1    7e-06   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_009355386.1|  PREDICTED: zinc-finger homeodomain protein 3     52.8    8e-06   Pyrus x bretschneideri [bai li]
ref|XP_004499360.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  52.8    8e-06   Cicer arietinum [garbanzo]
ref|XP_006417011.1|  hypothetical protein EUTSA_v10008236mg           52.8    8e-06   Eutrema salsugineum
gb|EPS57373.1|  hypothetical protein M569_17445                       50.1    8e-06   Genlisea aurea
ref|XP_010496079.1|  PREDICTED: zinc-finger homeodomain protein 4...  52.4    9e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010527865.1|  PREDICTED: zinc-finger homeodomain protein 4     52.4    9e-06   Tarenaya hassleriana [spider flower]
ref|XP_009396485.1|  PREDICTED: zinc-finger homeodomain protein 6...  52.8    9e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB75740.1|  hypothetical protein B456_012G054400                  49.7    1e-05   Gossypium raimondii
ref|XP_011028421.1|  PREDICTED: zinc-finger homeodomain protein 4     52.4    1e-05   Populus euphratica
ref|XP_010459528.1|  PREDICTED: mini zinc finger protein 3            49.7    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_011467968.1|  PREDICTED: mini zinc finger protein 2            49.7    1e-05   Fragaria vesca subsp. vesca
ref|XP_004230410.1|  PREDICTED: zinc-finger homeodomain protein 4     52.0    1e-05   Solanum lycopersicum
ref|NP_001152181.1|  mini zinc finger 3                               49.7    1e-05   Zea mays [maize]
ref|XP_007215197.1|  hypothetical protein PRUPE_ppa013998mg           49.7    1e-05   Prunus persica
gb|KJB58948.1|  hypothetical protein B456_009G231800                  51.6    1e-05   Gossypium raimondii
ref|XP_009112487.1|  PREDICTED: zinc-finger homeodomain protein 6...  52.0    1e-05   Brassica rapa
emb|CDX73152.1|  BnaC06g36000D                                        52.0    1e-05   Brassica napus [oilseed rape]
gb|KJB75741.1|  hypothetical protein B456_012G054400                  49.7    1e-05   Gossypium raimondii
emb|CDX83807.1|  BnaC08g18380D                                        49.7    1e-05   Brassica napus [oilseed rape]
emb|CDX68137.1|  BnaA07g21770D                                        52.0    1e-05   Brassica napus [oilseed rape]
emb|CDY45419.1|  BnaA07g31990D                                        52.0    1e-05   Brassica napus [oilseed rape]
emb|CDO97666.1|  unnamed protein product                              52.0    1e-05   Coffea canephora [robusta coffee]
ref|XP_010502893.1|  PREDICTED: mini zinc finger protein 2-like       49.7    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008218634.1|  PREDICTED: zinc-finger homeodomain protein 4...  52.4    1e-05   Prunus mume [ume]
ref|XP_004956813.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  49.7    1e-05   Setaria italica
ref|XP_011100838.1|  PREDICTED: mini zinc finger protein 2-like       49.7    1e-05   Sesamum indicum [beniseed]
ref|XP_009386975.1|  PREDICTED: mini zinc finger protein 1-like       49.7    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006395327.1|  hypothetical protein EUTSA_v10005183mg           49.7    1e-05   Eutrema salsugineum
ref|XP_010026173.1|  PREDICTED: zinc-finger homeodomain protein 6...  52.0    1e-05   Eucalyptus grandis [rose gum]
ref|XP_008339432.1|  PREDICTED: zinc-finger homeodomain protein 3...  52.4    1e-05   
gb|AFK40446.1|  unknown                                               49.7    1e-05   
ref|NP_190658.1|  homeobox protein 28                                 51.6    1e-05   
emb|CDY62531.1|  BnaA02g35950D                                        51.6    1e-05   
ref|XP_009106180.1|  PREDICTED: zinc-finger homeodomain protein 5     52.0    1e-05   
ref|XP_009104712.1|  PREDICTED: zinc-finger homeodomain protein 5...  52.0    1e-05   
ref|XP_001778248.1|  predicted protein                                51.6    1e-05   
gb|AAM63229.1|  unknown                                               51.6    1e-05   
ref|XP_003522326.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  49.7    1e-05   
emb|CDX85886.1|  BnaC06g22480D                                        52.0    1e-05   
ref|XP_009403385.1|  PREDICTED: zinc-finger homeodomain protein 4...  51.6    1e-05   
gb|KDP41452.1|  hypothetical protein JCGZ_15859                       52.0    1e-05   
ref|XP_009341386.1|  PREDICTED: zinc-finger homeodomain protein 3...  52.4    1e-05   
ref|XP_009373614.1|  PREDICTED: zinc-finger homeodomain protein 3...  52.4    1e-05   
gb|ADE77597.1|  unknown                                               51.2    1e-05   
ref|NP_974373.1|  mini zinc finger 2                                  49.7    1e-05   
ref|XP_006416562.1|  hypothetical protein EUTSA_v10009699mg           49.3    1e-05   
ref|XP_010496829.1|  PREDICTED: mini zinc finger protein 2            49.7    1e-05   
ref|XP_002283546.1|  PREDICTED: mini zinc finger protein 2            49.7    1e-05   
ref|XP_008789175.1|  PREDICTED: zinc-finger homeodomain protein 4...  51.2    1e-05   
gb|KJB39047.1|  hypothetical protein B456_007G037300                  49.3    1e-05   
gb|KCW56197.1|  hypothetical protein EUGRSUZ_I01942                   49.3    1e-05   
ref|XP_010425681.1|  PREDICTED: mini zinc finger protein 2-like       49.7    1e-05   
ref|XP_002875479.1|  hypothetical protein ARALYDRAFT_484661           49.7    1e-05   
emb|CDY37252.1|  BnaCnng08060D                                        51.6    2e-05   
ref|XP_009128086.1|  PREDICTED: zinc-finger homeodomain protein 5...  51.6    2e-05   
gb|KDP40895.1|  hypothetical protein JCGZ_24894                       51.2    2e-05   
gb|EPS61775.1|  hypothetical protein M569_13018                       51.6    2e-05   
ref|XP_008378554.1|  PREDICTED: zinc-finger homeodomain protein 2...  51.2    2e-05   
ref|XP_008788352.1|  PREDICTED: zinc-finger homeodomain protein 4...  51.2    2e-05   
gb|KCW51883.1|  hypothetical protein EUGRSUZ_J01344                   48.9    2e-05   
ref|XP_007226172.1|  hypothetical protein PRUPE_ppa015411mg           51.6    2e-05   
ref|XP_002965557.1|  hypothetical protein SELMODRAFT_68508            50.1    2e-05   
ref|XP_011098623.1|  PREDICTED: mini zinc finger protein 2            49.3    2e-05   
ref|XP_002306048.1|  zinc finger family protein                       49.7    2e-05   
gb|ABK21050.1|  unknown                                               49.3    2e-05   
ref|XP_006380765.1|  hypothetical protein POPTR_0007s12970g           51.6    2e-05   
emb|CDX86404.1|  BnaA06g31210D                                        48.9    2e-05   
ref|XP_009106129.1|  PREDICTED: mini zinc finger protein 1-like       48.9    2e-05   
gb|EPS61290.1|  hypothetical protein M569_13509                       50.4    2e-05   
ref|XP_010940074.1|  PREDICTED: zinc-finger homeodomain protein 6...  51.2    2e-05   
ref|NP_001147103.1|  zinc finger homeodomain protein 1                49.3    2e-05   
ref|XP_010246148.1|  PREDICTED: mini zinc finger protein 2-like       48.9    2e-05   
emb|CDX81897.1|  BnaC08g37040D                                        48.9    2e-05   
ref|XP_009117583.1|  PREDICTED: mini zinc finger protein 3            48.9    2e-05   
gb|AEN81226.1|  AT1G75240-like protein                                50.1    2e-05   
gb|KFK41904.1|  hypothetical protein AALP_AA2G187400                  48.9    2e-05   
gb|KJB75536.1|  hypothetical protein B456_012G046200                  50.1    2e-05   
ref|XP_010551857.1|  PREDICTED: zinc-finger homeodomain protein 8...  51.2    2e-05   
ref|XP_008678616.1|  PREDICTED: mini zinc finger protein 4-like       49.3    2e-05   
ref|XP_011025804.1|  PREDICTED: zinc-finger homeodomain protein 6     51.2    2e-05   
ref|XP_009405659.1|  PREDICTED: zinc-finger homeodomain protein 6...  51.2    2e-05   
ref|XP_010927875.1|  PREDICTED: zinc-finger homeodomain protein 4...  50.8    2e-05   
ref|XP_002518018.1|  conserved hypothetical protein                   50.8    3e-05   
ref|XP_009406459.1|  PREDICTED: zinc-finger homeodomain protein 4...  50.8    3e-05   
ref|XP_006385182.1|  hypothetical protein POPTR_0003s00800g           50.8    3e-05   
ref|XP_002448925.1|  hypothetical protein SORBIDRAFT_05g001690        48.9    3e-05   
ref|XP_006578270.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  50.8    3e-05   
ref|XP_003522760.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  50.8    3e-05   
ref|XP_007154109.1|  hypothetical protein PHAVU_003G091100g           50.8    3e-05   
ref|XP_009421143.1|  PREDICTED: zinc-finger homeodomain protein 4...  50.8    3e-05   
gb|AAZ07989.1|  zinc finger homeodomain protein 1                     51.2    3e-05   
ref|XP_010554331.1|  PREDICTED: zinc-finger homeodomain protein 4     51.2    3e-05   
gb|KHN13636.1|  ZF-HD homeobox protein                                48.5    3e-05   
ref|XP_010236710.1|  PREDICTED: mini zinc finger protein 4-like       48.9    3e-05   
ref|XP_002981262.1|  hypothetical protein SELMODRAFT_38995            48.1    3e-05   
ref|XP_002302329.1|  hypothetical protein POPTR_0002s10330g           50.4    3e-05   
ref|XP_009111614.1|  PREDICTED: mini zinc finger protein 2-like       48.5    3e-05   
ref|XP_010925945.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  51.2    3e-05   
emb|CDX73105.1|  BnaC06g35530D                                        48.5    3e-05   
ref|XP_011016887.1|  PREDICTED: zinc-finger homeodomain protein 2     50.4    3e-05   
ref|XP_010424889.1|  PREDICTED: zinc-finger homeodomain protein 7...  50.4    3e-05   
ref|XP_010454130.1|  PREDICTED: zinc-finger homeodomain protein 8...  48.9    3e-05   
gb|ABA96296.1|  ZF-HD protein dimerisation region containing protein  48.9    3e-05   
emb|CDX90679.1|  BnaA03g41020D                                        50.4    3e-05   
ref|NP_001176765.1|  Os12g0124500                                     48.5    3e-05   
ref|XP_010420655.1|  PREDICTED: zinc-finger homeodomain protein 8...  48.5    3e-05   
ref|XP_004238289.1|  PREDICTED: zinc-finger homeodomain protein 5     50.4    3e-05   
ref|XP_006376247.1|  hypothetical protein POPTR_0013s11330g           50.4    3e-05   
gb|AES94983.2|  homeobox domain, ZF-HD class protein                  50.8    3e-05   
ref|XP_003612025.1|  Zinc finger-homeodomain protein                  50.8    3e-05   
ref|XP_004293203.2|  PREDICTED: zinc-finger homeodomain protein 6     50.8    4e-05   
ref|XP_002876052.1|  ATHB28                                           50.1    4e-05   
ref|XP_010538070.1|  PREDICTED: mini zinc finger protein 1-like       48.5    4e-05   
gb|ABK25080.1|  unknown                                               50.4    4e-05   
ref|XP_010503763.1|  PREDICTED: zinc-finger homeodomain protein 7...  50.4    4e-05   
gb|ABK25143.1|  unknown                                               50.4    4e-05   
ref|XP_010252306.1|  PREDICTED: zinc-finger homeodomain protein 4     50.4    4e-05   
ref|XP_006376248.1|  hypothetical protein POPTR_0013s11330g           50.4    4e-05   
ref|XP_011001095.1|  PREDICTED: zinc-finger homeodomain protein 2...  50.4    4e-05   
emb|CDP07504.1|  unnamed protein product                              50.4    4e-05   
gb|ABY61029.1|  zinc finger-homeodomain protein 1                     50.4    4e-05   
gb|AFK39189.1|  unknown                                               48.1    4e-05   
ref|XP_010102085.1|  hypothetical protein L484_009028                 50.8    4e-05   
gb|EEC83629.1|  hypothetical protein OsI_29360                        48.5    4e-05   
gb|KFK33763.1|  hypothetical protein AALP_AA5G057100                  48.1    4e-05   
ref|XP_006349273.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  50.4    4e-05   
ref|XP_002514009.1|  transcription factor, putative                   50.4    4e-05   
ref|XP_003529692.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  50.4    4e-05   
gb|KDO82923.1|  hypothetical protein CISIN_1g046396mg                 50.4    5e-05   
ref|XP_006438687.1|  hypothetical protein CICLE_v10032160mg           50.4    5e-05   
ref|XP_004512050.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  50.1    5e-05   
ref|XP_004978993.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  50.4    5e-05   
ref|XP_008460585.1|  PREDICTED: zinc-finger homeodomain protein 4     50.4    5e-05   
emb|CDX85228.1|  BnaC07g25390D                                        48.1    5e-05   
ref|XP_011083674.1|  PREDICTED: zinc-finger homeodomain protein 5     50.1    5e-05   
ref|XP_002306871.1|  zinc finger family protein                       50.1    5e-05   
ref|NP_001061893.1|  Os08g0438100                                     47.8    5e-05   
gb|ABY61024.1|  zinc finger-homeodomain protein 2                     50.1    5e-05   
ref|XP_011004015.1|  PREDICTED: zinc-finger homeodomain protein 5...  50.1    5e-05   
ref|XP_009136568.1|  PREDICTED: zinc-finger homeodomain protein 7...  49.7    5e-05   
gb|EEE68757.1|  hypothetical protein OsJ_27455                        48.1    6e-05   
sp|Q0J5F8.2|MIF4_ORYSJ  RecName: Full=Mini zinc finger protein 4;...  48.1    6e-05   
ref|XP_004301574.1|  PREDICTED: zinc-finger homeodomain protein 4...  50.4    6e-05   
ref|XP_008678609.1|  PREDICTED: zinc-finger homeodomain protein 1...  50.4    6e-05   
ref|XP_003602944.1|  Zinc finger-homeodomain protein                  50.1    6e-05   
gb|KDO58763.1|  hypothetical protein CISIN_1g041672mg                 48.1    6e-05   
emb|CDY39311.1|  BnaC05g10680D                                        50.1    6e-05   
ref|XP_007046103.1|  Homeobox protein 34, putative                    50.1    6e-05   
ref|XP_006593674.1|  PREDICTED: ZF-HD homeobox protein At4g24660      47.8    6e-05   
ref|XP_010515469.1|  PREDICTED: zinc-finger homeodomain protein 7...  49.7    6e-05   
ref|XP_009136567.1|  PREDICTED: zinc-finger homeodomain protein 7...  49.7    6e-05   
ref|XP_009110317.1|  PREDICTED: mini zinc finger protein 3-like       47.4    6e-05   
ref|XP_009149365.1|  PREDICTED: mini zinc finger protein 3-like       47.4    7e-05   
emb|CAN64767.1|  hypothetical protein VITISV_010310                   47.4    7e-05   
ref|XP_009630982.1|  PREDICTED: zinc-finger homeodomain protein 5...  49.7    7e-05   
ref|XP_007018165.1|  Transcription factor, putative                   49.7    7e-05   
ref|XP_010091517.1|  hypothetical protein L484_015944                 47.4    7e-05   
ref|XP_010060081.1|  PREDICTED: zinc-finger homeodomain protein 2...  49.7    8e-05   
gb|EPS69607.1|  hypothetical protein M569_05160                       47.4    8e-05   
ref|XP_011012906.1|  PREDICTED: zinc-finger homeodomain protein 4...  49.7    8e-05   
gb|ABY61028.1|  zinc finger-homeodomain protein 1                     49.3    8e-05   
ref|XP_002994344.1|  hypothetical protein SELMODRAFT_236945           48.1    8e-05   
gb|KEH32742.1|  homeobox domain, ZF-HD class protein                  49.7    8e-05   
ref|XP_006291743.1|  hypothetical protein CARUB_v10017911mg           49.3    8e-05   
ref|XP_002449277.1|  hypothetical protein SORBIDRAFT_05g007050        50.1    8e-05   
ref|NP_001152541.1|  zinc finger homeodomain protein 1                47.4    9e-05   
gb|ACF84413.1|  unknown                                               49.3    9e-05   
ref|XP_010243316.1|  PREDICTED: zinc-finger homeodomain protein 1...  48.9    9e-05   
ref|XP_011010640.1|  PREDICTED: mini zinc finger protein 2-like       47.4    9e-05   
ref|XP_003544235.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  49.3    9e-05   
ref|XP_002445649.1|  hypothetical protein SORBIDRAFT_07g023360        49.3    9e-05   
gb|AFW62325.1|  hypothetical protein ZEAMMB73_977464                  50.1    9e-05   
ref|XP_006306186.1|  hypothetical protein CARUB_v10011804mg           47.0    1e-04   
gb|ACG40831.1|  zinc finger homeodomain protein 1                     47.4    1e-04   
ref|XP_004499446.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  47.0    1e-04   
ref|NP_001065634.1|  Os11g0128300                                     47.4    1e-04   
ref|XP_002325543.2|  hypothetical protein POPTR_0019s11070g           48.9    1e-04   
ref|XP_010530124.1|  PREDICTED: zinc-finger homeodomain protein 2     48.9    1e-04   
ref|XP_008807662.1|  PREDICTED: zinc-finger homeodomain protein 8...  49.3    1e-04   
ref|XP_006836924.1|  hypothetical protein AMTR_s00099p00145100        49.3    1e-04   
ref|XP_004495441.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  48.5    1e-04   
gb|KJB33553.1|  hypothetical protein B456_006G017200                  49.3    1e-04   
ref|XP_011085755.1|  PREDICTED: zinc-finger homeodomain protein 9     49.3    1e-04   
ref|XP_008341574.1|  PREDICTED: zinc-finger homeodomain protein 1...  49.3    1e-04   
gb|ABK22835.1|  unknown                                               48.9    1e-04   
gb|KJB70777.1|  hypothetical protein B456_011G090900                  49.3    1e-04   
ref|XP_008338913.1|  PREDICTED: zinc-finger homeodomain protein 2...  48.9    1e-04   
ref|XP_009115766.1|  PREDICTED: zinc-finger homeodomain protein 7     48.5    1e-04   
ref|XP_010060080.1|  PREDICTED: zinc-finger homeodomain protein 2...  49.3    1e-04   
ref|XP_010272957.1|  PREDICTED: zinc-finger homeodomain protein 1...  48.5    1e-04   
ref|XP_006482592.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  47.0    1e-04   
ref|XP_010498288.1|  PREDICTED: mini zinc finger protein 3-like       46.6    1e-04   
ref|XP_010675490.1|  PREDICTED: zinc-finger homeodomain protein 1...  49.3    1e-04   
ref|XP_006426395.1|  hypothetical protein CICLE_v10027184mg           48.5    1e-04   
ref|XP_006482593.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  47.0    1e-04   
ref|XP_008338912.1|  PREDICTED: zinc-finger homeodomain protein 2...  48.9    1e-04   
ref|XP_009405919.1|  PREDICTED: zinc-finger homeodomain protein 8...  48.9    1e-04   
ref|XP_006466561.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  48.1    1e-04   
emb|CDY45257.1|  BnaA06g09270D                                        48.9    1e-04   
ref|XP_006390403.1|  hypothetical protein EUTSA_v10019368mg           46.6    1e-04   
ref|XP_004501619.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  48.9    1e-04   
ref|XP_004137410.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  46.6    1e-04   
emb|CDY34299.1|  BnaA01g14020D                                        48.1    1e-04   
ref|XP_006338094.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  48.5    1e-04   
ref|XP_006360403.1|  PREDICTED: uncharacterized protein LOC102604466  50.1    1e-04   
ref|XP_010912536.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  48.5    1e-04   
ref|XP_002310240.2|  zinc finger family protein                       48.9    1e-04   
ref|XP_009607017.1|  PREDICTED: zinc-finger homeodomain protein 4...  48.5    1e-04   
ref|XP_009138327.1|  PREDICTED: zinc-finger homeodomain protein 2     48.1    1e-04   
ref|XP_004237971.1|  PREDICTED: zinc-finger homeodomain protein 2     48.5    1e-04   
ref|XP_006841247.1|  hypothetical protein AMTR_s00135p00085840        48.1    2e-04   
emb|CBI31956.3|  unnamed protein product                              48.1    2e-04   
ref|XP_002324056.2|  hypothetical protein POPTR_0017s11920g           48.9    2e-04   
ref|XP_009373696.1|  PREDICTED: zinc-finger homeodomain protein 2...  48.5    2e-04   
ref|XP_006431146.1|  hypothetical protein CICLE_v10012891mg           47.4    2e-04   
ref|XP_002982727.1|  hypothetical protein SELMODRAFT_17376            47.0    2e-04   
ref|NP_001146009.1|  ZF-HD homeobox protein                           48.9    2e-04   
ref|XP_008442199.1|  PREDICTED: mini zinc finger protein 1            46.6    2e-04   
ref|XP_002443023.1|  hypothetical protein SORBIDRAFT_08g006490        48.9    2e-04   
gb|KHN13637.1|  ZF-HD homeobox protein                                46.2    2e-04   
emb|CBI29630.3|  unnamed protein product                              47.0    2e-04   
ref|XP_006581501.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  48.5    2e-04   
ref|XP_002305381.2|  hypothetical protein POPTR_0004s12500g           48.5    2e-04   
ref|XP_008379353.1|  PREDICTED: zinc-finger homeodomain protein 9...  48.5    2e-04   
ref|NP_001149634.1|  ZF-HD homeobox protein                           48.9    2e-04   
ref|XP_009624224.1|  PREDICTED: zinc-finger homeodomain protein 2...  47.8    2e-04   
ref|XP_003526539.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  48.5    2e-04   
ref|XP_011010066.1|  PREDICTED: zinc-finger homeodomain protein 9...  48.5    2e-04   
gb|KHN03576.1|  ZF-HD homeobox protein                                48.1    2e-04   
ref|XP_010416323.1|  PREDICTED: mini zinc finger protein 1            46.2    2e-04   
ref|XP_002534012.1|  conserved hypothetical protein                   48.5    2e-04   
ref|NP_565088.1|  mini zinc finger 1                                  46.2    2e-04   
ref|XP_002888987.1|  hypothetical protein ARALYDRAFT_476603           46.2    2e-04   
ref|XP_003550152.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  48.1    2e-04   
ref|XP_004299701.1|  PREDICTED: zinc-finger homeodomain protein 2...  48.1    2e-04   
dbj|BAJ92783.1|  predicted protein                                    48.5    2e-04   
gb|AAM62558.1|  unknown                                               46.2    2e-04   
ref|XP_003576116.2|  PREDICTED: zinc-finger homeodomain protein 4...  48.5    2e-04   
ref|XP_010682105.1|  PREDICTED: zinc-finger homeodomain protein 3...  48.5    3e-04   
ref|XP_010908151.1|  PREDICTED: zinc-finger homeodomain protein 4...  48.1    3e-04   
ref|XP_006303044.1|  hypothetical protein CARUB_v10021199mg           45.8    3e-04   
ref|XP_006403985.1|  hypothetical protein EUTSA_v10010588mg           48.1    3e-04   
ref|XP_008679371.1|  PREDICTED: mini zinc finger protein 1-like       45.8    3e-04   
ref|XP_007141241.1|  hypothetical protein PHAVU_008G179200g           47.8    3e-04   
gb|EYU45173.1|  hypothetical protein MIMGU_mgv1a012298mg              47.8    3e-04   
ref|XP_006373320.1|  hypothetical protein POPTR_0017s11920g           47.8    3e-04   
ref|XP_010027493.1|  PREDICTED: zinc-finger homeodomain protein 2...  47.4    3e-04   
ref|XP_009385760.1|  PREDICTED: zinc-finger homeodomain protein 2...  47.8    3e-04   
ref|XP_003520078.1|  PREDICTED: transcription factor HB29-like        47.8    3e-04   
ref|XP_009621029.1|  PREDICTED: mini zinc finger protein 2-like       45.4    3e-04   



>ref|XP_007204025.1| hypothetical protein PRUPE_ppa020272mg [Prunus persica]
 gb|EMJ05224.1| hypothetical protein PRUPE_ppa020272mg [Prunus persica]
Length=331

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC RN+AA++GG VLD CGEFM SGE+DIP AL CA
Sbjct  122  VRYRECLRNHAASSGGHVLDGCGEFMPSGEEDIPEALKCA  161



>ref|XP_008241887.1| PREDICTED: zinc-finger homeodomain protein 5-like [Prunus mume]
Length=261

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC +N+AA++GG VLD CGEFM SGE+DIP AL CA
Sbjct  118  VRYRECLKNHAASSGGHVLDGCGEFMPSGEEDIPEALKCA  157



>ref|XP_004287891.1| PREDICTED: zinc-finger homeodomain protein 6-like [Fragaria vesca 
subsp. vesca]
Length=358

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC +N+AATTGG VLD CGEFM SGE+D P  L CA
Sbjct  139  VRYRECLKNHAATTGGHVLDGCGEFMPSGEEDSPGGLKCA  178



>ref|XP_008344270.1| PREDICTED: zinc-finger homeodomain protein 6-like [Malus domestica]
Length=320

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC +NYAA +GG VLD CGEFM SG++D P AL CA
Sbjct  113  IRYRECLKNYAANSGGHVLDGCGEFMPSGDEDTPGALKCA  152



>ref|XP_010531036.1| PREDICTED: zinc-finger homeodomain protein 6-like [Tarenaya hassleriana]
 ref|XP_010531037.1| PREDICTED: zinc-finger homeodomain protein 6-like [Tarenaya hassleriana]
Length=318

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            VRY ECQRN+AA +GG V+D CGEFM +GE D P +L CA    H+
Sbjct  110  VRYRECQRNHAANSGGHVVDGCGEFMPAGEGDTPESLRCAASDCHR  155



>ref|XP_010548327.1| PREDICTED: zinc-finger homeodomain protein 6-like [Tarenaya hassleriana]
Length=307

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQRN+AA++GG V+D CGEFMA+GE+  P  L CA
Sbjct  101  VRYRECQRNHAASSGGHVVDGCGEFMAAGEEGTPEYLRCA  140



>ref|XP_009800036.1| PREDICTED: mini zinc finger protein 3-like [Nicotiana sylvestris]
Length=87

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 45/75 (60%), Gaps = 8/75 (11%)
 Frame = +1

Query  1    RVTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCAD-GC---  168
            R   GGSS   I  RY ECQRN+AA  GG  +D C EFMASGED   AALTCA  GC   
Sbjct  15   RRNIGGSSTRNI--RYVECQRNHAANIGGYAVDGCREFMASGEDGTTAALTCAACGCHRN  72

Query  169  --SHQV*GFFMMSEC  207
                +V G  ++SEC
Sbjct  73   FHRREVDGGEVVSEC  87



>ref|XP_010547467.1| PREDICTED: zinc-finger homeodomain protein 7-like [Tarenaya hassleriana]
Length=251

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  43   RYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            RY ECQRN+AA TGG V+D CGEFM  GE+D P AL CA
Sbjct  75   RYRECQRNHAAVTGGLVIDGCGEFMPGGEEDTPDALKCA  113



>emb|CDP12305.1| unnamed protein product [Coffea canephora]
Length=90

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +1

Query  19   SSGVAI-IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            SSG A+  VRYAECQ+N+AA+ GG  +D C EFMASGE+    ALTCA
Sbjct  17   SSGSAVRTVRYAECQKNHAASLGGYAVDGCREFMASGEEGTSGALTCA  64



>ref|XP_009371603.1| PREDICTED: zinc-finger homeodomain protein 6-like [Pyrus x bretschneideri]
Length=311

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC +N+AA++GG VLD CGEFM  G++D P +L CA
Sbjct  105  VRYRECLKNHAASSGGHVLDGCGEFMPGGDEDTPGSLKCA  144



>ref|XP_008392268.1| PREDICTED: zinc-finger homeodomain protein 6-like [Malus domestica]
Length=311

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  22   SGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            S  A  VRY EC +N+AA++GG VLD CGEFM  G++D P +L CA
Sbjct  99   STAASRVRYRECLKNHAASSGGHVLDGCGEFMPGGDEDTPGSLKCA  144



>ref|XP_004247917.1| PREDICTED: uncharacterized protein LOC101258410 isoform X2 [Solanum 
lycopersicum]
Length=805

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  22   SGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            S +   +RY EC +N+AA+ GG  LD CGEFM SGE+  P AL CA    HQ
Sbjct  549  SDITSSIRYRECLKNHAASMGGHALDGCGEFMPSGEEGTPGALKCAACNCHQ  600



>ref|XP_010326742.1| PREDICTED: uncharacterized protein LOC101258410 isoform X1 [Solanum 
lycopersicum]
Length=821

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  22   SGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            S +   +RY EC +N+AA+ GG  LD CGEFM SGE+  P AL CA    HQ
Sbjct  565  SDITSSIRYRECLKNHAASMGGHALDGCGEFMPSGEEGTPGALKCAACNCHQ  616



>ref|XP_006354529.1| PREDICTED: uncharacterized protein LOC102604540 [Solanum tuberosum]
Length=810

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            +RY EC +N+AA+ GG  LD CGEFM SGE+  P AL CA    HQ
Sbjct  555  IRYRECLKNHAASMGGHALDGCGEFMPSGEEGTPGALKCAACNCHQ  600



>gb|KJB33554.1| hypothetical protein B456_006G017300 [Gossypium raimondii]
Length=128

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    RVTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            R T   SS     VRY ECQRN+AA+ GG V+D C EFMASGE+    AL CA
Sbjct  45   RKTTTNSSLTITTVRYGECQRNHAASIGGYVVDGCREFMASGEEGTSGALACA  97



>ref|XP_007224511.1| hypothetical protein PRUPE_ppa023369mg [Prunus persica]
 gb|EMJ25710.1| hypothetical protein PRUPE_ppa023369mg [Prunus persica]
Length=310

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  4    VTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            + +GG    + I+RY EC +N+AA  GG V D CGEFM SGE+    AL CA
Sbjct  88   LASGGPKSTSKIIRYRECLKNHAANIGGNVFDGCGEFMPSGEEGTLEALKCA  139



>gb|ABY61019.1| mini zinc finger 1 [Welwitschia mirabilis]
Length=184

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +1

Query  13   GGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
             G S  A  VRY EC++N+AA+ GG  +D CGEFM +GE+  P AL CA
Sbjct  109  NGESNTAKSVRYRECRKNHAASIGGYAVDGCGEFMPNGEEGTPGALKCA  157



>ref|XP_010326743.1| PREDICTED: uncharacterized protein LOC101258410 isoform X3 [Solanum 
lycopersicum]
Length=679

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  22   SGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            S +   +RY EC +N+AA+ GG  LD CGEFM SGE+  P AL CA    HQ
Sbjct  423  SDITSSIRYRECLKNHAASMGGHALDGCGEFMPSGEEGTPGALKCAACNCHQ  474



>ref|XP_008440716.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
 ref|XP_008440717.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
 ref|XP_008440718.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
 ref|XP_008440719.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
 ref|XP_008440720.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
Length=336

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++RY EC +N+AA+TGG VLD CGEFM +GED    A+ CA
Sbjct  129  VIRYRECLKNHAASTGGHVLDGCGEFMPNGEDGTTEAMKCA  169



>ref|XP_008220815.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X2 [Prunus 
mume]
 ref|XP_008220816.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X2 [Prunus 
mume]
Length=350

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  4    VTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            + +GG    + I+RY EC +N+AA  GG V D CGEFM SGE+    AL CA
Sbjct  100  LASGGPKSTSKIIRYRECLKNHAANIGGNVFDGCGEFMPSGEEGTLEALKCA  151



>ref|XP_008220812.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X1 [Prunus 
mume]
Length=356

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  4    VTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            + +GG    + I+RY EC +N+AA  GG V D CGEFM SGE+    AL CA
Sbjct  106  LASGGPKSTSKIIRYRECLKNHAANIGGNVFDGCGEFMPSGEEGTLEALKCA  157



>gb|KJB17762.1| hypothetical protein B456_003G014100 [Gossypium raimondii]
Length=291

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  25   GVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            G +++VRY EC +N+AAT GG V+D CGEFM SGE+   AA+ CA
Sbjct  53   GSSLVVRYRECLKNHAATMGGHVVDGCGEFMPSGEEGTMAAMKCA  97



>ref|XP_009591850.1| PREDICTED: mini zinc finger protein 1-like [Nicotiana tomentosiformis]
Length=87

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 45/75 (60%), Gaps = 8/75 (11%)
 Frame = +1

Query  1    RVTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCAD-GC---  168
            R   GGSS   I  RY ECQ+N+AA  GG  +D C EFMASGED   AALTCA  GC   
Sbjct  15   RRNIGGSSIRNI--RYVECQKNHAANIGGYAVDGCREFMASGEDGTTAALTCAACGCHRN  72

Query  169  --SHQV*GFFMMSEC  207
                +V G  ++SEC
Sbjct  73   FHRREVDGGEVVSEC  87



>ref|XP_009347543.1| PREDICTED: zinc-finger homeodomain protein 6-like [Pyrus x bretschneideri]
Length=319

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC +N+AA +GG VLD CGEFM SG++D   AL CA
Sbjct  112  IRYRECLKNHAANSGGHVLDGCGEFMPSGDEDTAGALKCA  151



>ref|XP_010095248.1| hypothetical protein L484_014588 [Morus notabilis]
 gb|EXB59094.1| hypothetical protein L484_014588 [Morus notabilis]
Length=311

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC RN+AA+ GG VLD CGEFM SG+D    AL CA
Sbjct  84   VRYRECLRNHAASKGGHVLDGCGEFMPSGDDGTEEALKCA  123



>ref|XP_009340741.1| PREDICTED: LOW QUALITY PROTEIN: zinc-finger homeodomain protein 
6 [Pyrus x bretschneideri]
Length=323

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC +N+AA +GG VLD CGEFM SG++D   AL CA
Sbjct  112  IRYRECLKNHAANSGGHVLDGCGEFMPSGDEDTAGALKCA  151



>ref|XP_004146554.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
Length=239

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  22   SGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            S  +  +RY++C +N+A  TGG VLD CGEFM SGED  P +  CA
Sbjct  43   SPTSTPLRYSQCLKNHAVKTGGHVLDGCGEFMPSGEDGTPDSFKCA  88



>gb|ABY61018.1| zinc finger-homeodomain protein 1 [Welwitschia mirabilis]
Length=316

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTC  156
            +VRY ECQRN+AA+ G   +D CGEFM +GED  P AL C
Sbjct  117  LVRYRECQRNHAASIGAHAVDGCGEFMPAGEDGTPEALRC  156



>ref|XP_004168867.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
Length=242

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  22   SGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            S  +  +RY++C +N+A  TGG VLD CGEFM SGED  P +  CA
Sbjct  46   SPTSTPLRYSQCLKNHAVKTGGHVLDGCGEFMPSGEDGTPDSFKCA  91



>gb|KGN53304.1| hypothetical protein Csa_4G046670 [Cucumis sativus]
Length=242

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  22   SGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            S  +  +RY++C +N+A  TGG VLD CGEFM SGED  P +  CA
Sbjct  46   SPTSTPLRYSQCLKNHAVKTGGHVLDGCGEFMPSGEDGTPDSFKCA  91



>ref|XP_009603276.1| PREDICTED: zinc-finger homeodomain protein 6-like [Nicotiana 
tomentosiformis]
Length=311

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC +N+AA+ GG VLD CGEFM SGE+  P  L CA
Sbjct  103  VRYKECLKNHAASMGGHVLDGCGEFMPSGEEGTPEYLKCA  142



>ref|XP_003517228.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=317

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC RN+AA+ G  V+D CGEFMASGE+  P +L CA
Sbjct  105  IRYRECLRNHAASMGSHVVDGCGEFMASGEEGTPESLRCA  144



>gb|KHN36110.1| ZF-HD homeobox protein [Glycine soja]
Length=319

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC RN+AA+ G  V+D CGEFMASGE+  P +L CA
Sbjct  107  IRYRECLRNHAASMGSHVVDGCGEFMASGEEGTPESLRCA  146



>ref|XP_003537589.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
 gb|KHN41972.1| ZF-HD homeobox protein [Glycine soja]
Length=336

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC RN+AA+ G  V+D CGEFMASGE+  P +L CA
Sbjct  122  IRYRECLRNHAASMGSHVVDGCGEFMASGEEGTPESLRCA  161



>gb|ACU20045.1| unknown [Glycine max]
Length=336

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC RN+AA+ G  V+D CGEFMASGE+  P +L CA
Sbjct  122  IRYRECLRNHAASMGSHVVDGCGEFMASGEEGTPESLRCA  161



>ref|XP_008452084.1| PREDICTED: zinc-finger homeodomain protein 6-like [Cucumis melo]
Length=241

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY++C +N+A  TGG VLD CGEFM SGED  P +  CA
Sbjct  49   VRYSQCLKNHAVKTGGHVLDGCGEFMPSGEDGTPDSFKCA  88



>ref|XP_007156949.1| hypothetical protein PHAVU_002G031000g [Phaseolus vulgaris]
 gb|ESW28943.1| hypothetical protein PHAVU_002G031000g [Phaseolus vulgaris]
Length=353

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC RN+AA+ G  V+D CGEFMASGE+  P +L CA
Sbjct  137  IRYRECLRNHAASMGSHVVDGCGEFMASGEEGTPESLRCA  176



>ref|XP_009804697.1| PREDICTED: zinc-finger homeodomain protein 6 [Nicotiana sylvestris]
Length=311

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC +N+AA+ GG VLD CGEFM SGE+  P  L CA
Sbjct  103  IRYKECLKNHAASMGGHVLDGCGEFMPSGEEGTPEYLKCA  142



>ref|XP_003622365.1| Zinc finger-homeodomain protein [Medicago truncatula]
 gb|AFK37422.1| unknown [Medicago truncatula]
 gb|KEH42846.1| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=191

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  31   AIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTC  156
             I+V+Y EC +N+AAT GG  +D CGEFM SGE+D   AL C
Sbjct  4    KIVVKYKECLKNHAATIGGNAIDGCGEFMPSGENDTLEALKC  45



>ref|XP_007046919.1| Homeobox protein 24, putative [Theobroma cacao]
 gb|EOX91076.1| Homeobox protein 24, putative [Theobroma cacao]
Length=385

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++RY EC +N+AA+ G  V+D CGEFM SGE+  P AL CA
Sbjct  157  LIRYRECMKNHAASMGSHVMDGCGEFMPSGEEGTPEALKCA  197



>ref|XP_006409164.1| hypothetical protein EUTSA_v10022806mg [Eutrema salsugineum]
 gb|ESQ50617.1| hypothetical protein EUTSA_v10022806mg [Eutrema salsugineum]
Length=267

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQRN+AA++GG V+D CGEFM+SGE+    +L CA
Sbjct  84   VRYRECQRNHAASSGGHVVDGCGEFMSSGEEGTAESLLCA  123



>emb|CDP02013.1| unnamed protein product [Coffea canephora]
Length=356

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 5/51 (10%)
 Frame = +1

Query  7    TAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            TA GSS     VRY EC +N+AA+ GG ++D CGEFM SGE+  P AL CA
Sbjct  121  TAPGSS-----VRYRECLKNHAASMGGHIVDGCGEFMPSGEEGTPEALRCA  166



>ref|XP_002442725.1| hypothetical protein SORBIDRAFT_08g001830 [Sorghum bicolor]
 gb|EES16563.1| hypothetical protein SORBIDRAFT_08g001830 [Sorghum bicolor]
Length=92

 Score = 56.2 bits (134),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  7    TAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            TA  S   A +V Y ECQRN+AA+ GG  +D C EFMASG +   AAL CA
Sbjct  14   TAARSKEAAKVVHYRECQRNHAASIGGHAVDGCREFMASGAEGTAAALMCA  64



>gb|KJB43477.1| hypothetical protein B456_007G202500 [Gossypium raimondii]
Length=324

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++RY EC +N+AA  GG V+D CGEFM SGE+  P AL CA
Sbjct  114  LIRYKECLKNHAAGMGGHVVDGCGEFMPSGEEGTPEALKCA  154



>emb|CDY71124.1| BnaCnng71430D [Brassica napus]
Length=257

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQRN+AA++GG V+D CG+FM+SGE+    +L CA
Sbjct  76   VRYRECQRNHAASSGGHVIDVCGKFMSSGEEGTAESLLCA  115



>ref|XP_010679737.1| PREDICTED: zinc-finger homeodomain protein 6 [Beta vulgaris subsp. 
vulgaris]
Length=290

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++RY ECQ+N+AA  G +V+D CGEFM SGE+  P AL CA
Sbjct  58   MIRYRECQKNHAAHLGSRVVDGCGEFMPSGEEGTPLALKCA  98



>ref|XP_001777987.1| predicted protein [Physcomitrella patens]
 gb|EDQ57200.1| predicted protein [Physcomitrella patens]
Length=165

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  31   AIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            A ++RY EC RN+A TTGG V+D CGEFM  GE+   AAL CA
Sbjct  16   AKVIRYRECNRNHAITTGGYVVDGCGEFMPGGEEGTVAALRCA  58



>ref|XP_009369300.1| PREDICTED: mini zinc finger protein 1 [Pyrus x bretschneideri]
Length=94

 Score = 55.8 bits (133),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            IVRY ECQ+N+AA  GG  +D C EFMASGE+    ALTCA
Sbjct  26   IVRYGECQKNHAAKLGGYAIDGCREFMASGEEGTTKALTCA  66



>gb|EYU40171.1| hypothetical protein MIMGU_mgv1a008153mg [Erythranthe guttata]
Length=383

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            VRY EC +N+AA+ GG V+D CGEFM SG+D  P +L CA    H+
Sbjct  158  VRYRECLKNHAASMGGHVVDGCGEFMPSGDDASPESLRCAACNCHR  203



>ref|XP_006827242.1| hypothetical protein AMTR_s00010p00261620 [Amborella trichopoda]
 gb|ERM94479.1| hypothetical protein AMTR_s00010p00261620 [Amborella trichopoda]
Length=94

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  4    VTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            V + G       VRYAECQ+N+AA  GG  LD C EFMASGE+    AL CA
Sbjct  15   VRSSGQCTRRKCVRYAECQKNHAANIGGYALDGCREFMASGEEGTSEALKCA  66



>gb|KJB11042.1| hypothetical protein B456_001G239100 [Gossypium raimondii]
Length=115

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRYAECQ+N+AA  GG  +D C EFMASGE+   AALTCA
Sbjct  46   VRYAECQKNHAAGVGGYAVDGCREFMASGEEGTTAALTCA  85



>ref|XP_008374543.1| PREDICTED: mini zinc finger protein 3-like [Malus domestica]
Length=98

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            IVRY ECQ+N+AA  GG  +D C EFMASGE+    ALTCA
Sbjct  26   IVRYGECQKNHAAKLGGYAIDGCREFMASGEEGTTEALTCA  66



>gb|KJB11040.1| hypothetical protein B456_001G239100 [Gossypium raimondii]
Length=97

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRYAECQ+N+AA  GG  +D C EFMASGE+   AALTCA
Sbjct  28   VRYAECQKNHAAGVGGYAVDGCREFMASGEEGTTAALTCA  67



>ref|XP_010254805.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
 ref|XP_010254806.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
 ref|XP_010254807.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
Length=363

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC +N+AA+ GG V+D CGEFM SGE+  P AL CA
Sbjct  143  VRYRECLKNHAASIGGHVVDGCGEFMPSGEEGTPEALKCA  182



>ref|XP_010467646.1| PREDICTED: zinc-finger homeodomain protein 6 [Camelina sativa]
Length=252

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  43   RYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            RY ECQ+N+AA++GG V+D CGEFM+SGED    +L CA
Sbjct  69   RYRECQKNHAASSGGHVVDGCGEFMSSGEDGTAESLLCA  107



>gb|KJB11041.1| hypothetical protein B456_001G239100 [Gossypium raimondii]
Length=110

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRYAECQ+N+AA  GG  +D C EFMASGE+   AALTCA
Sbjct  41   VRYAECQKNHAAGVGGYAVDGCREFMASGEEGTTAALTCA  80



>ref|XP_006291509.1| hypothetical protein CARUB_v10017657mg [Capsella rubella]
 gb|EOA24407.1| hypothetical protein CARUB_v10017657mg [Capsella rubella]
Length=320

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  34   IIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            ++++Y EC +N+AA+ GG  +D CGEFM SGED    ALTC+    H+
Sbjct  84   VVIKYKECLKNHAASMGGNAIDGCGEFMPSGEDGSIEALTCSACNCHR  131



>ref|XP_010514025.1| PREDICTED: zinc-finger homeodomain protein 3 [Camelina sativa]
 ref|XP_010514026.1| PREDICTED: zinc-finger homeodomain protein 3 [Camelina sativa]
Length=321

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  34   IIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            ++++Y EC +N+AA+ GG  +D CGEFM SGED    ALTC+    H+
Sbjct  90   VVIKYKECLKNHAASKGGNAIDGCGEFMPSGEDGSIEALTCSACNCHR  137



>ref|XP_002514762.1| transcription factor, putative [Ricinus communis]
 gb|EEF47868.1| transcription factor, putative [Ricinus communis]
Length=95

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            SS V   VRY ECQ+N+AA  GG  +D C EFMASGED    AL CA
Sbjct  21   SSSVVRNVRYGECQKNHAANIGGYAVDGCREFMASGEDAANGALICA  67



>ref|XP_004143516.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform 1 [Cucumis 
sativus]
 ref|XP_004143517.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform 2 [Cucumis 
sativus]
 ref|XP_004162318.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162319.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform 2 [Cucumis 
sativus]
 gb|KGN48833.1| hypothetical protein Csa_6G502710 [Cucumis sativus]
Length=337

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++RY EC +N+AA+TGG VLD CGEFM +GE+    A+ CA
Sbjct  130  VIRYRECLKNHAASTGGHVLDGCGEFMPNGENGTFEAMKCA  170



>gb|KHG03370.1| hypothetical protein F383_26745 [Gossypium arboreum]
Length=110

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRYAECQ+N+AA  GG  +D C EFMASGE+   AALTCA
Sbjct  41   VRYAECQKNHAAGVGGYAVDGCREFMASGEEGTTAALTCA  80



>ref|XP_011099626.1| PREDICTED: zinc-finger homeodomain protein 6 [Sesamum indicum]
Length=353

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +1

Query  13   GGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            G +   A  +RY EC +N+AA  GG V+D CGEFM SGE+  P +L CA
Sbjct  132  GSAPSAAGNIRYRECLKNHAAAMGGHVVDGCGEFMPSGEEGTPESLRCA  180



>ref|XP_010060955.1| PREDICTED: zinc-finger homeodomain protein 5 [Eucalyptus grandis]
 gb|KCW67854.1| hypothetical protein EUGRSUZ_F01575 [Eucalyptus grandis]
Length=308

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC RN+AA+ GG V D CGEFM +GED    AL CA
Sbjct  103  VRYRECLRNHAASVGGSVYDGCGEFMPAGEDGTAGALRCA  142



>ref|XP_010029792.1| PREDICTED: zinc-finger homeodomain protein 6 [Eucalyptus grandis]
 gb|KCW56751.1| hypothetical protein EUGRSUZ_I02434 [Eucalyptus grandis]
Length=343

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC RN+AA+ GG ++D CGEFM SGE+  P    CA
Sbjct  127  IRYRECLRNHAASMGGHIIDGCGEFMPSGEEGTPGYFRCA  166



>gb|AFT82678.1| ZHD9 ZF-HD type transcription factor, partial [Zea mays subsp. 
mays]
 tpg|DAA59217.1| TPA: zinc finger homeodomain protein 1 [Zea mays]
Length=100

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +VRY ECQRN+AA+ GG  +D C EFMAS  D    ALTCA
Sbjct  28   VVRYRECQRNHAASVGGHAVDGCREFMASSADGTAVALTCA  68



>ref|XP_010489538.1| PREDICTED: zinc-finger homeodomain protein 6 isoform X1 [Camelina 
sativa]
 ref|XP_010489539.1| PREDICTED: zinc-finger homeodomain protein 6 isoform X2 [Camelina 
sativa]
Length=262

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  43   RYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            RY ECQ+N+AA++GG V+D CGEFM+SGE+   A+L CA
Sbjct  79   RYRECQKNHAASSGGHVVDGCGEFMSSGEEGTAASLLCA  117



>ref|XP_006340630.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Solanum tuberosum]
Length=302

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  7    TAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            T+  S      VRY EC +N+AA  GG V D CGEFM SGE++ P  L CA
Sbjct  88   TSSASERNITPVRYKECLKNHAANMGGYVRDGCGEFMPSGEEETPEYLKCA  138



>ref|XP_006425664.1| hypothetical protein CICLE_v10025926mg [Citrus clementina]
 ref|XP_006466804.1| PREDICTED: ras-interacting protein RIP3-like [Citrus sinensis]
 gb|ESR38904.1| hypothetical protein CICLE_v10025926mg [Citrus clementina]
Length=363

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 4/51 (8%)
 Frame = +1

Query  19   SSGVAII----VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++  AII    +RY EC +N+AA  G  V+D CGEFM SGED  P  L CA
Sbjct  129  TTSTAIITASSIRYRECLKNHAANMGNHVIDGCGEFMPSGEDGTPEGLKCA  179



>emb|CBI22217.3| unnamed protein product [Vitis vinifera]
Length=89

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  7    TAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++  SS     VRY ECQ+N+AA  GG  +D C EFMASGE+   +ALTCA
Sbjct  16   SSANSSFTVRSVRYGECQKNHAAGVGGYAVDGCREFMASGEEGTSSALTCA  66



>ref|XP_009392577.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=257

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  34   IIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++V+Y EC +N+AA+ GG   D CGEFM SGE+  P AL C+
Sbjct  61   VVVKYRECHKNHAASIGGSATDGCGEFMPSGEEGTPEALKCS  102



>ref|XP_002875135.1| hypothetical protein ARALYDRAFT_484166 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51394.1| hypothetical protein ARALYDRAFT_484166 [Arabidopsis lyrata subsp. 
lyrata]
Length=318

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  34   IIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            ++++Y EC +N+AAT GG  +D CGEFM SGE+    ALTC+    H+
Sbjct  88   VVIKYKECLKNHAATMGGNAIDGCGEFMPSGEEGSIEALTCSACNCHR  135



>gb|KDP31250.1| hypothetical protein JCGZ_11626 [Jatropha curcas]
Length=99

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            SS +   VRY ECQ+N+AA  GG  +D C EFMASGE+    AL CA
Sbjct  24   SSSIVRTVRYGECQKNHAANIGGYAVDGCREFMASGEEGTNTALMCA  70



>ref|XP_004234800.1| PREDICTED: mini zinc finger protein 2-like [Solanum lycopersicum]
Length=88

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
             VRY ECQRN+AA  GG  +D C EFM SGE+  P AL+CA
Sbjct  23   TVRYRECQRNHAAGVGGYAVDGCREFMPSGEEGTPGALSCA  63



>ref|XP_008444722.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
Length=314

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 4/49 (8%)
 Frame = +1

Query  13   GGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            GG SGV    RY EC +N+AA+ GG + D CGEFM SGED    AL CA
Sbjct  80   GGVSGV----RYRECLKNHAASVGGNIYDGCGEFMPSGEDGTLEALKCA  124



>ref|XP_010037168.1| PREDICTED: mini zinc finger protein 3-like [Eucalyptus grandis]
 gb|KCW48836.1| hypothetical protein EUGRSUZ_K02471 [Eucalyptus grandis]
Length=96

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            SS     VRYAECQ+N+AA  GG  +D C EFMASGE+    ALTCA
Sbjct  20   SSSAVRSVRYAECQKNHAAGIGGYAVDGCREFMASGEEGTSDALTCA  66



>ref|XP_004165400.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 gb|KGN62606.1| hypothetical protein Csa_2G361700 [Cucumis sativus]
Length=320

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 4/49 (8%)
 Frame = +1

Query  13   GGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            GG SGV    RY EC +N+AA+ GG + D CGEFM SGED    AL CA
Sbjct  87   GGVSGV----RYRECLKNHAASVGGNIYDGCGEFMPSGEDGTLEALKCA  131



>ref|XP_006663173.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Oryza brachyantha]
Length=100

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +VRY ECQRN+AA+ GG  +D C EFMASG D    AL CA
Sbjct  29   VVRYRECQRNHAASIGGHAVDGCREFMASGADGTAPALLCA  69



>gb|AAM10791.1| hypothetical protein At2g02540/T822.16 [Arabidopsis thaliana]
Length=310

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  34   IIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++++Y EC +N+AAT GG  +D CGEFM SGE+    ALTC+
Sbjct  83   VVIKYKECLKNHAATMGGNAIDGCGEFMPSGEEGSIEALTCS  124



>ref|NP_178358.1| homeobox protein 21 [Arabidopsis thaliana]
 sp|O64722.1|ZHD3_ARATH RecName: Full=Zinc-finger homeodomain protein 3; Short=AtZHD3; 
AltName: Full=Homeobox protein 21; Short=AtHB-21; AltName: 
Full=Zinc finger homeodomain transcription factor 4 [Arabidopsis 
thaliana]
 gb|AAC18932.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAV63863.1| hypothetical protein At2g02540 [Arabidopsis thaliana]
 gb|AEC05592.1| homeobox protein 21 [Arabidopsis thaliana]
Length=310

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  34   IIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++++Y EC +N+AAT GG  +D CGEFM SGE+    ALTC+
Sbjct  83   VVIKYKECLKNHAATMGGNAIDGCGEFMPSGEEGSIEALTCS  124



>emb|CBI19706.3| unnamed protein product [Vitis vinifera]
Length=321

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +1

Query  7    TAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            T GGS+  A  VRY EC +N+AA  GG V+D CGEFM  GE+    AL CA    H+
Sbjct  123  TIGGSNSKAS-VRYRECLKNHAANIGGNVVDGCGEFMPDGEEGTLEALMCAACNCHR  178



>ref|XP_011003723.1| PREDICTED: zinc-finger homeodomain protein 6 [Populus euphratica]
 ref|XP_011003724.1| PREDICTED: zinc-finger homeodomain protein 6 [Populus euphratica]
 ref|XP_011003725.1| PREDICTED: zinc-finger homeodomain protein 6 [Populus euphratica]
 ref|XP_011003726.1| PREDICTED: zinc-finger homeodomain protein 6 [Populus euphratica]
 ref|XP_011003727.1| PREDICTED: zinc-finger homeodomain protein 6 [Populus euphratica]
 ref|XP_011003728.1| PREDICTED: zinc-finger homeodomain protein 6 [Populus euphratica]
Length=338

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +S  +  +RY EC +N+AA+ GG VLD CGEFM  GE+  P    CA
Sbjct  115  TSASSASIRYRECLKNHAASMGGHVLDGCGEFMPGGEEGTPETFKCA  161



>ref|XP_009395689.1| PREDICTED: zinc-finger homeodomain protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=359

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            ++   I  RY EC RN+AA  GG V+D CGEFM SGE D P A  CA    H+
Sbjct  126  AATATISTRYGECLRNHAAAIGGHVVDGCGEFMPSGEPDTPEAFNCAACGCHR  178



>ref|XP_010414224.1| PREDICTED: zinc-finger homeodomain protein 6-like [Camelina sativa]
Length=264

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  43   RYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            RY ECQ+N+AAT+GG V+D CGEFM+SGE+    +L CA
Sbjct  81   RYRECQKNHAATSGGHVVDGCGEFMSSGEEGTAESLLCA  119



>emb|CDP02231.1| unnamed protein product [Coffea canephora]
Length=96

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  7    TAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
             A  SS     VRY ECQ+N+AA  GG  +D C EFMASGE+   AAL+CA
Sbjct  16   NATNSSFTVRNVRYGECQKNHAAGVGGYAVDGCREFMASGEEGTNAALSCA  66



>ref|XP_010552888.1| PREDICTED: mini zinc finger protein 2 [Tarenaya hassleriana]
Length=99

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA  GG  +D C EFMASGE+   AALTCA
Sbjct  30   VRYGECQKNHAAAVGGYAVDGCREFMASGEEGSDAALTCA  69



>gb|KFK40227.1| hypothetical protein AALP_AA3G347100 [Arabis alpina]
Length=246

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  10   AGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            A      A  VRY ECQ+N+AA++GG V+D CGEFM+SGE+    +  CA
Sbjct  53   APAPRSYARSVRYRECQKNHAASSGGHVVDGCGEFMSSGEEGTAESFLCA  102



>gb|ABK25649.1| unknown [Picea sitchensis]
Length=139

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC++N+AA+ GG  +D CGEFMASGE+   AA+ CA
Sbjct  74   VRYGECRKNHAASIGGYAVDGCGEFMASGEEGTAAAMKCA  113



>ref|XP_007032530.1| Mini zinc finger 2 isoform 1 [Theobroma cacao]
 gb|EOY03456.1| Mini zinc finger 2 isoform 1 [Theobroma cacao]
Length=136

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA  GG  +D C EFMASGE+   AALTCA
Sbjct  68   VRYGECQKNHAAGVGGYAVDGCREFMASGEEGTSAALTCA  107



>ref|XP_008360844.1| PREDICTED: mini zinc finger protein 3-like [Malus domestica]
 ref|XP_008367549.1| PREDICTED: mini zinc finger protein 3-like [Malus domestica]
Length=94

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA  GG  +D C EFMASGED    ALTCA
Sbjct  27   VRYCECQKNHAANLGGYAVDGCREFMASGEDGTTEALTCA  66



>ref|XP_004509268.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cicer arietinum]
Length=171

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC +N+AA+ GG V D CGEFM SGE + P    CA
Sbjct  23   IRYKECVKNHAASIGGHVTDGCGEFMPSGEQNTPQHFICA  62



>ref|XP_004236047.1| PREDICTED: mini zinc finger protein 3 [Solanum lycopersicum]
Length=83

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 3/49 (6%)
 Frame = +1

Query  19   SSGVAII--VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            SSG + I  VRY ECQRN+AA  GG  +D C EFMA+G DD  AALTCA
Sbjct  13   SSGSSTIRNVRYVECQRNHAANIGGYAVDGCREFMATG-DDGTAALTCA  60



>emb|CDY28987.1| BnaC07g31930D [Brassica napus]
Length=245

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  43   RYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +Y ECQ+N+AA TGGQV+D C EFM  GE+  P AL CA
Sbjct  54   KYEECQKNHAALTGGQVVDGCCEFMPGGEEGTPGALKCA  92



>ref|XP_007032531.1| Mini zinc finger 2 isoform 2, partial [Theobroma cacao]
 gb|EOY03457.1| Mini zinc finger 2 isoform 2, partial [Theobroma cacao]
Length=139

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA  GG  +D C EFMASGE+   AALTCA
Sbjct  71   VRYGECQKNHAAGVGGYAVDGCREFMASGEEGTSAALTCA  110



>ref|XP_009411228.1| PREDICTED: zinc-finger homeodomain protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +1

Query  7    TAGGSSGVAII-VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            T   ++G A I  +Y EC RN+AA  GG V+D CGEFM SG+ D P AL CA    H+
Sbjct  134  TITAATGAAYISTKYKECLRNHAAALGGHVVDGCGEFMPSGDPDTPEALKCAACGCHR  191



>ref|XP_009376269.1| PREDICTED: mini zinc finger protein 2 [Pyrus x bretschneideri]
Length=89

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = +1

Query  1    RVTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMAS-GEDDIPAALTCA  159
            R T   S+    +VRY ECQ+N+AA  GG  +D C EFMAS GE+   AALTCA
Sbjct  9    RRTEQASASSFTVVRYGECQKNHAAAVGGYAVDGCREFMASNGEEGTTAALTCA  62



>ref|XP_008792497.1| PREDICTED: mini zinc finger protein 1-like [Phoenix dactylifera]
Length=91

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  7    TAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            + G S     +VRY EC++N+AA+ GG  +D C EFMASGE+   AAL CA
Sbjct  12   SNGSSVKKEKVVRYRECRKNHAASIGGYAVDGCREFMASGEEGTSAALRCA  62



>ref|XP_010550403.1| PREDICTED: zinc-finger homeodomain protein 7-like [Tarenaya hassleriana]
 ref|XP_010550404.1| PREDICTED: zinc-finger homeodomain protein 7-like [Tarenaya hassleriana]
Length=272

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY  CQ+N+AA TGG V+D C EFM SGE++ P AL CA
Sbjct  85   VRYRGCQKNHAAATGGHVVDGCCEFMPSGEEETPEALKCA  124



>ref|XP_010661067.1| PREDICTED: mini zinc finger protein 2-like [Vitis vinifera]
Length=129

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  7    TAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++  SS     VRY ECQ+N+AA  GG  +D C EFMASGE+   +ALTCA
Sbjct  50   SSANSSFTVRSVRYGECQKNHAAGVGGYAVDGCREFMASGEEGTSSALTCA  100



>ref|XP_010065227.1| PREDICTED: zinc-finger homeodomain protein 4-like [Eucalyptus 
grandis]
 gb|KCW62572.1| hypothetical protein EUGRSUZ_G00066 [Eucalyptus grandis]
Length=332

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  34   IIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            ++V+Y EC +N+AA  GG  +D CGEFM SGE+    ALTC+    H+
Sbjct  83   VVVKYKECLKNHAAAMGGTAMDGCGEFMPSGEEGTIEALTCSACNCHR  130



>ref|XP_009407034.1| PREDICTED: zinc-finger homeodomain protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=296

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC RN+AA+ GG VLD CGEFM  G+   P AL CA
Sbjct  69   IRYRECLRNHAASIGGHVLDGCGEFMPEGDPSSPEALKCA  108



>ref|XP_006364600.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Solanum tuberosum]
Length=83

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 3/49 (6%)
 Frame = +1

Query  19   SSGVAII--VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            SSG + I  +RY ECQRN+AA  GG  +D C EFMA+G DD  AALTCA
Sbjct  13   SSGSSTIRNIRYVECQRNHAANIGGYAVDGCREFMATG-DDGTAALTCA  60



>ref|XP_010425030.1| PREDICTED: zinc-finger homeodomain protein 3-like [Camelina sativa]
Length=321

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  34   IIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            ++++Y EC +N+AA+ GG  +D CG+FM SGED    ALTC+    H+
Sbjct  87   VVIKYKECLKNHAASKGGNAIDGCGDFMPSGEDGSIEALTCSACNCHR  134



>ref|XP_007156052.1| hypothetical protein PHAVU_003G254200g [Phaseolus vulgaris]
 gb|ESW28046.1| hypothetical protein PHAVU_003G254200g [Phaseolus vulgaris]
Length=321

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC +N+AA  GG V D CGEFM SGE+  P +  CA
Sbjct  113  VRYRECLKNHAAIMGGHVTDGCGEFMPSGEEGTPESFKCA  152



>ref|XP_009394611.1| PREDICTED: zinc-finger homeodomain protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=333

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +1

Query  34   IIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCAD-GC  168
            I  +Y EC RN+AA  GG V+D CGEFM +G+ D P AL CA  GC
Sbjct  124  IPTKYKECLRNHAAALGGHVVDGCGEFMPNGDPDTPEALKCAACGC  169



>gb|KJB58256.1| hypothetical protein B456_009G201300 [Gossypium raimondii]
 gb|KJB58257.1| hypothetical protein B456_009G201300 [Gossypium raimondii]
Length=299

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  4    VTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++ G ++  +  VRY EC +N+AA+ GG V D CGEFM SGE+    AL CA
Sbjct  80   ISVGSNAKPSNFVRYRECLKNHAASIGGNVYDGCGEFMPSGEEGTLEALKCA  131



>ref|XP_010246039.1| PREDICTED: zinc-finger homeodomain protein 1-like [Nelumbo nucifera]
Length=310

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = +1

Query  16   GSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCAD-GC  168
            GS G AI  RY ECQRN++A+ GG   D CGEFMA+GE+    ++ CA  GC
Sbjct  55   GSVGRAI--RYKECQRNHSASIGGHTYDGCGEFMAAGEEGSKESMRCAACGC  104



>gb|KHG11042.1| hypothetical protein F383_15979 [Gossypium arboreum]
Length=299

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  4    VTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++ G ++  +  VRY EC +N+AA+ GG V D CGEFM SGE+    AL CA
Sbjct  80   ISVGSNAKPSSFVRYRECLKNHAASIGGNVYDGCGEFMPSGEEGTLEALKCA  131



>ref|XP_002510399.1| transcription factor, putative [Ricinus communis]
 gb|EEF52586.1| transcription factor, putative [Ricinus communis]
Length=289

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  4    VTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            + + GS+     VRY EC RN+AA+ GG V D CGEFM  GE+    AL CA
Sbjct  60   IISKGSNSKTTHVRYRECLRNHAASVGGNVFDGCGEFMPGGEEGSLEALKCA  111



>ref|XP_007037343.1| Mini zinc finger [Theobroma cacao]
 gb|EOY21844.1| Mini zinc finger [Theobroma cacao]
Length=89

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA  GG  +D C EFMASGE+    ALTCA
Sbjct  24   VRYGECQKNHAANIGGYAVDGCREFMASGEEGTTGALTCA  63



>ref|XP_010922896.1| PREDICTED: mini zinc finger protein 1-like [Elaeis guineensis]
Length=95

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +VRY EC++N+AA+ GG  +D C EFMASGE+   AAL CA
Sbjct  22   VVRYGECRKNHAASIGGYAVDGCREFMASGEEGTSAALRCA  62



>ref|XP_002281371.1| PREDICTED: zinc-finger homeodomain protein 6 [Vitis vinifera]
Length=316

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +1

Query  7    TAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            T GGS+  A  VRY EC +N+AA  GG V+D CGEFM  GE+    AL CA    H+
Sbjct  94   TIGGSNSKAS-VRYRECLKNHAANIGGNVVDGCGEFMPDGEEGTLEALMCAACNCHR  149



>ref|XP_010502266.1| PREDICTED: zinc-finger homeodomain protein 3-like [Camelina sativa]
 ref|XP_010502267.1| PREDICTED: zinc-finger homeodomain protein 3-like [Camelina sativa]
Length=313

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  34   IIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            ++++Y EC +N+AA+ GG  +D CGEFM SG+D    ALTC+    H+
Sbjct  85   VVIKYKECLKNHAASKGGNAIDGCGEFMPSGKDGSIEALTCSACNCHR  132



>ref|XP_006383190.1| hypothetical protein POPTR_0005s12420g [Populus trichocarpa]
 gb|ERP60987.1| hypothetical protein POPTR_0005s12420g [Populus trichocarpa]
Length=339

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC +N+AA+ GG VLD CGEFM  GE+  P    CA
Sbjct  124  IRYRECLKNHAASMGGHVLDGCGEFMPGGEEGTPETFKCA  163



>ref|XP_004233925.1| PREDICTED: mini zinc finger protein 2-like [Solanum lycopersicum]
Length=102

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 3/55 (5%)
 Frame = +1

Query  4    VTAGGSSGVAI---IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VT+  S+  A    IVRY ECQ+N+AA  GG  +D C EFM SGE+   +A  CA
Sbjct  15   VTSESSTNSAFTVRIVRYKECQKNHAARVGGHAVDGCREFMPSGEEGTSSAFICA  69



>ref|XP_004152776.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
Length=276

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 4/49 (8%)
 Frame = +1

Query  13   GGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            GG SGV    RY EC +N+AA+ GG + D CGEFM SGED    AL CA
Sbjct  43   GGVSGV----RYRECLKNHAASVGGNIYDGCGEFMPSGEDGTLEALKCA  87



>ref|NP_565436.1| homeobox protein 24 [Arabidopsis thaliana]
 sp|Q9ZPW7.1|ZHD6_ARATH RecName: Full=Zinc-finger homeodomain protein 6; Short=AtZHD6; 
AltName: Full=Homeobox protein 24; Short=AtHB-24 [Arabidopsis 
thaliana]
 gb|AAD15502.1| expressed protein [Arabidopsis thaliana]
 gb|AAM65795.1| unknown [Arabidopsis thaliana]
 gb|AEC06760.1| homeobox protein 24 [Arabidopsis thaliana]
Length=262

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  43   RYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            RY ECQ+N+AA++GG V+D CGEFM+SGE+    +L CA
Sbjct  81   RYRECQKNHAASSGGHVVDGCGEFMSSGEEGTVESLLCA  119



>ref|XP_009364948.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=349

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            IVRY EC +N+AA  GG V D CGEFM SGE+    AL CA
Sbjct  117  IVRYRECLKNHAANIGGNVFDGCGEFMPSGEEGTLEALKCA  157



>gb|KHN00536.1| ZF-HD homeobox protein [Glycine soja]
Length=333

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            + RY EC +N+AA+ GG V D CGEFM +GE+  P +L CA
Sbjct  112  LFRYRECLKNHAASMGGHVTDGCGEFMPNGEEGTPESLKCA  152



>ref|XP_003520309.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=334

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            + RY EC +N+AA+ GG V D CGEFM +GE+  P +L CA
Sbjct  113  LFRYRECLKNHAASMGGHVTDGCGEFMPNGEEGTPESLKCA  153



>ref|XP_008453204.1| PREDICTED: mini zinc finger protein 3-like [Cucumis melo]
Length=96

 Score = 53.1 bits (126),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRYAECQ+N+AA  GG  +D C EFMA GED    AL CA
Sbjct  30   VRYAECQKNHAAKLGGFAVDGCREFMARGEDGTEEALNCA  69



>ref|XP_009365549.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=344

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  28   VAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +A +VRY EC +N+AA  GG V D CGEFM SGE+    AL CA
Sbjct  109  LAKVVRYRECLKNHAANIGGNVFDGCGEFMPSGEEGTMEALKCA  152



>ref|XP_009336904.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=351

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +VRY EC +N+AA  GG V D CGEFM SGE+    AL CA
Sbjct  119  VVRYRECLKNHAANIGGNVFDGCGEFMPSGEEGTAEALKCA  159



>ref|XP_010088164.1| hypothetical protein L484_013609 [Morus notabilis]
 gb|EXB31976.1| hypothetical protein L484_013609 [Morus notabilis]
Length=97

 Score = 53.1 bits (126),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA  GG  +D C EFMASGE+    ALTCA
Sbjct  28   VRYGECQKNHAAGVGGYAVDGCREFMASGEEGTSGALTCA  67



>emb|CDY70108.1| BnaCnng66730D [Brassica napus]
Length=265

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            V Y ECQRN+AA++GG V+D CGEFM+SGE+    +L CA
Sbjct  84   VSYRECQRNHAASSGGHVVDGCGEFMSSGEEGTAESLLCA  123



>ref|XP_004138166.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 gb|KGN63667.1| hypothetical protein Csa_1G009710 [Cucumis sativus]
Length=95

 Score = 53.1 bits (126),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRYAECQ+N+AA  GG  +D C EFMA GED    AL CA
Sbjct  29   VRYAECQKNHAAKLGGFAVDGCREFMARGEDGTEEALNCA  68



>ref|XP_006299733.1| hypothetical protein CARUB_v10015926mg [Capsella rubella]
 gb|EOA32631.1| hypothetical protein CARUB_v10015926mg [Capsella rubella]
Length=265

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  43   RYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            RY ECQ+N+AA++GG V+D CGEFM+SGE+    +L CA
Sbjct  82   RYRECQKNHAASSGGHVVDGCGEFMSSGEEGTAESLLCA  120



>gb|KDO79571.1| hypothetical protein CISIN_1g021302mg [Citrus sinensis]
 gb|KDO79572.1| hypothetical protein CISIN_1g021302mg [Citrus sinensis]
 gb|KDO79573.1| hypothetical protein CISIN_1g021302mg [Citrus sinensis]
 gb|KDO79574.1| hypothetical protein CISIN_1g021302mg [Citrus sinensis]
Length=314

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC +N+AA  G  V+D CGEFM SGED  P  L CA
Sbjct  141  IRYRECLKNHAANMGSHVIDGCGEFMPSGEDGTPEGLKCA  180



>ref|XP_010693242.1| PREDICTED: mini zinc finger protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=99

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA+ GG  LD C EFMASGE+    AL CA
Sbjct  28   VRYLECQKNHAASIGGYALDGCREFMASGEEGTDLALVCA  67



>emb|CDY70550.1| BnaAnng34110D [Brassica napus]
Length=257

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            V Y ECQRN+AA++GG V+D CGEFM+SGE+    +L CA
Sbjct  82   VSYRECQRNHAASSGGHVVDGCGEFMSSGEEGTAESLLCA  121



>emb|CDY41692.1| BnaC02g34620D [Brassica napus]
Length=300

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  4    VTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++   +    ++ +Y EC +N+AA+TGG  +D CGEFM SGE+    ALTC+
Sbjct  73   ISNNNNKEKHVVNKYKECLKNHAASTGGHAIDGCGEFMPSGEEGSIEALTCS  124



>ref|XP_009129138.1| PREDICTED: zinc-finger homeodomain protein 3 [Brassica rapa]
Length=300

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  4    VTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++   +    ++ +Y EC +N+AA+TGG  +D CGEFM SGE+    ALTC+
Sbjct  73   ISNNNNKEKHVVNKYKECLKNHAASTGGHAIDGCGEFMPSGEEGSIEALTCS  124



>ref|XP_002266577.2| PREDICTED: zinc-finger homeodomain protein 6 [Vitis vinifera]
Length=345

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC +N+AA+ GG V D CGEFM SGE+    AL CA
Sbjct  127  IRYRECLKNHAASMGGHVFDGCGEFMPSGEEGTLEALKCA  166



>ref|XP_007210942.1| hypothetical protein PRUPE_ppa024260mg [Prunus persica]
 gb|EMJ12141.1| hypothetical protein PRUPE_ppa024260mg [Prunus persica]
Length=94

 Score = 52.8 bits (125),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA  GG  +D C EFMASGE+    ALTCA
Sbjct  27   VRYGECQKNHAANLGGYAVDGCREFMASGEEGTTEALTCA  66



>ref|XP_008239948.1| PREDICTED: mini zinc finger protein 3 [Prunus mume]
Length=94

 Score = 52.8 bits (125),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA  GG  +D C EFMASGE+    ALTCA
Sbjct  27   VRYGECQKNHAANLGGYAVDGCREFMASGEEGTTEALTCA  66



>ref|XP_010471631.1| PREDICTED: zinc-finger homeodomain protein 5-like [Camelina sativa]
Length=307

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC +N+AAT GG V D CGEFM SGE+    AL CA
Sbjct  72   VRYRECLKNHAATVGGSVHDGCGEFMPSGEEGTIEALRCA  111



>ref|XP_010263641.1| PREDICTED: zinc-finger homeodomain protein 5 [Nelumbo nucifera]
Length=356

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC +N+AA+ GG V+D CGEFM SGE+  P AL CA
Sbjct  135  VRYRECLKNHAASIGGHVVDGCGEFMPSGEEGTPEALKCA  174



>ref|XP_010416393.1| PREDICTED: zinc-finger homeodomain protein 5-like [Camelina sativa]
Length=309

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC +N+AAT GG V D CGEFM SGE+    AL CA
Sbjct  74   VRYRECLKNHAATVGGSVHDGCGEFMPSGEEGTIEALRCA  113



>ref|XP_002886165.1| ATHB24 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62424.1| ATHB24 [Arabidopsis lyrata subsp. lyrata]
Length=261

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  43   RYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            RY ECQ+N+AA++GG V+D CGEFM SGE+    +L CA
Sbjct  81   RYRECQKNHAASSGGHVVDGCGEFMPSGEEGTAESLRCA  119



>ref|XP_007155312.1| hypothetical protein PHAVU_003G190300g [Phaseolus vulgaris]
 gb|ESW27306.1| hypothetical protein PHAVU_003G190300g [Phaseolus vulgaris]
Length=78

 Score = 52.4 bits (124),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY ECQ+N+AA TGG  +D C EFMAS  +   AALTCA
Sbjct  21   IRYGECQKNHAANTGGYAVDGCREFMASAGEGTSAALTCA  60



>ref|XP_009339301.1| PREDICTED: mini zinc finger protein 3-like [Pyrus x bretschneideri]
Length=94

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA  GG  +D C EFMASGE+    ALTCA
Sbjct  27   VRYCECQKNHAANLGGYAVDGCREFMASGEEGTTEALTCA  66



>emb|CBI17508.3| unnamed protein product [Vitis vinifera]
Length=410

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC +N+AA+ GG V D CGEFM SGE+    AL CA
Sbjct  89   IRYRECLKNHAASMGGHVFDGCGEFMPSGEEGTLEALKCA  128



>gb|KDP34399.1| hypothetical protein JCGZ_12803 [Jatropha curcas]
Length=340

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            +VRY EC +N+AA+ GG V+D CGEFM +GE+    AL CA    H+
Sbjct  123  LVRYRECLKNHAASKGGFVVDGCGEFMPTGEEGTAEALRCAACQCHR  169



>ref|XP_004168481.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
Length=110

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 46/88 (52%), Gaps = 3/88 (3%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCAD-GCSHQV*GFFM  195
            SS     VRY ECQ+N+AA  GG  +D C EFMASG++   A LTCA  GC        +
Sbjct  21   SSFTVRSVRYGECQKNHAAGVGGYAVDGCREFMASGDEGTTAGLTCAACGCHRNFHRRQV  80

Query  196  MSECMVSIFFLVINKV*EFFLQTSLDMY  279
             +E  + I    +N    FF   S ++Y
Sbjct  81   GTEVHLRIKKSYVNPF--FFHYISFELY  106



>gb|KJB40199.1| hypothetical protein B456_007G050500 [Gossypium raimondii]
Length=297

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++RY EC +N+ A+ GG V+D CGEFM SGED    AL CA
Sbjct  91   LIRYRECLKNHVASMGGHVVDGCGEFMPSGEDGTQEALKCA  131



>ref|XP_004232414.1| PREDICTED: zinc-finger homeodomain protein 5 [Solanum lycopersicum]
Length=293

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  7    TAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            T+  S      VRY EC +N+AA  GG VLD CGEFM SGE++    L CA
Sbjct  79   TSSASERNITPVRYKECLKNHAANLGGYVLDGCGEFMPSGEEETLEYLKCA  129



>ref|XP_009596464.1| PREDICTED: mini zinc finger protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009596465.1| PREDICTED: mini zinc finger protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009596466.1| PREDICTED: mini zinc finger protein 2-like [Nicotiana tomentosiformis]
Length=92

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +1

Query  16   GSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
             SS     VRY ECQ+N+AA+ GG  +D C EFM  GE+  P  LTCA
Sbjct  20   NSSFTIRTVRYRECQKNHAASVGGYAVDGCREFMPCGEEGTPGGLTCA  67



>ref|XP_007017558.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
 ref|XP_007017559.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
 gb|EOY14783.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
 gb|EOY14784.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
Length=296

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 10/63 (16%)
 Frame = +1

Query  1    RVTAGGSSGVAI----------IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAAL  150
            RVTA G++   I          ++RY EC +N+AA+ GG V D CGEFM SGE+    AL
Sbjct  67   RVTASGAAVAPISVSSNTKPSSVIRYRECLKNHAASIGGNVYDGCGEFMPSGEEGTLEAL  126

Query  151  TCA  159
             CA
Sbjct  127  KCA  129



>ref|XP_010550056.1| PREDICTED: mini zinc finger protein 2-like [Tarenaya hassleriana]
Length=101

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
             RY EC++N+   TG  VLD CGEFMA+GED  P + +CA
Sbjct  48   FRYGECKKNHGMDTGDYVLDGCGEFMAAGEDGSPESFSCA  87



>ref|XP_009415270.1| PREDICTED: zinc-finger homeodomain protein 6-like [Musa acuminata 
subsp. malaccensis]
Length=356

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +1

Query  34   IIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            + VRY EC RN+AA  GG VLD CGEFM  GE   P  L CA    H+
Sbjct  136  VSVRYKECLRNHAAGIGGHVLDGCGEFMPEGEPSTPGGLKCAACGCHR  183



>gb|KDP38514.1| hypothetical protein JCGZ_04439 [Jatropha curcas]
Length=302

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +1

Query  10   AGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            + GS+     VRY EC RN+AA+ GG V D CGEFM  GE+    AL CA
Sbjct  71   SKGSNSKTSNVRYRECLRNHAASVGGNVFDGCGEFMPGGEEGTLEALKCA  120



>ref|XP_006305389.1| hypothetical protein CARUB_v10009782mg [Capsella rubella]
 ref|XP_006305390.1| hypothetical protein CARUB_v10009782mg [Capsella rubella]
 gb|EOA38287.1| hypothetical protein CARUB_v10009782mg [Capsella rubella]
 gb|EOA38288.1| hypothetical protein CARUB_v10009782mg [Capsella rubella]
Length=317

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            +V+Y EC +N+AA  GG   D CGEFM SGED    ALTC+    H+
Sbjct  92   MVKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHR  138



>ref|XP_009341012.1| PREDICTED: mini zinc finger protein 2-like [Pyrus x bretschneideri]
Length=93

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMAS-GEDDIPAALTCA  159
            +VRY ECQ+N+AA  GG  +D C EFMAS GE+   AALTCA
Sbjct  22   VVRYGECQKNHAAAVGGYAVDGCREFMASNGEEGTTAALTCA  63



>ref|XP_006385095.1| hypothetical protein POPTR_0004s23860g, partial [Populus trichocarpa]
 gb|ERP62892.1| hypothetical protein POPTR_0004s23860g, partial [Populus trichocarpa]
Length=312

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            +VRY EC +N+AA+ GG   D CGEFM SGE+    ALTC+    H+
Sbjct  92   MVRYRECLKNHAASMGGNATDGCGEFMPSGEEGSIEALTCSACNCHR  138



>ref|XP_008353421.1| PREDICTED: mini zinc finger protein 2-like [Malus domestica]
Length=90

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMAS-GEDDIPAALTCA  159
            +VRY ECQ+N+AA  GG  +D C EFMAS GE+   AALTCA
Sbjct  22   VVRYGECQKNHAAAVGGYAVDGCREFMASNGEEGTTAALTCA  63



>ref|XP_006473514.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Citrus sinensis]
Length=307

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +1

Query  4    VTAGGSSGVAI-IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++AG +S   I ++RY EC +N+AA  GG + D CGEFM SG++    AL CA
Sbjct  67   ISAGSNSKPPINVIRYRECLKNHAACIGGNIFDGCGEFMPSGDEGTLEALKCA  119



>ref|XP_003524808.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=79

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY ECQ+N+AA TGG  +D C EFMAS  +   AALTCA
Sbjct  22   IRYGECQKNHAANTGGYAVDGCREFMASAGEGTNAALTCA  61



>ref|XP_010663359.1| PREDICTED: mini zinc finger protein 1 [Vitis vinifera]
Length=88

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA  GG  +D C EFMASG +   AA TCA
Sbjct  27   VRYRECQKNHAANMGGHAVDGCREFMASGVEGTSAAFTCA  66



>gb|KDP27146.1| hypothetical protein JCGZ_19845 [Jatropha curcas]
Length=98

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            V+Y ECQ+N+AA  GG  +D C EFMASGE+    ALTCA
Sbjct  28   VKYGECQKNHAANVGGYAVDGCREFMASGEEGTSLALTCA  67



>ref|XP_002267747.1| PREDICTED: zinc-finger homeodomain protein 3 [Vitis vinifera]
Length=250

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA+ GG   D CGEFMASGE+    AL C+
Sbjct  49   VRYRECQKNHAASMGGNARDGCGEFMASGEEGTLEALKCS  88



>ref|XP_008357201.1| PREDICTED: zinc-finger homeodomain protein 5-like [Malus domestica]
 ref|XP_008357202.1| PREDICTED: zinc-finger homeodomain protein 5-like [Malus domestica]
Length=345

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  28   VAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +A +VRY EC +N+AA  GG V D CGEFM SG++    AL CA
Sbjct  109  LAKVVRYRECLKNHAANIGGNVFDGCGEFMPSGQEGTMEALKCA  152



>ref|XP_006435006.1| hypothetical protein CICLE_v10001952mg [Citrus clementina]
 ref|XP_006435007.1| hypothetical protein CICLE_v10001952mg [Citrus clementina]
 gb|ESR48246.1| hypothetical protein CICLE_v10001952mg [Citrus clementina]
 gb|ESR48247.1| hypothetical protein CICLE_v10001952mg [Citrus clementina]
Length=306

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +1

Query  4    VTAGGSSGVAI-IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++AG +S   I ++RY EC +N+AA  GG + D CGEFM SG++    AL CA
Sbjct  67   ISAGSNSKPPINVIRYRECLKNHAACIGGNIFDGCGEFMPSGDEGTLEALKCA  119



>ref|XP_008388052.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
 ref|XP_008388053.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
 ref|XP_008388054.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
Length=350

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +VRY EC +N+AA  GG V D CGEFM SGE+    AL CA
Sbjct  117  VVRYRECLKNHAANIGGNVFDGCGEFMPSGEEGTLEALKCA  157



>gb|KDO84585.1| hypothetical protein CISIN_1g021941mg [Citrus sinensis]
Length=305

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +1

Query  4    VTAGGSSGVAI-IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++AG +S   I ++RY EC +N+AA  GG + D CGEFM SG++    AL CA
Sbjct  65   ISAGSNSKPPINVIRYRECLKNHAACIGGNIFDGCGEFMPSGDEGTLEALKCA  117



>gb|KHG07143.1| hypothetical protein F383_33189 [Gossypium arboreum]
Length=281

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  10   AGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +  +  +A +VRY EC +N+AA+ GG V D CGEFM SGE+    AL CA
Sbjct  66   SSNTKPLAGVVRYRECLKNHAASIGGNVYDGCGEFMPSGEEGTLEALKCA  115



>gb|KJB14484.1| hypothetical protein B456_002G127500 [Gossypium raimondii]
Length=281

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  10   AGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +  +  +A +VRY EC +N+AA+ GG V D CGEFM SGE+    AL CA
Sbjct  66   SSNTKPLAGVVRYRECLKNHAASIGGNVYDGCGEFMPSGEEGTLEALKCA  115



>emb|CDY09363.1| BnaA02g26470D [Brassica napus]
Length=298

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  34   IIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++ +Y EC +N+AA+TGG  +D CGEFM SGE+    ALTC+
Sbjct  81   VVNKYKECLKNHAASTGGHAIDGCGEFMPSGEEGSIEALTCS  122



>gb|KHN11103.1| ZF-HD homeobox protein [Glycine soja]
Length=317

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            + RY EC +N+AA+ GG V D CGEFM +GE+  P +  CA
Sbjct  108  LFRYRECLKNHAASMGGHVTDGCGEFMPNGEEGTPESFKCA  148



>emb|CAN72985.1| hypothetical protein VITISV_009036 [Vitis vinifera]
Length=250

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC +N+AA+ GG V D CGEFM SGE+    AL CA
Sbjct  32   IRYRECLKNHAASMGGHVFDGCGEFMPSGEEGTLEALKCA  71



>ref|XP_002521573.1| transcription factor, putative [Ricinus communis]
 gb|EEF40844.1| transcription factor, putative [Ricinus communis]
Length=333

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++  A  VRY EC +N+AA+TGG ++D CGEFM SG++    A+ CA
Sbjct  116  TTASAPSVRYRECLKNHAASTGGLIVDGCGEFMPSGQEGTLEAMKCA  162



>ref|XP_006599376.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform X2 [Glycine 
max]
 ref|XP_003548885.2| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform X1 [Glycine 
max]
Length=329

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            + RY EC +N+AA+ GG V D CGEFM +GE+  P +  CA
Sbjct  108  LFRYRECLKNHAASMGGHVTDGCGEFMPNGEEGTPESFKCA  148



>ref|XP_006395776.1| hypothetical protein EUTSA_v10004643mg [Eutrema salsugineum]
 gb|ESQ33062.1| hypothetical protein EUTSA_v10004643mg [Eutrema salsugineum]
Length=311

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  34   IIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            ++++Y EC +N+AA+ GG  +D CGEFM SGE+    A TC+    H+
Sbjct  78   VVIKYKECLKNHAASMGGNAIDGCGEFMPSGEEGSIEAFTCSACKCHR  125



>ref|XP_011087287.1| PREDICTED: mini zinc finger protein 2 [Sesamum indicum]
Length=80

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++ V  IV YAEC++N+AA  GG  +D C EFMA GE    AAL+CA
Sbjct  18   ATQVVRIVEYAECRKNHAANIGGYAVDGCREFMAGGEQGTTAALSCA  64



>ref|XP_002892806.1| ATHB31 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69065.1| ATHB31 [Arabidopsis lyrata subsp. lyrata]
Length=311

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            +++Y EC +N+AA  GG   D CGEFM SGED    ALTC+    H+
Sbjct  86   MIKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHR  132



>ref|NP_172896.1| homeobox protein 31 [Arabidopsis thaliana]
 ref|NP_973826.1| homeobox protein 31 [Arabidopsis thaliana]
 sp|Q9M9S0.1|ZHD4_ARATH RecName: Full=Zinc-finger homeodomain protein 4; Short=AtZHD4; 
AltName: Full=Homeobox protein 31; Short=AtHB-31; AltName: 
Full=Protein FLORAL TRANSITION AT THE MERISTEM 2 [Arabidopsis 
thaliana]
 gb|AAF43944.1|AC012188_21 Contains similarity to a hypothetical protein from Arabidopsis 
thaliana gb|AC004136.2 [Arabidopsis thaliana]
 gb|AAL66963.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20372.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH30294.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29163.1| homeobox protein 31 [Arabidopsis thaliana]
 gb|AEE29164.1| homeobox protein 31 [Arabidopsis thaliana]
Length=312

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            +++Y EC +N+AA  GG   D CGEFM SGED    ALTC+    H+
Sbjct  87   MIKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHR  133



>ref|XP_001752347.1| predicted protein [Physcomitrella patens]
 gb|EDQ83080.1| predicted protein [Physcomitrella patens]
Length=298

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA+ GG  LD CGEFM  GE+    AL CA
Sbjct  91   VRYRECQKNHAASIGGHALDGCGEFMPGGEEGTVDALRCA  130



>ref|XP_010476498.1| PREDICTED: zinc-finger homeodomain protein 4 [Camelina sativa]
 ref|XP_010476499.1| PREDICTED: zinc-finger homeodomain protein 4 [Camelina sativa]
Length=318

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            +++Y EC +N+AA  GG   D CGEFM SGED    ALTC+    H+
Sbjct  89   MIKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHR  135



>ref|XP_002887580.1| hypothetical protein ARALYDRAFT_895391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63839.1| hypothetical protein ARALYDRAFT_895391 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC +N+AA+ GG V D CGEFM SGE+    AL CA
Sbjct  75   VRYRECLKNHAASVGGSVHDGCGEFMPSGEEGTIEALRCA  114



>ref|XP_010458941.1| PREDICTED: zinc-finger homeodomain protein 4-like [Camelina sativa]
Length=320

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            +++Y EC +N+AA  GG   D CGEFM SGED    ALTC+    H+
Sbjct  90   MIKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHR  136



>ref|XP_009613099.1| PREDICTED: zinc-finger homeodomain protein 4 [Nicotiana tomentosiformis]
Length=304

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            IVRY EC +N+AA  GG   D CGEFM SGE+    AL C+    H+
Sbjct  75   IVRYKECLKNHAAAMGGNATDGCGEFMPSGEEGTIEALICSACNCHR  121



>ref|XP_009762783.1| PREDICTED: zinc-finger homeodomain protein 4-like [Nicotiana 
sylvestris]
Length=306

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            IVRY EC +N+AA  GG   D CGEFM SGE+    AL C+    H+
Sbjct  75   IVRYKECLKNHAAAMGGNATDGCGEFMPSGEEGTIEALICSACNCHR  121



>ref|XP_009117900.1| PREDICTED: zinc-finger homeodomain protein 4-like [Brassica rapa]
 ref|XP_009117901.1| PREDICTED: zinc-finger homeodomain protein 4-like [Brassica rapa]
 emb|CDY53549.1| BnaA09g57080D [Brassica napus]
Length=314

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            I+ Y EC +N+AA  GG   D CGEFM SGED    ALTC+    H+
Sbjct  90   IITYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHR  136



>emb|CDX81638.1| BnaC08g39630D [Brassica napus]
Length=315

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            I+ Y EC +N+AA  GG   D CGEFM SGED    ALTC+    H+
Sbjct  91   IITYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHR  137



>ref|XP_009408377.1| PREDICTED: mini zinc finger protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=94

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +VRY EC++N+AA+ GG  +D C EFMASGE+    AL CA
Sbjct  22   VVRYKECRKNHAASVGGYAVDGCREFMASGEEGTSDALRCA  62



>emb|CDY00105.1| BnaC09g01960D [Brassica napus]
Length=98

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  1    RVTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMAS-GEDDIPAALTCA  159
            R+++  SS +   VRY ECQ+N+AA  GG  +D C EFMAS GE+   +ALTCA
Sbjct  18   RISSTASSRMLRGVRYGECQKNHAAAVGGYAVDGCREFMASNGEEGTVSALTCA  71



>ref|XP_003599659.1| Zinc finger homeodomain protein [Medicago truncatula]
 gb|AES69910.1| mini zinc finger protein [Medicago truncatula]
 gb|AFK42801.1| unknown [Medicago truncatula]
Length=85

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    RVTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +V A  SS +   +RY ECQ+N+AA  GG  +D C EFMAS  +    ALTCA
Sbjct  5    QVVAKTSSSITRNIRYGECQKNHAANIGGYAVDGCREFMASTGEGTSGALTCA  57



>ref|XP_008782098.1| PREDICTED: zinc-finger homeodomain protein 4-like [Phoenix dactylifera]
Length=166

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            SS   ++++Y EC +N+AA+ GG   D CGEFM SGE+    AL C+
Sbjct  64   SSKKGVVLKYRECLKNHAASIGGNATDGCGEFMPSGEEGTLEALKCS  110



>gb|KHN05023.1| ZF-HD homeobox protein [Glycine soja]
Length=190

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +1

Query  34   IIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            II+RY EC +N+AA  GG   D CGEFMA+GE+    AL C+
Sbjct  6    IIIRYKECLKNHAAAIGGNATDGCGEFMAAGEEGTLEALKCS  47



>ref|XP_009148819.1| PREDICTED: zinc-finger homeodomain protein 4-like [Brassica rapa]
Length=310

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +++Y EC +N+AA  GG   D CGEFM SGED    ALTC+
Sbjct  90   MIKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCS  130



>ref|XP_003555538.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=200

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +1

Query  34   IIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            II+RY EC +N+AA  GG   D CGEFMA+GE+    AL C+
Sbjct  16   IIIRYKECLKNHAAAIGGNATDGCGEFMAAGEEGTLEALKCS  57



>ref|XP_010099792.1| hypothetical protein L484_010980 [Morus notabilis]
 gb|EXB80410.1| hypothetical protein L484_010980 [Morus notabilis]
Length=336

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +1

Query  13   GGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            G S    +I+RY EC +N+AA+ G    D CGEFM SGE+    AL C+    H+
Sbjct  105  GPSKKQVVIIRYRECLKNHAASMGANATDGCGEFMPSGEEGTIEALKCSACNCHR  159



>gb|ABK23568.1| unknown [Picea sitchensis]
Length=154

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +1

Query  13   GGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            GG +     VRY EC++N+AA+ GG  +D C EFM SGE+   AA+ CA
Sbjct  80   GGDTASTNRVRYRECRKNHAASIGGYAVDGCAEFMGSGEEGTAAAMKCA  128



>ref|XP_006390329.1| hypothetical protein EUTSA_v10018892mg [Eutrema salsugineum]
 ref|XP_006390330.1| hypothetical protein EUTSA_v10018892mg [Eutrema salsugineum]
 dbj|BAJ34360.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27615.1| hypothetical protein EUTSA_v10018892mg [Eutrema salsugineum]
 gb|ESQ27616.1| hypothetical protein EUTSA_v10018892mg [Eutrema salsugineum]
Length=318

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC +N+AA  GG V D CGEFM SGE+    AL CA
Sbjct  74   VRYRECLKNHAANVGGSVHDGCGEFMPSGEEGTIEALRCA  113



>emb|CAN60986.1| hypothetical protein VITISV_044469 [Vitis vinifera]
Length=199

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +1

Query  28   VAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            V  IVRY EC  N+AA+ G   +D CGEF+  GED  P AL CA
Sbjct  29   VVEIVRYKECMHNHAASIGYYTIDGCGEFLKGGEDGSPKALLCA  72



>gb|ABR16776.1| unknown [Picea sitchensis]
Length=289

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +1

Query  28   VAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTC  156
            V  IVRY ECQ+N+AA  G   LD CGEFMASG +    AL C
Sbjct  79   VEKIVRYRECQKNHAANIGSHALDGCGEFMASGLEGTADALKC  121



>ref|XP_004148693.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 gb|KGN52457.1| Transcription factor [Cucumis sativus]
Length=92

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            SS     VRY ECQ+N+AA  GG  +D C EFMASG++   A LTCA
Sbjct  21   SSFTVRSVRYGECQKNHAAGVGGYAVDGCREFMASGDEGTTAGLTCA  67



>ref|XP_008379352.1| PREDICTED: mini zinc finger protein 2 [Malus domestica]
Length=90

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMAS-GEDDIPAALTCA  159
            +VRY ECQ+N+AA  GG  +D C EFMAS GE+   AALTCA
Sbjct  22   VVRYGECQKNHAAGVGGYAVDGCREFMASNGEEGTTAALTCA  63



>gb|AEN81237.1| AT1G75240-like protein, partial [Neslia paniculata]
Length=193

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +1

Query  28   VAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            V   VRY EC +N+AA+ GG V D CGEFM SGE+    AL CA
Sbjct  2    VKSTVRYRECLKNHAASVGGSVHDGCGEFMPSGEEGTIEALRCA  45



>ref|NP_565106.1| homeobox protein 33 [Arabidopsis thaliana]
 sp|Q9FRL5.1|ZHD5_ARATH RecName: Full=Zinc-finger homeodomain protein 5; Short=AtZHD5; 
AltName: Full=Homeobox protein 33; Short=AtHB-33 [Arabidopsis 
thaliana]
 gb|AAG12686.1|AC025814_10 hypothetical protein; 24548-23619 [Arabidopsis thaliana]
 gb|AAM61034.1| unknown [Arabidopsis thaliana]
 dbj|BAF00922.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABI49441.1| At1g75240 [Arabidopsis thaliana]
 gb|AEE35692.1| homeobox protein 33 [Arabidopsis thaliana]
Length=309

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC +N+AA+ GG V D CGEFM SGE+    AL CA
Sbjct  74   VRYRECLKNHAASVGGSVHDGCGEFMPSGEEGTIEALRCA  113



>ref|XP_004978478.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Setaria italica]
Length=87

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +V Y ECQRN+AA+ GG  +D C EFMASG +   AAL CA
Sbjct  22   VVHYRECQRNHAASIGGYAVDGCREFMASGAEGTAAALMCA  62



>ref|XP_008459312.1| PREDICTED: mini zinc finger protein 2 [Cucumis melo]
 ref|XP_008459313.1| PREDICTED: mini zinc finger protein 2 [Cucumis melo]
Length=96

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            SS     VRY ECQ+N+AA  GG  +D C EFMASG++   A LTCA
Sbjct  21   SSFTVRSVRYGECQKNHAAGVGGYAVDGCREFMASGDEGTTAGLTCA  67



>gb|ACU20724.1| unknown [Glycine max]
Length=79

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY ECQ+N+AA TGG  +D C EFMAS  +   AALTCA
Sbjct  22   IRYGECQKNHAANTGGYAVDGCREFMASACEGTNAALTCA  61



>ref|XP_006302600.1| hypothetical protein CARUB_v10020705mg [Capsella rubella]
 gb|EOA35498.1| hypothetical protein CARUB_v10020705mg [Capsella rubella]
Length=306

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            S+ V   VRY EC +N+AA+ GG V D CGEFM SGE+    AL CA
Sbjct  68   SAAVQSPVRYRECLKNHAASVGGSVHDGCGEFMPSGEEGTIEALRCA  114



>ref|XP_008378952.1| PREDICTED: LOW QUALITY PROTEIN: zinc-finger homeodomain protein 
3 [Malus domestica]
Length=359

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            VRY EC +N+AA  GG  +D CGEFM SGE+    AL C+    H+
Sbjct  128  VRYKECLKNHAAAMGGSAMDGCGEFMPSGEEGTIEALNCSACNCHR  173



>ref|XP_009776475.1| PREDICTED: uncharacterized protein LOC104226233 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009776476.1| PREDICTED: uncharacterized protein LOC104226233 isoform X3 [Nicotiana 
sylvestris]
Length=946

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTC  156
            +RY EC +N+AA+ GG  +D CGEFM SG +  P AL C
Sbjct  712  IRYMECLKNHAASMGGHAIDGCGEFMPSGGEGTPGALKC  750



>ref|XP_009776474.1| PREDICTED: uncharacterized protein LOC104226233 isoform X2 [Nicotiana 
sylvestris]
Length=962

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTC  156
            +RY EC +N+AA+ GG  +D CGEFM SG +  P AL C
Sbjct  728  IRYMECLKNHAASMGGHAIDGCGEFMPSGGEGTPGALKC  766



>ref|XP_009776472.1| PREDICTED: uncharacterized protein LOC104226233 isoform X1 [Nicotiana 
sylvestris]
Length=1047

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTC  156
            +RY EC +N+AA+ GG  +D CGEFM SG +  P AL C
Sbjct  813  IRYMECLKNHAASMGGHAIDGCGEFMPSGGEGTPGALKC  851



>ref|XP_004489393.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cicer arietinum]
 ref|XP_004489394.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cicer arietinum]
Length=89

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            V+Y ECQ+N+AA  GG  +D C EFMASGE+    AL CA
Sbjct  21   VKYGECQKNHAANVGGYAVDGCREFMASGEEGTSVALICA  60



>ref|XP_002264250.1| PREDICTED: zinc-finger homeodomain protein 4-like [Vitis vinifera]
Length=243

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 28/48 (58%), Gaps = 0/48 (0%)
 Frame = +1

Query  16   GSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
                V  IVRY EC  N+AA+ G   +D CGEF+  GED  P AL CA
Sbjct  25   NHESVVEIVRYKECMHNHAASIGYYTIDGCGEFLKGGEDGSPKALLCA  72



>ref|XP_002306552.2| hypothetical protein POPTR_0005s17620g [Populus trichocarpa]
 gb|EEE93548.2| hypothetical protein POPTR_0005s17620g [Populus trichocarpa]
Length=257

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  4    VTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
             TA  ++     +RY ECQ+N+A   GG  LD CGEFMA+GE+    AL CA
Sbjct  48   TTAANTNTRKSSIRYRECQKNHAVGIGGHALDGCGEFMAAGEEGTLDALKCA  99



>ref|XP_008810728.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=344

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            VRY EC RN+AA  GG V+D CGEFMA G+   P AL CA    H+
Sbjct  119  VRYRECLRNHAAAVGGHVVDGCGEFMAYGDAGTPDALKCAACGCHR  164



>ref|XP_010931461.1| PREDICTED: mini zinc finger protein 1-like [Elaeis guineensis]
Length=91

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +VRY EC++N+AA+ GG  +D C EFMASGE+    AL CA
Sbjct  22   VVRYRECRKNHAASIGGYAVDGCREFMASGEEGTSDALRCA  62



>gb|ABR16769.1| unknown [Picea sitchensis]
Length=173

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC++N+AA+ GG  +D CGEFM SGE+    AL CA
Sbjct  108  VRYRECRKNHAASIGGYAVDGCGEFMPSGEEGTSGALKCA  147



>ref|XP_011010389.1| PREDICTED: zinc-finger homeodomain protein 2-like [Populus euphratica]
Length=259

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  4    VTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
             TA  ++     +RY ECQ+N+A   GG  LD CGEFMA+GE+    AL CA
Sbjct  48   TTAANTNTRKSSIRYRECQKNHAVGIGGHALDGCGEFMAAGEEGTLDALKCA  99



>gb|KDO55569.1| hypothetical protein CISIN_1g043467mg [Citrus sinensis]
Length=90

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRYAECQ+N+AA  GG  +D C EFMASGE+    ALTCA
Sbjct  29   VRYAECQKNHAANIGGYAVDGCREFMASGENG-TGALTCA  67



>gb|AEN81229.1| AT1G75240-like protein, partial [Capsella rubella]
 gb|AEN81230.1| AT1G75240-like protein, partial [Capsella rubella]
 gb|AEN81231.1| AT1G75240-like protein, partial [Capsella rubella]
 gb|AEN81232.1| AT1G75240-like protein, partial [Capsella rubella]
 gb|AEN81233.1| AT1G75240-like protein, partial [Capsella rubella]
 gb|AEN81234.1| AT1G75240-like protein, partial [Capsella rubella]
 gb|AEN81235.1| AT1G75240-like protein, partial [Capsella rubella]
 gb|AEN81236.1| AT1G75240-like protein, partial [Capsella rubella]
Length=191

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +1

Query  28   VAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            V   VRY EC +N+AA+ GG V D CGEFM SGE+    AL CA
Sbjct  2    VQSPVRYRECLKNHAASVGGSVHDGCGEFMPSGEEGTIEALRCA  45



>gb|AEN81227.1| AT1G75240-like protein, partial [Capsella grandiflora]
 gb|AEN81228.1| AT1G75240-like protein, partial [Capsella grandiflora]
Length=191

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +1

Query  28   VAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            V   VRY EC +N+AA+ GG V D CGEFM SGE+    AL CA
Sbjct  2    VQSPVRYRECLKNHAASVGGSVHDGCGEFMPSGEEGTIEALRCA  45



>ref|XP_010912718.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
 ref|XP_010912719.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
 ref|XP_010912720.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
Length=276

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            SS   ++V+Y EC +N+AA+ GG   D CGEFM SGE+    AL C+
Sbjct  68   SSKKGVVVKYRECLKNHAASIGGNATDGCGEFMPSGEEGTLEALKCS  114



>ref|XP_002534013.1| transcription factor, putative [Ricinus communis]
 gb|EEF28371.1| transcription factor, putative [Ricinus communis]
Length=98

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMAS-GEDDIPAALTCA  159
            VRY ECQ+N+AA  GG  +D C EFMAS GE+   AALTCA
Sbjct  28   VRYGECQKNHAANVGGYAVDGCREFMASNGEEGTTAALTCA  68



>ref|XP_004973532.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Setaria italica]
Length=121

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC+RN+AA+ GG  +D C EF+A GE+   AAL CA
Sbjct  32   VRYGECRRNHAASMGGHAVDGCREFLAEGEEGTTAALRCA  71



>ref|XP_007151284.1| hypothetical protein PHAVU_004G033400g [Phaseolus vulgaris]
 gb|ESW23278.1| hypothetical protein PHAVU_004G033400g [Phaseolus vulgaris]
Length=88

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            V+Y ECQ+N+AA  GG  +D C EFMASG +   AALTCA
Sbjct  20   VKYGECQKNHAANVGGYAVDGCREFMASGGEGTTAALTCA  59



>ref|XP_002302028.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE81301.1| zinc finger family protein [Populus trichocarpa]
Length=293

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +1

Query  4    VTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            + + GS+      RY EC RN+AA+ GG V D CGEFM  GE+    AL CA
Sbjct  62   IISSGSNSKTSNTRYLECLRNHAASVGGNVFDGCGEFMPGGEEGSLEALKCA  113



>ref|XP_010258353.1| PREDICTED: mini zinc finger protein 2 [Nelumbo nucifera]
Length=97

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA  GG  +D C EFMA GE+   AAL CA
Sbjct  29   VRYGECQKNHAANIGGYAVDGCREFMAGGEEGTIAALRCA  68



>ref|XP_008808961.1| PREDICTED: zinc-finger homeodomain protein 4-like [Phoenix dactylifera]
Length=274

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            S+   ++VRY EC +N+AA+ GG   D CGEFM SGE+    AL C+
Sbjct  66   STKKGVVVRYRECLKNHAASIGGSATDGCGEFMPSGEEGTLEALKCS  112



>ref|XP_010428533.1| PREDICTED: zinc-finger homeodomain protein 5 [Camelina sativa]
 ref|XP_010428535.1| PREDICTED: zinc-finger homeodomain protein 5 [Camelina sativa]
Length=310

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC +N+AA  GG V D CGEFM SGE+    AL CA
Sbjct  75   VRYRECLKNHAANVGGSVHDGCGEFMPSGEEGTIEALRCA  114



>ref|XP_002893018.1| hypothetical protein ARALYDRAFT_472107 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69277.1| hypothetical protein ARALYDRAFT_472107 [Arabidopsis lyrata subsp. 
lyrata]
Length=88

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 3/40 (8%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA  GG  +D C EFMASG DD   ALTCA
Sbjct  24   VRYVECQKNHAANIGGYAVDGCREFMASGGDD---ALTCA  60



>ref|XP_007138185.1| hypothetical protein PHAVU_009G187500g [Phaseolus vulgaris]
 gb|ESW10179.1| hypothetical protein PHAVU_009G187500g [Phaseolus vulgaris]
Length=90

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    RVTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            R  A  SS V   VRY ECQ+N+AA  GG  +D C EFMAS  D    ALTCA
Sbjct  10   RDVANTSSSVIRNVRYGECQKNHAANIGGYAVDGCREFMASTGDGGGGALTCA  62



>ref|XP_009782865.1| PREDICTED: mini zinc finger protein 2 [Nicotiana sylvestris]
Length=102

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA+ GG  +D C EFM   E+  P ALTCA
Sbjct  38   VRYRECQKNHAASVGGYAVDGCREFMPCDEEGTPGALTCA  77



>ref|XP_009416998.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416999.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=267

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            S+   ++VRY EC +N+AA+ GG   D CGEFM SGE+    AL C+
Sbjct  62   STKKGVVVRYRECLKNHAASIGGNATDGCGEFMPSGEEGTLEALKCS  108



>ref|XP_007136351.1| hypothetical protein PHAVU_009G037900g [Phaseolus vulgaris]
 gb|ESW08345.1| hypothetical protein PHAVU_009G037900g [Phaseolus vulgaris]
Length=305

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  13   GGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            GGS+G    VRY ECQ+N+A + GG  +D C EF+A+GE+    A+ CA    H+
Sbjct  62   GGSTGT---VRYRECQKNHAVSIGGHAVDGCCEFLAAGEEGTLEAVICAACNCHR  113



>ref|XP_001773677.1| predicted protein [Physcomitrella patens]
 gb|EDQ61565.1| predicted protein, partial [Physcomitrella patens]
Length=80

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +RY EC RN+A +TGG  +D CGEFM  GE+   AAL CA
Sbjct  18   IRYRECNRNHAISTGGYAVDGCGEFMPGGEEGTVAALKCA  57



>ref|XP_010539898.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539899.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010539900.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X1 [Tarenaya 
hassleriana]
Length=271

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +1

Query  28   VAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VA  VRY EC +N+AA+ GG V D CGEFM  GE+    AL CA
Sbjct  59   VAKTVRYRECLKNHAASVGGSVQDGCGEFMPGGEEGTIEALKCA  102



>gb|KDO42061.1| hypothetical protein CISIN_1g048741mg [Citrus sinensis]
Length=314

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            +V+Y EC +N+AA  GG   D CGEFM SGE+    ALTC+    H+
Sbjct  81   MVKYKECLKNHAAGMGGNATDGCGEFMPSGEEGTIEALTCSACNCHR  127



>ref|XP_006470838.1| PREDICTED: ZF-HD homeobox protein At5g65410-like [Citrus sinensis]
Length=314

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            +V+Y EC +N+AA  GG   D CGEFM SGE+    ALTC+    H+
Sbjct  81   MVKYKECLKNHAAGMGGNATDGCGEFMPSGEEGTIEALTCSACNCHR  127



>ref|XP_006431432.1| hypothetical protein CICLE_v10003702mg [Citrus clementina]
 gb|ESR44672.1| hypothetical protein CICLE_v10003702mg [Citrus clementina]
Length=314

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            +V+Y EC +N+AA  GG   D CGEFM SGE+    ALTC+    H+
Sbjct  81   MVKYKECLKNHAAGMGGNATDGCGEFMPSGEEGTIEALTCSACNCHR  127



>ref|XP_011028851.1| PREDICTED: zinc-finger homeodomain protein 5-like [Populus euphratica]
Length=293

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +1

Query  4    VTAGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            + + GS+      RY EC RN+AA+ GG V D CGEFM  GE+    AL CA
Sbjct  62   IISSGSNSKTSNTRYLECLRNHAASAGGNVFDGCGEFMPGGEEGSLEALKCA  113



>ref|XP_006477452.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Citrus sinensis]
Length=93

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRYAECQ+N+AA  GG  +D C EFMASGE+    ALTCA
Sbjct  28   VRYAECQKNHAANIGGYAVDGCREFMASGENGT-GALTCA  66



>ref|XP_008807352.1| PREDICTED: mini zinc finger protein 1-like [Phoenix dactylifera]
Length=91

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +VRY EC++N+AA+ GG  +D C EFMASGE    +AL CA
Sbjct  22   VVRYRECRKNHAASIGGYAVDGCREFMASGEAGTSSALHCA  62



>ref|NP_001077560.1| mini zinc finger protein [Arabidopsis thaliana]
 sp|Q2Q493.1|MIF3_ARATH RecName: Full=Mini zinc finger protein 3; Short=AtMIF3 [Arabidopsis 
thaliana]
 gb|ABB20816.1| mini zinc finger 3 [Arabidopsis thaliana]
 gb|AEE29768.1| mini zinc finger protein [Arabidopsis thaliana]
Length=88

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 3/40 (8%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY ECQ+N+AA  GG  +D C EFMASG DD   ALTCA
Sbjct  24   VRYVECQKNHAANIGGYAVDGCREFMASGGDD---ALTCA  60



>ref|XP_002525870.1| transcription factor, putative [Ricinus communis]
 gb|EEF36564.1| transcription factor, putative [Ricinus communis]
Length=311

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            +V+Y EC +N+AA  GG   D CGEFM SGE+    ALTC+    H+
Sbjct  86   MVKYKECLKNHAAAMGGNATDGCGEFMPSGEEGSIEALTCSACNCHR  132



>gb|ACN31494.1| unknown [Zea mays]
Length=119

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC+RN+AA+ GG  +D C EF+A GE+   AAL CA
Sbjct  29   VRYGECRRNHAASMGGHAVDGCREFLAEGEEGTAAALRCA  68



>ref|XP_010930367.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
Length=277

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            S+   ++VRY EC +N+AA+ GG   D CGEFM SGE+    AL C+
Sbjct  69   STKKGVVVRYRECLKNHAASIGGTATDGCGEFMPSGEEGTLEALKCS  115



>ref|XP_007023152.1| Homeobox protein 31 [Theobroma cacao]
 gb|EOY25774.1| Homeobox protein 31 [Theobroma cacao]
Length=292

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +1

Query  25   GVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            G   +VRY EC +N+AA  GG   D CGEFM SGE+    ALTC+
Sbjct  62   GFKKVVRYRECLKNHAAAMGGNATDGCGEFMPSGEEGSIEALTCS  106



>ref|XP_009763792.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nicotiana 
sylvestris]
Length=289

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 4/55 (7%)
 Frame = +1

Query  7    TAGGSSGVAIIV----RYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++GGS+     +    RY EC +N+AA+ GG V D CGEFM SGE+    AL CA
Sbjct  61   SSGGSTNNKFKITSRARYRECLKNHAASIGGNVTDGCGEFMPSGEEGTLEALKCA  115



>ref|XP_003574645.1| PREDICTED: zinc-finger homeodomain protein 1-like [Brachypodium 
distachyon]
Length=304

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +1

Query  10   AGGSSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCAD-GC  168
            +GG       VRY EC +N+A   GG  +D CGEFMA+GED    AL+CA  GC
Sbjct  49   SGGGRFRTPSVRYRECLKNHAVGIGGHAVDGCGEFMAAGEDGSIDALSCAACGC  102



>ref|XP_006440596.1| hypothetical protein CICLE_v10023399mg [Citrus clementina]
 gb|ESR53836.1| hypothetical protein CICLE_v10023399mg [Citrus clementina]
Length=94

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRYAECQ+N+AA  GG  +D C EFMASGE+    ALTCA
Sbjct  29   VRYAECQKNHAANIGGYAVDGCREFMASGENGT-GALTCA  67



>ref|XP_011087615.1| PREDICTED: zinc-finger homeodomain protein 4 [Sesamum indicum]
Length=291

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            +VRY EC +N+AA+ GG   D CGEFM SGE+    ALTC+
Sbjct  77   MVRYRECLKNHAASMGGNATDGCGEFMPSGEEGTLEALTCS  117



>ref|XP_006853040.1| hypothetical protein AMTR_s00038p00027320 [Amborella trichopoda]
 gb|ERN14507.1| hypothetical protein AMTR_s00038p00027320 [Amborella trichopoda]
Length=237

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 4/56 (7%)
 Frame = +1

Query  4    VTAGGSSG----VAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            V +G SSG    +   VRY EC +N+A + GG  +D CGEFMA+GE+    +L CA
Sbjct  39   VVSGDSSGSGKRIQSNVRYKECLKNHAVSIGGHAIDGCGEFMAAGEEGTLESLKCA  94



>ref|NP_001151712.1| mini zinc finger 3 [Zea mays]
 gb|ACG44087.1| mini zinc finger 3 [Zea mays]
Length=119

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  40   VRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            VRY EC+RN+AA+ GG  +D C EF+A GE+   AAL CA
Sbjct  29   VRYGECRRNHAASMGGHAVDGCREFLAEGEEGTAAALRCA  68



>ref|XP_008800713.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
 ref|XP_008800714.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
 ref|XP_008800715.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=330

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  19   SSGVAIIVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCADGCSHQ  177
            ++ +    RY EC RN+AA  GG V+D CGEFM SG+   P AL CA    H+
Sbjct  102  ATAIESAARYRECLRNHAAAIGGHVVDGCGEFMPSGDVGTPDALKCAACGCHR  154



>ref|XP_010678523.1| PREDICTED: mini zinc finger protein 1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010678524.1| PREDICTED: mini zinc finger protein 1 [Beta vulgaris subsp. vulgaris]
Length=89

 Score = 50.1 bits (118),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  37   IVRYAECQRNYAATTGGQVLDRCGEFMASGEDDIPAALTCA  159
            ++RY ECQ+N+AA+ GG  +D C EFMASG +    AL CA
Sbjct  23   VIRYGECQKNHAASIGGYAVDGCREFMASGAEGTNNALICA  63



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562775562090