BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP001C08 593 bp,

Length=593
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004241216.1|  PREDICTED: pumilio homolog 2-like                  249   2e-73   Solanum lycopersicum
emb|CDP09091.1|  unnamed protein product                                245   6e-72   Coffea canephora [robusta coffee]
ref|XP_006350784.1|  PREDICTED: pumilio homolog 2-like isoform X2       238   1e-69   
ref|XP_006350783.1|  PREDICTED: pumilio homolog 2-like isoform X1       239   1e-69   Solanum tuberosum [potatoes]
ref|XP_011089489.1|  PREDICTED: pumilio homolog 2-like                  233   2e-67   Sesamum indicum [beniseed]
ref|XP_006358700.1|  PREDICTED: pumilio homolog 2-like                  231   4e-67   
ref|XP_010321733.1|  PREDICTED: LOW QUALITY PROTEIN: pumilio homo...    224   2e-64   Solanum lycopersicum
ref|XP_007016356.1|  Pumilio 2 isoform 3                                219   7e-63   Theobroma cacao [chocolate]
ref|XP_007016354.1|  Pumilio 2 isoform 1                                220   9e-63   Theobroma cacao [chocolate]
ref|XP_007016355.1|  Pumilio 2 isoform 2                                219   2e-62   Theobroma cacao [chocolate]
emb|CAN61602.1|  hypothetical protein VITISV_024967                     219   2e-62   Vitis vinifera
ref|XP_002283191.1|  PREDICTED: pumilio homolog 2 isoform X2            218   4e-62   Vitis vinifera
ref|XP_010650999.1|  PREDICTED: pumilio homolog 2 isoform X1            218   4e-62   Vitis vinifera
ref|XP_007208120.1|  hypothetical protein PRUPE_ppa000627mg             211   1e-59   Prunus persica
ref|XP_008222212.1|  PREDICTED: pumilio homolog 1                       209   8e-59   Prunus mume [ume]
ref|XP_009802144.1|  PREDICTED: pumilio homolog 2-like isoform X2       205   9e-58   Nicotiana sylvestris
ref|XP_009802143.1|  PREDICTED: pumilio homolog 2-like isoform X1       205   1e-57   Nicotiana sylvestris
ref|XP_002314164.2|  hypothetical protein POPTR_0009s03980g             204   3e-57   Populus trichocarpa [western balsam poplar]
ref|XP_011032254.1|  PREDICTED: pumilio homolog 2-like isoform X2       203   9e-57   Populus euphratica
ref|XP_011032252.1|  PREDICTED: pumilio homolog 2-like isoform X1       203   1e-56   Populus euphratica
ref|XP_009597138.1|  PREDICTED: pumilio homolog 2-like isoform X2       202   1e-56   Nicotiana tomentosiformis
ref|XP_009597137.1|  PREDICTED: pumilio homolog 2-like isoform X1       202   2e-56   Nicotiana tomentosiformis
gb|KDO72813.1|  hypothetical protein CISIN_1g039493mg                   200   3e-56   Citrus sinensis [Valencia orange]
ref|XP_006424877.1|  hypothetical protein CICLE_v10027726mg             202   3e-56   Citrus clementina
ref|XP_006424876.1|  hypothetical protein CICLE_v10027726mg             202   4e-56   Citrus clementina
ref|XP_009616462.1|  PREDICTED: pumilio homolog 2-like isoform X3       199   1e-55   Nicotiana tomentosiformis
ref|XP_009779664.1|  PREDICTED: pumilio homolog 2-like isoform X2       199   1e-55   Nicotiana sylvestris
ref|XP_009779662.1|  PREDICTED: pumilio homolog 2-like isoform X1       199   2e-55   Nicotiana sylvestris
gb|KJB20011.1|  hypothetical protein B456_003G129200                    200   2e-55   Gossypium raimondii
gb|KHG15533.1|  Pumilio -like protein                                   199   2e-55   Gossypium arboreum [tree cotton]
gb|KJB20009.1|  hypothetical protein B456_003G129200                    199   2e-55   Gossypium raimondii
ref|XP_004294652.1|  PREDICTED: pumilio homolog 2                       200   2e-55   Fragaria vesca subsp. vesca
gb|KJB08901.1|  hypothetical protein B456_001G112000                    199   5e-55   Gossypium raimondii
ref|XP_009616461.1|  PREDICTED: pumilio homolog 2-like isoform X2       198   5e-55   Nicotiana tomentosiformis
gb|KJB08905.1|  hypothetical protein B456_001G112000                    198   5e-55   Gossypium raimondii
ref|XP_009616459.1|  PREDICTED: pumilio homolog 2-like isoform X1       198   5e-55   Nicotiana tomentosiformis
gb|KJB08904.1|  hypothetical protein B456_001G112000                    198   5e-55   Gossypium raimondii
gb|KHG26002.1|  Pumilio -like protein                                   199   5e-55   Gossypium arboreum [tree cotton]
gb|KJB08902.1|  hypothetical protein B456_001G112000                    198   6e-55   Gossypium raimondii
gb|KHG11376.1|  Pumilio -like protein                                   198   7e-55   Gossypium arboreum [tree cotton]
gb|KJB21632.1|  hypothetical protein B456_004G005400                    194   1e-53   Gossypium raimondii
gb|KJB21631.1|  hypothetical protein B456_004G005400                    194   2e-53   Gossypium raimondii
gb|KJB21630.1|  hypothetical protein B456_004G005400                    194   2e-53   Gossypium raimondii
gb|KJB21633.1|  hypothetical protein B456_004G005400                    194   2e-53   Gossypium raimondii
ref|XP_007132044.1|  hypothetical protein PHAVU_011G062200g             193   5e-53   Phaseolus vulgaris [French bean]
ref|XP_010106527.1|  Pumilio-2-like protein                             192   1e-52   Morus notabilis
ref|XP_006590976.1|  PREDICTED: pumilio homolog 2-like isoform X3       190   1e-52   
ref|XP_006590979.1|  PREDICTED: pumilio homolog 2-like isoform X2       192   1e-52   
gb|KHN21930.1|  Pumilio like 2                                          191   2e-52   Glycine soja [wild soybean]
ref|XP_002299859.2|  pumilio/Puf RNA-binding domain-containing fa...    192   2e-52   Populus trichocarpa [western balsam poplar]
ref|XP_003537978.1|  PREDICTED: pumilio homolog 2-like isoform X1       191   2e-52   Glycine max [soybeans]
gb|KEH39457.1|  pumilio Mpt5 protein, putative                          190   2e-52   Medicago truncatula
ref|XP_003597396.1|  Pumilio-like protein                               191   3e-52   Medicago truncatula
ref|XP_003537979.1|  PREDICTED: pumilio homolog 2-like isoform X1       191   3e-52   
ref|XP_006590974.1|  PREDICTED: pumilio homolog 2-like isoform X1       190   5e-52   Glycine max [soybeans]
ref|XP_009375924.1|  PREDICTED: pumilio homolog 1-like isoform X1       189   9e-52   Pyrus x bretschneideri [bai li]
gb|KHN21931.1|  Pumilio like 2                                          189   1e-51   Glycine soja [wild soybean]
ref|XP_010256854.1|  PREDICTED: pumilio homolog 2-like                  188   3e-51   Nelumbo nucifera [Indian lotus]
ref|XP_008384935.1|  PREDICTED: pumilio homolog 1-like                  188   3e-51   Malus domestica [apple tree]
ref|XP_011035276.1|  PREDICTED: pumilio homolog 2                       188   3e-51   Populus euphratica
gb|EYU45944.1|  hypothetical protein MIMGU_mgv1a000618mg                187   6e-51   Erythranthe guttata [common monkey flower]
ref|XP_004160189.1|  PREDICTED: LOW QUALITY PROTEIN: pumilio homo...    187   7e-51   
ref|XP_004143128.1|  PREDICTED: pumilio homolog 1-like                  187   8e-51   Cucumis sativus [cucumbers]
ref|XP_008356857.1|  PREDICTED: pumilio homolog 1-like                  187   9e-51   Malus domestica [apple tree]
ref|XP_006592187.1|  PREDICTED: pumilio homolog 2-like isoform X3       186   1e-50   
gb|KHN33363.1|  Pumilio like 2                                          185   1e-50   Glycine soja [wild soybean]
ref|XP_003539627.1|  PREDICTED: pumilio homolog 2-like isoform X1       186   2e-50   Glycine max [soybeans]
ref|XP_007132045.1|  hypothetical protein PHAVU_011G062300g             186   2e-50   Phaseolus vulgaris [French bean]
ref|XP_006592185.1|  PREDICTED: pumilio homolog 2-like isoform X2       184   2e-50   
ref|XP_003539618.1|  PREDICTED: pumilio homolog 2-like isoform X1       185   3e-50   Glycine max [soybeans]
gb|KJB55838.1|  hypothetical protein B456_009G097200                    184   5e-50   Gossypium raimondii
gb|KJB55837.1|  hypothetical protein B456_009G097200                    184   5e-50   Gossypium raimondii
ref|XP_003547219.1|  PREDICTED: pumilio homolog 2-like                  184   6e-50   
ref|XP_008464104.1|  PREDICTED: pumilio homolog 1-like                  184   7e-50   Cucumis melo [Oriental melon]
gb|KEH30178.1|  pumilio Mpt5 protein, putative                          184   7e-50   Medicago truncatula
gb|KHN32144.1|  Pumilio like 2                                          184   9e-50   Glycine soja [wild soybean]
ref|XP_003606712.1|  Pumilio-like protein                               183   1e-49   Medicago truncatula
gb|KHN21928.1|  Pumilio like 2                                          182   4e-49   Glycine soja [wild soybean]
ref|XP_010043502.1|  PREDICTED: pumilio homolog 2-like                  182   4e-49   Eucalyptus grandis [rose gum]
gb|KCW85517.1|  hypothetical protein EUGRSUZ_B02314                     182   4e-49   Eucalyptus grandis [rose gum]
gb|KHG12245.1|  Pumilio 2                                               182   5e-49   Gossypium arboreum [tree cotton]
gb|KHG12246.1|  Pumilio 2                                               182   6e-49   Gossypium arboreum [tree cotton]
ref|XP_010262560.1|  PREDICTED: pumilio homolog 2-like                  181   1e-48   Nelumbo nucifera [Indian lotus]
gb|KHN32146.1|  Pumilio like 2                                          179   5e-48   Glycine soja [wild soybean]
ref|XP_009364362.1|  PREDICTED: pumilio homolog 1-like                  177   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_002524200.1|  pumilio, putative                                  174   2e-46   
ref|XP_002524201.1|  pumilio, putative                                  174   3e-46   Ricinus communis
ref|XP_004507166.1|  PREDICTED: pumilio homolog 2-like isoform X1       172   9e-46   Cicer arietinum [garbanzo]
gb|KDP44926.1|  hypothetical protein JCGZ_01426                         166   1e-43   Jatropha curcas
ref|XP_010658540.1|  PREDICTED: pumilio homolog 2-like                  166   3e-43   Vitis vinifera
ref|XP_008233648.1|  PREDICTED: pumilio homolog 1-like                  165   3e-43   Prunus mume [ume]
ref|XP_007218909.1|  hypothetical protein PRUPE_ppa000626mg             165   3e-43   Prunus persica
ref|XP_006846288.1|  hypothetical protein AMTR_s00012p00251030          164   7e-43   Amborella trichopoda
ref|XP_006485456.1|  PREDICTED: pumilio homolog 1-like                  159   1e-41   Citrus sinensis [Valencia orange]
ref|XP_006475541.1|  PREDICTED: pumilio homolog 1-like                  158   1e-41   Citrus sinensis [Valencia orange]
ref|XP_006469751.1|  PREDICTED: pumilio homolog 2-like                  155   2e-41   Citrus sinensis [Valencia orange]
ref|XP_010685712.1|  PREDICTED: pumilio homolog 2-like isoform X1       159   5e-41   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_010685713.1|  PREDICTED: pumilio homolog 2-like isoform X2       159   5e-41   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_004486985.1|  PREDICTED: pumilio homolog 2-like                  159   5e-41   Cicer arietinum [garbanzo]
ref|XP_006486391.1|  PREDICTED: pumilio homolog 1-like                  159   6e-41   Citrus sinensis [Valencia orange]
ref|XP_006435646.1|  hypothetical protein CICLE_v10030588mg             159   6e-41   Citrus clementina
gb|KDO69136.1|  hypothetical protein CISIN_1g001588mg                   159   6e-41   Citrus sinensis [Valencia orange]
ref|XP_006435647.1|  hypothetical protein CICLE_v10030588mg             158   6e-41   Citrus clementina
gb|KDO69138.1|  hypothetical protein CISIN_1g001588mg                   158   7e-41   Citrus sinensis [Valencia orange]
gb|KDO69140.1|  hypothetical protein CISIN_1g001588mg                   158   7e-41   Citrus sinensis [Valencia orange]
ref|XP_006435648.1|  hypothetical protein CICLE_v10030588mg             158   8e-41   Citrus clementina
gb|KDO69137.1|  hypothetical protein CISIN_1g001588mg                   158   1e-40   Citrus sinensis [Valencia orange]
ref|XP_009343723.1|  PREDICTED: pumilio homolog 2-like                  156   6e-40   Pyrus x bretschneideri [bai li]
ref|XP_008343532.1|  PREDICTED: pumilio homolog 2-like                  154   2e-39   Malus domestica [apple tree]
emb|CBI31647.3|  unnamed protein product                                153   3e-39   Vitis vinifera
ref|XP_009351433.1|  PREDICTED: pumilio homolog 1-like                  151   3e-38   Pyrus x bretschneideri [bai li]
emb|CDP00123.1|  unnamed protein product                                148   3e-37   Coffea canephora [robusta coffee]
gb|KDP44922.1|  hypothetical protein JCGZ_01422                         144   5e-37   Jatropha curcas
ref|XP_007009257.1|  Pumilio 2 isoform 4                                145   6e-37   Theobroma cacao [chocolate]
ref|XP_008371890.1|  PREDICTED: pumilio homolog 2-like                  147   1e-36   Malus domestica [apple tree]
ref|XP_007009254.1|  Pumilio 2 isoform 1                                146   1e-36   Theobroma cacao [chocolate]
ref|XP_007009255.1|  Pumilio 2 isoform 2                                142   1e-35   Theobroma cacao [chocolate]
ref|XP_007009256.1|  Pumilio 2 isoform 3                                142   1e-35   Theobroma cacao [chocolate]
ref|XP_010906595.1|  PREDICTED: pumilio homolog 2-like isoform X1       144   1e-35   Elaeis guineensis
ref|XP_010906596.1|  PREDICTED: pumilio homolog 2-like isoform X2       143   1e-35   Elaeis guineensis
ref|XP_008777335.1|  PREDICTED: pumilio homolog 2-like isoform X1       142   3e-35   Phoenix dactylifera
ref|XP_008777342.1|  PREDICTED: pumilio homolog 2-like isoform X2       142   3e-35   Phoenix dactylifera
ref|XP_010557243.1|  PREDICTED: pumilio homolog 2-like                  141   6e-35   Tarenaya hassleriana [spider flower]
ref|XP_004236737.1|  PREDICTED: pumilio homolog 1-like                  140   1e-34   Solanum lycopersicum
ref|XP_010096599.1|  Pumilio-2-like protein                             139   6e-34   Morus notabilis
ref|XP_006346707.1|  PREDICTED: pumilio homolog 1-like                  137   1e-33   Solanum tuberosum [potatoes]
ref|XP_009795986.1|  PREDICTED: pumilio homolog 1-like                  137   2e-33   Nicotiana sylvestris
ref|XP_010690975.1|  PREDICTED: pumilio homolog 1-like                  137   2e-33   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008785558.1|  PREDICTED: pumilio homolog 2-like                  137   3e-33   Phoenix dactylifera
ref|XP_008372362.1|  PREDICTED: pumilio homolog 1-like                  133   8e-33   
ref|XP_002316273.2|  hypothetical protein POPTR_0010s20870g             135   9e-33   Populus trichocarpa [western balsam poplar]
ref|XP_009597728.1|  PREDICTED: pumilio homolog 1-like isoform X1       135   1e-32   Nicotiana tomentosiformis
ref|XP_009597729.1|  PREDICTED: pumilio homolog 2-like isoform X2       135   1e-32   Nicotiana tomentosiformis
ref|XP_011016453.1|  PREDICTED: pumilio homolog 1-like isoform X1       134   2e-32   Populus euphratica
ref|XP_011016454.1|  PREDICTED: pumilio homolog 1-like isoform X2       134   2e-32   Populus euphratica
ref|XP_010418800.1|  PREDICTED: pumilio homolog 2-like                  135   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010067428.1|  PREDICTED: pumilio homolog 1-like                  134   2e-32   Eucalyptus grandis [rose gum]
ref|XP_011032451.1|  PREDICTED: pumilio homolog 1-like isoform X2       132   5e-32   Populus euphratica
ref|XP_011002642.1|  PREDICTED: pumilio homolog 1-like                  133   6e-32   Populus euphratica
ref|XP_010922284.1|  PREDICTED: pumilio homolog 2-like                  133   7e-32   Elaeis guineensis
ref|XP_009795340.1|  PREDICTED: pumilio homolog 1-like isoform X2       131   1e-31   Nicotiana sylvestris
ref|XP_009795329.1|  PREDICTED: pumilio homolog 1-like isoform X1       131   1e-31   Nicotiana sylvestris
ref|XP_011032372.1|  PREDICTED: pumilio homolog 1-like isoform X1       132   1e-31   Populus euphratica
gb|ABW81068.1|  Mpt5-3                                                  131   2e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_002879203.1|  mpt5-3                                             131   2e-31   Arabidopsis lyrata subsp. lyrata
gb|ABW81111.1|  putative pumilio Mpt5                                   131   3e-31   Boechera divaricarpa
ref|XP_006409965.1|  hypothetical protein EUTSA_v10016189mg             130   4e-31   Eutrema salsugineum
ref|XP_002881034.1|  mpt5-1                                             129   9e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_010469980.1|  PREDICTED: pumilio homolog 2                       129   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_009631474.1|  PREDICTED: pumilio homolog 1-like isoform X3       127   2e-30   Nicotiana tomentosiformis
gb|ABW81063.1|  Mpt5-1                                                  129   2e-30   Arabidopsis lyrata subsp. lyrata
gb|KGN50567.1|  hypothetical protein Csa_5G182720                       129   2e-30   Cucumis sativus [cucumbers]
ref|XP_004147681.1|  PREDICTED: pumilio homolog 1-like                  128   3e-30   
ref|XP_010414430.1|  PREDICTED: pumilio homolog 2-like                  128   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_009631472.1|  PREDICTED: pumilio homolog 1-like isoform X1       127   4e-30   Nicotiana tomentosiformis
gb|ABW81162.1|  PMpt5-1                                                 127   6e-30   Capsella rubella
ref|XP_009631473.1|  PREDICTED: pumilio homolog 1-like isoform X2       126   6e-30   Nicotiana tomentosiformis
ref|XP_010920533.1|  PREDICTED: pumilio homolog 1-like                  126   1e-29   Elaeis guineensis
ref|XP_009381078.1|  PREDICTED: pumilio homolog 2-like isoform X2       126   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381077.1|  PREDICTED: pumilio homolog 2-like isoform X1       126   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAE98746.1|  putative pumilio/Mpt5 family RNA-binding protein       125   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180482.1|  pumilio 2                                             125   4e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20149.1|  putative pumilio/Mpt5 family RNA-binding protein        125   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510528.1|  PREDICTED: pumilio homolog 2-like                  124   5e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010937586.1|  PREDICTED: pumilio homolog 1-like                  124   9e-29   Elaeis guineensis
ref|XP_006293626.1|  hypothetical protein CARUB_v10022579mg             124   1e-28   Capsella rubella
ref|XP_006343744.1|  PREDICTED: pumilio homolog 1-like                  124   1e-28   Solanum tuberosum [potatoes]
gb|ABW81112.1|  putative pumilio Mpt5-2                                 123   2e-28   Boechera divaricarpa
gb|ABW74568.1|  Mpt5                                                    122   2e-28   Boechera divaricarpa
ref|XP_002311179.2|  hypothetical protein POPTR_0008s05850g             122   5e-28   Populus trichocarpa [western balsam poplar]
ref|XP_009402270.1|  PREDICTED: pumilio homolog 3-like                  122   5e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_180483.1|  pumilio 1                                             121   6e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293694.1|  hypothetical protein CARUB_v10022652mg             120   1e-27   Capsella rubella
gb|ABW81161.1|  unknown                                                 120   1e-27   Capsella rubella
ref|XP_006409963.1|  hypothetical protein EUTSA_v10016185mg             120   2e-27   Eutrema salsugineum
gb|ABW81064.1|  AlMpt5-2                                                119   3e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_006295787.1|  hypothetical protein CARUB_v10024911mg             119   5e-27   Capsella rubella
ref|XP_010473984.1|  PREDICTED: pumilio homolog 2-like                  118   5e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006644998.1|  PREDICTED: pumilio homolog 2-like                  119   6e-27   Oryza brachyantha
ref|XP_010469982.1|  PREDICTED: pumilio homolog 2-like                  117   2e-26   Camelina sativa [gold-of-pleasure]
ref|NP_180478.1|  pumilio 3                                             116   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001044782.1|  Os01g0844800                                       116   4e-26   
gb|EAY76473.1|  hypothetical protein OsI_04410                          116   4e-26   Oryza sativa Indica Group [Indian rice]
dbj|BAB89558.1|  putative pumilio domain-containing protein PPD1        116   5e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010414415.1|  PREDICTED: pumilio homolog 2-like                  115   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_008461691.1|  PREDICTED: pumilio homolog 1-like                  115   7e-26   Cucumis melo [Oriental melon]
ref|XP_004490875.1|  PREDICTED: pumilio homolog 1-like isoform X1       115   1e-25   Cicer arietinum [garbanzo]
ref|XP_004490876.1|  PREDICTED: pumilio homolog 1-like isoform X2       115   1e-25   Cicer arietinum [garbanzo]
ref|XP_006409962.1|  hypothetical protein EUTSA_v10016184mg             114   2e-25   Eutrema salsugineum
ref|XP_004970555.1|  PREDICTED: pumilio homolog 2-like                  114   3e-25   Setaria italica
ref|XP_002863049.1|  hypothetical protein ARALYDRAFT_920647             111   4e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_004960534.1|  PREDICTED: pumilio homolog 1-like                  112   6e-25   Setaria italica
ref|XP_003616446.1|  Pumilio-like protein                               112   8e-25   
gb|AES99404.2|  pumilio-family RNA-binding repeatprotein                112   8e-25   Medicago truncatula
ref|XP_002440447.1|  hypothetical protein SORBIDRAFT_09g001090          110   4e-24   Sorghum bicolor [broomcorn]
ref|XP_002456623.1|  hypothetical protein SORBIDRAFT_03g039600          110   5e-24   Sorghum bicolor [broomcorn]
gb|ACN27840.1|  unknown                                                 110   5e-24   Zea mays [maize]
gb|AFW82890.1|  hypothetical protein ZEAMMB73_959107                    110   5e-24   Zea mays [maize]
ref|NP_001146200.1|  uncharacterized protein LOC100279770               110   5e-24   Zea mays [maize]
gb|EMT17283.1|  Pumilio-like protein                                    110   5e-24   Aegilops tauschii
tpg|DAA46484.1|  TPA: hypothetical protein ZEAMMB73_346749              109   6e-24   Zea mays [maize]
ref|XP_008658750.1|  PREDICTED: pumilio homolog 1-like                  109   6e-24   Zea mays [maize]
ref|XP_010241847.1|  PREDICTED: pumilio homolog 4-like                  110   6e-24   Nelumbo nucifera [Indian lotus]
gb|EPS67369.1|  hypothetical protein M569_07403                         108   7e-24   Genlisea aurea
emb|CDM84977.1|  unnamed protein product                                109   1e-23   Triticum aestivum [Canadian hard winter wheat]
gb|AGW24466.1|  pumilio-like protein 3                                  100   2e-23   Avicennia marina subsp. marina
ref|XP_009384840.1|  PREDICTED: pumilio homolog 2-like                  108   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010535459.1|  PREDICTED: pumilio homolog 2-like                  108   3e-23   Tarenaya hassleriana [spider flower]
ref|XP_007141399.1|  hypothetical protein PHAVU_008G192100g             107   4e-23   Phaseolus vulgaris [French bean]
ref|NP_001170502.1|  uncharacterized protein LOC100384506               105   4e-23   Zea mays [maize]
gb|EMS59607.1|  Pumilio-like protein 2                                  107   7e-23   Triticum urartu
ref|XP_008648194.1|  PREDICTED: uncharacterized protein LOC100384...    105   2e-22   Zea mays [maize]
gb|AFW74987.1|  hypothetical protein ZEAMMB73_090092                    105   2e-22   Zea mays [maize]
ref|XP_006279123.1|  hypothetical protein CARUB_v10008047mg             104   3e-22   Capsella rubella
ref|XP_010253957.1|  PREDICTED: pumilio homolog 4-like                  103   2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_006827416.1|  hypothetical protein AMTR_s00009p00067490          102   2e-21   
ref|XP_010535464.1|  PREDICTED: pumilio homolog 2-like                  101   5e-21   Tarenaya hassleriana [spider flower]
ref|XP_010535467.1|  PREDICTED: pumilio homolog 2-like                  101   6e-21   Tarenaya hassleriana [spider flower]
gb|EMT27786.1|  Pumilio-like protein                                  99.0    3e-20   Aegilops tauschii
ref|XP_006653961.1|  PREDICTED: pumilio homolog 1-like                98.2    8e-20   
ref|XP_010535463.1|  PREDICTED: pumilio homolog 2-like                97.8    9e-20   Tarenaya hassleriana [spider flower]
gb|EMS50302.1|  Pumilio-like protein 3                                96.7    2e-19   Triticum urartu
ref|XP_003569112.1|  PREDICTED: pumilio homolog 1-like                95.5    3e-19   
ref|XP_010231850.1|  PREDICTED: pumilio homolog 1-like                95.5    6e-19   Brachypodium distachyon [annual false brome]
gb|AAK73144.1|AC079022_17  putative pumilio/Mpt5 family RNA-bindi...  94.0    2e-18   Oryza sativa [red rice]
gb|EEE62062.1|  hypothetical protein OsJ_16846                        94.0    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EEC78380.1|  hypothetical protein OsI_18154                        94.0    2e-18   Oryza sativa Indica Group [Indian rice]
dbj|BAH00903.1|  unnamed protein product                              94.0    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AAU44141.1|  putative pumilio/Mpt5 family RNA-binding protein      94.0    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AAM22812.1|AF427791_3  BPM                                         93.6    2e-18   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010935723.1|  PREDICTED: pumilio homolog 1-like                94.0    2e-18   Elaeis guineensis
ref|XP_011076803.1|  PREDICTED: pumilio homolog 2-like isoform X1     90.5    3e-17   Sesamum indicum [beniseed]
ref|XP_011076804.1|  PREDICTED: pumilio homolog 2-like isoform X2     90.1    4e-17   Sesamum indicum [beniseed]
emb|CDM82624.1|  unnamed protein product                              85.1    1e-15   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK03395.1|  predicted protein                                    85.5    1e-15   Hordeum vulgare subsp. vulgare [barley]
gb|EMS46736.1|  Pumilio-like protein 1                                85.5    2e-15   Triticum urartu
gb|EMT10419.1|  Pumilio-like protein                                  83.2    7e-15   Aegilops tauschii
emb|CDM87073.1|  unnamed protein product                              82.4    1e-14   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010658381.1|  PREDICTED: pumilio homolog 4 isoform X2          82.0    2e-14   Vitis vinifera
ref|XP_002273503.1|  PREDICTED: pumilio homolog 4 isoform X1          82.0    2e-14   Vitis vinifera
ref|XP_009395430.1|  PREDICTED: pumilio homolog 1-like                81.6    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007220282.1|  hypothetical protein PRUPE_ppa000731mg           79.0    2e-13   Prunus persica
ref|XP_008365664.1|  PREDICTED: pumilio homolog 4                     77.8    5e-13   Malus domestica [apple tree]
ref|XP_008233289.1|  PREDICTED: pumilio homolog 4                     77.0    1e-12   Prunus mume [ume]
gb|AAX58753.1|  PUF-domain RNA-binding protein                        75.9    2e-12   Physcomitrella patens
ref|XP_001767745.1|  predicted protein                                75.9    2e-12   Physcomitrella patens
ref|XP_008800533.1|  PREDICTED: pumilio homolog 1-like                75.5    2e-12   Phoenix dactylifera
ref|XP_001767683.1|  predicted protein                                75.5    3e-12   Physcomitrella patens
ref|XP_008789554.1|  PREDICTED: pumilio homolog 4-like                75.5    3e-12   Phoenix dactylifera
ref|XP_009396181.1|  PREDICTED: pumilio homolog 1-like                75.5    3e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001045538.1|  Os01g0971900                                     73.9    7e-12   
ref|XP_001759120.1|  predicted protein                                74.3    8e-12   Physcomitrella patens
ref|XP_007009913.1|  Pumilio 4 isoform 2                              73.6    1e-11   Theobroma cacao [chocolate]
ref|XP_007009914.1|  Pumilio 4 isoform 3                              73.2    1e-11   Theobroma cacao [chocolate]
ref|XP_007009912.1|  Pumilio 4 isoform 1                              73.6    1e-11   Theobroma cacao [chocolate]
ref|XP_009368909.1|  PREDICTED: pumilio homolog 4 isoform X3          72.4    3e-11   Pyrus x bretschneideri [bai li]
gb|EYU19929.1|  hypothetical protein MIMGU_mgv1a001211mg              71.2    6e-11   Erythranthe guttata [common monkey flower]
ref|XP_009368908.1|  PREDICTED: pumilio homolog 4 isoform X2          70.9    9e-11   Pyrus x bretschneideri [bai li]
ref|XP_009368907.1|  PREDICTED: pumilio homolog 4 isoform X1          70.9    9e-11   Pyrus x bretschneideri [bai li]
ref|XP_004496246.1|  PREDICTED: pumilio homolog 4-like isoform X4     70.9    1e-10   Cicer arietinum [garbanzo]
ref|XP_004496247.1|  PREDICTED: pumilio homolog 4-like isoform X5     70.9    1e-10   Cicer arietinum [garbanzo]
ref|XP_004496245.1|  PREDICTED: pumilio homolog 4-like isoform X3     70.5    1e-10   Cicer arietinum [garbanzo]
ref|XP_004496243.1|  PREDICTED: pumilio homolog 4-like isoform X1     70.5    1e-10   
ref|XP_008362674.1|  PREDICTED: pumilio homolog 4-like isoform X2     70.5    1e-10   Malus domestica [apple tree]
ref|XP_008362673.1|  PREDICTED: pumilio homolog 4-like isoform X1     70.1    2e-10   Malus domestica [apple tree]
emb|CDY31766.1|  BnaA04g17020D                                        67.4    1e-09   Brassica napus [oilseed rape]
ref|XP_009140975.1|  PREDICTED: pumilio homolog 1-like                67.0    1e-09   Brassica rapa
ref|XP_011041036.1|  PREDICTED: pumilio homolog 4-like                66.6    2e-09   Populus euphratica
emb|CDY50144.1|  BnaC04g40330D                                        65.5    4e-09   Brassica napus [oilseed rape]
ref|XP_002316382.2|  pumilio/Puf RNA-binding domain-containing fa...  64.7    8e-09   Populus trichocarpa [western balsam poplar]
ref|XP_001767679.1|  predicted protein                                62.4    5e-08   Physcomitrella patens
gb|AES62113.2|  pumilio-family RNA-binding repeatprotein              61.2    1e-07   Medicago truncatula
gb|KEH43507.1|  pumilio-family RNA-binding repeatprotein              60.8    1e-07   Medicago truncatula
gb|KEH43508.1|  pumilio-family RNA-binding repeatprotein              60.8    1e-07   Medicago truncatula
ref|XP_003591862.1|  60S ribosomal protein L4                         60.8    1e-07   
ref|XP_006279124.1|  hypothetical protein CARUB_v10008048mg           60.1    2e-07   Capsella rubella
gb|KDO48817.1|  hypothetical protein CISIN_1g001685mg                 60.1    2e-07   Citrus sinensis [Valencia orange]
gb|KDO48818.1|  hypothetical protein CISIN_1g001685mg                 60.1    2e-07   Citrus sinensis [Valencia orange]
gb|EPS62584.1|  hypothetical protein M569_12206                       60.1    2e-07   Genlisea aurea
gb|KDO48815.1|  hypothetical protein CISIN_1g001685mg                 60.1    2e-07   
ref|XP_006436466.1|  hypothetical protein CICLE_v10030594mg           60.1    3e-07   
ref|XP_002311080.2|  hypothetical protein POPTR_0008s03630g           59.7    3e-07   
ref|XP_002530940.1|  pumilio, putative                                59.3    4e-07   
ref|XP_010940626.1|  PREDICTED: pumilio homolog 1-like                59.3    5e-07   
gb|KJB74738.1|  hypothetical protein B456_012G005400                  58.2    9e-07   
gb|KJB74739.1|  hypothetical protein B456_012G005400                  58.2    1e-06   
ref|XP_006589409.1|  PREDICTED: pumilio homolog 4-like isoform X2     58.2    1e-06   
ref|XP_006589408.1|  PREDICTED: pumilio homolog 4-like isoform X1     58.2    1e-06   
gb|KHN00858.1|  Pumilio like 4                                        57.8    1e-06   
ref|XP_011469641.1|  PREDICTED: pumilio homolog 4                     57.8    1e-06   
ref|XP_006606261.1|  PREDICTED: pumilio homolog 4-like isoform X1     57.8    1e-06   
ref|XP_006606263.1|  PREDICTED: pumilio homolog 4-like isoform X3     57.8    1e-06   
gb|KHG29032.1|  Pumilio -like protein                                 57.8    1e-06   
gb|KHN17156.1|  Pumilio like 4                                        57.0    2e-06   
ref|XP_002453050.1|  hypothetical protein SORBIDRAFT_04g037410        57.0    2e-06   
ref|XP_007143735.1|  hypothetical protein PHAVU_007G097100g           55.8    5e-06   
ref|XP_006649176.1|  PREDICTED: pumilio homolog 1-like                54.7    1e-05   
gb|AFW63978.1|  hypothetical protein ZEAMMB73_492361                  53.9    2e-05   
ref|XP_008679159.1|  PREDICTED: pumilio homolog 3-like                53.9    2e-05   
ref|XP_010112210.1|  Pumilio-4-like protein                           53.5    3e-05   
ref|XP_011031696.1|  PREDICTED: pumilio homolog 4-like                53.1    5e-05   
dbj|BAD22967.1|  pumilio-like                                         52.8    6e-05   
ref|XP_003572951.1|  PREDICTED: pumilio homolog 3-like                50.8    3e-04   



>ref|XP_004241216.1| PREDICTED: pumilio homolog 2-like [Solanum lycopersicum]
Length=993

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 155/201 (77%), Gaps = 6/201 (3%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +++  GNYNL PLFE AAAAS MA+P MDSRM   S+LNS   +QN+GRM N M+GS LQ
Sbjct  441  VTSHLGNYNLPPLFETAAAASGMALPGMDSRMLGASHLNSGVSEQNLGRMGNHMSGSALQ  500

Query  186  AQYMDPMYIQYLL-----QFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYNVP  350
            A +MDPMY+QYL      Q ++ NDPSMDRNY+GNSY DL QKAY+G+ LSP KSQY VP
Sbjct  501  ASFMDPMYLQYLTAEYVAQVSALNDPSMDRNYMGNSYMDLFQKAYLGNALSP-KSQYGVP  559

Query  351  LSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMR  530
            LSSK  GS H GYYGNP F VGLSYPGS L S V+PNSPVGPGSP+R SDYNMR  G MR
Sbjct  560  LSSKGSGSNHLGYYGNPAFGVGLSYPGSPLASSVVPNSPVGPGSPMRHSDYNMRFSGAMR  619

Query  531  NFGVGVIGPWNLDNMENSFAS  593
            N   GVIG W+LDNMENSFAS
Sbjct  620  NITSGVIGSWHLDNMENSFAS  640



>emb|CDP09091.1| unnamed protein product [Coffea canephora]
Length=1030

 Score =   245 bits (626),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 156/198 (79%), Gaps = 7/198 (4%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQAQYMD  200
            GN+NL PLFENAAAASAMA+P MDSR+  GSN+ S   + N+ RM NQMAG+GLQ+ YMD
Sbjct  480  GNFNLPPLFENAAAASAMAVPGMDSRILGGSNIGSPVSEHNLSRMGNQMAGNGLQSPYMD  539

Query  201  PMYIQYLL-------QFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYNVPLSS  359
            P Y+QYL        Q A+ NDPS+DRNY+GNSY DLLQKAY+GS+LSPQKS Y VP  +
Sbjct  540  PAYLQYLRTAEYVANQVAALNDPSLDRNYMGNSYMDLLQKAYLGSVLSPQKSPYGVPAGT  599

Query  360  KNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFG  539
            KN GS HHGYYGNP F VGLSYPG+ L SPVIPNSP  PGSP+R +D+NMR  GGMRN  
Sbjct  600  KNTGSNHHGYYGNPAFGVGLSYPGNPLASPVIPNSPGAPGSPLRHNDFNMRFPGGMRNLA  659

Query  540  VGVIGPWNLDNMENSFAS  593
             GV+GPW+LDN++NSFAS
Sbjct  660  GGVMGPWHLDNIDNSFAS  677



>ref|XP_006350784.1| PREDICTED: pumilio homolog 2-like isoform X2 [Solanum tuberosum]
Length=942

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 157/201 (78%), Gaps = 6/201 (3%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +++  GNYNL PLFE AAAAS MA+P MDSRM   S+LNS   +QN+ RM NQM+GS LQ
Sbjct  441  VTSHLGNYNLPPLFETAAAASGMALPGMDSRMLGASHLNSGVSEQNLSRMGNQMSGSALQ  500

Query  186  AQYMDPMYIQYLL-----QFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYNVP  350
            A +MDPMY+QYL      Q A+ NDPSMDRNY+ NSY DLLQKAY+G+ LSP KSQY VP
Sbjct  501  ASFMDPMYLQYLTAEYVAQVAALNDPSMDRNYMANSYMDLLQKAYLGNALSP-KSQYGVP  559

Query  351  LSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMR  530
            LSSK  GS HHGYYGNP F VGLSYPGS L SPV+PNSPVGPGSP+R  DYNMR  G MR
Sbjct  560  LSSKGSGSSHHGYYGNPAFGVGLSYPGSPLASPVVPNSPVGPGSPMRHGDYNMRFPGAMR  619

Query  531  NFGVGVIGPWNLDNMENSFAS  593
            N   GVIGPW+LDNMENSFAS
Sbjct  620  NVTSGVIGPWHLDNMENSFAS  640



>ref|XP_006350783.1| PREDICTED: pumilio homolog 2-like isoform X1 [Solanum tuberosum]
Length=993

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 157/201 (78%), Gaps = 6/201 (3%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +++  GNYNL PLFE AAAAS MA+P MDSRM   S+LNS   +QN+ RM NQM+GS LQ
Sbjct  441  VTSHLGNYNLPPLFETAAAASGMALPGMDSRMLGASHLNSGVSEQNLSRMGNQMSGSALQ  500

Query  186  AQYMDPMYIQYLL-----QFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYNVP  350
            A +MDPMY+QYL      Q A+ NDPSMDRNY+ NSY DLLQKAY+G+ LSP KSQY VP
Sbjct  501  ASFMDPMYLQYLTAEYVAQVAALNDPSMDRNYMANSYMDLLQKAYLGNALSP-KSQYGVP  559

Query  351  LSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMR  530
            LSSK  GS HHGYYGNP F VGLSYPGS L SPV+PNSPVGPGSP+R  DYNMR  G MR
Sbjct  560  LSSKGSGSSHHGYYGNPAFGVGLSYPGSPLASPVVPNSPVGPGSPMRHGDYNMRFPGAMR  619

Query  531  NFGVGVIGPWNLDNMENSFAS  593
            N   GVIGPW+LDNMENSFAS
Sbjct  620  NVTSGVIGPWHLDNMENSFAS  640



>ref|XP_011089489.1| PREDICTED: pumilio homolog 2-like [Sesamum indicum]
Length=1048

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 155/203 (76%), Gaps = 7/203 (3%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S Q G+ NL PLFENAAAASAMA+P MDSR+  GSNL +AS+DQN+GR+ NQ+AGS LQ
Sbjct  493  ISGQLGSPNLPPLFENAAAASAMAVPGMDSRLLGGSNLGAASVDQNLGRLGNQIAGSALQ  552

Query  186  AQYMDPMYIQYLLQFASH-------NDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYN  344
            A ++DP+Y+QYL             NDPS+DRNY+GNSY DLLQKAY+G++LSP KSQYN
Sbjct  553  APFVDPLYLQYLRTAEYAAAQVAALNDPSVDRNYMGNSYMDLLQKAYLGNLLSPPKSQYN  612

Query  345  VPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGG  524
            VPL  K   S  HGYY NP F +GLSYPGS L SPVIPNS  GPGSP+R  ++NMR  GG
Sbjct  613  VPLGGKTSASSPHGYYANPTFGIGLSYPGSPLASPVIPNSAGGPGSPMRHGEFNMRFPGG  672

Query  525  MRNFGVGVIGPWNLDNMENSFAS  593
            +RN    VIGPW+LDN++NSFAS
Sbjct  673  LRNVAGNVIGPWHLDNIDNSFAS  695



>ref|XP_006358700.1| PREDICTED: pumilio homolog 2-like [Solanum tuberosum]
Length=972

 Score =   231 bits (590),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 155/201 (77%), Gaps = 9/201 (4%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S+  GNYNL PLF NAAAASAMA+P +DSRM  GSNL +A+ +Q + RM NQM G+ L 
Sbjct  423  MSSHLGNYNLPPLFGNAAAASAMAVPGLDSRMLGGSNLGAATSEQTLSRMGNQMGGNALP  482

Query  186  AQYMDPMYIQYL-----LQFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYNVP  350
            A Y+DPMY+QYL      Q A+ NDPS+DRNY+GNSY DLLQKAY+ ++L PQKSQY VP
Sbjct  483  ASYVDPMYLQYLSAEYAAQVAALNDPSLDRNYMGNSYVDLLQKAYLSNVL-PQKSQYGVP  541

Query  351  LSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMR  530
            L+SK   SGHHGYYGNP F VGLSYPGS L SPV   SPVGPGSP+R SDYNMR  G MR
Sbjct  542  LNSKTSSSGHHGYYGNPAFGVGLSYPGSPLASPV---SPVGPGSPMRHSDYNMRFPGRMR  598

Query  531  NFGVGVIGPWNLDNMENSFAS  593
            N   GV+GP++LDNMENS AS
Sbjct  599  NIAGGVMGPYHLDNMENSVAS  619



>ref|XP_010321733.1| PREDICTED: LOW QUALITY PROTEIN: pumilio homolog 1-like [Solanum 
lycopersicum]
Length=987

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 153/201 (76%), Gaps = 9/201 (4%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S+  GNYNL PLF NAAAASAMA+P +DSRM  GSNL++A+ +Q + RM NQM G+ + 
Sbjct  438  MSSHLGNYNLPPLFGNAAAASAMAVPGLDSRMLGGSNLSAATSEQTLSRMGNQMGGNAVP  497

Query  186  AQYMDPMYIQYL-----LQFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYNVP  350
            A +MDPMY+QYL      Q A  NDPS+DRNY+GNSY DL QKAY+ S+L PQKSQY VP
Sbjct  498  ASFMDPMYLQYLSAEYAAQVAVLNDPSLDRNYMGNSYVDLFQKAYLSSVL-PQKSQYGVP  556

Query  351  LSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMR  530
            L+SK  GSGH GYYGN  F VGLSYPGS L SPV   SPVGPGSP+R SDYNMR  G +R
Sbjct  557  LNSKTSGSGHPGYYGNSAFGVGLSYPGSPLASPV---SPVGPGSPMRHSDYNMRFPGRIR  613

Query  531  NFGVGVIGPWNLDNMENSFAS  593
            N   GV+GP++LDNMENS AS
Sbjct  614  NIAGGVMGPYHLDNMENSVAS  634



>ref|XP_007016356.1| Pumilio 2 isoform 3 [Theobroma cacao]
 gb|EOY33975.1| Pumilio 2 isoform 3 [Theobroma cacao]
Length=945

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 157/214 (73%), Gaps = 18/214 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNL-NSASLDQNIGRMENQM  167
            +++Q G  NL PLFEN AAAS MA+P MDSR+      +G N+ N+AS   N+GR+ +Q+
Sbjct  501  MASQLGTGNLPPLFENVAAASPMAVPGMDSRVLGGGLGSGQNISNAASESHNLGRVGSQI  560

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG+ LQA ++DPMY+QYL        Q A+ NDPSMDRN+LGNSY +LL  QKAY+G++L
Sbjct  561  AGNALQAPFVDPMYLQYLRTSDYAAAQLAALNDPSMDRNFLGNSYMNLLELQKAYLGALL  620

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            SPQKSQY VPL +K+  S  HG+YGNP F  G+SYPGS L SPVIPNSPVGPGSPIR +D
Sbjct  621  SPQKSQYGVPLGAKSGSSNLHGFYGNPTFGAGMSYPGSPLASPVIPNSPVGPGSPIRHTD  680

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NMR   GMRN   GVIGPW+LD   NM+ SFAS
Sbjct  681  LNMRFPSGMRNLAGGVIGPWHLDAGCNMDESFAS  714



>ref|XP_007016354.1| Pumilio 2 isoform 1 [Theobroma cacao]
 gb|EOY33973.1| Pumilio 2 isoform 1 [Theobroma cacao]
Length=1067

 Score =   220 bits (561),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 157/214 (73%), Gaps = 18/214 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNL-NSASLDQNIGRMENQM  167
            +++Q G  NL PLFEN AAAS MA+P MDSR+      +G N+ N+AS   N+GR+ +Q+
Sbjct  501  MASQLGTGNLPPLFENVAAASPMAVPGMDSRVLGGGLGSGQNISNAASESHNLGRVGSQI  560

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG+ LQA ++DPMY+QYL        Q A+ NDPSMDRN+LGNSY +LL  QKAY+G++L
Sbjct  561  AGNALQAPFVDPMYLQYLRTSDYAAAQLAALNDPSMDRNFLGNSYMNLLELQKAYLGALL  620

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            SPQKSQY VPL +K+  S  HG+YGNP F  G+SYPGS L SPVIPNSPVGPGSPIR +D
Sbjct  621  SPQKSQYGVPLGAKSGSSNLHGFYGNPTFGAGMSYPGSPLASPVIPNSPVGPGSPIRHTD  680

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NMR   GMRN   GVIGPW+LD   NM+ SFAS
Sbjct  681  LNMRFPSGMRNLAGGVIGPWHLDAGCNMDESFAS  714



>ref|XP_007016355.1| Pumilio 2 isoform 2 [Theobroma cacao]
 gb|EOY33974.1| Pumilio 2 isoform 2 [Theobroma cacao]
Length=1067

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 157/214 (73%), Gaps = 18/214 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNL-NSASLDQNIGRMENQM  167
            +++Q G  NL PLFEN AAAS MA+P MDSR+      +G N+ N+AS   N+GR+ +Q+
Sbjct  501  MASQLGTGNLPPLFENVAAASPMAVPGMDSRVLGGGLGSGQNISNAASESHNLGRVGSQI  560

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG+ LQA ++DPMY+QYL        Q A+ NDPSMDRN+LGNSY +LL  QKAY+G++L
Sbjct  561  AGNALQAPFVDPMYLQYLRTSDYAAAQLAALNDPSMDRNFLGNSYMNLLELQKAYLGALL  620

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            SPQKSQY VPL +K+  S  HG+YGNP F  G+SYPGS L SPVIPNSPVGPGSPIR +D
Sbjct  621  SPQKSQYGVPLGAKSGSSNLHGFYGNPTFGAGMSYPGSPLASPVIPNSPVGPGSPIRHTD  680

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NMR   GMRN   GVIGPW+LD   NM+ SFAS
Sbjct  681  LNMRFPSGMRNLAGGVIGPWHLDAGCNMDESFAS  714



>emb|CAN61602.1| hypothetical protein VITISV_024967 [Vitis vinifera]
Length=1039

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 154/214 (72%), Gaps = 18/214 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLD-QNIGRMENQM  167
            +++Q G  NL PLFEN AAASAM +P +DSR+      +G N+ +A+ + QN+ R+ N M
Sbjct  473  MASQLGAANLPPLFENVAAASAMGVPGIDSRVLGAGLASGPNIGAATSESQNLNRIGNHM  532

Query  168  AGSGLQAQYMDPMYIQYLLQFASH-------NDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG+ LQA ++DPMY+QYL             NDPS+DRNYLGNSY DLL  QKAY+G++L
Sbjct  533  AGNALQAPFVDPMYLQYLRTAEYAAAQVAALNDPSVDRNYLGNSYVDLLGLQKAYLGALL  592

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            SPQKSQY VPL SK+ GS HHGYYGNP F VG+SYPGS L SPVIPNSP+GPGSPIR +D
Sbjct  593  SPQKSQYGVPLGSKSSGSNHHGYYGNPAFGVGMSYPGSPLASPVIPNSPIGPGSPIRHND  652

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NMR   GMRN   GV+ PW+LD   NM+  FAS
Sbjct  653  LNMRYPSGMRNLAGGVMAPWHLDAGCNMDEGFAS  686



>ref|XP_002283191.1| PREDICTED: pumilio homolog 2 isoform X2 [Vitis vinifera]
Length=1065

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 154/214 (72%), Gaps = 18/214 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLD-QNIGRMENQM  167
            +++Q G  NL PLFEN AAASAM +P +DSR+      +G N+ +A+ + QN+ R+ N M
Sbjct  499  MASQLGAANLPPLFENVAAASAMGVPGIDSRVLGAGLASGPNIGAATSESQNLNRIGNHM  558

Query  168  AGSGLQAQYMDPMYIQYLLQFASH-------NDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG+ LQA ++DPMY+QYL             NDPS+DRNYLGNSY DLL  QKAY+G++L
Sbjct  559  AGNALQAPFVDPMYLQYLRTAEYAAAQVAALNDPSVDRNYLGNSYVDLLGLQKAYLGALL  618

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            SPQKSQY VPL SK+ GS HHGYYGNP F VG+SYPGS L SPVIPNSP+GPGSPIR +D
Sbjct  619  SPQKSQYGVPLGSKSSGSNHHGYYGNPAFGVGMSYPGSPLASPVIPNSPIGPGSPIRHND  678

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NMR   GMRN   GV+ PW+LD   NM+  FAS
Sbjct  679  LNMRYPSGMRNLAGGVMAPWHLDAGCNMDEGFAS  712



>ref|XP_010650999.1| PREDICTED: pumilio homolog 2 isoform X1 [Vitis vinifera]
Length=1066

 Score =   218 bits (556),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 154/214 (72%), Gaps = 18/214 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLD-QNIGRMENQM  167
            +++Q G  NL PLFEN AAASAM +P +DSR+      +G N+ +A+ + QN+ R+ N M
Sbjct  500  MASQLGAANLPPLFENVAAASAMGVPGIDSRVLGAGLASGPNIGAATSESQNLNRIGNHM  559

Query  168  AGSGLQAQYMDPMYIQYLLQFASH-------NDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG+ LQA ++DPMY+QYL             NDPS+DRNYLGNSY DLL  QKAY+G++L
Sbjct  560  AGNALQAPFVDPMYLQYLRTAEYAAAQVAALNDPSVDRNYLGNSYVDLLGLQKAYLGALL  619

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            SPQKSQY VPL SK+ GS HHGYYGNP F VG+SYPGS L SPVIPNSP+GPGSPIR +D
Sbjct  620  SPQKSQYGVPLGSKSSGSNHHGYYGNPAFGVGMSYPGSPLASPVIPNSPIGPGSPIRHND  679

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NMR   GMRN   GV+ PW+LD   NM+  FAS
Sbjct  680  LNMRYPSGMRNLAGGVMAPWHLDAGCNMDEGFAS  713



>ref|XP_007208120.1| hypothetical protein PRUPE_ppa000627mg [Prunus persica]
 gb|EMJ09319.1| hypothetical protein PRUPE_ppa000627mg [Prunus persica]
Length=1062

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 150/209 (72%), Gaps = 13/209 (6%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLD-QNIGRMENQMAGSGL  182
            +++Q G  NL PLFE+A  +  M    +   M +G NL +A+ +  N+GR+ + +AGSGL
Sbjct  501  VASQLGTGNLPPLFESAMGSPGMDSRVLGGGMASGPNLAAAASESHNLGRLGSPIAGSGL  560

Query  183  QAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKS  335
            QA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +LL  QKAY+G++LSPQKS
Sbjct  561  QAPFVDPMYLQYLRTSEYAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGALLSPQKS  620

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            QY VPL  K+ GS HHGYYGNP F VG+SYPGS + SPVIPNSPVGPGSP+R ++ NM  
Sbjct  621  QYGVPLGGKSAGSNHHGYYGNPAFGVGMSYPGSPMASPVIPNSPVGPGSPMRHNELNMCF  680

Query  516  GGGMRNFGVGVIGPWNLD---NMENSFAS  593
              GMRN   GV+GPW+LD   N++ SFAS
Sbjct  681  PSGMRNLAGGVMGPWHLDGGGNIDESFAS  709



>ref|XP_008222212.1| PREDICTED: pumilio homolog 1 [Prunus mume]
Length=1060

 Score =   209 bits (532),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 149/209 (71%), Gaps = 13/209 (6%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLD-QNIGRMENQMAGSGL  182
            +++Q G  NL PLFE+A  +  M    +   M +G NL +A+ +  N+GR+ + + GSGL
Sbjct  499  VASQLGTGNLPPLFESAMGSPGMDSRVLGGGMASGPNLAAAASESHNLGRLGSPITGSGL  558

Query  183  QAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKS  335
            QA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +LL  QKAY+G++LSPQKS
Sbjct  559  QAPFVDPMYLQYLRTSEYAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGALLSPQKS  618

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            QY VPL  K+ GS HHGYYGNP F VG+SYPGS + SPVIPNSPVGPGSP+R ++ NM  
Sbjct  619  QYGVPLGGKSAGSNHHGYYGNPAFGVGMSYPGSPMASPVIPNSPVGPGSPMRHNELNMCF  678

Query  516  GGGMRNFGVGVIGPWNLD---NMENSFAS  593
              GMRN   GV+GPW++D   N++ SFAS
Sbjct  679  PSGMRNLAGGVMGPWHMDGSCNIDESFAS  707



>ref|XP_009802144.1| PREDICTED: pumilio homolog 2-like isoform X2 [Nicotiana sylvestris]
Length=947

 Score =   205 bits (522),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 150/200 (75%), Gaps = 16/200 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S+  GN NL PLF NAAAASAMA+P +DSRM  GSNL+SA+ + N+ RM NQM G    
Sbjct  407  MSSHLGNCNLPPLFGNAAAASAMAVPGLDSRMLGGSNLSSATSEHNLSRMGNQMGGPS--  464

Query  186  AQYMDPMYIQYLLQ--FASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYNVPLSS  359
              +MDPMY+QYL     A+ NDPS+DRNY+GNSY DLLQKAY+G+++ PQKSQY V    
Sbjct  465  --FMDPMYLQYLTAEYVAALNDPSLDRNYMGNSYIDLLQKAYLGNVV-PQKSQYGV----  517

Query  360  KNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDY-NMRVGGGMRNF  536
            K+ GSGHHGYYGNP F VGLSYPGS L SPVIP SPVGPGSP+R SDY NMR    MRN 
Sbjct  518  KSSGSGHHGYYGNPAFGVGLSYPGSPLASPVIPGSPVGPGSPMRHSDYNNMR---RMRNI  574

Query  537  -GVGVIGPWNLDNMENSFAS  593
               GVIGP++LD MEN+ AS
Sbjct  575  AAAGVIGPYHLDAMENNLAS  594



>ref|XP_009802143.1| PREDICTED: pumilio homolog 2-like isoform X1 [Nicotiana sylvestris]
Length=971

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 150/200 (75%), Gaps = 16/200 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S+  GN NL PLF NAAAASAMA+P +DSRM  GSNL+SA+ + N+ RM NQM G    
Sbjct  431  MSSHLGNCNLPPLFGNAAAASAMAVPGLDSRMLGGSNLSSATSEHNLSRMGNQMGGPS--  488

Query  186  AQYMDPMYIQYLLQ--FASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYNVPLSS  359
              +MDPMY+QYL     A+ NDPS+DRNY+GNSY DLLQKAY+G+++ PQKSQY V    
Sbjct  489  --FMDPMYLQYLTAEYVAALNDPSLDRNYMGNSYIDLLQKAYLGNVV-PQKSQYGV----  541

Query  360  KNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDY-NMRVGGGMRNF  536
            K+ GSGHHGYYGNP F VGLSYPGS L SPVIP SPVGPGSP+R SDY NMR    MRN 
Sbjct  542  KSSGSGHHGYYGNPAFGVGLSYPGSPLASPVIPGSPVGPGSPMRHSDYNNMR---RMRNI  598

Query  537  -GVGVIGPWNLDNMENSFAS  593
               GVIGP++LD MEN+ AS
Sbjct  599  AAAGVIGPYHLDAMENNLAS  618



>ref|XP_002314164.2| hypothetical protein POPTR_0009s03980g [Populus trichocarpa]
 gb|EEE88119.2| hypothetical protein POPTR_0009s03980g [Populus trichocarpa]
Length=1009

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 153/214 (71%), Gaps = 20/214 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLD-QNIGRMENQM  167
            ++ Q G  NL PLFEN AAASAMA+P MDSR+      +G+NL +ASL+  N+GR+ + M
Sbjct  444  IANQLGTGNLPPLFENVAAASAMAMPGMDSRVLGGGLGSGANLTAASLESHNLGRVGSPM  503

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AGS LQA ++DP+Y+QYL        Q A+ NDPS+DR+YLGNSY + L  QKAY    L
Sbjct  504  AGSALQAPFVDPVYLQYLRTPEYATTQLAAINDPSVDRSYLGNSYLNYLEIQKAY--GFL  561

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            S QKSQY VPL  K+  S HHGY+GNPGF VG+SYPGS L SPVIPNSPVGPGSPIR ++
Sbjct  562  SSQKSQYGVPLGGKSGSSNHHGYFGNPGFGVGMSYPGSPLASPVIPNSPVGPGSPIRHNE  621

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NMR   GM N   G++GPW+LD   N++ SFAS
Sbjct  622  LNMRFSSGMSNLAGGIMGPWHLDAGCNIDESFAS  655



>ref|XP_011032254.1| PREDICTED: pumilio homolog 2-like isoform X2 [Populus euphratica]
Length=1058

 Score =   203 bits (517),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 153/214 (71%), Gaps = 20/214 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLD-QNIGRMENQM  167
            ++ Q G  NL PLFEN AAASAMAIP MDSR+      +G+NL +ASL+  N+GR+ + +
Sbjct  493  IANQLGTGNLPPLFENVAAASAMAIPGMDSRVLGGGLGSGANLTAASLESHNLGRVGSSI  552

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AGS LQA ++DP+Y+QYL        Q A+ NDPS+DR+YLGNSY + L  QKAY    L
Sbjct  553  AGSALQAPFVDPVYLQYLRTPEYATTQLAAINDPSVDRSYLGNSYLNYLEIQKAY--GFL  610

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            S QKSQY VPL  K+  S HHGY+GNPGF VG+SYPGS L SPVIPNSPVGPG+PIR ++
Sbjct  611  SSQKSQYGVPLGGKSGSSNHHGYFGNPGFGVGMSYPGSPLASPVIPNSPVGPGTPIRHNE  670

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NMR   GM N   G++GPW+LD   N++ SFAS
Sbjct  671  LNMRFSSGMSNLAGGIMGPWHLDAGCNIDESFAS  704



>ref|XP_011032252.1| PREDICTED: pumilio homolog 2-like isoform X1 [Populus euphratica]
 ref|XP_011032253.1| PREDICTED: pumilio homolog 2-like isoform X1 [Populus euphratica]
Length=1067

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 153/214 (71%), Gaps = 20/214 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLD-QNIGRMENQM  167
            ++ Q G  NL PLFEN AAASAMAIP MDSR+      +G+NL +ASL+  N+GR+ + +
Sbjct  502  IANQLGTGNLPPLFENVAAASAMAIPGMDSRVLGGGLGSGANLTAASLESHNLGRVGSSI  561

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AGS LQA ++DP+Y+QYL        Q A+ NDPS+DR+YLGNSY + L  QKAY    L
Sbjct  562  AGSALQAPFVDPVYLQYLRTPEYATTQLAAINDPSVDRSYLGNSYLNYLEIQKAY--GFL  619

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            S QKSQY VPL  K+  S HHGY+GNPGF VG+SYPGS L SPVIPNSPVGPG+PIR ++
Sbjct  620  SSQKSQYGVPLGGKSGSSNHHGYFGNPGFGVGMSYPGSPLASPVIPNSPVGPGTPIRHNE  679

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NMR   GM N   G++GPW+LD   N++ SFAS
Sbjct  680  LNMRFSSGMSNLAGGIMGPWHLDAGCNIDESFAS  713



>ref|XP_009597138.1| PREDICTED: pumilio homolog 2-like isoform X2 [Nicotiana tomentosiformis]
Length=947

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 148/200 (74%), Gaps = 16/200 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S+  GNYNL PLF NAAAASAMA+P +DSRM  GSNL++A+ + N+ RM NQM G    
Sbjct  407  MSSHLGNYNLPPLFGNAAAASAMAVPGLDSRMLGGSNLSAATSEHNLSRMGNQMGGPS--  464

Query  186  AQYMDPMYIQYLLQ--FASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYNVPLSS  359
              +MDPMY+QYL     A+ NDPS+DRNY+GNSY DLLQKAY+G+ + PQKSQY V    
Sbjct  465  --FMDPMYLQYLTAEYVAALNDPSVDRNYMGNSYIDLLQKAYLGNAV-PQKSQYGV----  517

Query  360  KNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDY-NMRVGGGMRNF  536
            K+ GSGHHGYYGNP F VGLSYPGS L SPVI  S VGPGSP+R SDY NMR    MRN 
Sbjct  518  KSSGSGHHGYYGNPAFGVGLSYPGSPLASPVITGSSVGPGSPMRHSDYNNMR---RMRNI  574

Query  537  -GVGVIGPWNLDNMENSFAS  593
               GVIGP++LD MENS AS
Sbjct  575  AAAGVIGPYHLDAMENSLAS  594



>ref|XP_009597137.1| PREDICTED: pumilio homolog 2-like isoform X1 [Nicotiana tomentosiformis]
Length=971

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 148/200 (74%), Gaps = 16/200 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S+  GNYNL PLF NAAAASAMA+P +DSRM  GSNL++A+ + N+ RM NQM G    
Sbjct  431  MSSHLGNYNLPPLFGNAAAASAMAVPGLDSRMLGGSNLSAATSEHNLSRMGNQMGGPS--  488

Query  186  AQYMDPMYIQYLLQ--FASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYNVPLSS  359
              +MDPMY+QYL     A+ NDPS+DRNY+GNSY DLLQKAY+G+ + PQKSQY V    
Sbjct  489  --FMDPMYLQYLTAEYVAALNDPSVDRNYMGNSYIDLLQKAYLGNAV-PQKSQYGV----  541

Query  360  KNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDY-NMRVGGGMRNF  536
            K+ GSGHHGYYGNP F VGLSYPGS L SPVI  S VGPGSP+R SDY NMR    MRN 
Sbjct  542  KSSGSGHHGYYGNPAFGVGLSYPGSPLASPVITGSSVGPGSPMRHSDYNNMR---RMRNI  598

Query  537  -GVGVIGPWNLDNMENSFAS  593
               GVIGP++LD MENS AS
Sbjct  599  AAAGVIGPYHLDAMENSLAS  618



>gb|KDO72813.1| hypothetical protein CISIN_1g039493mg [Citrus sinensis]
Length=749

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 150/210 (71%), Gaps = 15/210 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLDQNIGRMENQMA  170
            ++ Q G  NL PL+EN AAASAMA+P MDSR+      +G NL++ S   N+ R  +QM 
Sbjct  497  MAGQLGAGNLPPLYENVAAASAMAVPGMDSRVLGGGFASGQNLSATSESHNLNRAGSQMG  556

Query  171  GSGLQAQYMDPMYIQYL------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            G  LQ  ++DP+Y+QYL       Q A+ NDPS+DRN+LGNSY +LL  QKAY+G +LSP
Sbjct  557  GGALQFPFVDPVYLQYLRSSEYAAQLAALNDPSVDRNFLGNSYMNLLELQKAYLGVLLSP  616

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKSQY  PL SK+ GS HHGY G PGF +G+SYPGS L +PVIPNSPVGPGSPIR +D N
Sbjct  617  QKSQYGGPLGSKSSGSNHHGYCGTPGFGLGMSYPGSPLANPVIPNSPVGPGSPIRHNDPN  676

Query  507  MRVGGGMRNFGVGVIGPWNLD-NMENSFAS  593
            +R   GMRN   GV+GPW+LD +M+ SF S
Sbjct  677  LRF-AGMRNLAGGVMGPWHLDASMDESFGS  705



>ref|XP_006424877.1| hypothetical protein CICLE_v10027726mg [Citrus clementina]
 gb|ESR38117.1| hypothetical protein CICLE_v10027726mg [Citrus clementina]
Length=1003

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 151/210 (72%), Gaps = 15/210 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLDQNIGRMENQMA  170
            ++ Q G  NL PL+EN AAASAMA+P MDSR+      +G NL++AS   N+ R  +QM 
Sbjct  497  MAGQLGAGNLPPLYENVAAASAMAVPGMDSRVLGGGFASGQNLSAASESHNLNRAGSQMG  556

Query  171  GSGLQAQYMDPMYIQYL------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            G  LQ  ++DP+Y+QYL       Q A+ NDPS+DRN+LGNSY +LL  QKAY+G +LSP
Sbjct  557  GGALQFPFVDPVYLQYLRSSEYAAQLAALNDPSVDRNFLGNSYMNLLELQKAYLGVLLSP  616

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKSQY  PL SK+ GS HHGY G PGF +G+SYPGS L +PVIPNSPVGPGSPIR +D N
Sbjct  617  QKSQYGGPLGSKSSGSNHHGYCGTPGFGLGMSYPGSPLANPVIPNSPVGPGSPIRHNDPN  676

Query  507  MRVGGGMRNFGVGVIGPWNLD-NMENSFAS  593
            +R   GMRN   GV+GPW+LD +M+ SF S
Sbjct  677  LRF-AGMRNLAGGVMGPWHLDASMDESFGS  705



>ref|XP_006424876.1| hypothetical protein CICLE_v10027726mg [Citrus clementina]
 ref|XP_006488369.1| PREDICTED: pumilio homolog 2-like [Citrus sinensis]
 gb|ESR38116.1| hypothetical protein CICLE_v10027726mg [Citrus clementina]
Length=1058

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 151/210 (72%), Gaps = 15/210 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLDQNIGRMENQMA  170
            ++ Q G  NL PL+EN AAASAMA+P MDSR+      +G NL++AS   N+ R  +QM 
Sbjct  497  MAGQLGAGNLPPLYENVAAASAMAVPGMDSRVLGGGFASGQNLSAASESHNLNRAGSQMG  556

Query  171  GSGLQAQYMDPMYIQYL------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            G  LQ  ++DP+Y+QYL       Q A+ NDPS+DRN+LGNSY +LL  QKAY+G +LSP
Sbjct  557  GGALQFPFVDPVYLQYLRSSEYAAQLAALNDPSVDRNFLGNSYMNLLELQKAYLGVLLSP  616

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKSQY  PL SK+ GS HHGY G PGF +G+SYPGS L +PVIPNSPVGPGSPIR +D N
Sbjct  617  QKSQYGGPLGSKSSGSNHHGYCGTPGFGLGMSYPGSPLANPVIPNSPVGPGSPIRHNDPN  676

Query  507  MRVGGGMRNFGVGVIGPWNLD-NMENSFAS  593
            +R   GMRN   GV+GPW+LD +M+ SF S
Sbjct  677  LRF-AGMRNLAGGVMGPWHLDASMDESFGS  705



>ref|XP_009616462.1| PREDICTED: pumilio homolog 2-like isoform X3 [Nicotiana tomentosiformis]
Length=794

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 149/203 (73%), Gaps = 23/203 (11%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S+  GNYNL PLF NAAAASAMA+P +DSR+    NL++A+ + N+ RM NQM G    
Sbjct  255  MSSHLGNYNLPPLFGNAAAASAMAVPGLDSRI---PNLSAATSEHNLSRMGNQMGGPS--  309

Query  186  AQYMDPMYIQYLL-----QFASHNDPSMDRNYLG-NSYTDLLQKAYVGSMLSPQKSQYNV  347
              ++DPMY+QYL      Q A+ NDPS+DR+Y+G NSY DLLQKAY+G+ + PQKSQY  
Sbjct  310  --FVDPMYLQYLTAEYVAQVAALNDPSLDRSYMGGNSYVDLLQKAYLGNNVLPQKSQY--  365

Query  348  PLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDY-NMRVGGG  524
                K+ GSGHHGYYGNP F VGLSYPGS L SPV+P SPVGPGSP+R SDY NMR    
Sbjct  366  ----KSSGSGHHGYYGNPAFGVGLSYPGSPLASPVVPGSPVGPGSPMRHSDYNNMR---R  418

Query  525  MRNFGVGVIGPWNLDNMENSFAS  593
            MRN   GVIGP++LDNMENS AS
Sbjct  419  MRNIAAGVIGPYHLDNMENSLAS  441



>ref|XP_009779664.1| PREDICTED: pumilio homolog 2-like isoform X2 [Nicotiana sylvestris]
Length=951

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 149/203 (73%), Gaps = 23/203 (11%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S+  GNYNL PLF NAAAASAMA+P +DSR+    NL++A+ + N+ RM NQM G    
Sbjct  412  MSSHLGNYNLPPLFGNAAAASAMAVPGLDSRI---PNLSAATAEHNLSRMGNQMGGPS--  466

Query  186  AQYMDPMYIQYLL-----QFASHNDPSMDRNYLG-NSYTDLLQKAYVGSMLSPQKSQYNV  347
              ++DPMY+QYL      Q A+ NDPS+DR+Y+G NSY DLLQKAY+G+ + PQKSQY  
Sbjct  467  --FVDPMYLQYLTAEYVAQVAALNDPSLDRSYMGGNSYVDLLQKAYLGNNVLPQKSQY--  522

Query  348  PLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDY-NMRVGGG  524
                K+ GSGHHGYYGNP F VGLSYPGS L SPVIP SPVGPGSP+R SDY NMR    
Sbjct  523  ----KSSGSGHHGYYGNPAFGVGLSYPGSPLASPVIPGSPVGPGSPMRHSDYNNMR---R  575

Query  525  MRNFGVGVIGPWNLDNMENSFAS  593
            MRN   GVIGP++LDNMENS AS
Sbjct  576  MRNIAAGVIGPYHLDNMENSLAS  598



>ref|XP_009779662.1| PREDICTED: pumilio homolog 2-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009779663.1| PREDICTED: pumilio homolog 2-like isoform X1 [Nicotiana sylvestris]
Length=975

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 149/203 (73%), Gaps = 23/203 (11%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S+  GNYNL PLF NAAAASAMA+P +DSR+    NL++A+ + N+ RM NQM G    
Sbjct  436  MSSHLGNYNLPPLFGNAAAASAMAVPGLDSRI---PNLSAATAEHNLSRMGNQMGGPS--  490

Query  186  AQYMDPMYIQYLL-----QFASHNDPSMDRNYLG-NSYTDLLQKAYVGSMLSPQKSQYNV  347
              ++DPMY+QYL      Q A+ NDPS+DR+Y+G NSY DLLQKAY+G+ + PQKSQY  
Sbjct  491  --FVDPMYLQYLTAEYVAQVAALNDPSLDRSYMGGNSYVDLLQKAYLGNNVLPQKSQY--  546

Query  348  PLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDY-NMRVGGG  524
                K+ GSGHHGYYGNP F VGLSYPGS L SPVIP SPVGPGSP+R SDY NMR    
Sbjct  547  ----KSSGSGHHGYYGNPAFGVGLSYPGSPLASPVIPGSPVGPGSPMRHSDYNNMR---R  599

Query  525  MRNFGVGVIGPWNLDNMENSFAS  593
            MRN   GVIGP++LDNMENS AS
Sbjct  600  MRNIAAGVIGPYHLDNMENSLAS  622



>gb|KJB20011.1| hypothetical protein B456_003G129200 [Gossypium raimondii]
Length=1060

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 152/215 (71%), Gaps = 19/215 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNL-NSASLDQNIGRMENQM  167
            +++Q G  N+ PLF N  A+SA+ +  MDSR+      +G N+ N+AS   N+GR+ +Q+
Sbjct  493  MASQLGTSNMPPLFGNVTASSAVPVLGMDSRVLGGGLGSGQNISNAASESYNLGRVGSQI  552

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG+ LQA ++DPMY+QYL        Q A+ +DPSMDRN+LGNSY +LL  QKAY+G++L
Sbjct  553  AGNALQAPFVDPMYLQYLRTSDYTAAQLAALSDPSMDRNFLGNSYMNLLELQKAYLGALL  612

Query  321  SPQKSQYN-VPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCS  497
            SPQKSQY  VPL +K+  S  HG+YG+P F  G+SYPGS L SP+IPNSPVGPGSPIR +
Sbjct  613  SPQKSQYGGVPLGAKSGSSNLHGFYGSPTFGTGMSYPGSPLASPLIPNSPVGPGSPIRHT  672

Query  498  DYNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            D NM    GMRN    V+GPW+LD   NM+ SFAS
Sbjct  673  DLNMHFPSGMRNLAGAVMGPWHLDAGYNMDESFAS  707



>gb|KHG15533.1| Pumilio -like protein [Gossypium arboreum]
Length=1042

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 149/214 (70%), Gaps = 18/214 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFT------GSNLNSASLDQNIGRMENQM  167
            +++Q G  NL PLFE+ AA+SA+A+P MDSR+         SN N+AS     GR  +Q+
Sbjct  476  MASQPGTGNLPPLFESVAASSAIAVPGMDSRVLGRGLGSGQSNSNAASELHTFGRGGSQI  535

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG+ LQA  +DPMY+QYL        Q A+ NDPSMDRN+LGNSY +LL  QKAY+G++L
Sbjct  536  AGNALQASLIDPMYLQYLRTSDYTAAQLAALNDPSMDRNFLGNSYMNLLELQKAYLGTLL  595

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            SPQKS Y VPL +K+  S  HG+YG+P F  G+SYPGS L SPVIPNSPVGPGSP+R SD
Sbjct  596  SPQKSPYGVPLGAKSGSSNIHGFYGSPTFGAGMSYPGSPLASPVIPNSPVGPGSPMRHSD  655

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NM    GMRN   GV+GPW+ D   NM+ SFAS
Sbjct  656  LNMCFPSGMRNLAGGVMGPWHFDAGCNMDESFAS  689



>gb|KJB20009.1| hypothetical protein B456_003G129200 [Gossypium raimondii]
 gb|KJB20010.1| hypothetical protein B456_003G129200 [Gossypium raimondii]
 gb|KJB20012.1| hypothetical protein B456_003G129200 [Gossypium raimondii]
Length=1003

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 152/215 (71%), Gaps = 19/215 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNL-NSASLDQNIGRMENQM  167
            +++Q G  N+ PLF N  A+SA+ +  MDSR+      +G N+ N+AS   N+GR+ +Q+
Sbjct  493  MASQLGTSNMPPLFGNVTASSAVPVLGMDSRVLGGGLGSGQNISNAASESYNLGRVGSQI  552

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG+ LQA ++DPMY+QYL        Q A+ +DPSMDRN+LGNSY +LL  QKAY+G++L
Sbjct  553  AGNALQAPFVDPMYLQYLRTSDYTAAQLAALSDPSMDRNFLGNSYMNLLELQKAYLGALL  612

Query  321  SPQKSQYN-VPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCS  497
            SPQKSQY  VPL +K+  S  HG+YG+P F  G+SYPGS L SP+IPNSPVGPGSPIR +
Sbjct  613  SPQKSQYGGVPLGAKSGSSNLHGFYGSPTFGTGMSYPGSPLASPLIPNSPVGPGSPIRHT  672

Query  498  DYNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            D NM    GMRN    V+GPW+LD   NM+ SFAS
Sbjct  673  DLNMHFPSGMRNLAGAVMGPWHLDAGYNMDESFAS  707



>ref|XP_004294652.1| PREDICTED: pumilio homolog 2 [Fragaria vesca subsp. vesca]
Length=1077

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 156/218 (72%), Gaps = 24/218 (11%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLD-QNIGRMENQM  167
            +++Q G  NL PLFEN AAASAM  P MDSR+      +G NL +A+ D  N+GR+ + +
Sbjct  506  VASQLGTGNLPPLFENVAAASAMIPPGMDSRVLGGGLASGPNLAAAASDSHNLGRLGSPI  565

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG+GLQA Y+DPMY+QYL        Q A+ NDPS+DRNYLGNSY ++L  QKAY+G++L
Sbjct  566  AGNGLQAPYVDPMYLQYLRTSEYAAAQLAALNDPSVDRNYLGNSYMNILELQKAYLGALL  625

Query  321  SPQKSQYNV--PLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRC  494
            SPQKSQY V  PL  K+ GS HHGYYGN  F  G+SYPGS + SPVIPNSPVGPGSP+R 
Sbjct  626  SPQKSQYGVGAPLGGKSGGSNHHGYYGNHAF--GMSYPGSPMASPVIPNSPVGPGSPMRH  683

Query  495  SDYNMRVGGGMRNFGVG--VIGPWNLD---NMENSFAS  593
            +D NM    GMRN  +G  V+GPW+LD   N++ SFAS
Sbjct  684  NDLNMCYPSGMRNLNLGGSVMGPWHLDAGCNLDESFAS  721



>gb|KJB08901.1| hypothetical protein B456_001G112000 [Gossypium raimondii]
Length=1033

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 150/214 (70%), Gaps = 18/214 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFT------GSNLNSASLDQNIGRMENQM  167
            +++Q G  NL PLFE+ AA+SA+A+P MDSR+         SN N+AS     GR+ +Q+
Sbjct  467  MASQPGTGNLPPLFESVAASSAIAVPGMDSRVLGRGLGSGQSNSNAASELHTFGRVGSQI  526

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG+ LQA  +DPMY+QYL        Q ++ NDPSMDRN+LGNSY +LL  QKAY+G++L
Sbjct  527  AGNALQASLIDPMYLQYLRTSDYTAAQLSALNDPSMDRNFLGNSYMNLLELQKAYLGTLL  586

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            SPQKS Y VPL +K+  S  HG+YG+P F  G+SYPGS L +PVIPNSPVGPGSP+R SD
Sbjct  587  SPQKSPYGVPLGAKSGSSNIHGFYGSPTFGAGMSYPGSPLANPVIPNSPVGPGSPMRHSD  646

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NM    GMRN   GV+GPW+ D   NM+ SFAS
Sbjct  647  LNMCFPSGMRNLAGGVMGPWHFDAGCNMDESFAS  680



>ref|XP_009616461.1| PREDICTED: pumilio homolog 2-like isoform X2 [Nicotiana tomentosiformis]
Length=951

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 149/203 (73%), Gaps = 23/203 (11%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S+  GNYNL PLF NAAAASAMA+P +DSR+    NL++A+ + N+ RM NQM G    
Sbjct  412  MSSHLGNYNLPPLFGNAAAASAMAVPGLDSRI---PNLSAATSEHNLSRMGNQMGGPS--  466

Query  186  AQYMDPMYIQYLL-----QFASHNDPSMDRNYLG-NSYTDLLQKAYVGSMLSPQKSQYNV  347
              ++DPMY+QYL      Q A+ NDPS+DR+Y+G NSY DLLQKAY+G+ + PQKSQY  
Sbjct  467  --FVDPMYLQYLTAEYVAQVAALNDPSLDRSYMGGNSYVDLLQKAYLGNNVLPQKSQY--  522

Query  348  PLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDY-NMRVGGG  524
                K+ GSGHHGYYGNP F VGLSYPGS L SPV+P SPVGPGSP+R SDY NMR    
Sbjct  523  ----KSSGSGHHGYYGNPAFGVGLSYPGSPLASPVVPGSPVGPGSPMRHSDYNNMR---R  575

Query  525  MRNFGVGVIGPWNLDNMENSFAS  593
            MRN   GVIGP++LDNMENS AS
Sbjct  576  MRNIAAGVIGPYHLDNMENSLAS  598



>gb|KJB08905.1| hypothetical protein B456_001G112000 [Gossypium raimondii]
Length=986

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 150/214 (70%), Gaps = 18/214 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFT------GSNLNSASLDQNIGRMENQM  167
            +++Q G  NL PLFE+ AA+SA+A+P MDSR+         SN N+AS     GR+ +Q+
Sbjct  476  MASQPGTGNLPPLFESVAASSAIAVPGMDSRVLGRGLGSGQSNSNAASELHTFGRVGSQI  535

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG+ LQA  +DPMY+QYL        Q ++ NDPSMDRN+LGNSY +LL  QKAY+G++L
Sbjct  536  AGNALQASLIDPMYLQYLRTSDYTAAQLSALNDPSMDRNFLGNSYMNLLELQKAYLGTLL  595

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            SPQKS Y VPL +K+  S  HG+YG+P F  G+SYPGS L +PVIPNSPVGPGSP+R SD
Sbjct  596  SPQKSPYGVPLGAKSGSSNIHGFYGSPTFGAGMSYPGSPLANPVIPNSPVGPGSPMRHSD  655

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NM    GMRN   GV+GPW+ D   NM+ SFAS
Sbjct  656  LNMCFPSGMRNLAGGVMGPWHFDAGCNMDESFAS  689



>ref|XP_009616459.1| PREDICTED: pumilio homolog 2-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009616460.1| PREDICTED: pumilio homolog 2-like isoform X1 [Nicotiana tomentosiformis]
Length=975

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 149/203 (73%), Gaps = 23/203 (11%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S+  GNYNL PLF NAAAASAMA+P +DSR+    NL++A+ + N+ RM NQM G    
Sbjct  436  MSSHLGNYNLPPLFGNAAAASAMAVPGLDSRI---PNLSAATSEHNLSRMGNQMGGPS--  490

Query  186  AQYMDPMYIQYLL-----QFASHNDPSMDRNYLG-NSYTDLLQKAYVGSMLSPQKSQYNV  347
              ++DPMY+QYL      Q A+ NDPS+DR+Y+G NSY DLLQKAY+G+ + PQKSQY  
Sbjct  491  --FVDPMYLQYLTAEYVAQVAALNDPSLDRSYMGGNSYVDLLQKAYLGNNVLPQKSQY--  546

Query  348  PLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDY-NMRVGGG  524
                K+ GSGHHGYYGNP F VGLSYPGS L SPV+P SPVGPGSP+R SDY NMR    
Sbjct  547  ----KSSGSGHHGYYGNPAFGVGLSYPGSPLASPVVPGSPVGPGSPMRHSDYNNMR---R  599

Query  525  MRNFGVGVIGPWNLDNMENSFAS  593
            MRN   GVIGP++LDNMENS AS
Sbjct  600  MRNIAAGVIGPYHLDNMENSLAS  622



>gb|KJB08904.1| hypothetical protein B456_001G112000 [Gossypium raimondii]
Length=1035

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 150/214 (70%), Gaps = 18/214 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFT------GSNLNSASLDQNIGRMENQM  167
            +++Q G  NL PLFE+ AA+SA+A+P MDSR+         SN N+AS     GR+ +Q+
Sbjct  476  MASQPGTGNLPPLFESVAASSAIAVPGMDSRVLGRGLGSGQSNSNAASELHTFGRVGSQI  535

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG+ LQA  +DPMY+QYL        Q ++ NDPSMDRN+LGNSY +LL  QKAY+G++L
Sbjct  536  AGNALQASLIDPMYLQYLRTSDYTAAQLSALNDPSMDRNFLGNSYMNLLELQKAYLGTLL  595

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            SPQKS Y VPL +K+  S  HG+YG+P F  G+SYPGS L +PVIPNSPVGPGSP+R SD
Sbjct  596  SPQKSPYGVPLGAKSGSSNIHGFYGSPTFGAGMSYPGSPLANPVIPNSPVGPGSPMRHSD  655

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NM    GMRN   GV+GPW+ D   NM+ SFAS
Sbjct  656  LNMCFPSGMRNLAGGVMGPWHFDAGCNMDESFAS  689



>gb|KHG26002.1| Pumilio -like protein [Gossypium arboreum]
Length=1067

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 153/212 (72%), Gaps = 18/212 (8%)
 Frame = +3

Query  12   TQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNL-NSASLDQNIGRMENQMAG  173
            +Q G+ NL PLFEN AAASAMA+P MDSR+      +G N+ N+AS   N+GR+ +Q+AG
Sbjct  502  SQLGSGNLPPLFENVAAASAMAVPGMDSRVLGGAFGSGQNISNAASESHNLGRVGSQIAG  561

Query  174  SGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            + L A ++DP+Y+QYL        Q A+ NDP++DRN+LGNSY +LL  QKAY+G++LSP
Sbjct  562  NALNAPFIDPLYLQYLRTSDYAAAQQAALNDPTVDRNFLGNSYMNLLELQKAYLGALLSP  621

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKSQY VP+ +K+  S  HG+YGN  F  G+SYPGS L + V+PNSPVGPGSPIR +D N
Sbjct  622  QKSQYGVPMGAKSTSSNLHGFYGNTTFGAGMSYPGSPLANAVLPNSPVGPGSPIRHTDLN  681

Query  507  MRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            MR   GMRN    VIGPW+LD   N++ SF+S
Sbjct  682  MRFPSGMRNLAGSVIGPWHLDSGCNIDESFSS  713



>gb|KJB08902.1| hypothetical protein B456_001G112000 [Gossypium raimondii]
 gb|KJB08903.1| hypothetical protein B456_001G112000 [Gossypium raimondii]
Length=1042

 Score =   198 bits (504),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 150/214 (70%), Gaps = 18/214 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFT------GSNLNSASLDQNIGRMENQM  167
            +++Q G  NL PLFE+ AA+SA+A+P MDSR+         SN N+AS     GR+ +Q+
Sbjct  476  MASQPGTGNLPPLFESVAASSAIAVPGMDSRVLGRGLGSGQSNSNAASELHTFGRVGSQI  535

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG+ LQA  +DPMY+QYL        Q ++ NDPSMDRN+LGNSY +LL  QKAY+G++L
Sbjct  536  AGNALQASLIDPMYLQYLRTSDYTAAQLSALNDPSMDRNFLGNSYMNLLELQKAYLGTLL  595

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            SPQKS Y VPL +K+  S  HG+YG+P F  G+SYPGS L +PVIPNSPVGPGSP+R SD
Sbjct  596  SPQKSPYGVPLGAKSGSSNIHGFYGSPTFGAGMSYPGSPLANPVIPNSPVGPGSPMRHSD  655

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NM    GMRN   GV+GPW+ D   NM+ SFAS
Sbjct  656  LNMCFPSGMRNLAGGVMGPWHFDAGCNMDESFAS  689



>gb|KHG11376.1| Pumilio -like protein [Gossypium arboreum]
Length=1060

 Score =   198 bits (504),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 152/215 (71%), Gaps = 19/215 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNL-NSASLDQNIGRMENQM  167
            +++Q G  N+ PLF N  A+SA+ I  MDSR+      +G N+ N+AS   N+GR+ +Q+
Sbjct  493  MASQFGTSNMPPLFGNVTASSAVPILGMDSRVLGGGLGSGQNISNAASELHNLGRVGSQI  552

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG+ LQA ++DPMY+QYL        Q A+ +DPSMDRN+LGNSY +LL  QKAY+G++L
Sbjct  553  AGNALQAPFVDPMYLQYLRTSDYTAAQLAALSDPSMDRNFLGNSYMNLLELQKAYLGALL  612

Query  321  SPQKSQYN-VPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCS  497
            SPQKSQY  VPL +K+  S  HG+YG+P F  G+SYPGS L SP+IPNSPVGPGSPIR +
Sbjct  613  SPQKSQYGGVPLGAKSGSSNLHGFYGSPTFGTGMSYPGSPLASPLIPNSPVGPGSPIRHT  672

Query  498  DYNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            D N+    GMRN    V+GPW+LD   NM+ SFAS
Sbjct  673  DLNLHFPSGMRNLAGAVMGPWHLDAGYNMDESFAS  707



>gb|KJB21632.1| hypothetical protein B456_004G005400 [Gossypium raimondii]
Length=997

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 153/212 (72%), Gaps = 19/212 (9%)
 Frame = +3

Query  12   TQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNL-NSASLDQNIGRMENQMAG  173
            +Q G+ NL PLFEN AAASAMA+P MDSR+      +G N+ N+AS   N+GR+ +Q+AG
Sbjct  498  SQLGSGNLPPLFENVAAASAMAVPGMDSRLLGGAFGSGQNISNAASESHNLGRVGSQIAG  557

Query  174  SGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            + L A ++DP+Y+QYL        Q A+ NDP+MDRN+LGNSY +LL  QKAY+G++LSP
Sbjct  558  NALNAPFIDPLYLQYLRTSDYAAAQQAALNDPTMDRNFLGNSYMNLLELQKAYLGALLSP  617

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKSQY VPL +K+  S  HG+YGN  F  G++YPGS L + V+PNSPVGPGSPIR +D N
Sbjct  618  QKSQY-VPLGAKSSSSNLHGFYGNTTFGAGMAYPGSPLANAVLPNSPVGPGSPIRHTDLN  676

Query  507  MRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            MR   GMRN    V+GPW+LD   N++ SF+S
Sbjct  677  MRFPSGMRNLAGSVMGPWHLDSGCNIDESFSS  708



>gb|KJB21631.1| hypothetical protein B456_004G005400 [Gossypium raimondii]
Length=1061

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 153/212 (72%), Gaps = 19/212 (9%)
 Frame = +3

Query  12   TQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNL-NSASLDQNIGRMENQMAG  173
            +Q G+ NL PLFEN AAASAMA+P MDSR+      +G N+ N+AS   N+GR+ +Q+AG
Sbjct  498  SQLGSGNLPPLFENVAAASAMAVPGMDSRLLGGAFGSGQNISNAASESHNLGRVGSQIAG  557

Query  174  SGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            + L A ++DP+Y+QYL        Q A+ NDP+MDRN+LGNSY +LL  QKAY+G++LSP
Sbjct  558  NALNAPFIDPLYLQYLRTSDYAAAQQAALNDPTMDRNFLGNSYMNLLELQKAYLGALLSP  617

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKSQY VPL +K+  S  HG+YGN  F  G++YPGS L + V+PNSPVGPGSPIR +D N
Sbjct  618  QKSQY-VPLGAKSSSSNLHGFYGNTTFGAGMAYPGSPLANAVLPNSPVGPGSPIRHTDLN  676

Query  507  MRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            MR   GMRN    V+GPW+LD   N++ SF+S
Sbjct  677  MRFPSGMRNLAGSVMGPWHLDSGCNIDESFSS  708



>gb|KJB21630.1| hypothetical protein B456_004G005400 [Gossypium raimondii]
 gb|KJB21634.1| hypothetical protein B456_004G005400 [Gossypium raimondii]
Length=1062

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 153/212 (72%), Gaps = 19/212 (9%)
 Frame = +3

Query  12   TQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNL-NSASLDQNIGRMENQMAG  173
            +Q G+ NL PLFEN AAASAMA+P MDSR+      +G N+ N+AS   N+GR+ +Q+AG
Sbjct  498  SQLGSGNLPPLFENVAAASAMAVPGMDSRLLGGAFGSGQNISNAASESHNLGRVGSQIAG  557

Query  174  SGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            + L A ++DP+Y+QYL        Q A+ NDP+MDRN+LGNSY +LL  QKAY+G++LSP
Sbjct  558  NALNAPFIDPLYLQYLRTSDYAAAQQAALNDPTMDRNFLGNSYMNLLELQKAYLGALLSP  617

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKSQY VPL +K+  S  HG+YGN  F  G++YPGS L + V+PNSPVGPGSPIR +D N
Sbjct  618  QKSQY-VPLGAKSSSSNLHGFYGNTTFGAGMAYPGSPLANAVLPNSPVGPGSPIRHTDLN  676

Query  507  MRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            MR   GMRN    V+GPW+LD   N++ SF+S
Sbjct  677  MRFPSGMRNLAGSVMGPWHLDSGCNIDESFSS  708



>gb|KJB21633.1| hypothetical protein B456_004G005400 [Gossypium raimondii]
Length=1075

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 153/212 (72%), Gaps = 19/212 (9%)
 Frame = +3

Query  12   TQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNL-NSASLDQNIGRMENQMAG  173
            +Q G+ NL PLFEN AAASAMA+P MDSR+      +G N+ N+AS   N+GR+ +Q+AG
Sbjct  498  SQLGSGNLPPLFENVAAASAMAVPGMDSRLLGGAFGSGQNISNAASESHNLGRVGSQIAG  557

Query  174  SGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            + L A ++DP+Y+QYL        Q A+ NDP+MDRN+LGNSY +LL  QKAY+G++LSP
Sbjct  558  NALNAPFIDPLYLQYLRTSDYAAAQQAALNDPTMDRNFLGNSYMNLLELQKAYLGALLSP  617

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKSQY VPL +K+  S  HG+YGN  F  G++YPGS L + V+PNSPVGPGSPIR +D N
Sbjct  618  QKSQY-VPLGAKSSSSNLHGFYGNTTFGAGMAYPGSPLANAVLPNSPVGPGSPIRHTDLN  676

Query  507  MRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            MR   GMRN    V+GPW+LD   N++ SF+S
Sbjct  677  MRFPSGMRNLAGSVMGPWHLDSGCNIDESFSS  708



>ref|XP_007132044.1| hypothetical protein PHAVU_011G062200g [Phaseolus vulgaris]
 gb|ESW04038.1| hypothetical protein PHAVU_011G062200g [Phaseolus vulgaris]
Length=1050

 Score =   193 bits (490),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 145/209 (69%), Gaps = 14/209 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTG---SNLNSASLDQNIGRMENQMAGS  176
            ++ Q G  NL PLFEN AAASA+A P MDSR+  G   S   + S   N+GRM NQ+ GS
Sbjct  490  MTNQLGTGNLPPLFENVAAASAIAAPGMDSRILGGGLASRAAAPSDVHNLGRMGNQIPGS  549

Query  177  GLQAQYMDPMYIQYL------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQK  332
             LQA ++DPMY+QYL       Q  + +DPS+DRNYLGNSY  LL  QKAY+GSMLSPQK
Sbjct  550  ALQAPFVDPMYLQYLRTSEYAAQLGALSDPSVDRNYLGNSYMSLLELQKAYLGSMLSPQK  609

Query  333  SQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            SQYNVPL  K+  S  H YYGNP + VGLSYPGS + + V+  +PVG GSP+R ++ NMR
Sbjct  610  SQYNVPLGGKSGSSTPHNYYGNPAYGVGLSYPGSPMANSVVSTTPVGSGSPVRHNELNMR  669

Query  513  VGGGMRNFGVGVIGPWNLD--NMENSFAS  593
               GMRN   GV+GPW++D  N++ SFAS
Sbjct  670  FASGMRNLA-GVMGPWHVDTGNIDESFAS  697



>ref|XP_010106527.1| Pumilio-2-like protein [Morus notabilis]
 gb|EXC10703.1| Pumilio-2-like protein [Morus notabilis]
Length=1062

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 143/208 (69%), Gaps = 16/208 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            ++ Q G  N+ P F+  AAAS +  PAMDSR+  G   +  S   N+GR+ +QMAG GLQ
Sbjct  506  MAGQIGTGNVSPFFDGVAAASGVPSPAMDSRVLGGGLASGQSESHNLGRIGSQMAGGGLQ  565

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
              +MDPMY+QYL        Q A+ NDPS DR+YLGNSY +LL  QKAY+ ++LSPQKSQ
Sbjct  566  TPFMDPMYLQYLRSSEYAAAQLAALNDPSADRSYLGNSYMNLLELQKAYL-ALLSPQKSQ  624

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y   +  K+ GS HHGYYGNP F VG+SYPGS + SPVIPNSPVGPGSP+R S+ N+R  
Sbjct  625  Y---VGGKSGGSNHHGYYGNPAFGVGISYPGSPMASPVIPNSPVGPGSPLRHSELNLRFP  681

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             GMR+   GV+G W+LD   NM+  FAS
Sbjct  682  SGMRSLAGGVMGAWHLDGGCNMDEGFAS  709



>ref|XP_006590976.1| PREDICTED: pumilio homolog 2-like isoform X3 [Glycine max]
Length=833

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 145/210 (69%), Gaps = 15/210 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAGS  176
            ++ Q G  NL PLFEN AAASAMA P MD R+  G   + A   S   N+GRM NQ+ GS
Sbjct  271  MTNQLGTGNLPPLFENVAAASAMASPGMDLRILGGGLASGAAAPSDVHNLGRMGNQIPGS  330

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +LL  QKAY+GS+LSPQ
Sbjct  331  ALQAPFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSILSPQ  390

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYNVPL  K+  S  HGYYGNP + VG+SYPGS + + V+  SPVG  SP+R ++ NM
Sbjct  391  KSQYNVPLGGKSGSSTPHGYYGNPAYGVGMSYPGSPMANSVVSTSPVGSASPVRHNELNM  450

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
            R   GMRN   GV+GPW+ D  N++ SFAS
Sbjct  451  RFASGMRNLA-GVMGPWHADTGNIDESFAS  479



>ref|XP_006590979.1| PREDICTED: pumilio homolog 2-like isoform X2 [Glycine max]
Length=1031

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 147/210 (70%), Gaps = 15/210 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAGS  176
            ++ Q G  NL PLFEN AAASAMA P M SR+  G   + A   S   NIGRM NQ+ GS
Sbjct  469  MTNQLGTGNLPPLFENVAAASAMASPGMRSRILGGGLASGAAAPSDVHNIGRMGNQIPGS  528

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +LL  QKAY+GS+LSPQ
Sbjct  529  ALQAPFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSILSPQ  588

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYNVPL  K+  S  HGYYGNP + VG+SYPG+ + + V+  SPVG GSP+R ++ NM
Sbjct  589  KSQYNVPLGGKSGSSTPHGYYGNPAYGVGMSYPGTPIANSVVSTSPVGSGSPVRHNELNM  648

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
            R   G+RN   GV+GPW++D  N++ SFAS
Sbjct  649  RFASGLRNLA-GVMGPWHVDTGNIDESFAS  677



>gb|KHN21930.1| Pumilio like 2 [Glycine soja]
Length=1040

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 147/210 (70%), Gaps = 15/210 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAGS  176
            ++ Q G  NL PLFEN AAASAMA P MDSR+  G   + A   S   N+GRM NQ+ GS
Sbjct  478  MTNQLGTGNLPPLFENVAAASAMAAPGMDSRILGGGLASGAAAPSDVHNLGRMGNQIPGS  537

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +LL  QKAY+GS+LSPQ
Sbjct  538  ALQAPFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSILSPQ  597

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYNVPL  K+  S  HGYYGNP + VGLSYPG+ + + V+  SPVG GSPIR ++ NM
Sbjct  598  KSQYNVPLGGKSGSSTPHGYYGNPAYGVGLSYPGTAMANSVVSTSPVGSGSPIRHNELNM  657

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
            +   GMRN   G +GPW++D  N++ SFAS
Sbjct  658  QFASGMRNLA-GAMGPWHVDTGNIDESFAS  686



>ref|XP_002299859.2| pumilio/Puf RNA-binding domain-containing family protein [Populus 
trichocarpa]
 gb|EEE84664.2| pumilio/Puf RNA-binding domain-containing family protein [Populus 
trichocarpa]
Length=1065

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 148/213 (69%), Gaps = 20/213 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLDQ-NIGRMENQM  167
            ++ Q G  NL PLFEN AAASAMAIP MDSR+      +G+NL +ASL+  N+GR  + +
Sbjct  501  IAQQLGTGNLPPLFENVAAASAMAIPGMDSRVLGSGLGSGTNLTAASLESYNLGRGGSPI  560

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AGS LQA ++DPMY+QYL        Q ++ NDPS+DRNYLGNSY + L  QKAY   +L
Sbjct  561  AGSALQAPFVDPMYLQYLRTPDYAATQLSAINDPSLDRNYLGNSYLNFLEIQKAY--GLL  618

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            S QKSQY VPL  K+  S HHGY+GNP F VG+ YPGS L SPVIPNSPVGP SP+R ++
Sbjct  619  SSQKSQYGVPLGGKSGSSTHHGYFGNPAFGVGMPYPGSPLASPVIPNSPVGPASPLRHNE  678

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFA  590
             NMR   GMRN   G++G W LD   NM+ ++A
Sbjct  679  LNMRFPSGMRNLAGGIMGHWPLDAGCNMDENYA  711



>ref|XP_003537978.1| PREDICTED: pumilio homolog 2-like isoform X1 [Glycine max]
Length=1047

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 147/210 (70%), Gaps = 15/210 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAGS  176
            ++ Q G  NL PLFEN AAASAMA P M SR+  G   + A   S   NIGRM NQ+ GS
Sbjct  485  MTNQLGTGNLPPLFENVAAASAMASPGMRSRILGGGLASGAAAPSDVHNIGRMGNQIPGS  544

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +LL  QKAY+GS+LSPQ
Sbjct  545  ALQAPFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSILSPQ  604

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYNVPL  K+  S  HGYYGNP + VG+SYPG+ + + V+  SPVG GSP+R ++ NM
Sbjct  605  KSQYNVPLGGKSGSSTPHGYYGNPAYGVGMSYPGTPIANSVVSTSPVGSGSPVRHNELNM  664

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
            R   G+RN   GV+GPW++D  N++ SFAS
Sbjct  665  RFASGLRNLA-GVMGPWHVDTGNIDESFAS  693



>gb|KEH39457.1| pumilio Mpt5 protein, putative [Medicago truncatula]
Length=917

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 145/210 (69%), Gaps = 16/210 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTG---SNLNSASLDQNIGRMENQMAGS  176
            ++ Q G  N+ PLFEN AAASAM  P MDSR+  G   S + S S    + RM NQ+AG 
Sbjct  487  MANQLGTGNMPPLFENVAAASAMVSPGMDSRILGGGLPSGVASPSDVHVLSRMGNQIAGG  546

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQ+ Y+DPMY+QY+        Q A+ NDPS+DRNYLGNSY +LL  QKAY+GS+LSPQ
Sbjct  547  ALQSPYVDPMYLQYMRTPEYAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSLLSPQ  606

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYNVPL  K+ GS HHGYYGNP + VGLSYPGS + +  +  SPVG GSPIR +D NM
Sbjct  607  KSQYNVPLGGKSGGSNHHGYYGNPTYGVGLSYPGSPMANS-LSTSPVGSGSPIRHNDLNM  665

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
                GMRN   GV+ PW+LD  N++ +FAS
Sbjct  666  HFASGMRNV-AGVMAPWHLDAVNVDENFAS  694



>ref|XP_003597396.1| Pumilio-like protein [Medicago truncatula]
 gb|ABD33134.1| Nucleic acid binding NABP [Medicago truncatula]
 gb|AES67647.1| pumilio Mpt5 protein, putative [Medicago truncatula]
Length=1047

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 145/210 (69%), Gaps = 16/210 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTG---SNLNSASLDQNIGRMENQMAGS  176
            ++ Q G  N+ PLFEN AAASAM  P MDSR+  G   S + S S    + RM NQ+AG 
Sbjct  487  MANQLGTGNMPPLFENVAAASAMVSPGMDSRILGGGLPSGVASPSDVHVLSRMGNQIAGG  546

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQ+ Y+DPMY+QY+        Q A+ NDPS+DRNYLGNSY +LL  QKAY+GS+LSPQ
Sbjct  547  ALQSPYVDPMYLQYMRTPEYAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSLLSPQ  606

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYNVPL  K+ GS HHGYYGNP + VGLSYPGS + +  +  SPVG GSPIR +D NM
Sbjct  607  KSQYNVPLGGKSGGSNHHGYYGNPTYGVGLSYPGSPMANS-LSTSPVGSGSPIRHNDLNM  665

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
                GMRN   GV+ PW+LD  N++ +FAS
Sbjct  666  HFASGMRNVA-GVMAPWHLDAVNVDENFAS  694



>ref|XP_003537979.1| PREDICTED: pumilio homolog 2-like isoform X1 [Glycine max]
 ref|XP_006590977.1| PREDICTED: pumilio homolog 2-like isoform X2 [Glycine max]
Length=1049

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 147/210 (70%), Gaps = 15/210 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAGS  176
            ++ Q G  NL PLFEN AAASAMA P MDSR+  G   + A   S   N+GRM NQ+ GS
Sbjct  487  MTNQLGTGNLPPLFENVAAASAMAAPGMDSRILGGGLASGAAAPSDVHNLGRMGNQIPGS  546

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QYL        Q A+ NDP++DRNYLGNSY +LL  QKAY+GS+LSPQ
Sbjct  547  ALQAPFVDPMYLQYLRTSEFAAAQLAALNDPAVDRNYLGNSYMNLLELQKAYLGSILSPQ  606

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYNVPL  K+  S  HGYYGNP + VGLSYPG+ + + V+  SPVG GSPIR ++ NM
Sbjct  607  KSQYNVPLGGKSGSSTPHGYYGNPAYGVGLSYPGTAMANSVVSTSPVGSGSPIRHNELNM  666

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
            +   GMRN   G +GPW++D  N++ SFAS
Sbjct  667  QFASGMRNLA-GAMGPWHVDTGNIDESFAS  695



>ref|XP_006590974.1| PREDICTED: pumilio homolog 2-like isoform X1 [Glycine max]
 ref|XP_006590975.1| PREDICTED: pumilio homolog 2-like isoform X2 [Glycine max]
Length=1047

 Score =   190 bits (483),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 145/210 (69%), Gaps = 15/210 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAGS  176
            ++ Q G  NL PLFEN AAASAMA P MD R+  G   + A   S   N+GRM NQ+ GS
Sbjct  485  MTNQLGTGNLPPLFENVAAASAMASPGMDLRILGGGLASGAAAPSDVHNLGRMGNQIPGS  544

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +LL  QKAY+GS+LSPQ
Sbjct  545  ALQAPFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSILSPQ  604

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYNVPL  K+  S  HGYYGNP + VG+SYPGS + + V+  SPVG  SP+R ++ NM
Sbjct  605  KSQYNVPLGGKSGSSTPHGYYGNPAYGVGMSYPGSPMANSVVSTSPVGSASPVRHNELNM  664

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
            R   GMRN   GV+GPW+ D  N++ SFAS
Sbjct  665  RFASGMRNLA-GVMGPWHADTGNIDESFAS  693



>ref|XP_009375924.1| PREDICTED: pumilio homolog 1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009375925.1| PREDICTED: pumilio homolog 1-like isoform X2 [Pyrus x bretschneideri]
Length=1052

 Score =   189 bits (481),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 143/209 (68%), Gaps = 21/209 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLD-QNIGRMENQMAGSGL  182
            +++Q G  NL PLFE+A  +  M    +  RM +G NL + S +  N+  + + +AGSGL
Sbjct  499  VASQLGTGNLPPLFESAMGSPGMDSRVLGGRMASGPNLAATSNESHNLAGLGSPIAGSGL  558

Query  183  QAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKS  335
            QA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +L  LQKAY+G++LSPQKS
Sbjct  559  QASFVDPMYLQYLRTSEYAAAQLAALNDPSVDRNYLGNSYMNLIELQKAYLGALLSPQKS  618

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            QY VP+  K+ GS HHGYYGNP F VG+SYPGS    PVIPNSPVGPGSP+R ++ NM  
Sbjct  619  QYGVPMGGKSSGSNHHGYYGNPAFGVGMSYPGS---PPVIPNSPVGPGSPMRHNELNMCY  675

Query  516  GGGMRNFGVGVIGPWNLD---NMENSFAS  593
              GMRN     + PW+LD   N++ SFAS
Sbjct  676  PSGMRN-----LAPWHLDGGCNIDESFAS  699



>gb|KHN21931.1| Pumilio like 2 [Glycine soja]
Length=1174

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 145/210 (69%), Gaps = 15/210 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAGS  176
            ++ Q G  NL PLFEN AAASAMA P M SR+  G   + A   S   N+GRM NQ+ GS
Sbjct  610  MTNQLGTGNLPPLFENVAAASAMASPGMRSRILGGGLASGAAAPSDVHNLGRMGNQIPGS  669

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +LL  QKAY+GS+LSPQ
Sbjct  670  ALQAPFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSILSPQ  729

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYNVPL  K+  S  HGYYGNP + VG+SYPGS + + V+  SPVG  SP+R ++ NM
Sbjct  730  KSQYNVPLGGKSGSSTPHGYYGNPAYGVGMSYPGSPMANSVVSTSPVGSASPVRHNELNM  789

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
            R   GMRN   GV+GPW+ D  N++ SFAS
Sbjct  790  RFASGMRNLA-GVMGPWHADTGNIDESFAS  818



>ref|XP_010256854.1| PREDICTED: pumilio homolog 2-like [Nelumbo nucifera]
 ref|XP_010256855.1| PREDICTED: pumilio homolog 2-like [Nelumbo nucifera]
 ref|XP_010256857.1| PREDICTED: pumilio homolog 2-like [Nelumbo nucifera]
 ref|XP_010256858.1| PREDICTED: pumilio homolog 2-like [Nelumbo nucifera]
Length=1058

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 144/209 (69%), Gaps = 14/209 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLDQNIGRMENQMA  170
            +S   G  NL PLFEN AAASAMA   +D+R       +G+NL  A+  QN+ RM N  A
Sbjct  498  MSNHLGTGNLPPLFENVAAASAMAASGLDARALGGGLPSGTNLTGAAELQNLNRMGNHTA  557

Query  171  GSGLQAQYMDPMYIQYLLQF---ASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKS  335
            GS LQ   +DP+Y+QYL      A+ NDPS+DRNY+GNSY DLL  QKAY+G++LSPQKS
Sbjct  558  GSTLQMPLVDPLYLQYLRTAGYAAALNDPSVDRNYMGNSYVDLLGLQKAYLGALLSPQKS  617

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            QY VP   K+ G  + GYYGNPGF +G+SYPGS L SP+IPNSPVGPGSPIR ++ N+R 
Sbjct  618  QYGVPFLGKS-GGLNPGYYGNPGFGLGMSYPGSPLGSPLIPNSPVGPGSPIRHNERNLRF  676

Query  516  GGGMRNFGVGVIGPWNLD---NMENSFAS  593
              G+RN   GV+G W+ D   NM+  FAS
Sbjct  677  PPGLRNLAGGVMGSWHADASGNMDEGFAS  705



>ref|XP_008384935.1| PREDICTED: pumilio homolog 1-like [Malus domestica]
Length=1052

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 144/209 (69%), Gaps = 21/209 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLD-QNIGRMENQMAGSGL  182
            +++Q G  NL PLFE+A  +  M    +  RM +G NL +A+ +  N+  + + +AGSGL
Sbjct  499  VASQLGTGNLPPLFESAMGSPGMDSRVLGGRMASGPNLAAAANESHNLAGLGSPIAGSGL  558

Query  183  QAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKS  335
            QA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +L  LQKAY+G++LSPQKS
Sbjct  559  QAPFVDPMYLQYLRTSEYAAAQLAALNDPSVDRNYLGNSYMNLIELQKAYLGALLSPQKS  618

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            QY VP+  K+ GS HHGYYGNP F VG+SYPGS    PVIPNSPVGPGSP+R ++ N+  
Sbjct  619  QYGVPMGGKSGGSNHHGYYGNPAFGVGMSYPGS---PPVIPNSPVGPGSPMRHNELNICY  675

Query  516  GGGMRNFGVGVIGPWNLD---NMENSFAS  593
              GMRN     + PW+LD   N++ SFAS
Sbjct  676  PSGMRN-----LAPWHLDGGCNIDESFAS  699



>ref|XP_011035276.1| PREDICTED: pumilio homolog 2 [Populus euphratica]
Length=1065

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 141/203 (69%), Gaps = 17/203 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLDQ-NIGRMENQM  167
            ++ Q G  NL PLFEN AAASAMAIP MDSR+      +G+NL +ASL+  N+GR  + +
Sbjct  501  IAQQLGTGNLPPLFENVAAASAMAIPGMDSRVLGSGLGSGANLTAASLESYNLGRGGSPI  560

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            AG  LQA ++DPMY+QYL        Q ++ NDPS+DRNYLGNSY + L  QKAY   +L
Sbjct  561  AGGALQAPFVDPMYLQYLRTPDYAATQLSAINDPSIDRNYLGNSYLNFLEIQKAY--GLL  618

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            S QKSQY VPL  K+  S HHGY+GNP F VG+ YPGS L SPVIPNSPVGP SP+R ++
Sbjct  619  SSQKSQYGVPLGGKSGSSTHHGYFGNPAFGVGMPYPGSPLASPVIPNSPVGPASPLRHNE  678

Query  501  YNMRVGGGMRNFGVGVIGPWNLD  569
             NMR   GMRN   G++G W LD
Sbjct  679  LNMRFPSGMRNLAGGIMGHWPLD  701



>gb|EYU45944.1| hypothetical protein MIMGU_mgv1a000618mg [Erythranthe guttata]
Length=1042

 Score =   187 bits (475),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 142/207 (69%), Gaps = 19/207 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S Q GN NL PLFENAAAASA+    MD RM   SN + A  DQN  R+ NQM+G    
Sbjct  487  ISGQLGNSNLPPLFENAAAASAIG---MDPRMLGASNFSGA--DQNHNRLGNQMSG---H  538

Query  186  AQYMDPMYIQYLLQFASH--------NDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQY  341
            A Y+DP+Y+QYL              +DPS+DRNY+GNSY DLLQKAY+G++LSPQKSQY
Sbjct  539  APYVDPLYLQYLRTAEYAAAAQVAALSDPSVDRNYMGNSYMDLLQKAYLGNLLSPQKSQY  598

Query  342  NVPLSSKNMGSGH-HGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
             VP++ K  G+   HGYY N  F +GLSYPGS L + V+PNS  GPGSP+R  ++NMR  
Sbjct  599  GVPMAGKGGGATSPHGYYANHAFGIGLSYPGSPLANQVLPNSGGGPGSPMRHGEFNMRFT  658

Query  519  GGMRNFGVG-VIGPWNLDNME-NSFAS  593
            GGMRN   G V+GPW+LD M+ NSFAS
Sbjct  659  GGMRNVAAGSVVGPWHLDTMDNNSFAS  685



>ref|XP_004160189.1| PREDICTED: LOW QUALITY PROTEIN: pumilio homolog 1-like [Cucumis 
sativus]
Length=1043

 Score =   187 bits (474),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 145/209 (69%), Gaps = 17/209 (8%)
 Frame = +3

Query  15   QRGNYNLLPLFENaaaasamaipaMDSRMFTGS-----NLNSASLDQNI-GRMENQMAGS  176
            Q G+ NL  LFEN A+ASA+    ++SR+  GS     NL S++ D +I G++  QM+G+
Sbjct  479  QLGSGNLPTLFENVASASALGASGLESRVLGGSLASATNLTSSAPDSHILGKLGGQMSGN  538

Query  177  GLQAQYMDPMYIQYL------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQK  332
             LQA ++DP+Y+QYL       Q  + NDPS+DRNYLGNSY + L  QKAYVG++LSP K
Sbjct  539  ALQASFVDPIYLQYLRTSEYAAQLGALNDPSLDRNYLGNSYMNQLELQKAYVGALLSPPK  598

Query  333  SQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            SQYNVP S K+  S HHGY+GNP F V +SYPGS + SPV+ NSPVGPGSPIR +D ++R
Sbjct  599  SQYNVPFSGKSGVSNHHGYFGNPAFGVHMSYPGSPMASPVLSNSPVGPGSPIRHNDLHLR  658

Query  513  VGGGMRNFGVGVIGPWNLD--NMENSFAS  593
                 RN G GV+ PW+LD  N+  SF+S
Sbjct  659  YPSAARNLG-GVMSPWHLDVGNINESFSS  686



>ref|XP_004143128.1| PREDICTED: pumilio homolog 1-like [Cucumis sativus]
 gb|KGN47133.1| hypothetical protein Csa_6G190240 [Cucumis sativus]
Length=1043

 Score =   187 bits (474),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 145/209 (69%), Gaps = 17/209 (8%)
 Frame = +3

Query  15   QRGNYNLLPLFENaaaasamaipaMDSRMFTGS-----NLNSASLDQNI-GRMENQMAGS  176
            Q G+ NL  LFEN A+ASA+    ++SR+  GS     NL S++ D +I G++  QM+G+
Sbjct  479  QLGSGNLPTLFENVASASALGASGLESRVLGGSLASATNLTSSAPDSHILGKLGGQMSGN  538

Query  177  GLQAQYMDPMYIQYL------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQK  332
             LQA ++DP+Y+QYL       Q  + NDPS+DRNYLGNSY + L  QKAYVG++LSP K
Sbjct  539  ALQASFVDPIYLQYLRTSEYAAQLGALNDPSLDRNYLGNSYMNQLELQKAYVGALLSPPK  598

Query  333  SQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            SQYNVP S K+  S HHGY+GNP F V +SYPGS + SPV+ NSPVGPGSPIR +D ++R
Sbjct  599  SQYNVPFSGKSGVSNHHGYFGNPAFGVHMSYPGSPMASPVLSNSPVGPGSPIRHNDLHLR  658

Query  513  VGGGMRNFGVGVIGPWNLD--NMENSFAS  593
                 RN G GV+ PW+LD  N+  SF+S
Sbjct  659  YPSAARNLG-GVMSPWHLDVGNINESFSS  686



>ref|XP_008356857.1| PREDICTED: pumilio homolog 1-like [Malus domestica]
Length=1056

 Score =   187 bits (474),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 145/209 (69%), Gaps = 21/209 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLD-QNIGRMENQMAGSGL  182
            +++Q G  NL PLFE+A  +  M   A+  RM +G NL +A+ +  N+G + + +AGSGL
Sbjct  503  VASQLGTGNLPPLFESAMGSPGMDSRALGGRMSSGPNLAAAANESHNLGGLGSPIAGSGL  562

Query  183  QAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKS  335
            QA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +LL  QKAY+G++LSPQKS
Sbjct  563  QAPFVDPMYLQYLRTSEYAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGALLSPQKS  622

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            QY VP+  K+ GS H GYYGNP F +G+SYPGS    PVIPNSPVGPG+PIR ++ NM  
Sbjct  623  QYGVPMVGKSGGSNHQGYYGNPAFGLGMSYPGS---PPVIPNSPVGPGTPIRHNELNMCY  679

Query  516  GGGMRNFGVGVIGPWNLD---NMENSFAS  593
              GMRN     + PW+LD   N++ SFAS
Sbjct  680  PSGMRN-----LAPWHLDGGCNIDESFAS  703



>ref|XP_006592187.1| PREDICTED: pumilio homolog 2-like isoform X3 [Glycine max]
Length=926

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 143/210 (68%), Gaps = 15/210 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF---TGSNLNSASLDQNIGRMENQMAGS  176
            ++ Q G  NL PLF+N AAASAMA P MDSR+      S   + S   N+GRM NQ+ GS
Sbjct  491  MTNQLGTGNLPPLFQNVAAASAMAAPGMDSRILGCGLASGTAAPSDVHNLGRMGNQIQGS  550

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +LL  QKAY+GS+LSPQ
Sbjct  551  ALQAPFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSVLSPQ  610

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYNVP   K+     HGYYGNP +  GLSYPGS + + V+  SPVG GSP+R ++ NM
Sbjct  611  KSQYNVPPGGKSGSFTPHGYYGNPAYGAGLSYPGSPMANSVVSTSPVGSGSPVRHNELNM  670

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
                GMRN   GV+GPW++D  N++ SFAS
Sbjct  671  HFASGMRNLA-GVMGPWHVDNENIDESFAS  699



>gb|KHN33363.1| Pumilio like 2 [Glycine soja]
Length=882

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 149/210 (71%), Gaps = 19/210 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTG---SNLNSASLDQNIGRMENQMAGS  176
            +++Q G  NL PLFEN AAAS MA P MDSR+  G   S + + S     GRM NQ+AG 
Sbjct  325  VASQLGTSNLPPLFENVAAASVMAAPGMDSRILGGGLSSGVAAPSDVHGHGRMGNQIAGG  384

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QY+        Q A+ NDPS+DRNYLGNSY +LL  QKAY+G++LSPQ
Sbjct  385  ALQAPFVDPMYLQYIRSSELAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGTLLSPQ  444

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYNVPLS+K+ GS +HGYYGNP +  GLSYPGS + +  +  SPVG GSPIR +D NM
Sbjct  445  KSQYNVPLSAKSGGS-NHGYYGNPAY--GLSYPGSPMANS-LSTSPVGSGSPIRHNDLNM  500

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
            R   GMRN   GV+GPW+LD  NM+ +FAS
Sbjct  501  RFASGMRNLA-GVMGPWHLDAGNMDENFAS  529



>ref|XP_003539627.1| PREDICTED: pumilio homolog 2-like isoform X1 [Glycine max]
 ref|XP_006592186.1| PREDICTED: pumilio homolog 2-like isoform X2 [Glycine max]
Length=1053

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 143/210 (68%), Gaps = 15/210 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF---TGSNLNSASLDQNIGRMENQMAGS  176
            ++ Q G  NL PLF+N AAASAMA P MDSR+      S   + S   N+GRM NQ+ GS
Sbjct  491  MTNQLGTGNLPPLFQNVAAASAMAAPGMDSRILGCGLASGTAAPSDVHNLGRMGNQIQGS  550

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +LL  QKAY+GS+LSPQ
Sbjct  551  ALQAPFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSVLSPQ  610

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYNVP   K+     HGYYGNP +  GLSYPGS + + V+  SPVG GSP+R ++ NM
Sbjct  611  KSQYNVPPGGKSGSFTPHGYYGNPAYGAGLSYPGSPMANSVVSTSPVGSGSPVRHNELNM  670

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
                GMRN   GV+GPW++D  N++ SFAS
Sbjct  671  HFASGMRNLA-GVMGPWHVDNENIDESFAS  699



>ref|XP_007132045.1| hypothetical protein PHAVU_011G062300g [Phaseolus vulgaris]
 gb|ESW04039.1| hypothetical protein PHAVU_011G062300g [Phaseolus vulgaris]
Length=1047

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 143/210 (68%), Gaps = 16/210 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLD----QNIGRMENQMAG  173
            ++ Q G  NL PLFE  AAASA+A P MDSR+  GS L S +       N+GRM NQ+ G
Sbjct  487  MTNQLGTGNLPPLFETVAAASAIAAPGMDSRIL-GSGLASGAAAPSDVHNLGRMGNQIPG  545

Query  174  SGLQAQYMDPMYIQYL------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
            S LQA ++DPMY QYL       Q  + NDPS+DR YLGNSY  LL  QKAY+GS+LSPQ
Sbjct  546  SPLQAPFVDPMYHQYLRTTEYAAQLGALNDPSVDRTYLGNSYMSLLELQKAYLGSILSPQ  605

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYN PL  K+  S  HGYYGNP + VGLSYPGS + + V+  SPVG GSP+R ++ NM
Sbjct  606  KSQYNGPLGGKSGSSTPHGYYGNPAYGVGLSYPGSPMANSVVSTSPVGSGSPVRHNELNM  665

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
            R   GMRN   GV+GPW++D  N++ SFAS
Sbjct  666  RFASGMRNLA-GVMGPWHVDTGNIDESFAS  694



>ref|XP_006592185.1| PREDICTED: pumilio homolog 2-like isoform X2 [Glycine max]
Length=902

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 144/210 (69%), Gaps = 15/210 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAGS  176
            ++ Q G  NL PLFEN AAASAMA P MDSR+  G   + A   S   N+GRM NQ+ GS
Sbjct  471  MTNQLGTGNLPPLFENVAAASAMAAPRMDSRILGGGLASGAAAPSDVHNLGRMGNQIQGS  530

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +LL  QKAY+GS+LSPQ
Sbjct  531  ALQAPFVDPMYLQYLRTPEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSVLSPQ  590

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYNVP   K+     HGYYGNP +  GLSYPGS + + V+  SPVG GSP+R ++ NM
Sbjct  591  KSQYNVPPGGKSGSFTPHGYYGNPAYGAGLSYPGSPMANSVVSTSPVGSGSPVRHNELNM  650

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
                GMRN   GV+GPW++D  N++ SFAS
Sbjct  651  HFASGMRNLA-GVMGPWHVDNENIDESFAS  679



>ref|XP_003539618.1| PREDICTED: pumilio homolog 2-like isoform X1 [Glycine max]
Length=1033

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 144/210 (69%), Gaps = 15/210 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAGS  176
            ++ Q G  NL PLFEN AAASAMA P MDSR+  G   + A   S   N+GRM NQ+ GS
Sbjct  471  MTNQLGTGNLPPLFENVAAASAMAAPRMDSRILGGGLASGAAAPSDVHNLGRMGNQIQGS  530

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +LL  QKAY+GS+LSPQ
Sbjct  531  ALQAPFVDPMYLQYLRTPEFAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSVLSPQ  590

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYNVP   K+     HGYYGNP +  GLSYPGS + + V+  SPVG GSP+R ++ NM
Sbjct  591  KSQYNVPPGGKSGSFTPHGYYGNPAYGAGLSYPGSPMANSVVSTSPVGSGSPVRHNELNM  650

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
                GMRN   GV+GPW++D  N++ SFAS
Sbjct  651  HFASGMRNLA-GVMGPWHVDNENIDESFAS  679



>gb|KJB55838.1| hypothetical protein B456_009G097200 [Gossypium raimondii]
Length=984

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 130/187 (70%), Gaps = 18/187 (10%)
 Frame = +3

Query  87   MDSRMF-----TGSNLNSA-SLDQNIGRMENQMAGSGLQAQYMDPMYIQYL-------LQ  227
            MDSR+F     +G N++SA S   N+GR+ +Q+AG+ LQA ++DPMY+QYL        Q
Sbjct  506  MDSRVFGGGLGSGQNISSAVSESPNLGRVGSQIAGNALQAPFVDPMYLQYLRTSDYPAAQ  565

Query  228  FASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNP  401
              + NDP M+RN+LG+SY +LL  QKAY GSMLSPQKSQY VPL +K+ GS  HG+YGN 
Sbjct  566  LPAFNDPCMNRNFLGDSYMNLLELQKAYFGSMLSPQKSQYGVPLGTKSGGSNIHGFYGNS  625

Query  402  GFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD---N  572
             F  G+SYPGS L +  IPNSPVG GSPIR +D NMR   G RN   GV GPW+LD   N
Sbjct  626  TFGAGMSYPGSPLANTFIPNSPVGLGSPIRHTDLNMRFPSGTRNLTGGVTGPWHLDAGYN  685

Query  573  MENSFAS  593
            ++ SFAS
Sbjct  686  LDESFAS  692



>gb|KJB55837.1| hypothetical protein B456_009G097200 [Gossypium raimondii]
Length=1045

 Score =   184 bits (468),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 130/187 (70%), Gaps = 18/187 (10%)
 Frame = +3

Query  87   MDSRMF-----TGSNLNSA-SLDQNIGRMENQMAGSGLQAQYMDPMYIQYL-------LQ  227
            MDSR+F     +G N++SA S   N+GR+ +Q+AG+ LQA ++DPMY+QYL        Q
Sbjct  506  MDSRVFGGGLGSGQNISSAVSESPNLGRVGSQIAGNALQAPFVDPMYLQYLRTSDYPAAQ  565

Query  228  FASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNP  401
              + NDP M+RN+LG+SY +LL  QKAY GSMLSPQKSQY VPL +K+ GS  HG+YGN 
Sbjct  566  LPAFNDPCMNRNFLGDSYMNLLELQKAYFGSMLSPQKSQYGVPLGTKSGGSNIHGFYGNS  625

Query  402  GFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD---N  572
             F  G+SYPGS L +  IPNSPVG GSPIR +D NMR   G RN   GV GPW+LD   N
Sbjct  626  TFGAGMSYPGSPLANTFIPNSPVGLGSPIRHTDLNMRFPSGTRNLTGGVTGPWHLDAGYN  685

Query  573  MENSFAS  593
            ++ SFAS
Sbjct  686  LDESFAS  692



>ref|XP_003547219.1| PREDICTED: pumilio homolog 2-like [Glycine max]
Length=1054

 Score =   184 bits (468),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 149/210 (71%), Gaps = 19/210 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTG---SNLNSASLDQNIGRMENQMAGS  176
            +++Q G  NL PLFEN AAAS MA P MDSR+  G   S + + S     GRM NQ+AG 
Sbjct  497  VASQLGTSNLPPLFENVAAASVMAAPGMDSRILGGGLSSGVAAPSDVHGHGRMGNQIAGG  556

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QY+        Q A+ NDPS+DRNYLGNSY +LL  QKAY+G++LSPQ
Sbjct  557  ALQAPFVDPMYLQYIRSSELAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGTLLSPQ  616

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQYNVPLS+K+ GS +HGYYGNP +  GLSYPGS + +  +  SPVG GSPIR +D NM
Sbjct  617  KSQYNVPLSAKSGGS-NHGYYGNPAY--GLSYPGSPMANS-LSTSPVGSGSPIRHNDLNM  672

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
            R   GMRN   GV+GPW+LD  NM+ +FAS
Sbjct  673  RFASGMRNLA-GVMGPWHLDAGNMDENFAS  701



>ref|XP_008464104.1| PREDICTED: pumilio homolog 1-like [Cucumis melo]
Length=1042

 Score =   184 bits (467),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 143/208 (69%), Gaps = 16/208 (8%)
 Frame = +3

Query  15   QRGNYNLLPLFENaaaasamaipaMDSRMFTGS-----NLNSASLDQNI-GRMENQMAGS  176
            Q G  NL  LFEN A+ASA+    ++SR+  GS     NL S++ D +I G++  QM+G+
Sbjct  479  QLGTGNLPTLFENVASASALGASGLESRVLGGSLASATNLTSSAPDSHILGKLGGQMSGN  538

Query  177  GLQAQYMDPMYIQYL-----LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKS  335
             LQA ++DP+Y+QYL      Q  + NDPS+DRNYLGNSY + L  QKAYVG++LSP KS
Sbjct  539  ALQASFVDPIYLQYLRTEYAAQLGALNDPSLDRNYLGNSYMNQLELQKAYVGALLSPPKS  598

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            QYNVP S K+  S HHGY+GNP F V +SYPGS + SPV+ NSPVGPGSPIR +D ++R 
Sbjct  599  QYNVPFSGKSGVSNHHGYFGNPAFGVHMSYPGSPMASPVLSNSPVGPGSPIRHNDLHLRY  658

Query  516  GGGMRNFGVGVIGPWNLD--NMENSFAS  593
                RN   G++ PW+LD  N+  SF+S
Sbjct  659  PSATRNL-AGLMSPWHLDVGNINESFSS  685



>gb|KEH30178.1| pumilio Mpt5 protein, putative [Medicago truncatula]
Length=954

 Score =   184 bits (466),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 144/211 (68%), Gaps = 19/211 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAGS  176
            ++ Q G  NL P+FEN AAAS MA P MDSR+  G   + A   S   N+GRM NQ+AG 
Sbjct  395  MTNQYGTSNLPPMFENVAAASMMASPGMDSRILGGGLASGAGSPSDLHNLGRMGNQIAGG  454

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QY+        Q A+ NDPS+DRNYLGNSY +LL  QKAY+GS+LSPQ
Sbjct  455  ALQAPFVDPMYLQYMRTSEYAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSVLSPQ  514

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDY-N  506
            KSQYN  L  K+  S HHGYYGNP + VGLSYPGS + +     SPVG GSPIR +D  N
Sbjct  515  KSQYNAQLGGKSGNSNHHGYYGNPAYGVGLSYPGSPMAN---SGSPVGSGSPIRHNDLNN  571

Query  507  MRVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
            MR   GMRN   GV+GPW++D  NM+ SFAS
Sbjct  572  MRFASGMRNLA-GVMGPWHVDSGNMDESFAS  601



>gb|KHN32144.1| Pumilio like 2 [Glycine soja]
Length=1050

 Score =   184 bits (466),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 141/208 (68%), Gaps = 14/208 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF---TGSNLNSASLDQNIGRMENQMAGS  176
            ++ Q G  NL PLF+N AAASAMA P MDSR+      S   + S   N+GRM NQ+ GS
Sbjct  491  MTNQLGTGNLPPLFQNVAAASAMAAPGMDSRILGCGLASGTAAPSEVHNLGRMGNQIQGS  550

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKS  335
             LQA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +  QKAY+GS+LSPQKS
Sbjct  551  ALQAPFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNF-QKAYLGSVLSPQKS  609

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            QYNVP   K+     HGYYGNP +  GLSYPGS + + V+  SPVG GSP+R ++ NM  
Sbjct  610  QYNVPPGGKSGSFTPHGYYGNPAYGAGLSYPGSPMANSVVSTSPVGSGSPVRHNELNMHF  669

Query  516  GGGMRNFGVGVIGPWNLD--NMENSFAS  593
              GMRN   GV+GPW++D  N++ SFAS
Sbjct  670  ASGMRNLA-GVMGPWHVDNENIDESFAS  696



>ref|XP_003606712.1| Pumilio-like protein [Medicago truncatula]
 gb|AES88909.1| pumilio Mpt5 protein, putative [Medicago truncatula]
Length=1025

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 144/211 (68%), Gaps = 19/211 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAGS  176
            ++ Q G  NL P+FEN AAAS MA P MDSR+  G   + A   S   N+GRM NQ+AG 
Sbjct  466  MTNQYGTSNLPPMFENVAAASMMASPGMDSRILGGGLASGAGSPSDLHNLGRMGNQIAGG  525

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QY+        Q A+ NDPS+DRNYLGNSY +LL  QKAY+GS+LSPQ
Sbjct  526  ALQAPFVDPMYLQYMRTSEYAAAQLAALNDPSVDRNYLGNSYMNLLELQKAYLGSVLSPQ  585

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDY-N  506
            KSQYN  L  K+  S HHGYYGNP + VGLSYPGS + +     SPVG GSPIR +D  N
Sbjct  586  KSQYNAQLGGKSGNSNHHGYYGNPAYGVGLSYPGSPMAN---SGSPVGSGSPIRHNDLNN  642

Query  507  MRVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
            MR   GMRN   GV+GPW++D  NM+ SFAS
Sbjct  643  MRFASGMRNLA-GVMGPWHVDSGNMDESFAS  672



>gb|KHN21928.1| Pumilio like 2 [Glycine soja]
Length=1014

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 120/162 (74%), Gaps = 12/162 (7%)
 Frame = +3

Query  141  NIGRMENQMAGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--  293
            N+GRM NQ+ GS LQA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +LL  
Sbjct  500  NLGRMGNQIPGSALQAPFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMNLLEL  559

Query  294  QKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVG  473
            QKAY+GS+LSPQKSQYNVPL  K+  S  HGYYGNP + VG+SYPG+ + + V+  SPVG
Sbjct  560  QKAYLGSILSPQKSQYNVPLGGKSGSSTPHGYYGNPAYGVGMSYPGTPIANSVVSTSPVG  619

Query  474  PGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
             GSP+R ++ NMR   G+RN   GV+GPW++D  N++ SFAS
Sbjct  620  SGSPVRHNELNMRFASGLRNLA-GVMGPWHVDTGNIDESFAS  660



>ref|XP_010043502.1| PREDICTED: pumilio homolog 2-like [Eucalyptus grandis]
 gb|KCW85516.1| hypothetical protein EUGRSUZ_B02314 [Eucalyptus grandis]
Length=1038

 Score =   182 bits (462),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 148/208 (71%), Gaps = 19/208 (9%)
 Frame = +3

Query  15   QRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLDQN-IGRMENQMAGS  176
            Q G  NL PL+ENAAAASA+ +P  +SR+      TGSNL +A+ +QN + RM NQM+G 
Sbjct  483  QLGMGNLPPLYENAAAASAIGMPGTESRVLGGGLATGSNLTAAASEQNSLNRMANQMSGG  542

Query  177  GLQAQYMDPMYIQYL------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQK  332
             +QA +MDP+Y+QY+       Q A+ NDP +DRNYLG+SY +LL  QKAY+G++LSPQK
Sbjct  543  AVQAPFMDPLYLQYMRSSEYATQLAALNDP-VDRNYLGSSYLNLLEIQKAYLGALLSPQK  601

Query  333  SQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            S Y V    K+ GS HHGYYGN  F +G+SYPGS L + VIPNSPVGPGSP+R +D +MR
Sbjct  602  SLYGV--GGKSGGSNHHGYYGNHAFGIGMSYPGSPLANAVIPNSPVGPGSPMRQND-SMR  658

Query  513  VGGGMRNFGVGVIGPWNLD-NMENSFAS  593
            +  GMRN   GVIGPW+LD  M  +F S
Sbjct  659  LPSGMRNLAGGVIGPWHLDGGMNENFGS  686



>gb|KCW85517.1| hypothetical protein EUGRSUZ_B02314 [Eucalyptus grandis]
Length=1037

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 148/208 (71%), Gaps = 19/208 (9%)
 Frame = +3

Query  15   QRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLDQN-IGRMENQMAGS  176
            Q G  NL PL+ENAAAASA+ +P  +SR+      TGSNL +A+ +QN + RM NQM+G 
Sbjct  483  QLGMGNLPPLYENAAAASAIGMPGTESRVLGGGLATGSNLTAAASEQNSLNRMANQMSGG  542

Query  177  GLQAQYMDPMYIQYL------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQK  332
             +QA +MDP+Y+QY+       Q A+ NDP +DRNYLG+SY +LL  QKAY+G++LSPQK
Sbjct  543  AVQAPFMDPLYLQYMRSSEYATQLAALNDP-VDRNYLGSSYLNLLEIQKAYLGALLSPQK  601

Query  333  SQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            S Y V    K+ GS HHGYYGN  F +G+SYPGS L + VIPNSPVGPGSP+R +D +MR
Sbjct  602  SLYGV--GGKSGGSNHHGYYGNHAFGIGMSYPGSPLANAVIPNSPVGPGSPMRQND-SMR  658

Query  513  VGGGMRNFGVGVIGPWNLD-NMENSFAS  593
            +  GMRN   GVIGPW+LD  M  +F S
Sbjct  659  LPSGMRNLAGGVIGPWHLDGGMNENFGS  686



>gb|KHG12245.1| Pumilio 2 [Gossypium arboreum]
Length=1478

 Score =   182 bits (463),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 130/187 (70%), Gaps = 18/187 (10%)
 Frame = +3

Query  87   MDSRMF-----TGSNLNSASLDQ-NIGRMENQMAGSGLQAQYMDPMYIQYL-------LQ  227
            MDSR+F     +G N++SA+ +  N+GR+ +Q+AG+ LQA ++DPMY+QYL        Q
Sbjct  506  MDSRVFGGDLGSGQNISSAASESLNLGRIGSQIAGNALQAPFVDPMYLQYLRTSDYPAAQ  565

Query  228  FASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNP  401
              + NDP MDRN+LG+SY +LL  QKAY GS+LSPQKSQY VPL +K+ GS  HG+YGN 
Sbjct  566  LPAFNDPCMDRNFLGDSYMNLLELQKAYFGSLLSPQKSQYGVPLGTKSGGSNIHGFYGNS  625

Query  402  GFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD---N  572
             F  G+SYPGS L +  IPNSPVG GSPIR +D NMR   G RN   GV G W+LD   N
Sbjct  626  TFGAGMSYPGSPLANTFIPNSPVGLGSPIRHTDLNMRFPSGTRNLPGGVTGTWHLDAGYN  685

Query  573  MENSFAS  593
            ++ SFAS
Sbjct  686  LDESFAS  692



>gb|KHG12246.1| Pumilio 2 [Gossypium arboreum]
Length=1477

 Score =   182 bits (463),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 130/187 (70%), Gaps = 18/187 (10%)
 Frame = +3

Query  87   MDSRMF-----TGSNLNSASLDQ-NIGRMENQMAGSGLQAQYMDPMYIQYL-------LQ  227
            MDSR+F     +G N++SA+ +  N+GR+ +Q+AG+ LQA ++DPMY+QYL        Q
Sbjct  506  MDSRVFGGDLGSGQNISSAASESLNLGRIGSQIAGNALQAPFVDPMYLQYLRTSDYPAAQ  565

Query  228  FASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNP  401
              + NDP MDRN+LG+SY +LL  QKAY GS+LSPQKSQY VPL +K+ GS  HG+YGN 
Sbjct  566  LPAFNDPCMDRNFLGDSYMNLLELQKAYFGSLLSPQKSQYGVPLGTKSGGSNIHGFYGNS  625

Query  402  GFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD---N  572
             F  G+SYPGS L +  IPNSPVG GSPIR +D NMR   G RN   GV G W+LD   N
Sbjct  626  TFGAGMSYPGSPLANTFIPNSPVGLGSPIRHTDLNMRFPSGTRNLPGGVTGTWHLDAGYN  685

Query  573  MENSFAS  593
            ++ SFAS
Sbjct  686  LDESFAS  692



>ref|XP_010262560.1| PREDICTED: pumilio homolog 2-like [Nelumbo nucifera]
Length=1050

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 141/212 (67%), Gaps = 17/212 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF----TGSNLNSASLDQNIGRMENQMAG  173
            ++ Q G  NL PLFEN AAASAMA   +D+R      +G NL  A+  QN+ R+ N  AG
Sbjct  487  MANQLGTGNLPPLFENVAAASAMAASGLDARALGGLPSGGNLTGAAELQNLNRIGNHTAG  546

Query  174  SGLQAQYMDPMYIQYLLQFASH-------NDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            S LQ   +DP+Y+QYL             NDPS+DRNY+GNSY DLL  QKAY+G++LSP
Sbjct  547  SALQMPVLDPLYLQYLKTAEYAAAQVAALNDPSLDRNYMGNSYVDLLGLQKAYLGALLSP  606

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKSQY VP   K+ G    GYYGNP F +G+SYPGS L SP++PNSPVGPGSPIR ++ +
Sbjct  607  QKSQYGVPFLGKS-GGLSPGYYGNPAFGLGMSYPGSPLASPLLPNSPVGPGSPIRHNERS  665

Query  507  MRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            +R   GMRN   GV+G W+ +   NM+ SFAS
Sbjct  666  LRFPPGMRNLTGGVMGSWHSEAGGNMDESFAS  697



>gb|KHN32146.1| Pumilio like 2 [Glycine soja]
Length=1030

 Score =   179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 141/209 (67%), Gaps = 16/209 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAGS  176
            ++ Q G  NL PLFEN AAASAMA P M SR+  G   + A   S   N+GRM NQ+ GS
Sbjct  471  MTNQLGTGNLPPLFENVAAASAMASPGMRSRILGGGLASGAAAPSDVHNLGRMGNQIQGS  530

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKS  335
             LQA ++DPMY+QYL        Q A+ NDPS+DRNYLGNSY +  QKAY+GS+LSPQKS
Sbjct  531  ALQAPFVDPMYLQYLRTSEFAAAQLAALNDPSVDRNYLGNSYMN--QKAYLGSVLSPQKS  588

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            QYNVPL  K+  S  HGYYGN  +  GLSYPGS + + V+  SPVG GSP+R ++ NM  
Sbjct  589  QYNVPLGGKSGSSPAHGYYGNAAYGGGLSYPGSPMANSVVSTSPVGSGSPVRHNELNMHF  648

Query  516  GGGMRNFGVGVIGPWNLDN---MENSFAS  593
              GMRN   GV+GPW++DN    + SFAS
Sbjct  649  ASGMRNLA-GVMGPWHVDNGNIDDESFAS  676



>ref|XP_009364362.1| PREDICTED: pumilio homolog 1-like [Pyrus x bretschneideri]
Length=1060

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 140/209 (67%), Gaps = 21/209 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQ-NIGRMENQMAGSGL  182
            +++Q G  NL PLFE+A  +  M    +  RM +G NL + + +  N+G + + +AGSGL
Sbjct  507  VASQLGTGNLPPLFESAMGSPGMDSRVLGGRMSSGPNLAAVANESLNLGGLGSPIAGSGL  566

Query  183  QAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKS  335
            QA ++DPMY+QYL        Q  + NDPS+DRNYLGNSY +LL  QKAY+G++LSPQKS
Sbjct  567  QAPFVDPMYLQYLRTSEYAAAQLGALNDPSVDRNYLGNSYMNLLELQKAYLGALLSPQKS  626

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            QY VP+  K+ G  H GYYGNP F +G+SYPGS    PVIPNSPVGP +P+R ++ NM  
Sbjct  627  QYGVPMVGKSGGPNHQGYYGNPAFGLGMSYPGS---PPVIPNSPVGPATPMRHNELNMCY  683

Query  516  GGGMRNFGVGVIGPWNLD---NMENSFAS  593
              GMRN     + PW+LD   N++ SFAS
Sbjct  684  PSGMRN-----LAPWHLDGGCNIDESFAS  707



>ref|XP_002524200.1| pumilio, putative [Ricinus communis]
 gb|EEF38124.1| pumilio, putative [Ricinus communis]
Length=1011

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 136/196 (69%), Gaps = 11/196 (6%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF--TGSNLNSASLD-QNIGRMENQMAGS  176
            L++Q G+ +L PLFE+AAAASAM    +DSR     G NL +A+ + QN+ R+ NQ   +
Sbjct  438  LASQLGSGSLPPLFESAAAASAMGGTGLDSRALGALGPNLVAAAAELQNLSRVGNQNTSN  497

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKS  335
              Q   MDP+Y+QY+        Q A+ NDP+MDR Y+GNSY DLLQKAY+G++LSPQKS
Sbjct  498  AFQMPLMDPLYLQYMRSNEYAAAQLAALNDPTMDREYIGNSYMDLLQKAYIGALLSPQKS  557

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            QY VP   K+ GS +H YYGNP F +G+SY GS +  P++PNSP+G GSP+R ++ NMR 
Sbjct  558  QYGVPYLGKS-GSMNHNYYGNPAFGLGMSYSGSPIGGPLLPNSPIGSGSPVRHNERNMRF  616

Query  516  GGGMRNFGVGVIGPWN  563
              GMRNF  GV+G W+
Sbjct  617  TAGMRNFSGGVMGSWH  632



>ref|XP_002524201.1| pumilio, putative [Ricinus communis]
 gb|EEF38125.1| pumilio, putative [Ricinus communis]
Length=999

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 136/196 (69%), Gaps = 11/196 (6%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF--TGSNLNSASLD-QNIGRMENQMAGS  176
            L++Q G+ +L PLFE+AAAASAM    +DSR     G NL +A+ + QN+ R+ NQ   +
Sbjct  438  LASQLGSGSLPPLFESAAAASAMGGTGLDSRALGALGPNLVAAAAELQNLSRVGNQNTNN  497

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKS  335
            GLQ   MDP+Y+QY+        Q A+ NDP+MDR YLGNSY DLLQKAY+G++LSPQKS
Sbjct  498  GLQMPLMDPLYLQYMRSNEYAAAQLAALNDPTMDREYLGNSYMDLLQKAYLGALLSPQKS  557

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            QY VP    N GS +H YYGNP F +G+SY GS +  P++P+SP+G GSP+R S+ NMR 
Sbjct  558  QYGVPYLG-NSGSMNHNYYGNPAFGLGMSYSGSPIGGPLLPSSPIGSGSPVRHSERNMRF  616

Query  516  GGGMRNFGVGVIGPWN  563
              GMRN   GV+G W+
Sbjct  617  TAGMRNLSGGVMGSWH  632



>ref|XP_004507166.1| PREDICTED: pumilio homolog 2-like isoform X1 [Cicer arietinum]
 ref|XP_004507167.1| PREDICTED: pumilio homolog 2-like isoform X2 [Cicer arietinum]
 ref|XP_004507168.1| PREDICTED: pumilio homolog 2-like isoform X3 [Cicer arietinum]
Length=1030

 Score =   172 bits (437),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 144/209 (69%), Gaps = 17/209 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLD--QNIGRMENQMAGSG  179
            ++ Q G  NL PLFEN AAASA+A P MDSR+  G   + A      ++G M NQ+AG  
Sbjct  473  MTNQYGTGNLPPLFENVAAASALASPRMDSRILGGGLASGAGSSDMHSLGGMGNQIAGGA  532

Query  180  LQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQK  332
            LQA ++DPMY+QY+        Q A+ N+PS+D+NYL NSY +LL  QKAY+GS+LSPQK
Sbjct  533  LQAPFVDPMYLQYVRTSEYAAAQLAALNNPSVDQNYLDNSYMNLLELQKAYLGSVLSPQK  592

Query  333  SQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            SQYNVP+  K+  S HHGYYGNP + VGLSYPGS + +     SPVG GSPIR +D NMR
Sbjct  593  SQYNVPMGGKSGNSNHHGYYGNPAYGVGLSYPGSPMAN---SGSPVGSGSPIRHNDLNMR  649

Query  513  VGGGMRNFGVGVIGPWNLD--NMENSFAS  593
               GMRN   GV+GPW++D  NM+ SFAS
Sbjct  650  FASGMRNLS-GVMGPWHVDTGNMDESFAS  677



>gb|KDP44926.1| hypothetical protein JCGZ_01426 [Jatropha curcas]
Length=982

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 138/209 (66%), Gaps = 14/209 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFT--GSNLNSASLD-QNIGRMENQMAGS  176
            + +Q G+  L PLFEN AAASA+    +DSR     G NL +A+ +   + R+ NQ AG+
Sbjct  420  MGSQLGSGGLPPLFENVAAASAVGGTGLDSRSLNALGPNLMAAAPELHTLSRVGNQTAGN  479

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKS  335
             LQ   MDP+Y+QYL        Q A+ NDPSM+R YLGNSY DLLQKAY+GS+LSPQKS
Sbjct  480  ALQVPVMDPLYLQYLRSNEYAAAQLATLNDPSMEREYLGNSYMDLLQKAYLGSLLSPQKS  539

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            QY VP   K+ GS +H YYG+P F +G+SY GS +  P++ +SP+G GSP+R ++ NMR 
Sbjct  540  QYGVPYLGKS-GSLNHNYYGSPTFGLGMSYSGSPIGGPLLASSPIGWGSPVRHNERNMRF  598

Query  516  GGGMRNFGVGVIGPWNLD---NMENSFAS  593
              GM N   GV+G W+ +   N++ SF S
Sbjct  599  TAGMSNLPGGVMGSWHSESGGNLDESFPS  627



>ref|XP_010658540.1| PREDICTED: pumilio homolog 2-like [Vitis vinifera]
Length=1063

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 139/213 (65%), Gaps = 18/213 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLDQNIGRMENQMA  170
            + +Q G+ N+ PLFEN AAASAM +  MDSR        G NL +A+ +    R+ N   
Sbjct  499  MGSQHGSGNMPPLFENVAAASAMGVTGMDSRALGGGLNLGPNLMAAASELQNLRVGNHTT  558

Query  171  GSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLS  323
            G+ LQ   +DP+Y+QYL        Q  + NDP+MDR Y+G+SY DLL  QKAY+G++L+
Sbjct  559  GNALQVPVVDPLYLQYLRSAEYAATQGVALNDPTMDREYMGSSYMDLLGLQKAYLGALLT  618

Query  324  PQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDY  503
             QKSQY VP   K+  S +HGYYGNP F +G+SYPGS L  P++PNSPVG GSP+R ++ 
Sbjct  619  SQKSQYGVPYLGKS-SSMNHGYYGNPQFGLGMSYPGSPLAGPLLPNSPVGSGSPVRHNER  677

Query  504  NMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            NMR   GMRN   GV+G W+ +   N++++F S
Sbjct  678  NMRFPSGMRNLAGGVMGAWHSEAGGNLDDNFVS  710



>ref|XP_008233648.1| PREDICTED: pumilio homolog 1-like [Prunus mume]
Length=1060

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 139/209 (67%), Gaps = 21/209 (10%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLD-QNIGRMENQMAGSGL  182
            GN +L PLFENAAAASAM    +DS  F      G NL +A+ + QN+ R+ N  AGS +
Sbjct  500  GNGSLPPLFENAAAASAMGG--LDSGAFGGGMSLGPNLLAAAAELQNMNRLGNHTAGSAV  557

Query  183  QAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKS  335
            Q   MDP+Y+QY+        Q A+ NDP+ DR  +GN Y DLL  QKAY+G +LSPQKS
Sbjct  558  QVPMMDPLYLQYVRSNEYAAAQVAALNDPTKDREGMGNMYMDLLGLQKAYLGQLLSPQKS  617

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            Q+ VP   K+ GS +HGYYG+P + +G+SY G+ L  P++PNSPVGPGSP R SD N+R 
Sbjct  618  QFGVPYIGKS-GSLNHGYYGSPAYGLGMSYSGTALGGPLLPNSPVGPGSPARHSDRNLRF  676

Query  516  GGGMRNFGVGVIGPWNLD---NMENSFAS  593
              GMRN G G++GPW+ +   N + +FAS
Sbjct  677  SSGMRNMGGGLMGPWHSETGGNFDENFAS  705



>ref|XP_007218909.1| hypothetical protein PRUPE_ppa000626mg [Prunus persica]
 gb|EMJ20108.1| hypothetical protein PRUPE_ppa000626mg [Prunus persica]
Length=1062

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 138/209 (66%), Gaps = 21/209 (10%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLD-QNIGRMENQMAGSGL  182
            GN +L PLFENAAAASAM    +DS  F      G NL +A+ + QN+ R+ N  AGS +
Sbjct  502  GNGSLPPLFENAAAASAMGG--LDSGAFGGGMSLGPNLLAAAAELQNMNRLGNHTAGSAV  559

Query  183  QAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKS  335
            Q   MDP+Y+QYL        Q A+ NDP+ DR  +GN Y DLL  QKAY+G +LSPQKS
Sbjct  560  QVPMMDPLYLQYLRSNEYAAAQVAALNDPTKDREGMGNMYMDLLGLQKAYLGQLLSPQKS  619

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            Q+ VP   K+ GS +HGYYGNP + +G+SY G+ L  P++PNSPVGPGSP R SD N+R 
Sbjct  620  QFGVPYIGKS-GSLNHGYYGNPAYGLGMSYSGTALGGPLLPNSPVGPGSPARHSDRNLRF  678

Query  516  GGGMRNFGVGVIGPWNLD---NMENSFAS  593
              GMRN G G++G W+ +   N + +FAS
Sbjct  679  SSGMRNMGGGLMGAWHSETGGNFDENFAS  707



>ref|XP_006846288.1| hypothetical protein AMTR_s00012p00251030 [Amborella trichopoda]
 gb|ERN07963.1| hypothetical protein AMTR_s00012p00251030 [Amborella trichopoda]
Length=1019

 Score =   164 bits (416),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 143/210 (68%), Gaps = 23/210 (11%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSR-----MFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            G  N+ PLF+N + ++++A P +DSR     + +G+ L   +  QN+ R+ NQ   +GLQ
Sbjct  462  GANNMSPLFDNISFSASLAGPGLDSRSMGAGLNSGTGLTGNNDLQNLNRIRNQTV-NGLQ  520

Query  186  AQYMDPMYIQYLLQFASH--------NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKS  335
               MDP+YIQYL + A +         DPS++RNY+G+SY DLL  QKAY+G++L+ QKS
Sbjct  521  VPVMDPLYIQYLQRTAEYASQVAAGLTDPSLERNYMGSSYVDLLGLQKAYLGALLAQQKS  580

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGS-PIRCSDYNMR  512
            QYN+P  +K+ G  +HGYYGNP F +G+ YPGS LTSPV+PNSPVGPGS P+R +D ++R
Sbjct  581  QYNIPYFNKS-GGLNHGYYGNPAFGLGMPYPGSPLTSPVLPNSPVGPGSPPMRQNDRSLR  639

Query  513  VGGGMRNFGVGVIGPWNLD---NMENSFAS  593
               G+R  G GV+G W+ D   N+E +FAS
Sbjct  640  FASGIR--GSGVVGSWHADNGPNLEENFAS  667



>ref|XP_006485456.1| PREDICTED: pumilio homolog 1-like [Citrus sinensis]
Length=671

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 140/208 (67%), Gaps = 25/208 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFT----GSNLNSASLD-QNIGRMENQMAGSGLQ  185
            G+ NL PL+ENAAAASAMA   +D+R       G N+ +A+ + Q++ R+ N  AGS LQ
Sbjct  289  GSGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAAELQSMNRLGNHTAGSALQ  348

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            A  MDP+Y+QYL        Q AS NDP+MD   +GNSY DLL  QKAY+G++LSPQKSQ
Sbjct  349  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  405

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y VP  +K+ GS ++  YGNP F +G+SYPG     P++PNSPVG GSP+R  D NMR  
Sbjct  406  YGVPYLNKS-GSLNNNLYGNPAFGLGMSYPGG----PLLPNSPVGSGSPVRHGDRNMRFP  460

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             GMRN   GV+GPW+ +   +++ SFAS
Sbjct  461  SGMRNLSGGVMGPWHSEAGGSLDESFAS  488



>ref|XP_006475541.1| PREDICTED: pumilio homolog 1-like [Citrus sinensis]
Length=582

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 140/208 (67%), Gaps = 25/208 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFT----GSNLNSASLD-QNIGRMENQMAGSGLQ  185
            G+ NL PL+ENAAAASAMA   +D+R       G N+ +A+ + Q++ R+ N  AGS LQ
Sbjct  289  GSGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAAELQSMNRLGNHTAGSALQ  348

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            A  MDP+Y+QYL        Q AS NDP+MD   +GNSY DLL  QKAY+G++LSPQKSQ
Sbjct  349  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  405

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y VP  +K+ GS ++  YGNP F +G+SYPG     P++PNSPVG GSP+R  D NMR  
Sbjct  406  YGVPYLNKS-GSLNNNLYGNPAFGLGMSYPGG----PLLPNSPVGSGSPVRHGDRNMRFP  460

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             GMRN   GV+GPW+ +   +++ SFAS
Sbjct  461  SGMRNLSGGVMGPWHSEAGGSLDESFAS  488



>ref|XP_006469751.1| PREDICTED: pumilio homolog 2-like [Citrus sinensis]
Length=441

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 136/202 (67%), Gaps = 25/202 (12%)
 Frame = +3

Query  39   PLFENaaaasamaipaMDSRMFT----GSNLNSASLD-QNIGRMENQMAGSGLQAQYMDP  203
            PL+ENAAAASAMA   +D+R       G N+ +A+ + Q++ R+ N  AGS LQA  MDP
Sbjct  10   PLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAAELQSMNRLGNHTAGSALQAPLMDP  69

Query  204  MYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLS  356
            +Y+QYL        Q AS NDP+MD   +GNSY DLL  QKAY+G++LSPQKSQY VP  
Sbjct  70   LYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQYGVPYL  126

Query  357  SKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNF  536
            +K+ GS ++  YGNP F +G+SYPG     P++PNSPVG GSP+R  D NMR   GMRN 
Sbjct  127  NKS-GSLNNNLYGNPAFGLGMSYPGG----PLLPNSPVGSGSPVRHGDRNMRFPSGMRNL  181

Query  537  GVGVIGPWNLD---NMENSFAS  593
              GV+GPW+ +   +++ SFAS
Sbjct  182  SGGVMGPWHSEAGGSLDESFAS  203



>ref|XP_010685712.1| PREDICTED: pumilio homolog 2-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=1028

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 129/199 (65%), Gaps = 20/199 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSR-----MFTGSNLNSASLDQNIGRMENQMA  170
            +  Q GN+NL PL EN AAASAM +  +DSR     M +G NL +++     GR+ N M+
Sbjct  481  MGNQLGNFNLPPLLENVAAASAMGVHGLDSRVMAGGMPSGQNLTASA---ESGRLGNPMS  537

Query  171  GSGLQAQYMDPMYIQYLLQFASH------NDPSMDRNYLGNSYTDLLQKAYVGSMLSPQK  332
            G+ LQA   D MY+QYL            ND S D+ Y+     +LLQKAY+GS++SPQK
Sbjct  538  GNALQASLADAMYLQYLRSAEYAAQAAAMNDQSPDKYYM-----ELLQKAYLGSVMSPQK  592

Query  333  SQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            SQ+  P+ +K+ GS +HGYYGN  + VG+ YPGS LTSPVIPNSP G GSPIR +DY+MR
Sbjct  593  SQFGAPMGNKSGGS-NHGYYGNHAYGVGMGYPGSPLTSPVIPNSPGGAGSPIRHNDYSMR  651

Query  513  VGGGMRNFGVGVIGPWNLD  569
                MRN G G + PW+LD
Sbjct  652  YPSAMRNLGSGAMAPWHLD  670



>ref|XP_010685713.1| PREDICTED: pumilio homolog 2-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=1026

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 129/199 (65%), Gaps = 20/199 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSR-----MFTGSNLNSASLDQNIGRMENQMA  170
            +  Q GN+NL PL EN AAASAM +  +DSR     M +G NL +++     GR+ N M+
Sbjct  481  MGNQLGNFNLPPLLENVAAASAMGVHGLDSRVMAGGMPSGQNLTASA---ESGRLGNPMS  537

Query  171  GSGLQAQYMDPMYIQYLLQFASH------NDPSMDRNYLGNSYTDLLQKAYVGSMLSPQK  332
            G+ LQA   D MY+QYL            ND S D+ Y+     +LLQKAY+GS++SPQK
Sbjct  538  GNALQASLADAMYLQYLRSAEYAAQAAAMNDQSPDKYYM-----ELLQKAYLGSVMSPQK  592

Query  333  SQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            SQ+  P+ +K+ GS +HGYYGN  + VG+ YPGS LTSPVIPNSP G GSPIR +DY+MR
Sbjct  593  SQFGAPMGNKSGGS-NHGYYGNHAYGVGMGYPGSPLTSPVIPNSPGGAGSPIRHNDYSMR  651

Query  513  VGGGMRNFGVGVIGPWNLD  569
                MRN G G + PW+LD
Sbjct  652  YPSAMRNLGSGAMAPWHLD  670



>ref|XP_004486985.1| PREDICTED: pumilio homolog 2-like [Cicer arietinum]
Length=1050

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 139/210 (66%), Gaps = 16/210 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTG---SNLNSASLDQNIGRMENQMAGS  176
            ++ Q G  NL PLFEN AAASAMA P MDSR+  G   S + S S   ++ R+ N +A  
Sbjct  490  MANQLGTGNLPPLFENVAAASAMASPGMDSRILGGGLASGVASPSDVHSLSRIGNPIASG  549

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA ++DPMY+QY+        Q A+ NDPS+DRNYLGNSY ++L  QKAY+GS+LSPQ
Sbjct  550  ALQAPFVDPMYLQYMRTPEYATAQLAALNDPSVDRNYLGNSYMNILELQKAYLGSLLSPQ  609

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KS YNVP+  K+ GS HHGYYGN  + VGLSYPGS + + +  +     GSPIR +D NM
Sbjct  610  KSPYNVPMGGKSGGSNHHGYYGNAAYGVGLSYPGSPMANSLSSSPVG-SGSPIRHNDLNM  668

Query  510  RVGGGMRNFGVGVIGPWNLD--NMENSFAS  593
                GMRN   GV+G W+LD  N + +FAS
Sbjct  669  HFASGMRNV-AGVMGQWHLDAGNADENFAS  697



>ref|XP_006486391.1| PREDICTED: pumilio homolog 1-like [Citrus sinensis]
Length=1034

 Score =   159 bits (401),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 140/208 (67%), Gaps = 25/208 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFT----GSNLNSASLD-QNIGRMENQMAGSGLQ  185
            G+ NL PL+ENAAAASAMA   +D+R       G N+ +A+ + Q++ R+ N  AGS LQ
Sbjct  482  GSGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAAELQSMNRLGNHTAGSALQ  541

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            A  MDP+Y+QYL        Q AS NDP+MD   +GNSY DLL  QKAY+G++LSPQKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y VP  +K+ GS ++  YGNP F +G+SYPG     P++PNSPVG GSP+R  D NMR  
Sbjct  599  YGVPYLNKS-GSLNNNLYGNPAFGLGMSYPGG----PLLPNSPVGSGSPVRHGDRNMRFP  653

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             GMRN   GV+GPW+ +   +++ SFAS
Sbjct  654  SGMRNLSGGVMGPWHSEAGGSLDESFAS  681



>ref|XP_006435646.1| hypothetical protein CICLE_v10030588mg [Citrus clementina]
 gb|ESR48886.1| hypothetical protein CICLE_v10030588mg [Citrus clementina]
Length=1034

 Score =   159 bits (401),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 140/208 (67%), Gaps = 25/208 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFT----GSNLNSASLD-QNIGRMENQMAGSGLQ  185
            G+ NL PL+ENAAAASAMA   +D+R       G N+ +A+ + Q++ R+ N  AGS LQ
Sbjct  482  GSGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAAELQSMNRLGNHTAGSALQ  541

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            A  MDP+Y+QYL        Q AS NDP+MD   +GNSY DLL  QKAY+G++LSPQKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y VP  +K+ GS ++  YGNP F +G+SYPG     P++PNSPVG GSP+R  D NMR  
Sbjct  599  YGVPYLNKS-GSLNNNLYGNPAFGLGMSYPGG----PLLPNSPVGSGSPVRHGDRNMRFP  653

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             GMRN   GV+GPW+ +   +++ SFAS
Sbjct  654  SGMRNLSGGVMGPWHSEAGGSLDESFAS  681



>gb|KDO69136.1| hypothetical protein CISIN_1g001588mg [Citrus sinensis]
Length=1034

 Score =   159 bits (401),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 140/208 (67%), Gaps = 25/208 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFT----GSNLNSASLD-QNIGRMENQMAGSGLQ  185
            G+ NL PL+ENAAAASAMA   +D+R       G N+ +A+ + Q++ R+ N  AGS LQ
Sbjct  482  GSGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAAELQSMNRLGNHTAGSALQ  541

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            A  MDP+Y+QYL        Q AS NDP+MD   +GNSY DLL  QKAY+G++LSPQKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y VP  +K+ GS ++  YGNP F +G+SYPG     P++PNSPVG GSP+R  D NMR  
Sbjct  599  YGVPYLNKS-GSLNNNLYGNPAFGLGMSYPGG----PLLPNSPVGSGSPVRHGDRNMRFP  653

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             GMRN   GV+GPW+ +   +++ SFAS
Sbjct  654  SGMRNLSGGVMGPWHSEAGGSLDESFAS  681



>ref|XP_006435647.1| hypothetical protein CICLE_v10030588mg [Citrus clementina]
 gb|ESR48887.1| hypothetical protein CICLE_v10030588mg [Citrus clementina]
Length=967

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 140/208 (67%), Gaps = 25/208 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFT----GSNLNSASLD-QNIGRMENQMAGSGLQ  185
            G+ NL PL+ENAAAASAMA   +D+R       G N+ +A+ + Q++ R+ N  AGS LQ
Sbjct  482  GSGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAAELQSMNRLGNHTAGSALQ  541

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            A  MDP+Y+QYL        Q AS NDP+MD   +GNSY DLL  QKAY+G++LSPQKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y VP  +K+ GS ++  YGNP F +G+SYPG     P++PNSPVG GSP+R  D NMR  
Sbjct  599  YGVPYLNKS-GSLNNNLYGNPAFGLGMSYPGG----PLLPNSPVGSGSPVRHGDRNMRFP  653

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             GMRN   GV+GPW+ +   +++ SFAS
Sbjct  654  SGMRNLSGGVMGPWHSEAGGSLDESFAS  681



>gb|KDO69138.1| hypothetical protein CISIN_1g001588mg [Citrus sinensis]
 gb|KDO69139.1| hypothetical protein CISIN_1g001588mg [Citrus sinensis]
Length=967

 Score =   158 bits (400),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 140/208 (67%), Gaps = 25/208 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFT----GSNLNSASLD-QNIGRMENQMAGSGLQ  185
            G+ NL PL+ENAAAASAMA   +D+R       G N+ +A+ + Q++ R+ N  AGS LQ
Sbjct  482  GSGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAAELQSMNRLGNHTAGSALQ  541

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            A  MDP+Y+QYL        Q AS NDP+MD   +GNSY DLL  QKAY+G++LSPQKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y VP  +K+ GS ++  YGNP F +G+SYPG     P++PNSPVG GSP+R  D NMR  
Sbjct  599  YGVPYLNKS-GSLNNNLYGNPAFGLGMSYPGG----PLLPNSPVGSGSPVRHGDRNMRFP  653

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             GMRN   GV+GPW+ +   +++ SFAS
Sbjct  654  SGMRNLSGGVMGPWHSEAGGSLDESFAS  681



>gb|KDO69140.1| hypothetical protein CISIN_1g001588mg [Citrus sinensis]
Length=904

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 140/208 (67%), Gaps = 25/208 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFT----GSNLNSASLD-QNIGRMENQMAGSGLQ  185
            G+ NL PL+ENAAAASAMA   +D+R       G N+ +A+ + Q++ R+ N  AGS LQ
Sbjct  482  GSGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAAELQSMNRLGNHTAGSALQ  541

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            A  MDP+Y+QYL        Q AS NDP+MD   +GNSY DLL  QKAY+G++LSPQKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y VP  +K+ GS ++  YGNP F +G+SYPG     P++PNSPVG GSP+R  D NMR  
Sbjct  599  YGVPYLNKS-GSLNNNLYGNPAFGLGMSYPGG----PLLPNSPVGSGSPVRHGDRNMRFP  653

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             GMRN   GV+GPW+ +   +++ SFAS
Sbjct  654  SGMRNLSGGVMGPWHSEAGGSLDESFAS  681



>ref|XP_006435648.1| hypothetical protein CICLE_v10030588mg [Citrus clementina]
 gb|ESR48888.1| hypothetical protein CICLE_v10030588mg [Citrus clementina]
Length=904

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 140/208 (67%), Gaps = 25/208 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFT----GSNLNSASLD-QNIGRMENQMAGSGLQ  185
            G+ NL PL+ENAAAASAMA   +D+R       G N+ +A+ + Q++ R+ N  AGS LQ
Sbjct  482  GSGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAAELQSMNRLGNHTAGSALQ  541

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            A  MDP+Y+QYL        Q AS NDP+MD   +GNSY DLL  QKAY+G++LSPQKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y VP  +K+ GS ++  YGNP F +G+SYPG     P++PNSPVG GSP+R  D NMR  
Sbjct  599  YGVPYLNKS-GSLNNNLYGNPAFGLGMSYPGG----PLLPNSPVGSGSPVRHGDRNMRFP  653

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             GMRN   GV+GPW+ +   +++ SFAS
Sbjct  654  SGMRNLSGGVMGPWHSEAGGSLDESFAS  681



>gb|KDO69137.1| hypothetical protein CISIN_1g001588mg [Citrus sinensis]
Length=1049

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 140/208 (67%), Gaps = 25/208 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFT----GSNLNSASLD-QNIGRMENQMAGSGLQ  185
            G+ NL PL+ENAAAASAMA   +D+R       G N+ +A+ + Q++ R+ N  AGS LQ
Sbjct  482  GSGNLPPLYENAAAASAMAGNGLDARTLASLGLGPNVMAAAAELQSMNRLGNHTAGSALQ  541

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            A  MDP+Y+QYL        Q AS NDP+MD   +GNSY DLL  QKAY+G++LSPQKSQ
Sbjct  542  APLMDPLYLQYLRSNEYAAAQVASLNDPAMD---IGNSYMDLLGLQKAYLGALLSPQKSQ  598

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y VP  +K+ GS ++  YGNP F +G+SYPG     P++PNSPVG GSP+R  D NMR  
Sbjct  599  YGVPYLNKS-GSLNNNLYGNPAFGLGMSYPGG----PLLPNSPVGSGSPVRHGDRNMRFP  653

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             GMRN   GV+GPW+ +   +++ SFAS
Sbjct  654  SGMRNLSGGVMGPWHSEAGGSLDESFAS  681



>ref|XP_009343723.1| PREDICTED: pumilio homolog 2-like [Pyrus x bretschneideri]
 ref|XP_009343732.1| PREDICTED: pumilio homolog 2-like [Pyrus x bretschneideri]
Length=1035

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 135/208 (65%), Gaps = 21/208 (10%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFTGSNLN-----SASLDQNIGRMENQMAGSGLQ  185
            GN +L PLFENAAAASAM    +DS  F G +L      +A+  QNI R+ N   GS LQ
Sbjct  477  GNGSLPPLFENAAAASAMGG--LDSGAFGGMSLGPNLLAAATELQNI-RLGNHGGGSALQ  533

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
               MDP+Y+QYL        Q A+ NDP+ DR  +GN+Y DLL  QKAY+G +LSPQKSQ
Sbjct  534  VPMMDPLYVQYLRSNEYAAAQLAALNDPTKDREGMGNTYMDLLGLQKAYLGQLLSPQKSQ  593

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            +  P   ++ GS +HGYYGNP +  G+SY G+ L  P++PNSPVGPGSP R  + N+R  
Sbjct  594  FGAPYIGRS-GSLNHGYYGNPSYVHGMSYSGTPLGGPLLPNSPVGPGSPARHGERNLRFS  652

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             G+RN G G++G W+ +   N++ SFAS
Sbjct  653  SGLRNMGGGLMGAWHSENGGNLDESFAS  680



>ref|XP_008343532.1| PREDICTED: pumilio homolog 2-like [Malus domestica]
Length=960

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 134/208 (64%), Gaps = 21/208 (10%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFTGSNLN-----SASLDQNIGRMENQMAGSGLQ  185
            GN +L PLFENAAAASAM    +DS  F G +L      +A+  QNI R+ N   GS LQ
Sbjct  469  GNGSLPPLFENAAAASAMGG--LDSGAFGGMSLGPNLLAAAAELQNI-RVGNHGGGSALQ  525

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
               MDP+Y+QYL        Q A+ NDP+ DR  +GN+Y DLL  QKAY+G +LSPQKSQ
Sbjct  526  VPMMDPLYVQYLRSNEYAAAQLAALNDPTKDREGMGNTYMDLLGLQKAYLGQLLSPQKSQ  585

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            +  P   K+ GS +HGYYGNP +  G+SY G+ L  P++PNSPVGPGSP R  + N+R  
Sbjct  586  FGAPYIGKS-GSLNHGYYGNPAYGHGMSYSGTPLGGPLLPNSPVGPGSPARHGERNLRFS  644

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             G+RN G  ++G W+ +   N++ SFAS
Sbjct  645  SGLRNMGGSLMGAWHSENGGNLDESFAS  672



>emb|CBI31647.3| unnamed protein product [Vitis vinifera]
Length=874

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 120/186 (65%), Gaps = 18/186 (10%)
 Frame = +3

Query  87   MDSRMF-----TGSNLNSASLDQNIGRMENQMAGSGLQAQYMDPMYIQYL-------LQF  230
            MDSR        G NL +A+ +    R+ N   G+ LQ   +DP+Y+QYL        Q 
Sbjct  337  MDSRALGGGLNLGPNLMAAASELQNLRVGNHTTGNALQVPVVDPLYLQYLRSAEYAATQG  396

Query  231  ASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPG  404
             + NDP+MDR Y+G+SY DLL  QKAY+G++L+ QKSQY VP   K+  S +HGYYGNP 
Sbjct  397  VALNDPTMDREYMGSSYMDLLGLQKAYLGALLTSQKSQYGVPYLGKS-SSMNHGYYGNPQ  455

Query  405  FRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD---NM  575
            F +G+SYPGS L  P++PNSPVG GSP+R ++ NMR   GMRN   GV+G W+ +   N+
Sbjct  456  FGLGMSYPGSPLAGPLLPNSPVGSGSPVRHNERNMRFPSGMRNLAGGVMGAWHSEAGGNL  515

Query  576  ENSFAS  593
            +++F S
Sbjct  516  DDNFVS  521



>ref|XP_009351433.1| PREDICTED: pumilio homolog 1-like [Pyrus x bretschneideri]
Length=1022

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 133/208 (64%), Gaps = 21/208 (10%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMF----TGSNLNSASLD-QNIGRMENQMAGSGLQ  185
            GN +L PLFENAAAASAM    +DS  F     G NL +A+ + QNI R+ N   GS LQ
Sbjct  464  GNGSLPPLFENAAAASAMGG--LDSGAFGGMSLGPNLLAAAAELQNI-RVGNHGTGSALQ  520

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
               MDP+Y+QYL        Q A+ NDP+ DR  +G+ Y DLL  QKAY+G  LSPQKSQ
Sbjct  521  VPMMDPLYVQYLRSNEYAAAQLAALNDPTKDREGMGSMYMDLLGLQKAYLGQFLSPQKSQ  580

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            +  P   K+  S +HGYYGNP +  G+SY G+ L  P++PNSPVGPGSP R  + N+R  
Sbjct  581  FGAPYVGKS-ASLNHGYYGNPAYGHGMSYSGTPLGGPLLPNSPVGPGSPARHGERNLRFS  639

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             G+RN G G++G W+ +   N++ SFAS
Sbjct  640  SGLRNMGGGLMGAWHSETGGNLDESFAS  667



>emb|CDP00123.1| unnamed protein product [Coffea canephora]
Length=992

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 134/210 (64%), Gaps = 18/210 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFT-GSNLNSASLD-QNIGRMENQMAGSG  179
            L  Q G  N LPL EN AAA AM    +DSR  T G NL +A+ + QN+GR+ NQ + S 
Sbjct  433  LGNQLGGGNPLPLIENIAAARAMG---VDSRGVTLGPNLLAAAAELQNLGRVGNQNSASA  489

Query  180  LQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQK  332
            LQ   MDP+Y+QYL          A+ NDP +DR  +GNS+ +LL  QK+Y+ ++L  QK
Sbjct  490  LQMPLMDPLYLQYLKSTEYAAAHAAALNDPMLDRESVGNSFMELLEMQKSYLETLLLHQK  549

Query  333  SQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            S Y++P   K  G+ +HGYYGNPGF +G+SY G+ L   ++PNSP+G GSP+R  + NMR
Sbjct  550  SHYSLPYLGK-AGNPNHGYYGNPGFGLGMSYAGNQLGGQLLPNSPIGSGSPVRHGERNMR  608

Query  513  VGGGMRNFGVGVIGPWNLD---NMENSFAS  593
               GMRNF   V+G W+LD    +E SFAS
Sbjct  609  FPSGMRNFTGNVMGSWHLDLGSGLEESFAS  638



>gb|KDP44922.1| hypothetical protein JCGZ_01422 [Jatropha curcas]
Length=497

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 11/143 (8%)
 Frame = +3

Query  195  MDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYNVPL  353
            MDP+Y+QYL        Q A+ NDPSMDR YLGNSY DLLQKAY+G+++SPQKSQY V  
Sbjct  1    MDPLYLQYLRSNEYAAAQLATLNDPSMDREYLGNSYMDLLQKAYLGALVSPQKSQYGVSY  60

Query  354  SSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRN  533
              K+ GS +H YYG+P F +G+SYPGS + +P++ +SP+G GSP+R +D N+R   G+ N
Sbjct  61   LGKS-GSLNHNYYGSPTFGLGMSYPGSPIGAPLLASSPIGSGSPVRHNDRNIRFTAGISN  119

Query  534  FGVGVIGPWNLD---NMENSFAS  593
               GV+G W+ +   N++ SF S
Sbjct  120  LSGGVMGSWHSESVGNLDESFPS  142



>ref|XP_007009257.1| Pumilio 2 isoform 4, partial [Theobroma cacao]
 gb|EOY18067.1| Pumilio 2 isoform 4, partial [Theobroma cacao]
Length=698

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 126/211 (60%), Gaps = 35/211 (17%)
 Frame = +3

Query  15   QRGNYNLLPLFENaaaasamaipaMDSRMFTGS-----NLNSASLD-QNIGRMENQMAGS  176
            Q G  +L PLFEN AA SAM    ++SR   G      NL +A+++ QN+ R+ N  +G+
Sbjct  469  QLGTGSLPPLFENVAALSAMGGTGLESRALAGGLAMNPNLMAAAVELQNLSRLGNHNSGN  528

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA  +DP+Y+QYL        Q A+ ND  +DR Y GNSY DLL  QKAY+G++LSPQ
Sbjct  529  ALQAPLLDPLYLQYLRSNELAAAQVAALNDAMVDREYSGNSYMDLLGIQKAYLGALLSPQ  588

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KS                 YYGNP   +G+SYPGS L  P+ P+S VG GSP+R S+ NM
Sbjct  589  KS-----------------YYGNPALALGMSYPGSPLAGPLFPSSAVGSGSPVRHSERNM  631

Query  510  RVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            R   G+RN   GV+G W+ +   N++ SFAS
Sbjct  632  RFASGLRNVPGGVMGAWHSEAAGNLDESFAS  662



>ref|XP_008371890.1| PREDICTED: pumilio homolog 2-like [Malus domestica]
Length=1024

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 132/208 (63%), Gaps = 21/208 (10%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFTGSNLN-----SASLDQNIGRMENQMAGSGLQ  185
            GN +L PLFENAAAASAM    +DS  F G +L      +A+  QNI R+ N   GS LQ
Sbjct  466  GNGSLPPLFENAAAASAMGG--LDSGAFGGMSLGPNLLAAAAELQNI-RVGNHGTGSALQ  522

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
               MDP+Y+QYL        Q A+ NDP+ DR  +G+ + DLL  QKAY+G  L+PQKSQ
Sbjct  523  VPMMDPLYVQYLRSNEYAAAQLAALNDPTKDREGMGSMHMDLLGLQKAYLGQFLTPQKSQ  582

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            +  P   K+  S ++GYYGNP +  G+SY G+ L  P++PNSPVGPGSP R  + N+R  
Sbjct  583  FGAPYVGKS-ASLNNGYYGNPAYGHGMSYSGTPLGGPLLPNSPVGPGSPARHGERNLRFS  641

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             G+RN G G++G W+ +   N++ SFAS
Sbjct  642  SGLRNMGGGLVGAWHSETGGNLDESFAS  669



>ref|XP_007009254.1| Pumilio 2 isoform 1 [Theobroma cacao]
 gb|EOY18064.1| Pumilio 2 isoform 1 [Theobroma cacao]
Length=1016

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 126/211 (60%), Gaps = 35/211 (17%)
 Frame = +3

Query  15   QRGNYNLLPLFENaaaasamaipaMDSRMFTGS-----NLNSASLD-QNIGRMENQMAGS  176
            Q G  +L PLFEN AA SAM    ++SR   G      NL +A+++ QN+ R+ N  +G+
Sbjct  469  QLGTGSLPPLFENVAALSAMGGTGLESRALAGGLAMNPNLMAAAVELQNLSRLGNHNSGN  528

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA  +DP+Y+QYL        Q A+ ND  +DR Y GNSY DLL  QKAY+G++LSPQ
Sbjct  529  ALQAPLLDPLYLQYLRSNELAAAQVAALNDAMVDREYSGNSYMDLLGIQKAYLGALLSPQ  588

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KS                 YYGNP   +G+SYPGS L  P+ P+S VG GSP+R S+ NM
Sbjct  589  KS-----------------YYGNPALALGMSYPGSPLAGPLFPSSAVGSGSPVRHSERNM  631

Query  510  RVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            R   G+RN   GV+G W+ +   N++ SFAS
Sbjct  632  RFASGLRNVPGGVMGAWHSEAAGNLDESFAS  662



>ref|XP_007009255.1| Pumilio 2 isoform 2 [Theobroma cacao]
 gb|EOY18065.1| Pumilio 2 isoform 2 [Theobroma cacao]
Length=703

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 120/203 (59%), Gaps = 32/203 (16%)
 Frame = +3

Query  15   QRGNYNLLPLFENaaaasamaipaMDSRMFTGS-----NLNSASLD-QNIGRMENQMAGS  176
            Q G  +L PLFEN AA SAM    ++SR   G      NL +A+++ QN+ R+ N  +G+
Sbjct  238  QLGTGSLPPLFENVAALSAMGGTGLESRALAGGLAMNPNLMAAAVELQNLSRLGNHNSGN  297

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA  +DP+Y+QYL        Q A+ ND  +DR Y GNSY DLL  QKAY+G++LSPQ
Sbjct  298  ALQAPLLDPLYLQYLRSNELAAAQVAALNDAMVDREYSGNSYMDLLGIQKAYLGALLSPQ  357

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KS                 YYGNP   +G+SYPGS L  P+ P+S VG GSP+R S+ NM
Sbjct  358  KS-----------------YYGNPALALGMSYPGSPLAGPLFPSSAVGSGSPVRHSERNM  400

Query  510  RVGGGMRNFGVGVIGPWNLDNME  578
            R   G+RN   GV+G W+ +  E
Sbjct  401  RFASGLRNVPGGVMGAWHSEAAE  423



>ref|XP_007009256.1| Pumilio 2 isoform 3, partial [Theobroma cacao]
 gb|EOY18066.1| Pumilio 2 isoform 3, partial [Theobroma cacao]
Length=710

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 120/203 (59%), Gaps = 32/203 (16%)
 Frame = +3

Query  15   QRGNYNLLPLFENaaaasamaipaMDSRMFTGS-----NLNSASLD-QNIGRMENQMAGS  176
            Q G  +L PLFEN AA SAM    ++SR   G      NL +A+++ QN+ R+ N  +G+
Sbjct  469  QLGTGSLPPLFENVAALSAMGGTGLESRALAGGLAMNPNLMAAAVELQNLSRLGNHNSGN  528

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             LQA  +DP+Y+QYL        Q A+ ND  +DR Y GNSY DLL  QKAY+G++LSPQ
Sbjct  529  ALQAPLLDPLYLQYLRSNELAAAQVAALNDAMVDREYSGNSYMDLLGIQKAYLGALLSPQ  588

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KS                 YYGNP   +G+SYPGS L  P+ P+S VG GSP+R S+ NM
Sbjct  589  KS-----------------YYGNPALALGMSYPGSPLAGPLFPSSAVGSGSPVRHSERNM  631

Query  510  RVGGGMRNFGVGVIGPWNLDNME  578
            R   G+RN   GV+G W+ +  E
Sbjct  632  RFASGLRNVPGGVMGAWHSEAAE  654



>ref|XP_010906595.1| PREDICTED: pumilio homolog 2-like isoform X1 [Elaeis guineensis]
Length=1031

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 126/210 (60%), Gaps = 24/210 (11%)
 Frame = +3

Query  15   QRGNYNLLPLFENaaaasamaipaMDSR-----MFTGSNLNSASLDQNIGRMENQMAGSG  179
            Q G  NL  LFENA A SA      DSR     +F   +L S +  QN+GR+ NQ A + 
Sbjct  476  QIGTGNLPSLFENAVATSAPVSLGTDSRALGGGIFAPPHLTSHTDLQNLGRIGNQTAAT-  534

Query  180  LQAQYMDPMYIQYLLQF-------ASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQK  332
            LQ+   DP+Y+QYL          AS N+PS++  ++GNSY DLL  QKAY G++L PQK
Sbjct  535  LQSPIADPLYVQYLKAAEYTAQVAASRNNPSVETGFVGNSYMDLLGFQKAYAGALLQPQK  594

Query  333  SQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
             QY +PL  K   SG  G+YGNP F +G+SYPG+ L SP+I  SPVGPGSP+R  + +M+
Sbjct  595  -QYGMPLLDK---SGAQGFYGNPAFGLGMSYPGNPLASPII--SPVGPGSPLRHGERHMQ  648

Query  513  VGGGMRNFGVGVIGPWNLD---NMENSFAS  593
               G+RN    V+  W+ D   NM+  F S
Sbjct  649  FASGLRNLTGSVMSSWHCDPTGNMDEKFLS  678



>ref|XP_010906596.1| PREDICTED: pumilio homolog 2-like isoform X2 [Elaeis guineensis]
Length=985

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 126/210 (60%), Gaps = 24/210 (11%)
 Frame = +3

Query  15   QRGNYNLLPLFENaaaasamaipaMDSR-----MFTGSNLNSASLDQNIGRMENQMAGSG  179
            Q G  NL  LFENA A SA      DSR     +F   +L S +  QN+GR+ NQ A + 
Sbjct  430  QIGTGNLPSLFENAVATSAPVSLGTDSRALGGGIFAPPHLTSHTDLQNLGRIGNQTAAT-  488

Query  180  LQAQYMDPMYIQYLLQF-------ASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQK  332
            LQ+   DP+Y+QYL          AS N+PS++  ++GNSY DLL  QKAY G++L PQK
Sbjct  489  LQSPIADPLYVQYLKAAEYTAQVAASRNNPSVETGFVGNSYMDLLGFQKAYAGALLQPQK  548

Query  333  SQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
             QY +PL  K   SG  G+YGNP F +G+SYPG+ L SP+I  SPVGPGSP+R  + +M+
Sbjct  549  -QYGMPLLDK---SGAQGFYGNPAFGLGMSYPGNPLASPII--SPVGPGSPLRHGERHMQ  602

Query  513  VGGGMRNFGVGVIGPWNLD---NMENSFAS  593
               G+RN    V+  W+ D   NM+  F S
Sbjct  603  FASGLRNLTGSVMSSWHCDPTGNMDEKFLS  632



>ref|XP_008777335.1| PREDICTED: pumilio homolog 2-like isoform X1 [Phoenix dactylifera]
Length=1035

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 133/208 (64%), Gaps = 25/208 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSR-----MFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            G  NL  LFENAAAA+++++   DSR     +F   +L S +  QN+G++ NQ A S LQ
Sbjct  483  GTGNLPSLFENAAAAASVSLG-TDSRALGGGIFAPPHLTSHAELQNLGQIGNQTAAS-LQ  540

Query  186  AQYMDPMYIQYLLQF-------ASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            +   DP+YIQYL          AS N+PS++  ++GNSY DLL  QKAYVG++L PQK Q
Sbjct  541  SPLADPLYIQYLKAAEYTAQVAASRNNPSVETGFVGNSYMDLLGLQKAYVGALLQPQK-Q  599

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y +PL  K   SG  G+YGNP F +G++YPG+ L SP+   SPVGPGSP+R  + NM+  
Sbjct  600  YGMPLLGK---SGAQGFYGNPAFGLGMAYPGNPLASPIA--SPVGPGSPLRHGERNMQFP  654

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             G+RN    V+GPW+ D   NM+ +F S
Sbjct  655  SGLRNLTGSVMGPWHCDPAGNMDENFLS  682



>ref|XP_008777342.1| PREDICTED: pumilio homolog 2-like isoform X2 [Phoenix dactylifera]
Length=989

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 133/208 (64%), Gaps = 25/208 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSR-----MFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            G  NL  LFENAAAA+++++   DSR     +F   +L S +  QN+G++ NQ A S LQ
Sbjct  437  GTGNLPSLFENAAAAASVSLGT-DSRALGGGIFAPPHLTSHAELQNLGQIGNQTAAS-LQ  494

Query  186  AQYMDPMYIQYLLQF-------ASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            +   DP+YIQYL          AS N+PS++  ++GNSY DLL  QKAYVG++L PQK Q
Sbjct  495  SPLADPLYIQYLKAAEYTAQVAASRNNPSVETGFVGNSYMDLLGLQKAYVGALLQPQK-Q  553

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y +PL  K   SG  G+YGNP F +G++YPG+ L SP+   SPVGPGSP+R  + NM+  
Sbjct  554  YGMPLLGK---SGAQGFYGNPAFGLGMAYPGNPLASPIA--SPVGPGSPLRHGERNMQFP  608

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
             G+RN    V+GPW+ D   NM+ +F S
Sbjct  609  SGLRNLTGSVMGPWHCDPAGNMDENFLS  636



>ref|XP_010557243.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
Length=919

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 123/196 (63%), Gaps = 25/196 (13%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGS-GL  182
            +++Q G+ N   L+ N AAASA+ +  +DSR+F G NL+ +    N+GR+ NQM G   L
Sbjct  384  MASQLGSGNFPHLYGNVAAASALGLSGVDSRLFGGQNLSES---HNLGRVSNQMTGGVAL  440

Query  183  QAQYMDPMYIQYL------LQFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYN  344
            Q+   +PMY+QYL       Q A++ND SM+R +LGNSY +LL+          QKSQY 
Sbjct  441  QSPLSNPMYLQYLKTSDYAAQLAANNDLSMERGFLGNSYMNLLEL---------QKSQY-  490

Query  345  VPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGG  524
                 K+ GS HHGYYG+P F   +SYPGS L S VIP+S VGP SP+R S  NMR   G
Sbjct  491  -----KSGGSNHHGYYGSPTFGSSMSYPGSPLASHVIPDSLVGPASPMRRSGVNMRYPSG  545

Query  525  MRNFGVGVIGPWNLDN  572
            MRN+  GV+ PW++D 
Sbjct  546  MRNYAGGVMEPWHMDT  561



>ref|XP_004236737.1| PREDICTED: pumilio homolog 1-like [Solanum lycopersicum]
Length=1024

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 110/175 (63%), Gaps = 14/175 (8%)
 Frame = +3

Query  108  GSNLNSASLD-QNIGRMENQMAGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRN  263
            G NL +A+ + QN+ R+ NQ  G  L    MDP+Y+QYL        Q A+ NDP+++R 
Sbjct  496  GPNLMAAAAELQNLNRLGNQTLGGSLPMSQMDPLYLQYLRSPEYLAAQLAALNDPTVNRE  555

Query  264  YLGNSYTDL--LQKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSL  437
             LG SY +L  LQKAY+ ++++ QKSQY +P   K+ G  +HGYYGNP   + +SYPGS 
Sbjct  556  SLGTSYMELIELQKAYLETLVASQKSQYGIPYLGKS-GGLNHGYYGNPALGLNMSYPGSP  614

Query  438  LTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWN---LDNMENSFAS  593
            L    +PNSP GPGSP+R  + NMR   GMRN   GV+G W+   + NM  +FAS
Sbjct  615  LAGAGLPNSPFGPGSPVRYGERNMRFHSGMRNLAGGVMGAWHSEAVSNMGETFAS  669



>ref|XP_010096599.1| Pumilio-2-like protein [Morus notabilis]
 gb|EXB65267.1| Pumilio-2-like protein [Morus notabilis]
Length=966

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 133/209 (64%), Gaps = 25/209 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFTG------SNLNSASLDQNIGRMENQMAGSGL  182
            G+ NL PLFE+AAAAS M    +DS  F G      S L  A+  QN GR+ N   G  L
Sbjct  450  GSGNLPPLFESAAAASGMGG--LDSGAFGGGLALGPSMLAVAAELQNAGRVGNHSGGMPL  507

Query  183  QAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKS  335
                MDP+Y+QYL        Q A+ ND +MDR  +GN+Y D+  LQKAY+G++LSPQKS
Sbjct  508  ----MDPLYLQYLRSNEYAAAQAAALNDATMDREGMGNTYMDIFGLQKAYLGALLSPQKS  563

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            Q+ VP   K+  S +HGYYGNP F +G+SYPGS L  P++PNSPVG GSP+R S+ N+R 
Sbjct  564  QFAVPYMGKS-SSLNHGYYGNPAFGLGMSYPGSPLGGPLLPNSPVGSGSPVRHSERNLRY  622

Query  516  GGGMRNFGVGVIGPWNLD---NMENSFAS  593
              GMRN   G++G W+ +   N+++ F S
Sbjct  623  SSGMRNMAGGLMGGWHAEAGGNLDDGFPS  651



>ref|XP_006346707.1| PREDICTED: pumilio homolog 1-like [Solanum tuberosum]
Length=1025

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 109/175 (62%), Gaps = 14/175 (8%)
 Frame = +3

Query  108  GSNLNSASLD-QNIGRMENQMAGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRN  263
            G NL +A+ + QN+ R+ NQ  G  L    MDP+Y+QYL        Q A+ NDP+++R 
Sbjct  497  GPNLMAAAAELQNLNRLGNQTLGGSLPMSQMDPLYLQYLRSPEYLAAQLAALNDPTVNRE  556

Query  264  YLGNSYTDL--LQKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSL  437
             LG SY +L  LQKAY+ ++++ Q SQY +P   K+ G  +HGYYGNP   + +SYPGS 
Sbjct  557  SLGTSYMELIELQKAYLETLVASQNSQYGIPYLGKS-GGLNHGYYGNPALGLSMSYPGSP  615

Query  438  LTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWN---LDNMENSFAS  593
            L    +PNSP GPGSP+R  + NMR   GMRN   GV+G W+   + N+  +FAS
Sbjct  616  LAGAGLPNSPFGPGSPVRYGERNMRFHSGMRNLAGGVMGAWHSEAVSNLGETFAS  670



>ref|XP_009795986.1| PREDICTED: pumilio homolog 1-like [Nicotiana sylvestris]
Length=1012

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 113/186 (61%), Gaps = 18/186 (10%)
 Frame = +3

Query  87   MDSRMFTGS-----NLNSASLDQNIGRMENQMAGSGLQAQYMDPMYIQYL-------LQF  230
            +D+R   GS     NL +A+ +    R+ NQ  G  LQ   MDP+Y+QYL        Q 
Sbjct  474  IDARATGGSLSLGPNLLAAAAELQNLRLGNQTLGGSLQMSQMDPLYLQYLRSTEYHAAQL  533

Query  231  ASHNDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPG  404
            A+ NDP+++R  LG SY DL  LQKAY+ ++L+ Q SQY +P   K+ G  +HGYYGN  
Sbjct  534  AALNDPTVNRESLGTSYMDLIELQKAYLETLLASQNSQYGLPYLGKS-GGLNHGYYGNAA  592

Query  405  FRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLDNMEN-  581
              + +SYPGS L   V+PNSP GPGSP+R  + NMR   GMRN   GV+G W+ +++ N 
Sbjct  593  NGLNMSYPGSPLAGAVLPNSPFGPGSPVRYGERNMRFPSGMRNLAGGVMGAWHSESVSNL  652

Query  582  --SFAS  593
              SFAS
Sbjct  653  GESFAS  658



>ref|XP_010690975.1| PREDICTED: pumilio homolog 1-like [Beta vulgaris subsp. vulgaris]
Length=1047

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 129/208 (62%), Gaps = 19/208 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            ++ Q G+  L PLFENAAA++      MDSR   GS  + A++      ++N +   G Q
Sbjct  490  MAGQLGSGALPPLFENAAASAIGVGG-MDSRALGGSASSRANMMAAAAELQN-LGRGGSQ  547

Query  186  AQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            +Q +DP+Y+ YL        Q A+ +DPS+D    GNSY DLL  QKAY+GS+LSPQKS+
Sbjct  548  SQ-LDPLYMHYLSSNDYTAAQLAALSDPSVDG---GNSYMDLLTLQKAYLGSLLSPQKSE  603

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
               P   K+ G  +HGYYGNP F +G +Y G+ L S ++PNSPVGPGSP+R  + NMR+ 
Sbjct  604  CGRPYLGKSTGL-NHGYYGNPAFGIGTAYAGNHLASSLLPNSPVGPGSPLRHGERNMRLP  662

Query  519  GGMRNFGVGVIGPWNLDN---MENSFAS  593
             GMRN   G++G W  +    ME+SF S
Sbjct  663  SGMRNLAGGMMGNWRSETGGFMEHSFGS  690



>ref|XP_008785558.1| PREDICTED: pumilio homolog 2-like [Phoenix dactylifera]
Length=1042

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 127/208 (61%), Gaps = 22/208 (11%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSR-----MFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            G  NL  LFE A+AA+A     MD R     +F   NL S +  QN+GR+ NQ A + LQ
Sbjct  487  GTGNLPSLFETASAAAASVSLGMDCRGLGGGIFAPPNLTSQADLQNLGRIGNQTA-TALQ  545

Query  186  AQYMDPMYIQYLLQF-------ASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            +   DP+Y+QYL          A+H++P+ +  ++GNSY DLL  QKAY G++L PQK Q
Sbjct  546  SPLADPLYVQYLKAVEYTAQVAATHSNPAAETGFVGNSYMDLLGLQKAYGGTLLQPQK-Q  604

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y +PL  K+ G+ +  +YGNP F +G+SYPGS L SP+   SPVGPGSP+R  + NMR  
Sbjct  605  YGMPLLGKS-GALNQSFYGNPAFGLGMSYPGSPLASPIA--SPVGPGSPLRHGERNMRFP  661

Query  519  GGMRNFGVGVIGPWNL---DNMENSFAS  593
             G+RN    V+G W+     NM+ +F S
Sbjct  662  SGLRNLTGSVMGSWHCGPTGNMDENFPS  689



>ref|XP_008372362.1| PREDICTED: pumilio homolog 1-like [Malus domestica]
Length=550

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 96/143 (67%), Gaps = 13/143 (9%)
 Frame = +3

Query  201  PMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPL  353
            P+Y+QYL        Q A+ NDP+ DR  +GN+Y DLL  QKAY+G +LSPQKSQ+  P 
Sbjct  54   PLYVQYLRSNEYAAAQLAALNDPTKDREGMGNTYMDLLGLQKAYLGQLLSPQKSQFGAPY  113

Query  354  SSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRN  533
              K+ GS +HGYYGNP +  G+SY G+ L  P++PNSPVGPGSP R  + N+R   G+RN
Sbjct  114  IGKS-GSLNHGYYGNPAYGHGMSYSGTPLGGPLLPNSPVGPGSPARHGERNLRFSSGLRN  172

Query  534  FGVGVIGPWNLD---NMENSFAS  593
             G  ++G W+ +   N++ SFAS
Sbjct  173  MGGSLMGAWHSENGGNLDESFAS  195



>ref|XP_002316273.2| hypothetical protein POPTR_0010s20870g [Populus trichocarpa]
 gb|EEF02444.2| hypothetical protein POPTR_0010s20870g [Populus trichocarpa]
Length=973

 Score =   135 bits (340),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 126/204 (62%), Gaps = 20/204 (10%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMF--TGSNLNSASLD-QNIGRMENQMAGSGLQAQ  191
            GN +L PLFENAAAA+      +DSR     G NL + + + QN  R+ N  AG  L   
Sbjct  422  GNGSLPPLFENAAAAAMAGTG-LDSRALGALGPNLMATAAELQNHSRLGNHTAGLPL---  477

Query  192  YMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYNVP  350
             +DP+Y+QYL        Q A+ NDP +DR Y+GN+Y DLLQK  + +++S QKSQY VP
Sbjct  478  -VDPLYLQYLRSNEYAAAQLAALNDPMLDREYVGNAY-DLLQKLQLETLMSSQKSQYGVP  535

Query  351  LSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMR  530
               K+ GS +H YYGNPGF +G+SY GS L  P++PNS VG G P+R S+ NM     MR
Sbjct  536  YLGKS-GSLNHNYYGNPGFGLGMSYSGSPLGGPLLPNSSVGSGGPLRHSERNMLFSPAMR  594

Query  531  NFGVGVIGPWNLD---NMENSFAS  593
            N   GV+G W+ +   N++ SF S
Sbjct  595  NLSGGVMGSWHSEAGSNLDESFPS  618



>ref|XP_009597728.1| PREDICTED: pumilio homolog 1-like isoform X1 [Nicotiana tomentosiformis]
Length=1010

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 112/186 (60%), Gaps = 18/186 (10%)
 Frame = +3

Query  87   MDSRMFTGS-----NLNSASLDQNIGRMENQMAGSGLQAQYMDPMYIQYL-------LQF  230
            +D+R   GS     NL +A+ +    R+ NQ  G  LQ   MDP+Y+QYL        Q 
Sbjct  472  IDARATGGSLSLGPNLLAAAAELQNLRLGNQTLGGSLQMSQMDPLYLQYLRSTEYHAAQL  531

Query  231  ASHNDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPG  404
            A+ NDP+++R  LG SY DL  LQKAY+ ++L+ Q SQY +P   K+ G  +HGYYGN  
Sbjct  532  AALNDPTVNRESLGTSYMDLIELQKAYLETLLASQNSQYGLPYLGKS-GGLNHGYYGNTA  590

Query  405  FRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLDNMEN-  581
              + +SYPGS L   V+PNSP GPGSP+R  + NM    GMRN   GV+G W+ +++ N 
Sbjct  591  NGLNMSYPGSPLAGAVLPNSPFGPGSPVRYGERNMHFPSGMRNLAGGVMGAWHSESVSNL  650

Query  582  --SFAS  593
              SFAS
Sbjct  651  GESFAS  656



>ref|XP_009597729.1| PREDICTED: pumilio homolog 2-like isoform X2 [Nicotiana tomentosiformis]
Length=933

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 112/186 (60%), Gaps = 18/186 (10%)
 Frame = +3

Query  87   MDSRMFTGS-----NLNSASLDQNIGRMENQMAGSGLQAQYMDPMYIQYL-------LQF  230
            +D+R   GS     NL +A+ +    R+ NQ  G  LQ   MDP+Y+QYL        Q 
Sbjct  395  IDARATGGSLSLGPNLLAAAAELQNLRLGNQTLGGSLQMSQMDPLYLQYLRSTEYHAAQL  454

Query  231  ASHNDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPG  404
            A+ NDP+++R  LG SY DL  LQKAY+ ++L+ Q SQY +P   K+ G  +HGYYGN  
Sbjct  455  AALNDPTVNRESLGTSYMDLIELQKAYLETLLASQNSQYGLPYLGKS-GGLNHGYYGNTA  513

Query  405  FRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLDNMEN-  581
              + +SYPGS L   V+PNSP GPGSP+R  + NM    GMRN   GV+G W+ +++ N 
Sbjct  514  NGLNMSYPGSPLAGAVLPNSPFGPGSPVRYGERNMHFPSGMRNLAGGVMGAWHSESVSNL  573

Query  582  --SFAS  593
              SFAS
Sbjct  574  GESFAS  579



>ref|XP_011016453.1| PREDICTED: pumilio homolog 1-like isoform X1 [Populus euphratica]
Length=990

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 125/204 (61%), Gaps = 20/204 (10%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMF--TGSNLNSASLD-QNIGRMENQMAGSGLQAQ  191
            GN +L PLFENAAAA+      +DSR     G NL + + + QN  R+ N  AG      
Sbjct  445  GNGSLPPLFENAAAAAMAGTG-LDSRALGALGPNLMATAAELQNHSRLGNHAAG----VP  499

Query  192  YMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYNVP  350
             +DP+Y+QYL        Q A+ NDP +DR Y+GN+Y DLLQK  + +++S QKSQY V 
Sbjct  500  VVDPLYLQYLRSNEYASAQLAALNDPMLDREYVGNAY-DLLQKLQLETLMSSQKSQYGVA  558

Query  351  LSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMR  530
               K+ GS +H YYGN GF +G+SY GS L  P++PNS VG G P+R S+ NMR    MR
Sbjct  559  YLGKS-GSLNHNYYGNTGFGLGMSYSGSPLGGPLLPNSSVGSGGPLRHSERNMRFSPAMR  617

Query  531  NFGVGVIGPWNLD---NMENSFAS  593
            N   GV+G W+ D   N++ SF+S
Sbjct  618  NLSGGVMGSWHSDAGSNLDESFSS  641



>ref|XP_011016454.1| PREDICTED: pumilio homolog 1-like isoform X2 [Populus euphratica]
Length=883

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 125/204 (61%), Gaps = 20/204 (10%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMF--TGSNLNSASLD-QNIGRMENQMAGSGLQAQ  191
            GN +L PLFENAAAA+      +DSR     G NL + + + QN  R+ N  AG      
Sbjct  445  GNGSLPPLFENAAAAAMAGTG-LDSRALGALGPNLMATAAELQNHSRLGNHAAG----VP  499

Query  192  YMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYNVP  350
             +DP+Y+QYL        Q A+ NDP +DR Y+GN+Y DLLQK  + +++S QKSQY V 
Sbjct  500  VVDPLYLQYLRSNEYASAQLAALNDPMLDREYVGNAY-DLLQKLQLETLMSSQKSQYGVA  558

Query  351  LSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMR  530
               K+ GS +H YYGN GF +G+SY GS L  P++PNS VG G P+R S+ NMR    MR
Sbjct  559  YLGKS-GSLNHNYYGNTGFGLGMSYSGSPLGGPLLPNSSVGSGGPLRHSERNMRFSPAMR  617

Query  531  NFGVGVIGPWNLD---NMENSFAS  593
            N   GV+G W+ D   N++ SF+S
Sbjct  618  NLSGGVMGSWHSDAGSNLDESFSS  641



>ref|XP_010418800.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
Length=1253

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 123/204 (60%), Gaps = 14/204 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQM--A  170
            +++Q G  N  P++EN +AASAM    MDSR+  G  ++S    S  +N+GR  N+M   
Sbjct  802  MASQLGTNNYSPMYENVSAASAMGFSGMDSRLHGGGYVSSGQNLSESRNLGRFSNRMMGG  861

Query  171  GSGLQAQYMDPMYIQYLLQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYN  344
            G+GLQ+   DPMY QY       NDPSMDRN++GNSY  +L  Q+AY+G+    QKSQY 
Sbjct  862  GAGLQSHMADPMYHQYADSLDLLNDPSMDRNFMGNSYMGMLELQRAYLGA----QKSQYG  917

Query  345  VPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGG  524
            VP  S +  S  H  YG+P F   +SYPGS L   ++PNS V P SP+R  + NMR    
Sbjct  918  VPYKSGSPNS--HSDYGSPTFASNMSYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSA  975

Query  525  MRNFGVGVIGPWNLDN-MENSFAS  593
             RN+  GV+G W++D  ++  F S
Sbjct  976  TRNYAGGVVGSWHMDTCLDEGFGS  999


 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 119/195 (61%), Gaps = 13/195 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQM--A  170
            +++Q G  N  P++EN +AASAM    MDSR+  G  ++S    S  +N+GR  N+M   
Sbjct  390  MASQLGTNNYSPMYENVSAASAMGFSGMDSRLHGGGYVSSGQNLSESRNLGRFSNRMMGG  449

Query  171  GSGLQAQYMDPMYIQYLLQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYN  344
            G+GLQ+   DPMY QY       NDPSMDRN++GNSY ++L  Q+AY+G+    QKSQY 
Sbjct  450  GAGLQSHMADPMYHQYADSLDLLNDPSMDRNFMGNSYMNMLELQRAYLGA----QKSQYG  505

Query  345  VPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGG  524
            VP  S +  S  H  YG+P F   +SYPGS L   ++PNS V P SP+R  + NMR    
Sbjct  506  VPYKSGSPNS--HSDYGSPTFASNMSYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSA  563

Query  525  MRNFGVGVIGPWNLD  569
             RN+  GV+G W +D
Sbjct  564  TRNYPGGVMGSWPMD  578



>ref|XP_010067428.1| PREDICTED: pumilio homolog 1-like [Eucalyptus grandis]
 gb|KCW65554.1| hypothetical protein EUGRSUZ_G02951 [Eucalyptus grandis]
Length=990

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 132/215 (61%), Gaps = 20/215 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTG------SNLNSASLDQNIGRMENQM  167
            +S+Q  + NL PLF+N AAASA+ +  +D R   G      +++ +A+  QN+ R     
Sbjct  424  MSSQLASGNLPPLFKNVAAASALGMNGLDPRALGGGSPLGPNSMAAAAELQNLSRAGAHA  483

Query  168  AGSGLQAQYMDPMYIQY-------LLQFASHNDPSM-DRNYLGNSYTDL--LQKAYVGSM  317
             G+GLQ   M P Y+QY         Q  +  DP++ DR  +G+SY D   LQKAY+  +
Sbjct  484  TGNGLQFPLMGPSYLQYSRSNEYAAAQLTALGDPTLLDREGMGDSYMDFMGLQKAYLDLL  543

Query  318  LSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCS  497
            LS QKSQY +P   K+ GS +HGYYGN    +G+SYPG+ L SP++P+SP+G GSP+R  
Sbjct  544  LSSQKSQYGIPYLGKS-GSFNHGYYGNLACGMGMSYPGNQLGSPLLPSSPLGCGSPVRHG  602

Query  498  DYNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            + N+R   G+RN G GV+G W+ +   N++ SF+S
Sbjct  603  ERNVRFSSGLRNLGGGVMGAWHSEAGSNLDESFSS  637



>ref|XP_011032451.1| PREDICTED: pumilio homolog 1-like isoform X2 [Populus euphratica]
Length=790

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 105/169 (62%), Gaps = 16/169 (9%)
 Frame = +3

Query  117  LNSASLDQNIGRMENQMAGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGN  275
            + SA+  QN+ R  NQ AG  L    +DP+Y+QYL        Q A+ NDP +DR Y GN
Sbjct  273  MASAAELQNLSRFGNQTAGVPL----VDPLYLQYLRSDEYAAAQLAALNDPMLDREYAGN  328

Query  276  SYTDLLQKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVI  455
            +Y DLLQK  + ++LS QKSQY VP   K+ GS +H YYGN GF +G+SY GS L  PV+
Sbjct  329  AY-DLLQKLQLETLLSSQKSQYGVPYLGKS-GSLNHNYYGNTGFGLGMSYSGSPLGGPVL  386

Query  456  PNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            PN   G G P+R S+ NMR   GMRN   GV+G W+ +   N++ SF S
Sbjct  387  PNLLTGSGGPVRHSERNMRFSPGMRNLSGGVMGSWHSEAGSNLDESFPS  435



>ref|XP_011002642.1| PREDICTED: pumilio homolog 1-like [Populus euphratica]
Length=1000

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 127/209 (61%), Gaps = 25/209 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMF--TGSNLNSASLD-QNIGRMENQMAGSGLQAQ  191
            GN +L PLFENAAAA+      +DSR     G NL + + + QN  R+ N  AG  L   
Sbjct  444  GNGSLPPLFENAAAAAMAGTG-LDSRALGALGPNLMATAAELQNHSRLGNHTAGVPL---  499

Query  192  YMDPMYIQYL------------LQFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKS  335
             +DP+Y+QYL             Q A+ NDP +DR Y+GN+Y DLLQK  + +++S QKS
Sbjct  500  -VDPLYLQYLRSNEYASAQLSAAQLAALNDPMLDREYVGNAY-DLLQKLQLETLMSSQKS  557

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
            QY VP   K+ GS +H YYGN GF +G+SY GS L  P++PNS VG G P+R S+ NMR 
Sbjct  558  QYGVPYLGKS-GSLNHNYYGNTGFGLGMSYSGSPLGGPLLPNSSVGSGGPLRHSERNMRF  616

Query  516  GGGMRNFGVGVIGPWNLD---NMENSFAS  593
               MRN   GVIG W+ D   N++ SF+S
Sbjct  617  SPAMRNLSGGVIGSWHSDAGSNLDESFSS  645



>ref|XP_010922284.1| PREDICTED: pumilio homolog 2-like [Elaeis guineensis]
Length=1010

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 122/196 (62%), Gaps = 19/196 (10%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSR-----MFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            G  NL  LFE+A+AA+A     MD R     +F   NL + +  QN+GR+ NQ A + LQ
Sbjct  455  GTGNLPSLFESASAAAASVSLGMDYRGLGGGIFAPPNLTNQADLQNLGRIGNQTAAA-LQ  513

Query  186  AQYMDPMYIQYLLQF-------ASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            +   DP+Y+QYL          ASH++PS++  + GNSY DLL  QKAYVG++L PQK Q
Sbjct  514  SPLADPLYVQYLKAVEYTAQVAASHSNPSVETGFAGNSYMDLLGLQKAYVGTLLQPQK-Q  572

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y VPL  K+ G+ +  +YG+P F +G+SYP S L SP+   SPVGPGSP+R  + NMR  
Sbjct  573  YGVPLLGKS-GALNQSFYGSPAFGLGMSYPVSPLASPIA--SPVGPGSPLRHGERNMRFP  629

Query  519  GGMRNFGVGVIGPWNL  566
             G+RN    V+G W+ 
Sbjct  630  SGLRNLPGSVMGSWHC  645



>ref|XP_009795340.1| PREDICTED: pumilio homolog 1-like isoform X2 [Nicotiana sylvestris]
Length=693

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 121/214 (57%), Gaps = 20/214 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGS-----NLNSASLD-QNIGRMENQM  167
            L  Q G  N   LFEN +A + M    +D R   G      NL +A+ + QNI R++ Q 
Sbjct  420  LENQLGGGNFPSLFENISAGATMGACGIDPRAMAGGLNFCPNLLAAAAELQNINRLDGQT  479

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
             GS LQ   +DPMY+QYL        Q ++ NDP+++R  LGNSY DLL  QKAY G++ 
Sbjct  480  LGSSLQIPQVDPMYLQYLRSTEYLSAQLSAVNDPTVNRESLGNSYMDLLELQKAYFGALF  539

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            + QKSQY +    K+ G  ++GYYGN    + +SYPGS L    + NSP  PGSPIR  +
Sbjct  540  ASQKSQYGLSCLGKS-GGINNGYYGNIALGINMSYPGSPLAGAALHNSPFWPGSPIRYGE  598

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NM    GMRN   GV+G W+ +   N+  SF S
Sbjct  599  RNMHFPSGMRNLS-GVMGAWHSESGSNLGESFTS  631



>ref|XP_009795329.1| PREDICTED: pumilio homolog 1-like isoform X1 [Nicotiana sylvestris]
Length=703

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 121/214 (57%), Gaps = 20/214 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGS-----NLNSASLD-QNIGRMENQM  167
            L  Q G  N   LFEN +A + M    +D R   G      NL +A+ + QNI R++ Q 
Sbjct  430  LENQLGGGNFPSLFENISAGATMGACGIDPRAMAGGLNFCPNLLAAAAELQNINRLDGQT  489

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
             GS LQ   +DPMY+QYL        Q ++ NDP+++R  LGNSY DLL  QKAY G++ 
Sbjct  490  LGSSLQIPQVDPMYLQYLRSTEYLSAQLSAVNDPTVNRESLGNSYMDLLELQKAYFGALF  549

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            + QKSQY +    K+ G  ++GYYGN    + +SYPGS L    + NSP  PGSPIR  +
Sbjct  550  ASQKSQYGLSCLGKS-GGINNGYYGNIALGINMSYPGSPLAGAALHNSPFWPGSPIRYGE  608

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NM    GMRN   GV+G W+ +   N+  SF S
Sbjct  609  RNMHFPSGMRNLS-GVMGAWHSESGSNLGESFTS  641



>ref|XP_011032372.1| PREDICTED: pumilio homolog 1-like isoform X1 [Populus euphratica]
Length=993

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 105/169 (62%), Gaps = 16/169 (9%)
 Frame = +3

Query  117  LNSASLDQNIGRMENQMAGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGN  275
            + SA+  QN+ R  NQ AG  L    +DP+Y+QYL        Q A+ NDP +DR Y GN
Sbjct  476  MASAAELQNLSRFGNQTAGVPL----VDPLYLQYLRSDEYAAAQLAALNDPMLDREYAGN  531

Query  276  SYTDLLQKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVI  455
            +Y DLLQK  + ++LS QKSQY VP   K+ GS +H YYGN GF +G+SY GS L  PV+
Sbjct  532  AY-DLLQKLQLETLLSSQKSQYGVPYLGKS-GSLNHNYYGNTGFGLGMSYSGSPLGGPVL  589

Query  456  PNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            PN   G G P+R S+ NMR   GMRN   GV+G W+ +   N++ SF S
Sbjct  590  PNLLTGSGGPVRHSERNMRFSPGMRNLSGGVMGSWHSEAGSNLDESFPS  638



>gb|ABW81068.1| Mpt5-3 [Arabidopsis lyrata subsp. lyrata]
Length=968

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 129/210 (61%), Gaps = 20/210 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQM--A  170
            +++Q G  N  P++ENA+AASAM    MDSR+  G  ++S    S  +NIGR+ N+M   
Sbjct  404  MASQLGTNNYPPMYENASAASAMGFSGMDSRLHGGGFVSSGQNLSESRNIGRVGNRMMGG  463

Query  171  GSGLQAQYMDPMYIQYLL------QFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            G+GLQ+   DPMY QY         F   NDPSMDR+Y+GNSY ++L  Q+AY+G+    
Sbjct  464  GTGLQSHLADPMYHQYARFSENADSFDLLNDPSMDRSYMGNSYMNMLELQRAYLGA----  519

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKSQY +P  S +  S  H YYG+P F   +SYPGS L  P +PNS + P SP+R  + N
Sbjct  520  QKSQYGLPYKSGSPNS--HSYYGSPTFGSNMSYPGSPLAHPGMPNSLMSPYSPMRRGEVN  577

Query  507  MRVGGGMRNFGVGVIGPWNLD-NMENSFAS  593
            MR     RN+  GV+G W++D +++  F S
Sbjct  578  MRYPSATRNYSGGVMGSWHMDASLDEGFGS  607



>ref|XP_002879203.1| mpt5-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55462.1| mpt5-3 [Arabidopsis lyrata subsp. lyrata]
Length=973

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 129/210 (61%), Gaps = 20/210 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQM--A  170
            +++Q G  N  P++ENA+AASAM    MDSR+  G  ++S    S  +NIGR+ N+M   
Sbjct  414  MASQLGTNNYPPMYENASAASAMGFSGMDSRLHGGGFVSSGQNLSESRNIGRVGNRMMGG  473

Query  171  GSGLQAQYMDPMYIQYLL------QFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            G+GLQ+   DPMY QY         F   NDPSMDR+Y+GNSY ++L  Q+AY+G+    
Sbjct  474  GTGLQSHMADPMYHQYARFSENADSFDLLNDPSMDRSYMGNSYMNMLELQRAYLGA----  529

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKSQY +P  S +  S  H YYG+P F   +SYPGS L  P +PNS + P SP+R  + N
Sbjct  530  QKSQYGLPYKSGSPNS--HSYYGSPTFGSNMSYPGSPLAHPGMPNSLMSPYSPMRRGEVN  587

Query  507  MRVGGGMRNFGVGVIGPWNLD-NMENSFAS  593
            MR     RN+  GV+G W++D +++  F S
Sbjct  588  MRYPSATRNYSGGVMGSWHMDASLDEGFGS  617



>gb|ABW81111.1| putative pumilio Mpt5 [Boechera divaricarpa]
Length=975

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 128/211 (61%), Gaps = 22/211 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQM--A  170
            + +Q GN N  P++EN +AASA+    MDS+++ G  ++S    S  +N+GR  NQM   
Sbjct  416  MVSQLGNSNFSPMYENVSAASALGFSGMDSKLYGGGYVSSGQNLSESRNLGRFSNQMMGG  475

Query  171  GSGLQAQYMDPMYIQYLLQFASH-------NDPSMDRNYLGNSYTDLL--QKAYVGSMLS  323
            G GLQ+   DPMY QY  +F+ +       NDPSMDRN++GNSY  +L  Q+AY+G+   
Sbjct  476  GVGLQSHMADPMYHQYA-RFSENADALDLLNDPSMDRNFMGNSYMSMLELQRAYLGA---  531

Query  324  PQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDY  503
             QKSQY VP  S +  S  H  YG+P F   +SYPGS L   ++PNS V P SP+R  + 
Sbjct  532  -QKSQYGVPYKSGSPNS--HSDYGSPTFGSNMSYPGSPLAHHLLPNSLVSPCSPMRRGEV  588

Query  504  NMRVGGGMRNFGVGVIGPWNLD-NMENSFAS  593
            NMR     RN+  GV+G W++D +++  F S
Sbjct  589  NMRYPSTTRNYSGGVMGSWHMDASLDEGFGS  619



>ref|XP_006409965.1| hypothetical protein EUTSA_v10016189mg [Eutrema salsugineum]
 ref|XP_006409966.1| hypothetical protein EUTSA_v10016189mg [Eutrema salsugineum]
 gb|ESQ51418.1| hypothetical protein EUTSA_v10016189mg [Eutrema salsugineum]
 gb|ESQ51419.1| hypothetical protein EUTSA_v10016189mg [Eutrema salsugineum]
Length=969

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 117/194 (60%), Gaps = 15/194 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRM----FTGSNLNSASLDQNIGRMENQMAG  173
            +++Q G  N  P++E+ +AAS +    MD R+    F G NL+ +   +N+GR+ N+M  
Sbjct  424  MASQLGAGNFSPMYEDVSAASTLGFSGMDPRLHGRGFNGQNLSES---RNLGRINNRMMS  480

Query  174  SGLQAQYMDPMYIQYLLQFASHNDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKSQYNV  347
            +GLQ+   DPMY QY       NDP+MDR+++GNSY ++  LQ+AY+G+    QKSQY V
Sbjct  481  AGLQSHIADPMYHQYADSLDLLNDPAMDRSFMGNSYMNMLELQRAYLGA----QKSQYGV  536

Query  348  PLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGM  527
            P  S +  S  H YYG+P F   +SYPGS L   V+ NS V P SP+R  + NMR     
Sbjct  537  PYKSGSPNS--HSYYGSPTFGSNMSYPGSPLAHHVMHNSLVAPCSPMRRGEVNMRYPSAT  594

Query  528  RNFGVGVIGPWNLD  569
            RNF  G +  W++D
Sbjct  595  RNFSGGAMDSWHMD  608



>ref|XP_002881034.1| mpt5-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57293.1| mpt5-1 [Arabidopsis lyrata subsp. lyrata]
Length=969

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 124/204 (61%), Gaps = 14/204 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQM--A  170
            ++ Q GN N  P+++N +AASA+    MDSR+  G  ++S    S  +N+GR  N+M   
Sbjct  416  MANQLGNNNFSPMYDNVSAASALGFSGMDSRLHGGGFVSSGQNLSESRNLGRFSNRMMGG  475

Query  171  GSGLQAQYMDPMYIQYLLQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYN  344
            G+GLQ+   DPMY QY       NDPSMD N++G+SY  +L  Q+A++G+    QKSQY 
Sbjct  476  GTGLQSHMADPMYHQYADSLDLLNDPSMDMNFMGSSYMSMLELQRAFLGA----QKSQYG  531

Query  345  VPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGG  524
            +P  S +  S  H YYG+P F   +SYPGS L   ++PNS V P SP+R  + NMR    
Sbjct  532  LPYKSGSPNS--HSYYGSPTFGSNISYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSA  589

Query  525  MRNFGVGVIGPWNLD-NMENSFAS  593
             RN+  GV+G W++D +++  F S
Sbjct  590  ARNYSGGVMGSWHMDASLDEGFGS  613



>ref|XP_010469980.1| PREDICTED: pumilio homolog 2 [Camelina sativa]
 ref|XP_010469981.1| PREDICTED: pumilio homolog 2 [Camelina sativa]
Length=984

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 116/195 (59%), Gaps = 13/195 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQM--A  170
            +++Q G  N  P++EN +AASAM    MDSR+  G  ++S    S  +N GR  N+M   
Sbjct  431  MASQLGTNNYSPMYENVSAASAMGFSGMDSRLHGGGYVSSGQNLSESRNFGRFSNRMMGG  490

Query  171  GSGLQAQYMDPMYIQYLLQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYN  344
            G+GLQ+   DPMY QY       NDPSMDR ++GNSY  +L  Q+AY+G+    Q SQY 
Sbjct  491  GAGLQSHMADPMYHQYADSLDHLNDPSMDRIFMGNSYMGMLELQRAYLGA----QNSQYG  546

Query  345  VPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGG  524
            VP  S +  S  H  YG+P F   +SYPGS L   ++PNS V P SP+R  + NMR    
Sbjct  547  VPYKSGSPNS--HSDYGSPTFTSNMSYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSA  604

Query  525  MRNFGVGVIGPWNLD  569
             RN+  GVIG W++D
Sbjct  605  TRNYSGGVIGSWHMD  619



>ref|XP_009631474.1| PREDICTED: pumilio homolog 1-like isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009631475.1| PREDICTED: pumilio homolog 1-like isoform X3 [Nicotiana tomentosiformis]
Length=610

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 119/214 (56%), Gaps = 20/214 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGS-----NLNSASLD-QNIGRMENQM  167
            L  Q G  N   LFEN +A   M    +D R   G      NL +A+ + QNI R++ Q 
Sbjct  250  LENQLGGGNFPSLFENISAGVTMGACGIDPRAMAGGLNFCPNLLAAAAELQNINRLDGQT  309

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
             G  LQ   +DPMY+QYL        Q ++ NDP+++R  LG+SY DLL  QKAY G +L
Sbjct  310  LGRSLQIPQVDPMYLQYLRSTEYLSAQLSAVNDPTVNRESLGSSYMDLLELQKAYFGVLL  369

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            + QKS+Y +    K+ G  ++GYYGN    V +SYPGS L    + NSP  PGSP+R  +
Sbjct  370  ASQKSEYGLLCLGKS-GGLNNGYYGNIALGVNMSYPGSPLAGAALHNSPFWPGSPVRYGE  428

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NM    GMRN   GV+G W  +   N+  SFAS
Sbjct  429  RNMHFPSGMRNLS-GVMGAWYSESGSNLGESFAS  461



>gb|ABW81063.1| Mpt5-1 [Arabidopsis lyrata subsp. lyrata]
Length=969

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 124/204 (61%), Gaps = 14/204 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQM--A  170
            ++ Q GN N  P+++N +AASA+    MDSR+  G  ++S    S  +N+GR  N+M   
Sbjct  416  MANQLGNNNFSPMYDNVSAASALGFSGMDSRLHGGGFVSSGQNLSESRNLGRFSNRMMGG  475

Query  171  GSGLQAQYMDPMYIQYLLQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYN  344
            G+G+Q+   DPMY QY       NDPSMD N++G+SY  +L  Q+A++G+    QKSQY 
Sbjct  476  GTGIQSHMADPMYHQYADSLDLLNDPSMDMNFMGSSYMSMLELQRAFLGA----QKSQYG  531

Query  345  VPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGG  524
            +P  S +  S  H YYG+P F   +SYPGS L   ++PNS V P SP+R  + NMR    
Sbjct  532  LPYKSGSPNS--HSYYGSPTFGSNISYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSA  589

Query  525  MRNFGVGVIGPWNLD-NMENSFAS  593
             RN+  GV+G W++D +++  F S
Sbjct  590  ARNYSGGVMGSWHMDASLDEGFGS  613



>gb|KGN50567.1| hypothetical protein Csa_5G182720 [Cucumis sativus]
Length=1051

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 129/214 (60%), Gaps = 19/214 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTG-----SNLNSASLDQNIGRMENQMA  170
            + T  G+ NL PL+ENAAAASAM + A+++R F G     S L +AS  QN  R+EN  A
Sbjct  482  VGTHLGSGNLPPLYENAAAASAMGMSALNNRAFNGLALGSSMLETASEFQNNNRLENHNA  541

Query  171  GSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYL-GNSYTDLL--QKAYVGSML  320
             +G+Q   +DP YIQYL        Q    +DP +D + L GN Y DLL  QKAY+G++L
Sbjct  542  MNGMQLSGLDPSYIQYLGSNEYAAAQVGGISDPPLDSDSLMGNGYMDLLGVQKAYLGALL  601

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            SPQ SQ+ +P   K+ GS +H YYGNPG+ +G+SYPGS L   ++P SP G G+ +    
Sbjct  602  SPQNSQFVLPYFGKS-GSLNHNYYGNPGYGLGMSYPGSPLAGSLLPGSPAGSGNALNHIS  660

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
              +R   GMRNF  G +G W+ +   NM   F S
Sbjct  661  KALRFSSGMRNFAGGGLGGWHSEGGGNMNGGFVS  694



>ref|XP_004147681.1| PREDICTED: pumilio homolog 1-like [Cucumis sativus]
 ref|XP_004161912.1| PREDICTED: pumilio homolog 1-like [Cucumis sativus]
Length=1016

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 129/214 (60%), Gaps = 19/214 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTG-----SNLNSASLDQNIGRMENQMA  170
            + T  G+ NL PL+ENAAAASAM + A+++R F G     S L +AS  QN  R+EN  A
Sbjct  447  VGTHLGSGNLPPLYENAAAASAMGMSALNNRAFNGLALGSSMLETASEFQNNNRLENHNA  506

Query  171  GSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYL-GNSYTDLL--QKAYVGSML  320
             +G+Q   +DP YIQYL        Q    +DP +D + L GN Y DLL  QKAY+G++L
Sbjct  507  MNGMQLSGLDPSYIQYLGSNEYAAAQVGGISDPPLDSDSLMGNGYMDLLGVQKAYLGALL  566

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            SPQ SQ+ +P   K+ GS +H YYGNPG+ +G+SYPGS L   ++P SP G G+ +    
Sbjct  567  SPQNSQFVLPYFGKS-GSLNHNYYGNPGYGLGMSYPGSPLAGSLLPGSPAGSGNALNHIS  625

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
              +R   GMRNF  G +G W+ +   NM   F S
Sbjct  626  KALRFSSGMRNFAGGGLGGWHSEGGGNMNGGFVS  659



>ref|XP_010414430.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010414431.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010414432.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010414433.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
Length=984

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 121/201 (60%), Gaps = 19/201 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAG-  173
            ++ Q G  N  P++ENA+AASA+    MDSR+  G  ++S    S  +NIGR+ N+M G 
Sbjct  425  MAGQLGTNNYSPMYENASAASALGFSGMDSRLHGGGYVSSGQNLSEPRNIGRVGNRMTGG  484

Query  174  -SGLQAQYMDPMYIQY------LLQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
             +GLQ+   DPMY QY         F   NDP+MDRN++GNSY ++L  Q+AY+G+    
Sbjct  485  GAGLQSHMADPMYHQYGRFSDNADSFDLLNDPAMDRNFMGNSYVNMLELQRAYLGA----  540

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKSQY VP  S +  S  H YYG+P F   +SYPGS L    +PNS + P SP+R  + N
Sbjct  541  QKSQYGVPYKSGSPNS--HSYYGSPTFGSNMSYPGSPLAHHGMPNSLMSPYSPMRRGEVN  598

Query  507  MRVGGGMRNFGVGVIGPWNLD  569
            MR     RNF  GV+G W +D
Sbjct  599  MRYPSATRNFSGGVMGSWQMD  619



>ref|XP_009631472.1| PREDICTED: pumilio homolog 1-like isoform X1 [Nicotiana tomentosiformis]
Length=780

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 119/214 (56%), Gaps = 20/214 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGS-----NLNSASLD-QNIGRMENQM  167
            L  Q G  N   LFEN +A   M    +D R   G      NL +A+ + QNI R++ Q 
Sbjct  420  LENQLGGGNFPSLFENISAGVTMGACGIDPRAMAGGLNFCPNLLAAAAELQNINRLDGQT  479

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
             G  LQ   +DPMY+QYL        Q ++ NDP+++R  LG+SY DLL  QKAY G +L
Sbjct  480  LGRSLQIPQVDPMYLQYLRSTEYLSAQLSAVNDPTVNRESLGSSYMDLLELQKAYFGVLL  539

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            + QKS+Y +    K+ G  ++GYYGN    V +SYPGS L    + NSP  PGSP+R  +
Sbjct  540  ASQKSEYGLLCLGKS-GGLNNGYYGNIALGVNMSYPGSPLAGAALHNSPFWPGSPVRYGE  598

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NM    GMRN   GV+G W  +   N+  SFAS
Sbjct  599  RNMHFPSGMRNLS-GVMGAWYSESGSNLGESFAS  631



>gb|ABW81162.1| PMpt5-1 [Capsella rubella]
Length=961

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 129/208 (62%), Gaps = 21/208 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQM--AGSG  179
            +++Q GN N  P++EN +AASA+    MDSR+  G  + + S  +N+GR  N+M   G+G
Sbjct  420  MASQLGNTNFSPMYENVSAASALGFSGMDSRLHGG--VQNLSEPRNLGRFSNRMMGGGAG  477

Query  180  LQAQYMDPMYIQYLLQFASH-------NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQK  332
            LQ+  +DPMY QY  +F+ +       NDP+MDRN++ NSY ++L  Q+AY+G+    QK
Sbjct  478  LQSHMVDPMYNQYG-RFSENVDSLDLLNDPAMDRNFMNNSYMNMLELQRAYLGA----QK  532

Query  333  SQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            SQY VP  S +  S  H  YG+P F   +SYPGS L   ++PNS V P SP+R  + NMR
Sbjct  533  SQYGVPYKSGSPNS--HSDYGSPTFGSNMSYPGSPLAHHLLPNSLVSPCSPMRRGEVNMR  590

Query  513  VGGGMRNFGVGVIGPWNLD-NMENSFAS  593
                 RN+  GV+G W++D +++  F S
Sbjct  591  YPSATRNYPGGVMGAWHMDASLDEGFGS  618



>ref|XP_009631473.1| PREDICTED: pumilio homolog 1-like isoform X2 [Nicotiana tomentosiformis]
Length=760

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 119/214 (56%), Gaps = 20/214 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGS-----NLNSASLD-QNIGRMENQM  167
            L  Q G  N   LFEN +A   M    +D R   G      NL +A+ + QNI R++ Q 
Sbjct  420  LENQLGGGNFPSLFENISAGVTMGACGIDPRAMAGGLNFCPNLLAAAAELQNINRLDGQT  479

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
             G  LQ   +DPMY+QYL        Q ++ NDP+++R  LG+SY DLL  QKAY G +L
Sbjct  480  LGRSLQIPQVDPMYLQYLRSTEYLSAQLSAVNDPTVNRESLGSSYMDLLELQKAYFGVLL  539

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            + QKS+Y +    K+ G  ++GYYGN    V +SYPGS L    + NSP  PGSP+R  +
Sbjct  540  ASQKSEYGLLCLGKS-GGLNNGYYGNIALGVNMSYPGSPLAGAALHNSPFWPGSPVRYGE  598

Query  501  YNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
             NM    GMRN   GV+G W  +   N+  SFAS
Sbjct  599  RNMHFPSGMRNLS-GVMGAWYSESGSNLGESFAS  631



>ref|XP_010920533.1| PREDICTED: pumilio homolog 1-like [Elaeis guineensis]
Length=1048

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 117/196 (60%), Gaps = 18/196 (9%)
 Frame = +3

Query  30   NLLPLFENaaaasamaipaMDSRMF----TGSNLNSASLDQNIGRMENQMAGSGLQAQYM  197
            N+ PL ENA  AS MA P MD R      +GSN +  +  Q +  + N  A + LQ   +
Sbjct  503  NVPPLSENAPVASGMASPGMDFRATGGFSSGSNFSGVADLQTLNSIGNYTAAAALQMP-I  561

Query  198  DPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVP  350
            +P+Y+QYL          A+ NDPSM+R Y+GNSY DLL  Q+AY+G +L  Q  QY +P
Sbjct  562  NPLYVQYLRAAEYAAQVAANFNDPSMERGYMGNSYADLLGIQRAYLGLLLQ-QDKQYGMP  620

Query  351  LSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMR  530
               K  G  HHG+YGNP F  GL YPGS L+SPV+P SP GPGS +R S+ N+R+  G+R
Sbjct  621  FIGK-AGGLHHGFYGNPAF--GLGYPGSPLSSPVLPASPGGPGSSLRHSERNIRLSSGIR  677

Query  531  NFGVGVIGPWNLDNME  578
            N   G +G W  D  +
Sbjct  678  NSSGGAMGSWQSDRTD  693



>ref|XP_009381078.1| PREDICTED: pumilio homolog 2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=1057

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 124/208 (60%), Gaps = 22/208 (11%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSR-----MFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            G+ NL PLFE A AASA+A   M+SR     +F   NL   +  Q + R+ NQ A + LQ
Sbjct  507  GSGNLPPLFEGAVAASAVASG-MESRALGGGLFASPNLAGPADLQTLSRIGNQTAAAALQ  565

Query  186  AQYMDPMYIQYL------LQFASHN-DPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
                DP+Y+QYL       Q A++  DPS++R Y+GNSY DLL   KAYV S+L  Q++Q
Sbjct  566  TSLNDPLYVQYLKAAEYTAQIAANCCDPSLERGYMGNSYADLLGIPKAYVESLLQ-QENQ  624

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            YN+P  SK+ G  +H YYGNP F +G  YPGS L S +   SPVG GSP+  S+ NMR  
Sbjct  625  YNMPFLSKS-GRLNHSYYGNPAFGLGNLYPGSPLASSIA--SPVGHGSPLNLSERNMRFS  681

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
              +RN    V+G W+ D   N++  F S
Sbjct  682  SNLRNLSGSVLGSWHSDPTGNIDERFPS  709



>ref|XP_009381077.1| PREDICTED: pumilio homolog 2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1070

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 124/208 (60%), Gaps = 22/208 (11%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSR-----MFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            G+ NL PLFE A AASA+A   M+SR     +F   NL   +  Q + R+ NQ A + LQ
Sbjct  507  GSGNLPPLFEGAVAASAVASG-MESRALGGGLFASPNLAGPADLQTLSRIGNQTAAAALQ  565

Query  186  AQYMDPMYIQYL------LQFASHN-DPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
                DP+Y+QYL       Q A++  DPS++R Y+GNSY DLL   KAYV S+L  Q++Q
Sbjct  566  TSLNDPLYVQYLKAAEYTAQIAANCCDPSLERGYMGNSYADLLGIPKAYVESLLQ-QENQ  624

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            YN+P  SK+ G  +H YYGNP F +G  YPGS L S +   SPVG GSP+  S+ NMR  
Sbjct  625  YNMPFLSKS-GRLNHSYYGNPAFGLGNLYPGSPLASSIA--SPVGHGSPLNLSERNMRFS  681

Query  519  GGMRNFGVGVIGPWNLD---NMENSFAS  593
              +RN    V+G W+ D   N++  F S
Sbjct  682  SNLRNLSGSVLGSWHSDPTGNIDERFPS  709



>dbj|BAE98746.1| putative pumilio/Mpt5 family RNA-binding protein [Arabidopsis 
thaliana]
Length=736

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 123/204 (60%), Gaps = 17/204 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQM--A  170
            ++ Q G  N  P++ENA+AASAM    MDSR+  G  ++S    S  +N+GR  N+M   
Sbjct  422  MANQLGTNNYSPVYENASAASAMGFSGMDSRLHGGGYVSSGQNLSESRNLGRFSNRMMGG  481

Query  171  GSGLQAQYMDPMYIQYLLQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYN  344
            G+GLQ+   DPMY QY       NDPSMD N++GNSY ++L  Q+AY+G+    QKSQY 
Sbjct  482  GTGLQSHMADPMYHQYADSLDLLNDPSMDVNFMGNSYMNMLELQRAYLGA----QKSQYG  537

Query  345  VPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGG  524
            VP  S +  S  H  YG+P F    SYPGS L   ++PNS V P SP+R  + NMR    
Sbjct  538  VPYKSGSPNS--HTDYGSPTFG---SYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSA  592

Query  525  MRNFGVGVIGPWNLD-NMENSFAS  593
             RN+  GV+G W++D +++  F S
Sbjct  593  TRNYAGGVMGSWHMDASLDEGFGS  616



>ref|NP_180482.1| pumilio 2 [Arabidopsis thaliana]
 ref|NP_001189630.1| pumilio 2 [Arabidopsis thaliana]
 sp|Q9ZW06.1|PUM2_ARATH RecName: Full=Pumilio homolog 2; Short=APUM-2; Short=AtPUM2 [Arabidopsis 
thaliana]
 gb|AAC95216.1| putative pumilio/Mpt5 family RNA-binding protein [Arabidopsis 
thaliana]
 gb|AEC08220.1| pumilio 2 [Arabidopsis thaliana]
 gb|AEC08221.1| pumilio 2 [Arabidopsis thaliana]
Length=972

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 123/204 (60%), Gaps = 17/204 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQM--A  170
            ++ Q G  N  P++ENA+AASAM    MDSR+  G  ++S    S  +N+GR  N+M   
Sbjct  422  MANQLGTNNYSPVYENASAASAMGFSGMDSRLHGGGYVSSGQNLSESRNLGRFSNRMMGG  481

Query  171  GSGLQAQYMDPMYIQYLLQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYN  344
            G+GLQ+   DPMY QY       NDPSMD N++GNSY ++L  Q+AY+G+    QKSQY 
Sbjct  482  GTGLQSHMADPMYHQYADSLDLLNDPSMDVNFMGNSYMNMLELQRAYLGA----QKSQYG  537

Query  345  VPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGG  524
            VP  S +  S  H  YG+P F    SYPGS L   ++PNS V P SP+R  + NMR    
Sbjct  538  VPYKSGSPNS--HTDYGSPTFG---SYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSA  592

Query  525  MRNFGVGVIGPWNLD-NMENSFAS  593
             RN+  GV+G W++D +++  F S
Sbjct  593  TRNYAGGVMGSWHMDASLDEGFGS  616



>gb|AAM20149.1| putative pumilio/Mpt5 family RNA-binding protein [Arabidopsis 
thaliana]
Length=972

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 122/204 (60%), Gaps = 17/204 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQM--A  170
            ++ Q G  N  P++ENA+A SAM    MDSR+  G  ++S    S  +N+GR  N+M   
Sbjct  422  MANQLGTNNYSPVYENASATSAMGFSGMDSRLHGGGYVSSGQNLSESRNLGRFSNRMMGG  481

Query  171  GSGLQAQYMDPMYIQYLLQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYN  344
            G+GLQ+   DPMY QY       NDPSMD N++GNSY ++L  Q+AY+G+    QKSQY 
Sbjct  482  GTGLQSHMADPMYHQYADSLDLLNDPSMDVNFMGNSYMNMLELQRAYLGA----QKSQYG  537

Query  345  VPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGG  524
            VP  S +  S  H  YG+P F    SYPGS L   ++PNS V P SP+R  + NMR    
Sbjct  538  VPYKSGSPNS--HTDYGSPTFG---SYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSA  592

Query  525  MRNFGVGVIGPWNLD-NMENSFAS  593
             RN+  GV+G W++D +++  F S
Sbjct  593  TRNYAGGVMGSWHMDASLDEGFGS  616



>ref|XP_010510528.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010510530.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010510531.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010510532.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
Length=984

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 120/201 (60%), Gaps = 19/201 (9%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAG-  173
            ++ Q G  N  P++ENA+AASA     MDSR+  G  ++S    S  +NIGR+ N+M G 
Sbjct  425  MAGQLGTNNYSPMYENASAASAFGFSGMDSRLHGGGFVSSGQNLSEPRNIGRVGNRMMGG  484

Query  174  -SGLQAQYMDPMYIQY------LLQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
             +GLQ+   DPMY QY         F   NDPSMDR+++GNSY ++L  Q+AY+G+    
Sbjct  485  NAGLQSHMADPMYHQYGRFSDNADSFDLLNDPSMDRSFMGNSYMNMLELQRAYLGA----  540

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKSQY VP  S +  S  H Y+G+P F   +SYPGS L    +PNS + P SP+R  + N
Sbjct  541  QKSQYGVPYKSGSPNS--HSYFGSPTFGSNMSYPGSPLAHHGMPNSLMSPYSPMRRGEVN  598

Query  507  MRVGGGMRNFGVGVIGPWNLD  569
            MR     RNF  GV+G W +D
Sbjct  599  MRYPSATRNFSGGVMGSWQMD  619



>ref|XP_010937586.1| PREDICTED: pumilio homolog 1-like [Elaeis guineensis]
Length=1063

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 126/205 (61%), Gaps = 22/205 (11%)
 Frame = +3

Query  30   NLLPLFENaaaasamaipaMDSRMFTG-----SNLNSASLDQNIGRMENQMAGSGLQAQY  194
            NL PLF++AA AS MA P MDS    G     SN + A+  QN+ R+ N  A + LQ   
Sbjct  511  NLPPLFDSAAVASGMATPGMDSSAAGGGFSSESNFSGAADLQNLNRIGNHTAAAALQMP-  569

Query  195  MDPMYIQY--LLQFASH-----NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNV  347
            ++P+Y QY    ++A+      NDPSM+R YLGNSY+DLL  QKAY+G++L P + QY +
Sbjct  570  INPLYFQYSKAAEYAAQVPANFNDPSMERGYLGNSYSDLLGVQKAYLGALLQPWQ-QYGM  628

Query  348  PLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGM  527
            P   K+ G  +HG+YGNP F  GL YPGS L SPV   SPVGPGSP+R S+ +  +  G 
Sbjct  629  PSVGKS-GGLNHGFYGNPAF--GLGYPGSSLASPVFCASPVGPGSPLRYSESDTCLSSGR  685

Query  528  RNFGVGVIGPWNLD---NMENSFAS  593
            RN    V+G W  D    ME +FAS
Sbjct  686  RNSSRRVMGSWPSDGIGTMEENFAS  710



>ref|XP_006293626.1| hypothetical protein CARUB_v10022579mg [Capsella rubella]
 gb|EOA26524.1| hypothetical protein CARUB_v10022579mg [Capsella rubella]
Length=968

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/205 (41%), Positives = 119/205 (58%), Gaps = 20/205 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            ++ Q GN N  P+++N +AASA+    M SR+  G         +N+GR    M G GLQ
Sbjct  419  MANQLGNSNFSPMYDNYSAASALGYSGMGSRLHGG-----GFESRNLGRSNRMMGGGGLQ  473

Query  186  AQYMDPMYIQY------LLQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQY  341
            +   DPMY QY      +      NDP+MDR+++GNSY ++L  Q+AY+G+    QKSQY
Sbjct  474  SHMADPMYHQYGRYSENVDSLDLLNDPAMDRSFMGNSYMNMLELQRAYLGA----QKSQY  529

Query  342  NVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGG  521
             VP  S +  S  H YYG+P F   +SYPGS L    +PNS + P SP+R  + NMR   
Sbjct  530  GVPYKSGSPNS--HSYYGSPTFGSNMSYPGSPLAHHAMPNSLMSPCSPMRRGEVNMRYPS  587

Query  522  GMRNFGVGVIGPWNLD-NMENSFAS  593
              RN+  GV+GPW++D +++  F S
Sbjct  588  ATRNYSGGVMGPWHMDASLDEGFGS  612



>ref|XP_006343744.1| PREDICTED: pumilio homolog 1-like [Solanum tuberosum]
Length=982

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 120/211 (57%), Gaps = 20/211 (9%)
 Frame = +3

Query  15   QRGNYNLLPLFENaaaasamaipaMDSRMF-----TGSNLNSASLD-QNIGRMENQMAGS  176
            Q G  N   LFEN AA +AM    +D R        G NL + + + QNI R+ NQ  G 
Sbjct  421  QLGGGNFPSLFENIAAGAAMGACRIDPRAIGGGLNLGPNLLAVAAELQNINRLGNQTLGG  480

Query  177  GLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             +Q   MDPM++QYL        Q ++ NDP+++R  LGNSY DLL  QKAY+ ++L+ Q
Sbjct  481  SVQLCQMDPMHLQYLRSAEYLAAQLSAVNDPTVNRESLGNSYMDLLEIQKAYIEALLASQ  540

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNM  509
            KSQY+     K+ G  ++GYYGN G  V +SYPGS L S  + NSP GP S +R  +  +
Sbjct  541  KSQYDFSRIGKSCGF-NNGYYGNLGLGVNMSYPGSPLASASLENSPFGPDSYVRYGERYV  599

Query  510  RVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
                GMRN   GV+G W+ D   N+   FAS
Sbjct  600  HFPLGMRNLS-GVMGAWDSDPGSNLGECFAS  629



>gb|ABW81112.1| putative pumilio Mpt5-2 [Boechera divaricarpa]
Length=967

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 122/199 (61%), Gaps = 23/199 (12%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAG--SG  179
            +++Q GN N  P+++N +AASA+ I  MDSR+  G         +N+GR+ N+M G  +G
Sbjct  416  MASQLGNSNFSPMYDNYSAASALEISGMDSRLHGG-----GFESRNLGRVNNRMMGGAAG  470

Query  180  LQAQYMDPMYIQYLLQFASH-------NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQK  332
             Q+   DPMY +Y  +F+ +       NDP+MDRN++GNSY ++L  Q+AY+G+    QK
Sbjct  471  HQSHMADPMYHKYG-RFSENVDSLDLLNDPAMDRNFMGNSYMNMLELQRAYLGA----QK  525

Query  333  SQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            SQY VP  S +  S  H YYG+P F   +SYPGS L    +PNS + P SP+R  + NMR
Sbjct  526  SQYGVPYKSGSPNS--HSYYGSPTFGSNMSYPGSPLAHHAMPNSLMSPCSPMRRGEVNMR  583

Query  513  VGGGMRNFGVGVIGPWNLD  569
                 RN+  GV+G W++D
Sbjct  584  YPSATRNYSGGVMGSWHMD  602



>gb|ABW74568.1| Mpt5 [Boechera divaricarpa]
Length=970

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 127/210 (60%), Gaps = 20/210 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQM--A  170
            +++Q G  N  P++ENA+AASA+    MDSR+  G  ++S    S  +NIGR+ N+M   
Sbjct  411  MASQLGTNNYSPMYENASAASALGFSGMDSRLHEGGFVSSGQNLSESRNIGRVGNRMMGG  470

Query  171  GSGLQAQYMDPMYIQYLL------QFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            G+GLQ+   DPMY Q+         F   NDPS+DR+++GNSY ++L  Q+AY+G+    
Sbjct  471  GAGLQSHLADPMYPQFARFSENADSFDLLNDPSVDRSFMGNSYMNMLELQRAYLGA----  526

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKS Y +P  S +  S  H YYG+P F   +SYPGS L    +PNS + P SP+R  + N
Sbjct  527  QKSHYGLPYKSGSPNS--HSYYGSPTFGSNISYPGSPLAHHGMPNSLMSPYSPMRRGEVN  584

Query  507  MRVGGGMRNFGVGVIGPWNLD-NMENSFAS  593
            MR     RN+  GV+G W++D +++  F S
Sbjct  585  MRYPSATRNYSGGVMGSWHMDASLDEGFGS  614



>ref|XP_002311179.2| hypothetical protein POPTR_0008s05850g [Populus trichocarpa]
 gb|EEE88546.2| hypothetical protein POPTR_0008s05850g [Populus trichocarpa]
Length=999

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 105/174 (60%), Gaps = 21/174 (12%)
 Frame = +3

Query  117  LNSASLDQNIGRMENQMAGSGLQAQYMDPMYIQYL------------LQFASHNDPSMDR  260
            + SA+  QN+ R  NQ AG  L    +DP+Y+QYL             Q A+ N+P +DR
Sbjct  477  MASAAELQNLSRFGNQTAGVPL----VDPLYLQYLRSDEYAAAQLATAQLAALNEPMLDR  532

Query  261  NYLGNSYTDLLQKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLL  440
             Y+GN+Y DLLQK  + ++LS Q SQY VP   K+ GS +H YYGN GF +G+SY GS L
Sbjct  533  EYVGNAY-DLLQKLQLETLLSSQNSQYGVPYLGKS-GSLNHNYYGNTGFGLGMSYSGSPL  590

Query  441  TSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
              PV+PN   G G P+R S+ NMR   GMRN   GV+G W+ +   N++ SF S
Sbjct  591  GGPVLPNLLAGSGGPVRHSERNMRFSPGMRNLSGGVMGSWHSEAGSNLDESFPS  644



>ref|XP_009402270.1| PREDICTED: pumilio homolog 3-like [Musa acuminata subsp. malaccensis]
Length=1038

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 103/164 (63%), Gaps = 16/164 (10%)
 Frame = +3

Query  138  QNIGRMENQMAGSGLQAQYMDPMYIQYLLQF-------ASHNDPSMDRNYLGNSYTDL--  290
            QNI ++ NQ A + ++AQ  DP+Y+Q++          A++ D SM+R Y GNS  DL  
Sbjct  520  QNISQIGNQSAVAAVRAQLNDPLYVQHIRAAEYTAQVAATYGDSSMERGYTGNSCADLPG  579

Query  291  LQKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPV  470
            +QKA++ S+L  QK QY +PL  K+ GS + GYY NP F +GL+YPGS L   +  +SPV
Sbjct  580  IQKAHIESLLQSQK-QYGIPLLGKS-GSLNQGYYANPAFALGLAYPGSPLAGQI--DSPV  635

Query  471  GPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            GPGSP+R  + +M+   G+RN   G++G W+ D   NM+  F S
Sbjct  636  GPGSPLRLGERSMQFPYGLRNLNGGIMGAWHFDPTRNMDEHFPS  679



>ref|NP_180483.1| pumilio 1 [Arabidopsis thaliana]
 sp|Q9ZW07.1|PUM1_ARATH RecName: Full=Pumilio homolog 1; Short=APUM-1; Short=AtPUM1 [Arabidopsis 
thaliana]
 gb|AAC95215.1| putative pumilio/Mpt5 family RNA-binding protein [Arabidopsis 
thaliana]
 gb|AEC08222.1| pumilio 1 [Arabidopsis thaliana]
Length=968

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 118/199 (59%), Gaps = 23/199 (12%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSR------MFTGSNLNSASLDQNIGRMENQM  167
            ++ Q GN N  P+++N +A        MDSR      + +G NL+ +   +N+GR  N+M
Sbjct  417  MANQLGNNNFAPMYDNVSALGFSG---MDSRHHGRGFVSSGQNLSES---RNLGRFSNRM  470

Query  168  --AGSGLQAQYMDPMYIQYLLQFASHNDPSMDRNYLG-NSYTDLL--QKAYVGSMLSPQK  332
               G+GLQ+  +DPMY QY       NDPSMDRN++G +SY D+L  Q+AY+G+    QK
Sbjct  471  MGGGAGLQSHMVDPMYNQYADSLDLLNDPSMDRNFMGGSSYMDMLELQRAYLGA----QK  526

Query  333  SQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            SQY VP  S +  S  H YYG+P F   +SYPGS L    +PNS + P SP+R  + NMR
Sbjct  527  SQYGVPYKSGSPNS--HSYYGSPTFGSNMSYPGSPLAHHGMPNSLMSPYSPMRRDEVNMR  584

Query  513  VGGGMRNFGVGVIGPWNLD  569
                 RN+  G++G W++D
Sbjct  585  FPSATRNYSGGLMGSWHMD  603



>ref|XP_006293694.1| hypothetical protein CARUB_v10022652mg [Capsella rubella]
 gb|EOA26592.1| hypothetical protein CARUB_v10022652mg [Capsella rubella]
Length=811

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 118/205 (58%), Gaps = 20/205 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            ++ Q GN N  P+++N +AASA+    MDSR+  G         +N+GR    M G GLQ
Sbjct  262  MANQLGNSNFSPMYDNYSAASALGFSGMDSRLHGG-----GFESRNLGRSNRMMGGGGLQ  316

Query  186  AQYMDPMYIQY------LLQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQY  341
            +   DPMY QY      +      NDP+MDR+++GNSY ++L  Q+AY+G+    QKSQY
Sbjct  317  SHMADPMYHQYGRYSENVDALDLLNDPAMDRSFMGNSYMNMLELQRAYLGA----QKSQY  372

Query  342  NVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGG  521
             VP  S +  S  H YYG+P F   +SYPGS L    + NS + P SP+R  + NMR   
Sbjct  373  GVPYKSGSPNS--HSYYGSPTFGSNMSYPGSPLAHHAMQNSLMSPCSPMRRGEVNMRYPS  430

Query  522  GMRNFGVGVIGPWNLD-NMENSFAS  593
              RN+  GV+G W++D +++  F S
Sbjct  431  ATRNYSGGVMGSWHMDASLDEGFGS  455



>gb|ABW81161.1| unknown [Capsella rubella]
Length=991

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 118/205 (58%), Gaps = 20/205 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            ++ Q GN N  P+++N +AASA+    MDSR+  G         +N+GR    M G GLQ
Sbjct  411  MANQLGNSNFSPMYDNYSAASALGFSGMDSRLHGG-----GFESRNLGRSNRMMGGGGLQ  465

Query  186  AQYMDPMYIQY------LLQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQY  341
            +   DPMY QY      +      NDP+MDR+++GNSY ++L  Q+AY+G+    QKSQY
Sbjct  466  SHMADPMYHQYGRYSENVDALDLLNDPAMDRSFMGNSYMNMLELQRAYLGA----QKSQY  521

Query  342  NVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGG  521
             VP  S +  S  H YYG+P F   +SYPGS L    + NS + P SP+R  + NMR   
Sbjct  522  GVPYKSGSPNS--HSYYGSPTFGSNMSYPGSPLAHHAMQNSLMSPCSPMRRGEVNMRYPS  579

Query  522  GMRNFGVGVIGPWNLD-NMENSFAS  593
              RN+  GV+G W++D +++  F S
Sbjct  580  ATRNYSGGVMGSWHMDASLDEGFGS  604



>ref|XP_006409963.1| hypothetical protein EUTSA_v10016185mg [Eutrema salsugineum]
 gb|ESQ51416.1| hypothetical protein EUTSA_v10016185mg [Eutrema salsugineum]
Length=971

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 112/192 (58%), Gaps = 16/192 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAGS  176
            +++Q G  N  P++E+A   S      +DSR+  G  ++S    S  +N+GR+ N+M G 
Sbjct  425  MASQLGTGNFSPMYEDALGFSG-----IDSRLHGGGFVSSGQNLSESRNLGRLSNRMMGG  479

Query  177  GLQAQYMDPMYIQYLLQFASHNDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKSQYNVP  350
            GLQ   +DPMY QY       NDP+MDR+++GNSY ++  LQ+AY GS     KSQY VP
Sbjct  480  GLQPHIVDPMYHQYADSLDLLNDPAMDRSFMGNSYMNMLELQRAYQGS----PKSQYGVP  535

Query  351  LSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMR  530
              S +  S  H YYG+P F   +SYPGS L   V+ NS + P SP+R  + NMR     R
Sbjct  536  YKSGSPTS--HSYYGSPTFGSNMSYPGSPLAHHVLQNSLLSPCSPLRRGEVNMRYPSAAR  593

Query  531  NFGVGVIGPWNL  566
            N+  GV+  W++
Sbjct  594  NYAGGVMDSWHM  605



>gb|ABW81064.1| AlMpt5-2 [Arabidopsis lyrata subsp. lyrata]
Length=949

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 123/211 (58%), Gaps = 28/211 (13%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQM--A  170
            ++ Q GN N  P++EN +A        MDSR+  G  ++S    S  +N GR+ N+M   
Sbjct  421  MACQLGNSNFSPMYENVSAMGLSG---MDSRLHGGGYVSSGQNLSESRNFGRLSNRMLGG  477

Query  171  GSGLQAQYMDPMYIQYLLQFASH-------NDPSMDRNYLGNSYTDLL--QKAYVGSMLS  323
            G+GLQ+   DPMY QY  +F+ +       NDPSMD N++GNSY ++L  Q+AY+G+   
Sbjct  478  GAGLQSHMADPMYHQYA-RFSENADSLDLLNDPSMDMNFMGNSYMNMLELQRAYLGA---  533

Query  324  PQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDY  503
             QKSQY VP  S +  S  H  YG+P F    SYPGS L   ++PNS V P SP+R  + 
Sbjct  534  -QKSQYGVPYKSGSPNS--HSDYGSPTFG---SYPGSPLAHHLLPNSLVSPCSPMRRGEV  587

Query  504  NMRVGGGMRNFGVGVIGPWNLD-NMENSFAS  593
            NMR     RN+  GV+G W++D +++  F S
Sbjct  588  NMRYPSAARNYSGGVMGSWHMDASLDEGFGS  618



>ref|XP_006295787.1| hypothetical protein CARUB_v10024911mg [Capsella rubella]
 gb|EOA28685.1| hypothetical protein CARUB_v10024911mg [Capsella rubella]
Length=979

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 124/208 (60%), Gaps = 21/208 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQM--AGSG  179
            +++Q GN N  P++EN +AASA+    +DSR+  G    + S  +N+GR  N+M   G+G
Sbjct  425  MASQLGNTNFSPMYENVSAASALGFSGIDSRLHGGGQ--NLSEPRNLGRFSNRMMGGGAG  482

Query  180  LQAQYMDPMYIQYLLQFASH-------NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQK  332
            LQ+   DPMY QY  +F+ +       NDP+MDRN++ NSY ++L  Q+AY    L  QK
Sbjct  483  LQSHMADPMYNQYG-RFSENVDSLDLLNDPAMDRNFMNNSYMNMLELQRAY----LRAQK  537

Query  333  SQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            S Y VP  S +  S  +  YG+P F   +SYPGS L   ++PNS V P SP+R  + NMR
Sbjct  538  SHYGVPYKSGSPNS--YSGYGSPTFESNMSYPGSPLAHHLLPNSLVSPCSPMRQGEVNMR  595

Query  513  VGGGMRNFGVGVIGPWNLD-NMENSFAS  593
                 RN+  GV+G W++D +++  F S
Sbjct  596  YPSATRNYPGGVMGAWHMDASLDEGFGS  623



>ref|XP_010473984.1| PREDICTED: pumilio homolog 2-like, partial [Camelina sativa]
Length=898

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 120/203 (59%), Gaps = 21/203 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQMAG-  173
            ++ Q G  N  P++ENA+AASA+    MDSR+  G  ++S    S  +NIGR+ N+M G 
Sbjct  337  MAGQLGTNNYSPMYENASAASALGFSGMDSRLHGGGFVSSGQNLSEPRNIGRVGNRMMGG  396

Query  174  -SGLQAQYMDPMYIQY------LLQFASHNDPSMDRNYLG--NSYTDLL--QKAYVGSML  320
             +GLQ+   DPMY QY         F   NDPSMDR+++G  NSY ++L  Q+AY+G+  
Sbjct  397  NAGLQSHMADPMYHQYGRFSDNADSFDLLNDPSMDRSFMGMGNSYMNMLELQRAYLGA--  454

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
              QKSQY  P  S +  S  H YYG+P F   +SYPGS L    +PNS + P SP+R  +
Sbjct  455  --QKSQYGFPYKSGSPNS--HSYYGSPTFGSNMSYPGSPLAHHGMPNSLMSPYSPMRRGE  510

Query  501  YNMRVGGGMRNFGVGVIGPWNLD  569
             NMR     RNF  GV+G W +D
Sbjct  511  VNMRHPSATRNFSGGVMGSWQMD  533



>ref|XP_006644998.1| PREDICTED: pumilio homolog 2-like [Oryza brachyantha]
Length=1058

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 121/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLD----QNIGRMENQMAGSGLQA  188
            G+ N+ PLFENAAAASA+A    DSR    + L+S +L     QN+GR  NQ A +GL +
Sbjct  510  GSSNMPPLFENAAAASAIASLGSDSRNIGSNILSSPTLSLSDVQNLGRTGNQTA-TGLLS  568

Query  189  QYMDPMYIQYL--LQFASH-----NDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKSQY  341
               DP Y+QYL   Q+A+      +DPS++R ++G+ Y DL  +QKAY+ ++L  QK QY
Sbjct  569  PLSDPFYVQYLKATQYAAQGAANCSDPSLERGFMGSQYGDLTAVQKAYIEALLQQQK-QY  627

Query  342  NVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGG  521
             +PL      + + GYYGN  F +G+SYPGS L SPV   SP GPGSP+R S+ NMR   
Sbjct  628  GMPLGKST--TSNQGYYGNLAFGMGMSYPGSPLGSPVA--SPSGPGSPLRLSERNMRFPS  683

Query  522  GMRNFGVGVIGPWNLD  569
             +RN     +G WN D
Sbjct  684  NLRN-----LGGWNSD  694



>ref|XP_010469982.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
Length=975

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 106/180 (59%), Gaps = 22/180 (12%)
 Frame = +3

Query  87   MDSRMFTGSNLNSASLDQNIGRMENQM--AGSGLQAQYMDPMYIQY------LLQFASHN  242
            MDSR+  G         +N+GR+ N+M   G+GLQ+   DPMY QY      +      N
Sbjct  451  MDSRLHGG-----GFESRNLGRVSNRMMGGGTGLQSHMADPMYHQYGRYSENVDSLDLLN  505

Query  243  DPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVG  416
            DP+MDRN++GNSY ++L  Q+AY+G+    QKSQY VP  S +  S  H YYG+P F   
Sbjct  506  DPAMDRNFMGNSYMNMLELQRAYLGA----QKSQYGVPYKSGSPNS--HSYYGSPTFGSN  559

Query  417  LSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD-NMENSFAS  593
            +SYPGS L    +PNS + P SP+R  + NMR     RN+  GV+G W++D +++  F S
Sbjct  560  MSYPGSPLAHHAMPNSLLSPCSPMRRGEVNMRYPSATRNYSGGVMGSWHMDASLDEGFGS  619



>ref|NP_180478.1| pumilio 3 [Arabidopsis thaliana]
 sp|Q9ZW02.1|PUM3_ARATH RecName: Full=Pumilio homolog 3; Short=APUM-3; Short=AtPUM3 [Arabidopsis 
thaliana]
 gb|AAC95220.1| putative pumilio/Mpt5 family RNA-binding protein [Arabidopsis 
thaliana]
 gb|AEC08216.1| pumilio 3 [Arabidopsis thaliana]
Length=964

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 122/210 (58%), Gaps = 23/210 (11%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLDQNIGRMENQM--A  170
            ++ Q G  N  P++ENA+A    +   MDSR+  GS ++S    S  +NIGR+ N+M   
Sbjct  408  MANQLGTNNYSPMYENASATLGYSA--MDSRLHGGSFVSSGQNLSESRNIGRVGNRMMEG  465

Query  171  GSGLQAQYMDPMYIQYLL------QFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            G+G  +   DPMY QY         F   NDPSMDRNY GNSY ++L  Q+AY+GS    
Sbjct  466  GTGHPSHLADPMYHQYARFSENADSFDLLNDPSMDRNY-GNSYMNMLEIQRAYLGS----  520

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKSQY +P  S +  S  H YYG+P F   +SYPGS L    +PNS + P SP+R  + N
Sbjct  521  QKSQYGLPYKSGSPNS--HSYYGSPTFGSNMSYPGSPLAHHGMPNSLMSPYSPMRRGEVN  578

Query  507  MRVGGGMRNFGVGVIGPWNLD-NMENSFAS  593
            MR     RN+  GV+G W++D +++  F S
Sbjct  579  MRYPAATRNYTGGVMGSWHMDASLDEGFGS  608



>ref|NP_001044782.1| Os01g0844800 [Oryza sativa Japonica Group]
 dbj|BAF06696.1| Os01g0844800 [Oryza sativa Japonica Group]
 dbj|BAG94300.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1060

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 121/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLD----QNIGRMENQMAGSGLQA  188
            G+ N+ PLFE+AAAASA+A    DSR    + L+S +L      N+GR  NQ A +GL +
Sbjct  512  GSGNMPPLFESAAAASAIASFGADSRNLGNNILSSPTLSLSDVHNLGRTGNQTA-TGLLS  570

Query  189  QYMDPMYIQYL--LQFASH-----NDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKSQY  341
               DP Y+QYL   Q+A+      +DPS++R ++G+ Y DL  +QKAY+ ++L  QK QY
Sbjct  571  PLSDPFYVQYLKATQYAAQGTANCSDPSLERGFMGSQYGDLTAVQKAYIEALLQQQK-QY  629

Query  342  NVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGG  521
             +PL      + +HGYYGN  F +G++YPGS L SPV   SP GPGSP+R S+ NMR   
Sbjct  630  GMPLGKST--TSNHGYYGNLAFGMGMAYPGSPLGSPVA--SPSGPGSPLRLSERNMRFPS  685

Query  522  GMRNFGVGVIGPWNLD  569
             +RN     +G WN D
Sbjct  686  NLRN-----LGGWNSD  696



>gb|EAY76473.1| hypothetical protein OsI_04410 [Oryza sativa Indica Group]
Length=1046

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 121/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLD----QNIGRMENQMAGSGLQA  188
            G+ N+ PLFE+AAAASA+A    DSR    + L+S +L      N+GR  NQ A +GL +
Sbjct  498  GSGNMPPLFESAAAASAIASLGADSRNLGNNILSSPTLSLSDVHNLGRTGNQTA-TGLLS  556

Query  189  QYMDPMYIQYL--LQFASH-----NDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKSQY  341
               DP Y+QYL   Q+A+      +DPS++R ++G+ Y DL  +QKAY+ ++L  QK QY
Sbjct  557  PLSDPFYVQYLKATQYAAQGTANCSDPSLERGFMGSQYGDLTAVQKAYIEALLQQQK-QY  615

Query  342  NVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGG  521
             +PL      + +HGYYGN  F +G++YPGS L SPV   SP GPGSP+R S+ NMR   
Sbjct  616  GMPLGKST--TSNHGYYGNLAFGMGMAYPGSPLGSPVA--SPSGPGSPLRLSERNMRFPS  671

Query  522  GMRNFGVGVIGPWNLD  569
             +RN     +G WN D
Sbjct  672  NLRN-----LGGWNSD  682



>dbj|BAB89558.1| putative pumilio domain-containing protein PPD1 [Oryza sativa 
Japonica Group]
 gb|EAZ14131.1| hypothetical protein OsJ_04054 [Oryza sativa Japonica Group]
Length=1048

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 121/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLD----QNIGRMENQMAGSGLQA  188
            G+ N+ PLFE+AAAASA+A    DSR    + L+S +L      N+GR  NQ A +GL +
Sbjct  500  GSGNMPPLFESAAAASAIASFGADSRNLGNNILSSPTLSLSDVHNLGRTGNQTA-TGLLS  558

Query  189  QYMDPMYIQYL--LQFASH-----NDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKSQY  341
               DP Y+QYL   Q+A+      +DPS++R ++G+ Y DL  +QKAY+ ++L  QK QY
Sbjct  559  PLSDPFYVQYLKATQYAAQGTANCSDPSLERGFMGSQYGDLTAVQKAYIEALLQQQK-QY  617

Query  342  NVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGG  521
             +PL      + +HGYYGN  F +G++YPGS L SPV   SP GPGSP+R S+ NMR   
Sbjct  618  GMPLGKST--TSNHGYYGNLAFGMGMAYPGSPLGSPVA--SPSGPGSPLRLSERNMRFPS  673

Query  522  GMRNFGVGVIGPWNLD  569
             +RN     +G WN D
Sbjct  674  NLRN-----LGGWNSD  684



>ref|XP_010414415.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010414416.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010414417.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
 ref|XP_010414418.1| PREDICTED: pumilio homolog 2-like [Camelina sativa]
Length=992

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 119/203 (59%), Gaps = 27/203 (13%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQM--AGSGLQAQY  194
            GN N  P+++N +A        MDSR+  G    S    +N+GR+ N+M   G+GLQ+  
Sbjct  449  GNNNFSPMYDNYSALGFSG---MDSRL-NGGGFES----RNLGRVSNRMMGGGTGLQSHM  500

Query  195  MDPMYIQYLLQFASH-------NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNV  347
             DPMY QY  +F+ +       NDP+M RN++GNSY ++L  Q+AY+G+    QKSQY V
Sbjct  501  ADPMYHQYG-RFSENVDSLDLLNDPAMGRNFMGNSYMNMLELQRAYLGA----QKSQYGV  555

Query  348  PLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGM  527
            P  S +  S  H YYG+P F   +SYPGS L    +PNS + P SP+R  + NMR     
Sbjct  556  PYKSGSPNS--HSYYGSPTFGSNMSYPGSPLAHHAMPNSLLSPCSPMRRGEINMRYPSAT  613

Query  528  RNFGVGVIGPWNLD-NMENSFAS  593
            RN+  GV+G W++D +++  F S
Sbjct  614  RNYSGGVMGSWHMDASLDEGFGS  636



>ref|XP_008461691.1| PREDICTED: pumilio homolog 1-like [Cucumis melo]
Length=1047

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 125/215 (58%), Gaps = 21/215 (10%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipa-MDSRMFTG-----SNLNSASLDQNIGRMENQM  167
            + T  G+ NL PL+ENAAAA++    + +++R F G     S L +AS  QN  R+EN  
Sbjct  478  VGTHLGSGNLPPLYENAAAAASAMGMSALNNRAFNGLALGSSMLETASEFQN-NRLENHN  536

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYL-GNSYTDLL--QKAYVGSM  317
            A +G+Q   +DP YIQYL        Q    +DP +D + L GN Y DLL  QKAY+G++
Sbjct  537  AMNGMQLPGLDPSYIQYLGSNEYAAAQVGGISDPPLDSDSLMGNGYMDLLGVQKAYLGAL  596

Query  318  LSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCS  497
            LSPQ SQ+ +P   K+ GS +H Y GNP + +G+SYPGS L   ++P SP G G+ +   
Sbjct  597  LSPQNSQFVLPYFGKS-GSLNHNYCGNPSYGLGMSYPGSPLAGSLLPGSPAGSGNALNHI  655

Query  498  DYNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
               +R   GMRNF  G +G W+ +   NM   F S
Sbjct  656  SKALRFSSGMRNFAGGSLGGWHSEGGGNMNGGFVS  690



>ref|XP_004490875.1| PREDICTED: pumilio homolog 1-like isoform X1 [Cicer arietinum]
Length=1014

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 120/206 (58%), Gaps = 16/206 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSR-MFTGSNLN---SASLDQNIGRMENQMAG  173
            ++ Q G+ NL  LFE+AA +SA+ +  +D R +  G+NL    +AS  QN  R  N  AG
Sbjct  447  MANQLGSGNLPLLFEHAAPSSALGMNVIDPRGLGRGANLAPLLAASELQNASRFGNHAAG  506

Query  174  SGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            S  Q   MDPMY+QYL        Q A+ N+ + +R +  NS TDLL  QKAY+ S+++P
Sbjct  507  STHQLPLMDPMYLQYLRSSELAAAQMAALNESARNREHTNNSLTDLLGLQKAYIESLIAP  566

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QK  ++ P   K+  S +H  YG+P   +G+SYPGS L     PNS  G GSP+  S+ N
Sbjct  567  QKQHFSAPYIGKS-ASMNHNSYGSPSHGLGMSYPGSPLAGSAFPNSIYGQGSPMSQSERN  625

Query  507  MRVGGGMRNFGVGVI-GPWNLDNMEN  581
            MR+  GMRN   G+  G W+ D + N
Sbjct  626  MRL-SGMRNVAGGLTGGAWHSDAVSN  650



>ref|XP_004490876.1| PREDICTED: pumilio homolog 1-like isoform X2 [Cicer arietinum]
Length=1013

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 120/206 (58%), Gaps = 16/206 (8%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSR-MFTGSNLN---SASLDQNIGRMENQMAG  173
            ++ Q G+ NL  LFE+AA +SA+ +  +D R +  G+NL    +AS  QN  R  N  AG
Sbjct  446  MANQLGSGNLPLLFEHAAPSSALGMNVIDPRGLGRGANLAPLLAASELQNASRFGNHAAG  505

Query  174  SGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            S  Q   MDPMY+QYL        Q A+ N+ + +R +  NS TDLL  QKAY+ S+++P
Sbjct  506  STHQLPLMDPMYLQYLRSSELAAAQMAALNESARNREHTNNSLTDLLGLQKAYIESLIAP  565

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QK  ++ P   K+  S +H  YG+P   +G+SYPGS L     PNS  G GSP+  S+ N
Sbjct  566  QKQHFSAPYIGKS-ASMNHNSYGSPSHGLGMSYPGSPLAGSAFPNSIYGQGSPMSQSERN  624

Query  507  MRVGGGMRNFGVGVI-GPWNLDNMEN  581
            MR+  GMRN   G+  G W+ D + N
Sbjct  625  MRL-SGMRNVAGGLTGGAWHSDAVSN  649



>ref|XP_006409962.1| hypothetical protein EUTSA_v10016184mg [Eutrema salsugineum]
 gb|ESQ51415.1| hypothetical protein EUTSA_v10016184mg [Eutrema salsugineum]
Length=976

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 119/201 (59%), Gaps = 24/201 (12%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMF------TGSNLNSASLDQNIGRMENQM  167
            + +Q G  N  P++E+ +AASA+    MD R+       +G NL+ +   +N+GR+ N+M
Sbjct  420  MGSQLGTGNFSPMYEDVSAASALGFSGMDHRLHGRGYVSSGQNLSES---RNLGRISNRM  476

Query  168  AGSGLQAQYMDPMYIQYLLQFASH----NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
             G GLQ+   DP Y QY  +F  +    NDP++DR+++GNSY ++L  Q+AY+G+    Q
Sbjct  477  MGGGLQSHIADPTYHQYG-RFPENADLFNDPAIDRSFMGNSYMNMLELQRAYLGA----Q  531

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVG--LSYPGSLLTSPVIPNSPVGPGSPIRCSDY  503
            KSQY VP  S +  S    YYG+P  + G  +SYPGS L   V+PN  V P SP+R  + 
Sbjct  532  KSQYGVPYKSGSPNS--RSYYGSPTLQYGCNMSYPGSPLAHHVMPNPLVAPCSPVRRGEV  589

Query  504  NMRVGGGMRNFGVGVIGPWNL  566
            NMR     RN+  GV+  W++
Sbjct  590  NMRYPSATRNYSGGVMDAWHM  610



>ref|XP_004970555.1| PREDICTED: pumilio homolog 2-like [Setaria italica]
Length=1056

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 115/180 (64%), Gaps = 18/180 (10%)
 Frame = +3

Query  39   PLFENaaaasamaipaMDSRMFTGSNLNSASLD----QNIGRMENQMAGSGLQAQYMDPM  206
            PLFE+AAAASA+A    DSR    + L S +L      N+GR  NQ A +GLQ+   DP 
Sbjct  513  PLFESAAAASAIASLGADSRNLGNNILASPTLSLTDVHNLGRGGNQ-APTGLQSPLSDPF  571

Query  207  YIQYL--LQFA-----SHNDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKSQYNVPLSS  359
            Y+QYL   Q+A     S+ DPS++R Y+GNSY +L  +QKAY+ ++L  QK QY +PL  
Sbjct  572  YVQYLKATQYATQGAGSYGDPSLERGYMGNSYGNLTAVQKAYIEALLQQQK-QYEMPLLG  630

Query  360  KNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFG  539
            K+  S +HGYYGN  F +G++YPGS L SPV   SP GPGSP+R  + N+R    +RN G
Sbjct  631  KSNAS-NHGYYGNLPFGMGMAYPGSPLGSPVA--SPSGPGSPLRLGERNLRFPSNLRNLG  687



>ref|XP_002863049.1| hypothetical protein ARALYDRAFT_920647 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39308.1| hypothetical protein ARALYDRAFT_920647 [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 92/150 (61%), Gaps = 15/150 (10%)
 Frame = +3

Query  171  GSGLQAQYMDPMYIQYLL------QFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSP  326
            G+GLQ+   DPMY QY         F   NDPSMDR+Y+GNSY ++L  Q+AY+G+    
Sbjct  4    GTGLQSHLADPMYHQYARFSENADSFDLLNDPSMDRSYMGNSYMNMLELQRAYLGA----  59

Query  327  QKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYN  506
            QKSQY +P  S +  S  H YYG+P F   +SYPGS L  P +PNS + P SP+R  + N
Sbjct  60   QKSQYGLPYKSGSPNS--HSYYGSPTFGSNMSYPGSPLAHPGMPNSLMSPYSPMRRGEVN  117

Query  507  MRVGGGMRNFGVGVIGPWNLD-NMENSFAS  593
            MR     RN+  GV+G W++D +++  F S
Sbjct  118  MRYPSATRNYSGGVMGSWHMDASLDEGFGS  147



>ref|XP_004960534.1| PREDICTED: pumilio homolog 1-like [Setaria italica]
Length=871

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 79/126 (63%), Gaps = 21/126 (17%)
 Frame = +3

Query  195  MDPMYIQYLLQFA-SHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKN  365
            +DP YIQYL Q A S +DP MDR +LGNSY DLL  QKA +G +L  QK           
Sbjct  397  IDPAYIQYLAQLAASCDDPLMDRGHLGNSYMDLLGPQKANLGPLLQSQK-----------  445

Query  366  MGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVG  545
                 +GYYGN GF +G  Y GS LTSPV+P+SP+ PGSP+R  D +MR   GMRNFG G
Sbjct  446  ----QYGYYGNLGFNLG--YAGSPLTSPVLPSSPIAPGSPLRHGDRSMRFPSGMRNFG-G  498

Query  546  VIGPWN  563
              G WN
Sbjct  499  SFGSWN  504



>ref|XP_003616446.1| Pumilio-like protein [Medicago truncatula]
Length=1066

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 112/189 (59%), Gaps = 13/189 (7%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSR-MFTGSNLN---SASLDQNIGRMENQMAGSGLQA  188
            G+ NL   FE+AA +S + + AMDSR +  G+NL    +AS  QN  R+ N  AGS  Q 
Sbjct  483  GSANLPHFFEHAAPSSPLGMNAMDSRGLARGANLGPLLAASELQNASRLGNHAAGSTHQL  542

Query  189  QYMDPMYIQYLLQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSK  362
              +DP+Y+QYL    S    +  RN   NS TDLL  QKAY+ S+++ QK+Q++VP   K
Sbjct  543  PLIDPLYLQYL---RSGEVAAAQRN---NSITDLLGLQKAYIESLIAQQKAQFSVPYLGK  596

Query  363  NMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGV  542
            +  S +H  YGNP +  G+SYPGS L     P+S  GPGSP+  S+ NMR+  GMRN   
Sbjct  597  S-ASMNHNSYGNPSYGHGMSYPGSPLAGSPFPSSMYGPGSPMSQSERNMRLAAGMRNVAG  655

Query  543  GVIGPWNLD  569
               G W+ D
Sbjct  656  VFTGAWHSD  664



>gb|AES99404.2| pumilio-family RNA-binding repeatprotein [Medicago truncatula]
Length=1012

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 112/189 (59%), Gaps = 13/189 (7%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSR-MFTGSNLN---SASLDQNIGRMENQMAGSGLQA  188
            G+ NL   FE+AA +S + + AMDSR +  G+NL    +AS  QN  R+ N  AGS  Q 
Sbjct  462  GSANLPHFFEHAAPSSPLGMNAMDSRGLARGANLGPLLAASELQNASRLGNHAAGSTHQL  521

Query  189  QYMDPMYIQYLLQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSK  362
              +DP+Y+QYL    S    +  RN   NS TDLL  QKAY+ S+++ QK+Q++VP   K
Sbjct  522  PLIDPLYLQYL---RSGEVAAAQRN---NSITDLLGLQKAYIESLIAQQKAQFSVPYLGK  575

Query  363  NMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGV  542
            +  S +H  YGNP +  G+SYPGS L     P+S  GPGSP+  S+ NMR+  GMRN   
Sbjct  576  S-ASMNHNSYGNPSYGHGMSYPGSPLAGSPFPSSMYGPGSPMSQSERNMRLAAGMRNVAG  634

Query  543  GVIGPWNLD  569
               G W+ D
Sbjct  635  VFTGAWHSD  643



>ref|XP_002440447.1| hypothetical protein SORBIDRAFT_09g001090 [Sorghum bicolor]
 gb|EES18877.1| hypothetical protein SORBIDRAFT_09g001090 [Sorghum bicolor]
Length=878

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 78/126 (62%), Gaps = 21/126 (17%)
 Frame = +3

Query  195  MDPMYIQYLLQFASH-NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKN  365
            +DP YIQYL Q A+  +DP MDR +LGNSY DLL  QKA +G +L  QK           
Sbjct  404  IDPAYIQYLAQLAATCDDPLMDRGHLGNSYMDLLGTQKANLGPLLQSQK-----------  452

Query  366  MGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVG  545
                 +GYYGN GF +G  Y GS LTSPV+P+SP+ PGSP+R  + NMR   GMRNFG  
Sbjct  453  ----QYGYYGNLGFNLG--YAGSPLTSPVLPSSPIAPGSPLRHGERNMRFPSGMRNFG-N  505

Query  546  VIGPWN  563
              G WN
Sbjct  506  SFGSWN  511



>ref|XP_002456623.1| hypothetical protein SORBIDRAFT_03g039600 [Sorghum bicolor]
 gb|EES01743.1| hypothetical protein SORBIDRAFT_03g039600 [Sorghum bicolor]
Length=1057

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 97/152 (64%), Gaps = 19/152 (13%)
 Frame = +3

Query  141  NIGRMENQMAGSGLQAQYMDPMYIQYL--LQFA-----SHNDPSMDRNYLGNSYTDL--L  293
            N+GR  NQ A +GLQ+   DP Y+QYL   Q+A     S+ DPS++R Y+GNSY +L  +
Sbjct  552  NLGRGGNQ-APTGLQSPLSDPFYVQYLKATQYAAQGAGSYGDPSLERGYMGNSYANLNAV  610

Query  294  QKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVG  473
            QKAY+ ++L  QK Q+ +PL  K+  S +HGYYGN  F +G++YPGS L SPV   S  G
Sbjct  611  QKAYIEALLQQQK-QFEMPLLGKSTTS-NHGYYGNLAFGMGMAYPGSPLNSPVASQS--G  666

Query  474  PGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD  569
            PGSP+R  + N+R    +RN     +G WN D
Sbjct  667  PGSPLRLGERNLRFPSNLRN-----LGGWNSD  693



>gb|ACN27840.1| unknown [Zea mays]
 gb|AFW82889.1| hypothetical protein ZEAMMB73_959107 [Zea mays]
Length=873

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 77/126 (61%), Gaps = 21/126 (17%)
 Frame = +3

Query  195  MDPMYIQYLLQFASH-NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKN  365
            +DP YIQYL Q A+  +DP MDR +LGNSY DLL   KA +G +L  QK           
Sbjct  399  IDPAYIQYLAQLAATCDDPLMDRGHLGNSYMDLLGTHKANIGPLLQSQK-----------  447

Query  366  MGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVG  545
                 +GYYGN GF +G  YPGS L SPV+P+SP+ PGSP+R  + NMR   GMRNFG  
Sbjct  448  ----QYGYYGNLGFNLG--YPGSPLASPVLPSSPIAPGSPLRHGERNMRFPSGMRNFG-N  500

Query  546  VIGPWN  563
              G WN
Sbjct  501  SFGSWN  506



>gb|AFW82890.1| hypothetical protein ZEAMMB73_959107 [Zea mays]
Length=869

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 77/126 (61%), Gaps = 21/126 (17%)
 Frame = +3

Query  195  MDPMYIQYLLQFASH-NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKN  365
            +DP YIQYL Q A+  +DP MDR +LGNSY DLL   KA +G +L  QK           
Sbjct  395  IDPAYIQYLAQLAATCDDPLMDRGHLGNSYMDLLGTHKANIGPLLQSQK-----------  443

Query  366  MGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVG  545
                 +GYYGN GF +G  YPGS L SPV+P+SP+ PGSP+R  + NMR   GMRNFG  
Sbjct  444  ----QYGYYGNLGFNLG--YPGSPLASPVLPSSPIAPGSPLRHGERNMRFPSGMRNFG-N  496

Query  546  VIGPWN  563
              G WN
Sbjct  497  SFGSWN  502



>ref|NP_001146200.1| uncharacterized protein LOC100279770 [Zea mays]
 gb|ACL53455.1| unknown [Zea mays]
Length=873

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 77/126 (61%), Gaps = 21/126 (17%)
 Frame = +3

Query  195  MDPMYIQYLLQFASH-NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKN  365
            +DP YIQYL Q A+  +DP MDR +LGNSY DLL   KA +G +L  QK           
Sbjct  399  IDPAYIQYLAQLAATCDDPLMDRGHLGNSYMDLLGTHKANIGPLLQSQK-----------  447

Query  366  MGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVG  545
                 +GYYGN GF +G  YPGS L SPV+P+SP+ PGSP+R  + NMR   GMRNFG  
Sbjct  448  ----QYGYYGNLGFNLG--YPGSPLASPVLPSSPIAPGSPLRHGERNMRFPSGMRNFG-N  500

Query  546  VIGPWN  563
              G WN
Sbjct  501  SFGSWN  506



>gb|EMT17283.1| Pumilio-like protein [Aegilops tauschii]
Length=946

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 124/197 (63%), Gaps = 27/197 (14%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFTGSNLNS---ASLD--QNIGRMENQMAGSGLQ  185
            G+ ++ PLFE+ AAASA+A    DSR   GSN++S    SL    N+GR  NQ A +GLQ
Sbjct  433  GSGSMPPLFESGAAASAIASLGSDSRNL-GSNISSPPALSLSDLHNLGRSNNQTA-TGLQ  490

Query  186  AQYMDPMYIQYLL-------QFASHNDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKSQ  338
            +   DP Y+QYL        + A+++DP ++R ++G+SY DL  +QKAYV ++L  Q+ Q
Sbjct  491  SPLSDPFYVQYLKTAQYTAQEAANYSDPYLERGFVGSSYADLTPVQKAYVEALL--QQKQ  548

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y +PL  K++ S +HGYY N G+ +GL+YPGS L SPV   SP GPGSPIR  + N+R  
Sbjct  549  YGMPLG-KSVAS-NHGYYSNLGYGMGLAYPGSPLGSPVA--SPSGPGSPIRLGERNLRFP  604

Query  519  GGMRNFGVGVIGPWNLD  569
               R+     +  WN+D
Sbjct  605  SNTRS-----LTGWNVD  616



>tpg|DAA46484.1| TPA: hypothetical protein ZEAMMB73_346749 [Zea mays]
Length=752

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 77/126 (61%), Gaps = 21/126 (17%)
 Frame = +3

Query  195  MDPMYIQYLLQFASH-NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKN  365
            +DP YIQYL Q A+  +DP MDR +LGNSY DLL   KA +G +L  QK           
Sbjct  399  IDPAYIQYLAQLAATCDDPLMDRGHLGNSYMDLLGTHKANIGPLLQSQK-----------  447

Query  366  MGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVG  545
                 +GYYGN GF +G  YPGS L SPV+P+SP+ PGSP+R  + NMR   GMRNFG  
Sbjct  448  ----QYGYYGNLGFNLG--YPGSPLASPVLPSSPIAPGSPLRHGERNMRFPSGMRNFG-N  500

Query  546  VIGPWN  563
              G WN
Sbjct  501  SFGSWN  506



>ref|XP_008658750.1| PREDICTED: pumilio homolog 1-like [Zea mays]
Length=762

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 77/126 (61%), Gaps = 21/126 (17%)
 Frame = +3

Query  195  MDPMYIQYLLQFASH-NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKN  365
            +DP YIQYL Q A+  +DP MDR +LGNSY DLL   KA +G +L  QK           
Sbjct  399  IDPAYIQYLAQLAATCDDPLMDRGHLGNSYMDLLGTHKANIGPLLQSQK-----------  447

Query  366  MGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVG  545
                 +GYYGN GF +G  YPGS L SPV+P+SP+ PGSP+R  + NMR   GMRNFG  
Sbjct  448  ----QYGYYGNLGFNLG--YPGSPLASPVLPSSPIAPGSPLRHGERNMRFPSGMRNFG-N  500

Query  546  VIGPWN  563
              G WN
Sbjct  501  SFGSWN  506



>ref|XP_010241847.1| PREDICTED: pumilio homolog 4-like [Nelumbo nucifera]
 ref|XP_010241848.1| PREDICTED: pumilio homolog 4-like [Nelumbo nucifera]
Length=1032

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 97/164 (59%), Gaps = 17/164 (10%)
 Frame = +3

Query  141  NIGRMENQMAGSGLQAQYMDPMYIQYLLQFASH--------NDPSMDRNYLGNSYTDLL-  293
            ++ R  NQ+ GSG+Q   MDP+Y+QYL + + +         D S+ RNYLG S  DL  
Sbjct  520  SLSRRGNQL-GSGIQLPVMDPLYLQYLQRTSDYAEQGASGLTDASLGRNYLGTSEADLFG  578

Query  294  -QKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPV  470
             QKAY+  +L+ QK QY +    K  G  +HGYYGNP F +GL YPG+ L +P +P+  +
Sbjct  579  FQKAYLEVLLAQQKQQYGLAFLGKPSGL-NHGYYGNPAFGLGLPYPGNPLANPGLPS--I  635

Query  471  GPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            GPGSPIR S+   R    +R+   G  G W+ D   NM+ SFAS
Sbjct  636  GPGSPIRQSERISRFPSMIRSSAGGSAGSWHSDNSGNMDESFAS  679



>gb|EPS67369.1| hypothetical protein M569_07403, partial [Genlisea aurea]
Length=574

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 120/199 (60%), Gaps = 29/199 (15%)
 Frame = +3

Query  30   NLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMA-GSGLQAQYMDPM  206
            NL PLFENAAAASAMA+P +D+R+   SNL     +Q++ R  ++M  GS LQ+  +DP 
Sbjct  48   NLPPLFENAAAASAMAMPGIDARLLGASNL-----EQHLNRNGHKMTRGSVLQSPMLDPS  102

Query  207  YIQYL-------LQFASHNDPSMDRNYLGNSYTDLLQKAYVGSMLSPQKSQYNVPLSSKN  365
            Y+QYL       LQ  S +DPS+D NY GN+Y DLLQK Y G++LS QKSQY +P   K+
Sbjct  103  YLQYLREGEYGSLQIGSLSDPSIDMNYRGNAYMDLLQKTYFGNLLSAQKSQYGLPPGVKS  162

Query  366  MGSGHHGYY-GNPGFRVGLSYPGSLLTSPVIPNSP-VGPGSPIRCSDYNMRV-GGGMRNF  536
              S  H Y+ G+P F  GLSYP      P+ PNS     G+      YNMR    G  +F
Sbjct  163  GQSSPHAYFGGSPAF--GLSYP----RGPLTPNSDGFSAGAH---GLYNMRYPSSGGSSF  213

Query  537  GVGVIGPWNLDNMENSFAS  593
                  PW+LDNM++++ S
Sbjct  214  A----APWHLDNMDSNYGS  228



>emb|CDM84977.1| unnamed protein product [Triticum aestivum]
Length=1047

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 121/197 (61%), Gaps = 27/197 (14%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSA---SLD--QNIGRMENQMAGSGLQ  185
            G+ ++ PLFE+ AAASA+A    DSR   GSN++S    SL    N+GR  NQ A +GLQ
Sbjct  499  GSGSMPPLFESGAAASAIASLGSDSRNL-GSNISSPPALSLSDLHNLGRSNNQTA-TGLQ  556

Query  186  AQYMDPMYIQYLL-------QFASHNDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKSQ  338
            +   DP Y+QYL        + A+++DP ++R ++G+SY DL  +QKAYV ++L  Q+ Q
Sbjct  557  SPLSDPFYVQYLKTAQYTAQEAANYSDPYLERGFMGSSYADLTPVQKAYVEALL--QQKQ  614

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y +PL      S +HGYY N G+ +G++YPGS L SPV   SP GPGSPIR  + N+R  
Sbjct  615  YGMPLGKSV--SSNHGYYSNLGYGMGMAYPGSPLGSPVA--SPSGPGSPIRLGERNLRFP  670

Query  519  GGMRNFGVGVIGPWNLD  569
               R+     +  WN+D
Sbjct  671  SNTRS-----LTGWNVD  682



>gb|AGW24466.1| pumilio-like protein 3, partial [Avicennia marina var. marina]
Length=109

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  348  PLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGM  527
            PL  K   S  HGYY NP F +GLSYPGS L SPVIPNS  GPGSP+R  ++N R  GGM
Sbjct  2    PLGGKTGVSSPHGYYANPTFGIGLSYPGSPLASPVIPNSVGGPGSPMRHGEFNARFPGGM  61

Query  528  RNFGVGVIGPWNLDNMENSFAS  593
            RN    VIGPW+LDNM+NSF S
Sbjct  62   RNAAGSVIGPWHLDNMDNSFGS  83



>ref|XP_009384840.1| PREDICTED: pumilio homolog 2-like [Musa acuminata subsp. malaccensis]
Length=1044

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 103/177 (58%), Gaps = 16/177 (9%)
 Frame = +3

Query  99   MFTGSNLNSASLDQNIGRMENQMAGSGLQAQYMDPMYIQYLLQF-------ASHNDPSMD  257
            +F  S+L   +  +++G++ NQ A + LQ    DP+Y+QYL          AS+ DPSM+
Sbjct  516  IFAPSSLAGLTDLKSLGQIGNQSAIAALQTPPSDPLYLQYLKAAEYTAQVAASYGDPSME  575

Query  258  RNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPG  431
            R Y+GNS+ +LL  Q AY+ S+L  QK QY+  L  K  G  +HGYYG+P F +GLSYPG
Sbjct  576  RGYVGNSHAELLGVQNAYIASLLQSQK-QYDPSLLGK-FGFTNHGYYGSPAFDLGLSYPG  633

Query  432  SLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            S L   +  +S +GPGS ++  ++  +   G+RN   G  G W  D   N++  F S
Sbjct  634  SPLAGQI--DSQIGPGSALKLGEHYTQFPYGLRNLNGGTTGSWYFDQSHNLDKHFRS  688



>ref|XP_010535459.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
 ref|XP_010535460.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
 ref|XP_010535461.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
Length=980

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 107/199 (54%), Gaps = 29/199 (15%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S Q G  N  P  EN  AASA+ +   DSR+  G  L+S   D+        M  S LQ
Sbjct  437  MSGQLGTGNFPPHLENGNAASALGLQGFDSRVL-GGGLSSGHTDRTA------MGSSALQ  489

Query  186  AQYMDPMYIQYL------LQFASHNDPSMDRNYLGN-SYTDLL---QKAYVGSMLSPQKS  335
              ++DP+Y+QYL       Q A+ NDP MD N LGN SY + L   Q+AY+  +LS QK 
Sbjct  490  HPFVDPLYVQYLRTSEYAAQLAALNDPMMDHNLLGNNSYMNNLAEMQRAYIDQLLSAQKQ  549

Query  336  QYNVPLSSK-NMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            QY   +  K   GS   GYYG       +SYPGS L +P +PNSPVG GSP+R +D NM 
Sbjct  550  QYVASVGGKYGGGSNQRGYYG-------MSYPGSPLANPGLPNSPVGSGSPMRHNDLNMS  602

Query  513  VGGGMRNFGVGVIGPWNLD  569
                MRN      G W+LD
Sbjct  603  YPSRMRNLA----GGWHLD  617



>ref|XP_007141399.1| hypothetical protein PHAVU_008G192100g [Phaseolus vulgaris]
 gb|ESW13393.1| hypothetical protein PHAVU_008G192100g [Phaseolus vulgaris]
Length=1028

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 119/209 (57%), Gaps = 15/209 (7%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasama-ipaMDSRMF-TGSNLN---SASLDQNIGRMENQMA  170
            +++Q G+ NL P FENAA A++   + AMDSR    G  L    +A+  QN  R+ +  A
Sbjct  466  MASQLGSGNLPPFFENAAVAASALGLNAMDSRALGRGVALGPLLAATELQNSSRLGSHAA  525

Query  171  GSGLQAQYMDPMYIQYLLQ---FASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKS  335
            GS  Q   MDP+Y+QYL      ++    ++  + +    TDLL  QKAYV S+++PQ S
Sbjct  526  GSTQQLPLMDPLYLQYLRSGDVASAAQIAALKESVINRECTDLLGLQKAYVESLIAPQNS  585

Query  336  QYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRV  515
             +NVP  SK+  +     +GNP + +  SYPGS L   + PNS  GPGSP+  S+ NMR+
Sbjct  586  HFNVPYLSKS-ATLSPNSFGNPSYGLATSYPGSPLAGSLFPNSLYGPGSPMNQSERNMRL  644

Query  516  GGGMRNFGVGVIGPWNLDN---MENSFAS  593
              GMRN   G +G W+ D    +E +F S
Sbjct  645  -SGMRNAAGGFMGAWHSDTVGGLEENFPS  672



>ref|NP_001170502.1| uncharacterized protein LOC100384506 [Zea mays]
 gb|ACR33883.1| unknown [Zea mays]
Length=440

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 78/126 (62%), Gaps = 20/126 (16%)
 Frame = +3

Query  195  MDPMYIQYLLQFASH-NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKN  365
            +DP YIQYL Q A+  +DP MDR++LG+SY DLL  QKA +G +L  QK           
Sbjct  256  IDPAYIQYLAQIAATWDDPLMDRSHLGSSYMDLLGTQKANLGPLLQSQK-----------  304

Query  366  MGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVG  545
                 +GY GN GF +G  Y GS LTSPV+P+SP+ PGSP+R  D NMR   GMRNFG  
Sbjct  305  ----QYGYCGNLGFNLG-GYAGSPLTSPVLPSSPIAPGSPLRHGDRNMRFPPGMRNFG-N  358

Query  546  VIGPWN  563
              G WN
Sbjct  359  SFGSWN  364



>gb|EMS59607.1| Pumilio-like protein 2 [Triticum urartu]
Length=1001

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 124/197 (63%), Gaps = 27/197 (14%)
 Frame = +3

Query  21   GNYNLLPLFENaaaasamaipaMDSRMFTGSNLNS---ASLD--QNIGRMENQMAGSGLQ  185
            G+ ++ PLFE+ AAASA+A    DSR   GSN++S    SL    N+GR  NQ A +GLQ
Sbjct  437  GSGSMPPLFESGAAASAIASLGSDSRNL-GSNISSPPALSLSDLHNLGRSNNQTA-TGLQ  494

Query  186  AQYMDPMYIQYLL-------QFASHNDPSMDRNYLGNSYTDL--LQKAYVGSMLSPQKSQ  338
            +   DP Y+QYL        + A+++DP ++R ++G+SY DL  +QKAYV ++L  Q+ Q
Sbjct  495  SPLSDPFYVQYLKTAQYTAQEAANYSDPYLERGFMGSSYADLTPVQKAYVEALL--QQKQ  552

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
            Y +P+  K++ S +HGY+ N G+ +G++YPGS L SPV   SP GPGSPIR  + N+R  
Sbjct  553  YGMPVG-KSVAS-NHGYFSNLGYGMGMTYPGSPLGSPVA--SPSGPGSPIRLGERNLRFP  608

Query  519  GGMRNFGVGVIGPWNLD  569
               R+     +  WN+D
Sbjct  609  SNTRS-----LTGWNVD  620



>ref|XP_008648194.1| PREDICTED: uncharacterized protein LOC100384506 isoform X1 [Zea 
mays]
Length=871

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 78/126 (62%), Gaps = 20/126 (16%)
 Frame = +3

Query  195  MDPMYIQYLLQFASH-NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKN  365
            +DP YIQYL Q A+  +DP MDR++LG+SY DLL  QKA +G +L  QK           
Sbjct  396  IDPAYIQYLAQIAATWDDPLMDRSHLGSSYMDLLGTQKANLGPLLQSQK-----------  444

Query  366  MGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVG  545
                 +GY GN GF +G  Y GS LTSPV+P+SP+ PGSP+R  D NMR   GMRNFG  
Sbjct  445  ----QYGYCGNLGFNLG-GYAGSPLTSPVLPSSPIAPGSPLRHGDRNMRFPPGMRNFG-N  498

Query  546  VIGPWN  563
              G WN
Sbjct  499  SFGSWN  504



>gb|AFW74987.1| hypothetical protein ZEAMMB73_090092 [Zea mays]
Length=919

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 78/126 (62%), Gaps = 20/126 (16%)
 Frame = +3

Query  195  MDPMYIQYLLQFASH-NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSKN  365
            +DP YIQYL Q A+  +DP MDR++LG+SY DLL  QKA +G +L  QK           
Sbjct  396  IDPAYIQYLAQIAATWDDPLMDRSHLGSSYMDLLGTQKANLGPLLQSQK-----------  444

Query  366  MGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVG  545
                 +GY GN GF +G  Y GS LTSPV+P+SP+ PGSP+R  D NMR   GMRNFG  
Sbjct  445  ----QYGYCGNLGFNLG-GYAGSPLTSPVLPSSPIAPGSPLRHGDRNMRFPPGMRNFG-N  498

Query  546  VIGPWN  563
              G WN
Sbjct  499  SFGSWN  504



>ref|XP_006279123.1| hypothetical protein CARUB_v10008047mg, partial [Capsella rubella]
 gb|EOA12021.1| hypothetical protein CARUB_v10008047mg, partial [Capsella rubella]
Length=695

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 94/151 (62%), Gaps = 17/151 (11%)
 Frame = +3

Query  171  GSGLQAQYMDPMYIQYLLQFASH-------NDPSMDRNYLGNSYTDLL--QKAYVGSMLS  323
            G+GLQ+  +DPMY QY  +F+ +       NDP+MDRN++ NSY ++L  Q+AY+G+   
Sbjct  441  GAGLQSHMVDPMYNQYG-RFSENVDCLDLLNDPAMDRNFMNNSYMNMLELQRAYLGA---  496

Query  324  PQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDY  503
             QKSQY VP  S +  S  H  YG+P F   +SYPGS L   ++PNS V P SP+R  + 
Sbjct  497  -QKSQYGVPYKSGSPNS--HSDYGSPTFGSNMSYPGSPLAHHLLPNSLVSPCSPMRRGEV  553

Query  504  NMRVGGGMRNFGVGVIGPWNLD-NMENSFAS  593
            NMR     RN+  GV+G W++D +++  F S
Sbjct  554  NMRYPSATRNYPGGVMGAWHMDASLDEGFGS  584



>ref|XP_010253957.1| PREDICTED: pumilio homolog 4-like [Nelumbo nucifera]
Length=1033

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 96/161 (60%), Gaps = 14/161 (9%)
 Frame = +3

Query  141  NIGRMENQMAGSGLQAQYMDPMYIQYL-------LQFASH-NDPSMDRNYLGNSYTDLL-  293
            ++ R  NQ+ GSG Q   MDP+Y+QYL        Q AS  ND S+ RN+LG S  DLL 
Sbjct  524  SLNRSRNQL-GSGNQLPAMDPLYLQYLQRTTDLAAQTASALNDASLGRNFLGTSQADLLG  582

Query  294  -QKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPV  470
             QKAY+ ++++ QK QY +P   K+ G  +HGYYGNPGF +GL YPG+ L    +  S +
Sbjct  583  FQKAYLEALIAQQKQQYGIPFLGKSDGL-NHGYYGNPGFGLGLPYPGNPLVG--VGLSSL  639

Query  471  GPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLDNMENSFAS  593
            G GSPIR ++   R+    R+   G IG W+ D+  N+  S
Sbjct  640  GAGSPIRQNERMSRLPSMTRSSVGGSIGSWHSDDSRNAEES  680



>ref|XP_006827416.1| hypothetical protein AMTR_s00009p00067490 [Amborella trichopoda]
 gb|ERM94832.1| hypothetical protein AMTR_s00009p00067490 [Amborella trichopoda]
Length=1037

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 109/181 (60%), Gaps = 19/181 (10%)
 Frame = +3

Query  90   DSRMFTGSNLNSASLDQNIGRMENQMAGSGLQAQYMDPMYIQYL---LQFASH-----ND  245
            +S   TG+ L+  +  Q++ R  NQ+ G+GLQ   MDP+Y+QY+   +++A H      D
Sbjct  500  NSHFCTGATLSETNDVQSMNRAVNQV-GAGLQMPLMDPLYLQYMQRAVEYAGHVTGNLGD  558

Query  246  PSMDRNYLGNSYTDL--LQKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGL  419
            PS  RNY+GNSY DL  LQKAY+G +L+ QKSQY +P  SK+ G  +HGY+GN    VG+
Sbjct  559  PSAGRNYMGNSYVDLLGLQKAYLG-LLAQQKSQYAMPFLSKSDGL-NHGYFGNGSCGVGM  616

Query  420  SYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD---NMENSFA  590
             Y    + + ++  S +G G+PIR  + N R    MR+   G  G W+ +   NME+ FA
Sbjct  617  QYSEFPVANSLLSAS-LGVGNPIRQGERNHRF-PAMRS-SAGATGSWHSENGGNMEDCFA  673

Query  591  S  593
            S
Sbjct  674  S  674



>ref|XP_010535464.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
 ref|XP_010535466.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
Length=986

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 105/199 (53%), Gaps = 29/199 (15%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S Q G  N  P  EN  AASA+ +   DSR+  G  ++S   D    RM   M  S LQ
Sbjct  444  MSGQLGTGNFPPHLENGNAASALGLQGFDSRVL-GGGMSSGHTD----RM--TMGSSALQ  496

Query  186  AQYMDPMYIQYL------LQFASHNDPSMDRNYLGN-SYTDLL---QKAYVGSMLSPQKS  335
              + DP+Y+QYL       Q  + NDP MD N LGN SY + L   Q+AY+  +LS QK 
Sbjct  497  HPFADPLYVQYLRTSEYAAQLGALNDPMMDHNLLGNNSYMNNLAEMQRAYIDQLLSAQKQ  556

Query  336  QYNVPLSSK-NMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            QY   +  K   GS   GY+G       +SYPGS L +P  PNSPVG GSP+R +D NM 
Sbjct  557  QYVASVGGKYGGGSNQRGYHG-------MSYPGSPLANPGFPNSPVGSGSPMRHNDLNMS  609

Query  513  VGGGMRNFGVGVIGPWNLD  569
                MRN      G W+LD
Sbjct  610  YPSRMRNLA----GGWHLD  624



>ref|XP_010535467.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
 ref|XP_010535468.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
 ref|XP_010535469.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
Length=988

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 104/199 (52%), Gaps = 29/199 (15%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S Q G  N  P  EN  AASA+ +   DSR+  G  ++S   D    RM   M  S LQ
Sbjct  446  MSGQLGTGNFPPHLENGNAASALGLQGFDSRVL-GGGISSGHTD----RM--TMGSSALQ  498

Query  186  AQYMDPMYIQYL------LQFASHNDPSMDRNYLGN-SYTDLL---QKAYVGSMLSPQKS  335
              + DP+Y+QYL       Q  + NDP MD N LGN SY + L   Q+AYV   LS QK 
Sbjct  499  HPFADPLYVQYLRTSEYAAQLGALNDPMMDHNPLGNNSYMNNLAEMQRAYVDQFLSAQKL  558

Query  336  QYNVPLSSK-NMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            QY   +  K   GS   GYYG       +SYPGS L +P  PNSPVG GSP+R +D NM 
Sbjct  559  QYVASVGGKYGGGSNQRGYYG-------MSYPGSPLANPDFPNSPVGSGSPMRHNDLNMS  611

Query  513  VGGGMRNFGVGVIGPWNLD  569
                MRN      G W+LD
Sbjct  612  YPSRMRNLA----GGWHLD  626



>gb|EMT27786.1| Pumilio-like protein [Aegilops tauschii]
Length=727

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 77/129 (60%), Gaps = 22/129 (17%)
 Frame = +3

Query  195  MDPMYIQYLLQ--FASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSK  362
            +DP+Y+QYL     AS++DP M   +LG+SY DLL  QK  +  +L  QK          
Sbjct  252  IDPLYVQYLAAQVAASYDDPFMASGHLGSSYMDLLGPQKGCLSPLLQSQK----------  301

Query  363  NMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGV  542
                 ++G YGNPGF  GL Y GS LTSPV+P+SPV  GSP+R  + +MR   GMRNFG 
Sbjct  302  -----NYGCYGNPGF--GLGYGGSPLTSPVLPSSPVASGSPLRHGERSMRFASGMRNFG-  353

Query  543  GVIGPWNLD  569
            G  G WN D
Sbjct  354  GSFGSWNPD  362



>ref|XP_006653961.1| PREDICTED: pumilio homolog 1-like [Oryza brachyantha]
Length=877

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 81/143 (57%), Gaps = 28/143 (20%)
 Frame = +3

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            A + LQA  +DP YIQYL          AS +DP M   +LG+SY DLL  QKAY   +L
Sbjct  388  AATSLQAP-IDPAYIQYLQAAEIAAQLAASCDDPLMASGHLGSSYMDLLGPQKAYSSPLL  446

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
              QK               + GYYGN GF  GL+Y GS L SPV+P+SP  PGSP+R  +
Sbjct  447  QSQK---------------NCGYYGNLGF--GLNYAGSPLMSPVLPSSPAAPGSPLRHGE  489

Query  501  YNMRVGGGMRNFGVGVIGPWNLD  569
             +MR+  GMRNFG G  G WN D
Sbjct  490  RSMRLQSGMRNFG-GSFGSWNTD  511



>ref|XP_010535463.1| PREDICTED: pumilio homolog 2-like [Tarenaya hassleriana]
Length=1002

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 107/199 (54%), Gaps = 29/199 (15%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTGSNLNSASLDQNIGRMENQMAGSGLQ  185
            +S Q G  N  P  EN  AASA+ +   DSR+  G  ++S   D    RM   M  S LQ
Sbjct  445  MSGQLGTGNFPPHLENGNAASALGLQGFDSRVL-GGGMSSGHAD----RM--TMGSSALQ  497

Query  186  AQYMDPMYIQYLL--QFASH----NDPSMDRNYLGN-SYTDLL---QKAYVGSMLSPQKS  335
              + DP+Y+QYL   ++A+H    NDP MD N LGN SY + L   Q AY+G +LS QK 
Sbjct  498  HPFADPLYVQYLRTSEYAAHLGALNDPMMDHNLLGNNSYMNNLAEMQSAYIGQLLSAQKQ  557

Query  336  QYNVPLSSK-NMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMR  512
            QY   +  K   GS   GY+G       +SYPG+ L +P  PNSPVG GSP+R +D NM 
Sbjct  558  QYVASVGGKYGGGSNQRGYHG-------MSYPGNPLANPGFPNSPVGSGSPMRHNDLNMS  610

Query  513  VGGGMRNFGVGVIGPWNLD  569
                M+       G W+LD
Sbjct  611  YPSRMKYLA----GGWHLD  625



>gb|EMS50302.1| Pumilio-like protein 3 [Triticum urartu]
Length=730

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 80/137 (58%), Gaps = 23/137 (17%)
 Frame = +3

Query  171  GSGLQAQYMDPMYIQYLLQ--FASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQ  338
            GS LQ   +DP+Y+QYL     AS++DP M   +LGNSY DLL  QK  +  +L  QK  
Sbjct  248  GSSLQMP-IDPLYVQYLAAQVAASYDDPFMAGGHLGNSYMDLLGPQKGCLSPLLQSQK--  304

Query  339  YNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVG  518
                         ++G YGN GF  GL Y GS LTSPV+P+SPV  GSP+R  + +MR  
Sbjct  305  -------------NYGCYGNLGF--GLGYGGSPLTSPVLPSSPVASGSPLRHGERSMRFA  349

Query  519  GGMRNFGVGVIGPWNLD  569
             GMRNFG G  G WN D
Sbjct  350  SGMRNFG-GSFGSWNPD  365



>ref|XP_003569112.1| PREDICTED: pumilio homolog 1-like, partial [Brachypodium distachyon]
Length=639

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 74/129 (57%), Gaps = 22/129 (17%)
 Frame = +3

Query  195  MDPMYIQYLLQ--FASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSK  362
            +DP Y+QYL     AS+ DP M    LG+SY DLL  QKA +  +L  QK          
Sbjct  164  IDPAYVQYLAAQVAASYEDPYMASGLLGSSYMDLLGPQKACLSPLLQSQK----------  213

Query  363  NMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGV  542
                 ++G YGN GF  GL Y GS LTSPV+P+SPV  GSP+R  + +MR   GMRNFG 
Sbjct  214  -----NYGCYGNLGF--GLGYAGSPLTSPVLPSSPVASGSPLRHGERSMRFASGMRNFG-  265

Query  543  GVIGPWNLD  569
            G  G WN D
Sbjct  266  GSFGSWNPD  274



>ref|XP_010231850.1| PREDICTED: pumilio homolog 1-like [Brachypodium distachyon]
Length=888

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 74/129 (57%), Gaps = 22/129 (17%)
 Frame = +3

Query  195  MDPMYIQYLLQ--FASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSK  362
            +DP Y+QYL     AS+ DP M    LG+SY DLL  QKA +  +L  QK          
Sbjct  413  IDPAYVQYLAAQVAASYEDPYMASGLLGSSYMDLLGPQKACLSPLLQSQK----------  462

Query  363  NMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGV  542
                 ++G YGN GF  GL Y GS LTSPV+P+SPV  GSP+R  + +MR   GMRNFG 
Sbjct  463  -----NYGCYGNLGF--GLGYAGSPLTSPVLPSSPVASGSPLRHGERSMRFASGMRNFG-  514

Query  543  GVIGPWNLD  569
            G  G WN D
Sbjct  515  GSFGSWNPD  523



>gb|AAK73144.1|AC079022_17 putative pumilio/Mpt5 family RNA-binding protein [Oryza sativa]
Length=851

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 79/143 (55%), Gaps = 28/143 (20%)
 Frame = +3

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            A + LQ   +DP YIQYL          AS +DP M   +LG+SY DLL  QKAY   +L
Sbjct  362  AATSLQTA-IDPSYIQYLQAAEIAAQLAASCDDPLMASGHLGSSYMDLLGPQKAYASPLL  420

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
              QK               + GYYGN GF  GL Y GS L SPV+P+SP  PGSP+R  +
Sbjct  421  QSQK---------------NCGYYGNLGF--GLGYSGSPLMSPVLPSSPAAPGSPLRHGE  463

Query  501  YNMRVGGGMRNFGVGVIGPWNLD  569
             +MR+  G+RNFG G  G WN D
Sbjct  464  RSMRMQSGIRNFG-GSFGSWNPD  485



>gb|EEE62062.1| hypothetical protein OsJ_16846 [Oryza sativa Japonica Group]
Length=878

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 79/143 (55%), Gaps = 28/143 (20%)
 Frame = +3

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            A + LQ   +DP YIQYL          AS +DP M   +LG+SY DLL  QKAY   +L
Sbjct  389  AATSLQTA-IDPSYIQYLQAAEIAAQLAASCDDPLMASGHLGSSYMDLLGPQKAYASPLL  447

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
              QK               + GYYGN GF  GL Y GS L SPV+P+SP  PGSP+R  +
Sbjct  448  QSQK---------------NCGYYGNLGF--GLGYSGSPLMSPVLPSSPAAPGSPLRHGE  490

Query  501  YNMRVGGGMRNFGVGVIGPWNLD  569
             +MR+  G+RNFG G  G WN D
Sbjct  491  RSMRMQSGIRNFG-GSFGSWNPD  512



>gb|EEC78380.1| hypothetical protein OsI_18154 [Oryza sativa Indica Group]
Length=862

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 79/143 (55%), Gaps = 28/143 (20%)
 Frame = +3

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            A + LQ   +DP YIQYL          AS +DP M   +LG+SY DLL  QKAY   +L
Sbjct  373  AATSLQTA-IDPSYIQYLQAAEIAAQLAASCDDPLMASGHLGSSYMDLLGPQKAYASPLL  431

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
              QK               + GYYGN GF  GL Y GS L SPV+P+SP  PGSP+R  +
Sbjct  432  QSQK---------------NCGYYGNLGF--GLGYSGSPLMSPVLPSSPAAPGSPLRHGE  474

Query  501  YNMRVGGGMRNFGVGVIGPWNLD  569
             +MR+  G+RNFG G  G WN D
Sbjct  475  RSMRMQSGIRNFG-GSFGSWNPD  496



>dbj|BAH00903.1| unnamed protein product [Oryza sativa Japonica Group]
Length=882

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 79/143 (55%), Gaps = 28/143 (20%)
 Frame = +3

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            A + LQ   +DP YIQYL          AS +DP M   +LG+SY DLL  QKAY   +L
Sbjct  393  AATSLQTA-IDPSYIQYLQAAEIAAQLAASCDDPLMASGHLGSSYMDLLGPQKAYASPLL  451

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
              QK               + GYYGN GF  GL Y GS L SPV+P+SP  PGSP+R  +
Sbjct  452  QSQK---------------NCGYYGNLGF--GLGYSGSPLMSPVLPSSPAAPGSPLRHGE  494

Query  501  YNMRVGGGMRNFGVGVIGPWNLD  569
             +MR+  G+RNFG G  G WN D
Sbjct  495  RSMRMQSGIRNFG-GSFGSWNPD  516



>gb|AAU44141.1| putative pumilio/Mpt5 family RNA-binding protein [Oryza sativa 
Japonica Group]
Length=874

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 79/143 (55%), Gaps = 28/143 (20%)
 Frame = +3

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSML  320
            A + LQ   +DP YIQYL          AS +DP M   +LG+SY DLL  QKAY   +L
Sbjct  217  AATSLQTA-IDPSYIQYLQAAEIAAQLAASCDDPLMASGHLGSSYMDLLGPQKAYASPLL  275

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
              QK               + GYYGN GF  GL Y GS L SPV+P+SP  PGSP+R  +
Sbjct  276  QSQK---------------NCGYYGNLGF--GLGYSGSPLMSPVLPSSPAAPGSPLRHGE  318

Query  501  YNMRVGGGMRNFGVGVIGPWNLD  569
             +MR+  G+RNFG G  G WN D
Sbjct  319  RSMRMQSGIRNFG-GSFGSWNPD  340



>gb|AAM22812.1|AF427791_3 BPM [Hordeum vulgare subsp. vulgare]
Length=911

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 76/129 (59%), Gaps = 22/129 (17%)
 Frame = +3

Query  195  MDPMYIQYLLQ--FASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVPLSSK  362
            +DP+Y+QYL     AS++DP M   +LG+SY DLL  QK  +  +L  QK          
Sbjct  436  IDPLYLQYLAAQVAASYDDPFMASGHLGSSYMDLLGPQKGCLSPLLQSQK----------  485

Query  363  NMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGV  542
                 ++G YGN GF  GL Y GS LTSPV+P+SPV  GSP+R  + +MR   GMRNFG 
Sbjct  486  -----NYGCYGNLGF--GLGYAGSPLTSPVLPSSPVASGSPLRHGERSMRFASGMRNFG-  537

Query  543  GVIGPWNLD  569
            G  G W+ D
Sbjct  538  GSFGSWSPD  546



>ref|XP_010935723.1| PREDICTED: pumilio homolog 1-like [Elaeis guineensis]
 ref|XP_010935724.1| PREDICTED: pumilio homolog 1-like [Elaeis guineensis]
 ref|XP_010935725.1| PREDICTED: pumilio homolog 1-like [Elaeis guineensis]
Length=1031

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 94/153 (61%), Gaps = 14/153 (9%)
 Frame = +3

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDL--LQKAYVGSML  320
             GSG Q   MDP+Y QYL       +  A+  DPS+ RNYLG S+ DL   QKAY+G++L
Sbjct  530  VGSGFQLPIMDPLYAQYLHSSSNAAIHAAATLDPSLGRNYLGTSHMDLSEYQKAYLGALL  589

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            + QK QY +PL  K+ GS +HG++G   F +G+ YP S L+S V   SP+G GSP   ++
Sbjct  590  TQQKLQYGMPLPGKS-GSLNHGFFGGHAFGLGMPYPASPLSSSV--LSPLGSGSPAMQNE  646

Query  501  YNMRVGGGMRNFGVGVIGPWNLDN--MENSFAS  593
               R    MR+  VG +G WNL+N  ME ++AS
Sbjct  647  RLSRSPSFMRSAAVGSMGSWNLENGVMEENYAS  679



>ref|XP_011076803.1| PREDICTED: pumilio homolog 2-like isoform X1 [Sesamum indicum]
Length=965

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 110/212 (52%), Gaps = 23/212 (11%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTG-----SNLNSASLD-QNIGRMENQM  167
            L  Q G  N+ PLFEN  A +A+ I  +D R  +G     SNL +A+ + +N+ R+ N  
Sbjct  410  LGNQVGGGNIPPLFENVTAGTAIGISGVDPRALSGGLALGSNLLAAAAEMENLARLGNH-  468

Query  168  AGSGLQAQYMDPMYIQYL----LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
              S   A  MDP YIQYL       A+  D    R  L NS+ +LL  QKAY  ++   Q
Sbjct  469  --SSRDALLMDPSYIQYLRANEYSTAAGADLRTSRESLANSHMELLALQKAYFEAL--HQ  524

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGP-GSPIRCSDYN  506
            KSQY++     +  S  +G++GN  F VG  YP + +  P+ PNSP+G  G PI+  +  
Sbjct  525  KSQYSLAFGKSSTLS--NGFHGNSAFGVGFPYPVNPMGGPIYPNSPIGSGGGPIKHVEQM  582

Query  507  MRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            M     +RN     +G W  +   N+E SFA+
Sbjct  583  MHFPASLRNVAGNFMGQWPSEPGCNLEESFAA  614



>ref|XP_011076804.1| PREDICTED: pumilio homolog 2-like isoform X2 [Sesamum indicum]
Length=957

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 110/212 (52%), Gaps = 23/212 (11%)
 Frame = +3

Query  6    LSTQRGNYNLLPLFENaaaasamaipaMDSRMFTG-----SNLNSASLD-QNIGRMENQM  167
            L  Q G  N+ PLFEN  A +A+ I  +D R  +G     SNL +A+ + +N+ R+ N  
Sbjct  402  LGNQVGGGNIPPLFENVTAGTAIGISGVDPRALSGGLALGSNLLAAAAEMENLARLGNH-  460

Query  168  AGSGLQAQYMDPMYIQYL----LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQ  329
              S   A  MDP YIQYL       A+  D    R  L NS+ +LL  QKAY  ++   Q
Sbjct  461  --SSRDALLMDPSYIQYLRANEYSTAAGADLRTSRESLANSHMELLALQKAYFEAL--HQ  516

Query  330  KSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGP-GSPIRCSDYN  506
            KSQY++     +  S  +G++GN  F VG  YP + +  P+ PNSP+G  G PI+  +  
Sbjct  517  KSQYSLAFGKSSTLS--NGFHGNSAFGVGFPYPVNPMGGPIYPNSPIGSGGGPIKHVEQM  574

Query  507  MRVGGGMRNFGVGVIGPWNLD---NMENSFAS  593
            M     +RN     +G W  +   N+E SFA+
Sbjct  575  MHFPASLRNVAGNFMGQWPSEPGCNLEESFAA  606



>emb|CDM82624.1| unnamed protein product [Triticum aestivum]
Length=759

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 70/133 (53%), Gaps = 26/133 (20%)
 Frame = +3

Query  195  MDPMYIQYLLQFASH------NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVP  350
            +DP+Y Q+L             DP M+R  LG+SY DL   Q  Y+G +L  QK QY+  
Sbjct  278  VDPLYAQFLRAAEIAAFAANCEDPLMERGNLGSSYMDLFGHQNDYLGPLLQSQK-QYD--  334

Query  351  LSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMR  530
                        YYGN G   GL Y G+ LTSPV P SP GPGSP+R  D +MR    MR
Sbjct  335  ------------YYGNLG--SGLGYAGNSLTSPVFPTSPGGPGSPLRHVDRSMRFQSSMR  380

Query  531  NFGVGVIGPWNLD  569
            NFG G  G WN D
Sbjct  381  NFG-GSYGSWNSD  392



>dbj|BAK03395.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AHG29012.1| pumilio [Hordeum vulgare subsp. vulgare]
Length=886

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 70/133 (53%), Gaps = 26/133 (20%)
 Frame = +3

Query  195  MDPMYIQYLLQFASH------NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVP  350
            +DP+Y Q+L             DP M+R  LG+SY DL   Q  Y+G +L  QK QY+  
Sbjct  405  VDPLYAQFLRAAEIAAFAANCEDPLMERGNLGSSYMDLFGHQNDYLGPLLQSQK-QYD--  461

Query  351  LSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMR  530
                        YYGN G   GL Y G+ LTSPV P SP GPGSP+R  D +MR    MR
Sbjct  462  ------------YYGNLG--SGLGYAGNSLTSPVFPTSPGGPGSPLRHVDRSMRFQSSMR  507

Query  531  NFGVGVIGPWNLD  569
            NFG G  G WN D
Sbjct  508  NFG-GSFGSWNSD  519



>gb|EMS46736.1| Pumilio-like protein 1 [Triticum urartu]
Length=1197

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 70/133 (53%), Gaps = 26/133 (20%)
 Frame = +3

Query  195  MDPMYIQYLLQFASH------NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVP  350
            +DP+Y Q+L             DP M+R  LG+SY DL   Q  Y+G +L  QK QY+  
Sbjct  698  VDPLYAQFLRAAEIAAFAANCEDPLMERGNLGSSYMDLFGHQNDYLGPLLQSQK-QYD--  754

Query  351  LSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMR  530
                        YYGN G   GL Y G+ LTSPV P SP GPGSP+R  D +MR    MR
Sbjct  755  ------------YYGNLG--SGLGYAGNSLTSPVFPTSPGGPGSPLRHVDRSMRFQSSMR  800

Query  531  NFGVGVIGPWNLD  569
            NFG G  G WN D
Sbjct  801  NFG-GSYGSWNSD  812



>gb|EMT10419.1| Pumilio-like protein [Aegilops tauschii]
Length=764

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 70/133 (53%), Gaps = 26/133 (20%)
 Frame = +3

Query  195  MDPMYIQYLLQFASH------NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVP  350
            +DP+Y Q+L             DP M+R  LG+SY DL   Q  Y+G +L  QK QY+  
Sbjct  284  VDPLYAQFLRAAEIAAFAANCEDPLMERGNLGSSYMDLFGHQNDYLGPLLQSQK-QYD--  340

Query  351  LSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMR  530
                        YYGN G   GL Y G+ LT+PV P SP GPGSP+R  D +MR    MR
Sbjct  341  ------------YYGNLG--SGLGYAGNSLTNPVFPTSPGGPGSPLRHVDRSMRFQSSMR  386

Query  531  NFGVGVIGPWNLD  569
            NFG G  G WN D
Sbjct  387  NFG-GSYGSWNSD  398



>emb|CDM87073.1| unnamed protein product [Triticum aestivum]
Length=759

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 69/133 (52%), Gaps = 26/133 (20%)
 Frame = +3

Query  195  MDPMYIQYLLQFASH------NDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQYNVP  350
            +DP+Y Q+L             DP M+R  LG+SY DL   Q  Y+G +L  QK QY+  
Sbjct  278  VDPLYAQFLRAAEIAAFAANCEDPLMERGNLGSSYMDLFGHQNDYLGPLLQSQK-QYD--  334

Query  351  LSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMR  530
                        YYGN     GL Y G+ LT+PV P SP GPGSP+R  D +MR    MR
Sbjct  335  ------------YYGN--LVSGLGYAGNSLTNPVFPTSPGGPGSPLRHVDRSMRFQSSMR  380

Query  531  NFGVGVIGPWNLD  569
            NFG G  G WN D
Sbjct  381  NFG-GSYGSWNSD  392



>ref|XP_010658381.1| PREDICTED: pumilio homolog 4 isoform X2 [Vitis vinifera]
Length=1024

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 83/146 (57%), Gaps = 15/146 (10%)
 Frame = +3

Query  192  YMDPMYIQYL--------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQY  341
            YM+P  + Y+           AS  DPS  RN++G S+ DLL  QKAY+ ++L+ QK QY
Sbjct  529  YMEPHGVHYMQGTSDYATRTAASQGDPSSVRNFIGTSHGDLLGLQKAYLETLLAQQKQQY  588

Query  342  NVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGG  521
             +PL  K+ G  + GYYGN  + +G++YPG+ + +  +P+  VG G+P+  +D       
Sbjct  589  ELPLLGKS-GGLNQGYYGNSSYGLGMAYPGNPMANSALPS--VGSGNPMFQNDQISCFTS  645

Query  522  GMRNFGVGVIGPWNLD--NMENSFAS  593
             MR+   G I  W+ D  NME  FAS
Sbjct  646  MMRSSMGGPITSWHTDTSNMEGRFAS  671



>ref|XP_002273503.1| PREDICTED: pumilio homolog 4 isoform X1 [Vitis vinifera]
 ref|XP_010658380.1| PREDICTED: pumilio homolog 4 isoform X1 [Vitis vinifera]
 emb|CBI31431.3| unnamed protein product [Vitis vinifera]
Length=1026

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 83/146 (57%), Gaps = 15/146 (10%)
 Frame = +3

Query  192  YMDPMYIQYL--------LQFASHNDPSMDRNYLGNSYTDLL--QKAYVGSMLSPQKSQY  341
            YM+P  + Y+           AS  DPS  RN++G S+ DLL  QKAY+ ++L+ QK QY
Sbjct  531  YMEPHGVHYMQGTSDYATRTAASQGDPSSVRNFIGTSHGDLLGLQKAYLETLLAQQKQQY  590

Query  342  NVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGG  521
             +PL  K+ G  + GYYGN  + +G++YPG+ + +  +P+  VG G+P+  +D       
Sbjct  591  ELPLLGKS-GGLNQGYYGNSSYGLGMAYPGNPMANSALPS--VGSGNPMFQNDQISCFTS  647

Query  522  GMRNFGVGVIGPWNLD--NMENSFAS  593
             MR+   G I  W+ D  NME  FAS
Sbjct  648  MMRSSMGGPITSWHTDTSNMEGRFAS  673



>ref|XP_009395430.1| PREDICTED: pumilio homolog 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009395431.1| PREDICTED: pumilio homolog 1-like [Musa acuminata subsp. malaccensis]
Length=1004

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 85/148 (57%), Gaps = 15/148 (10%)
 Frame = +3

Query  159  NQMAGSGLQAQYMDPMYIQYLLQFAS----HNDPSMD----RNYLGNSYTDL--LQKAYV  308
            NQ+A SG Q Q MD ++ Q+L Q AS    H   S++    RN+LG    DL   Q AY+
Sbjct  501  NQVA-SGFQGQIMDSLFSQHL-QSASESLVHAAGSLNSYSGRNFLGVPQMDLPEYQNAYL  558

Query  309  GSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPI  488
            GS+L+ QK QY +PL SK+ G   HG+Y +  F VG+ YPGS L++  I    +G GSP+
Sbjct  559  GSLLAQQKLQYGMPLLSKS-GDSDHGFYSSHFFGVGMPYPGSHLST-AIHTPTLGSGSPV  616

Query  489  RCSDYNMRVGGGMRNFGVGVIGPWNLDN  572
            R  +  +R+   +R    G IG W  +N
Sbjct  617  RQGE-RLRISSNIRTATGGSIGSWTTEN  643



>ref|XP_007220282.1| hypothetical protein PRUPE_ppa000731mg [Prunus persica]
 gb|EMJ21481.1| hypothetical protein PRUPE_ppa000731mg [Prunus persica]
Length=1021

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 98/168 (58%), Gaps = 18/168 (11%)
 Frame = +3

Query  99   MFTGSNLNSASL-----DQNIGRMENQMAGSGLQAQYMDPMYIQYLLQ--FASHN--DPS  251
            M   ++L++A+L       ++ R+ N++ GSGL +  MDP YIQ+L +  +A+ N   PS
Sbjct  491  MTINNHLDAAALPGSGDGHSMNRLGNKV-GSGLHSSVMDPSYIQFLQRADYATRNVNSPS  549

Query  252  M---DRNYLGNSYTDL--LQKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVG  416
                 +N+ G  + DL  LQKAY+ ++L+ QK QY + L  K+ G  +HGYYGNP + +G
Sbjct  550  GYPPSKNHFGTLHGDLEGLQKAYLEALLAQQKQQYELSLLGKS-GGFNHGYYGNPSYGLG  608

Query  417  LSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPW  560
            ++YPG+ + + V P+  VG  SP+  ++   R    +R+   G +  W
Sbjct  609  MTYPGNQMANSVHPS--VGSSSPMFQNEKIERFNSMLRSSMGGSVSSW  654



>ref|XP_008365664.1| PREDICTED: pumilio homolog 4 [Malus domestica]
 ref|XP_008365729.1| PREDICTED: pumilio homolog 4 [Malus domestica]
Length=1021

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 95/154 (62%), Gaps = 14/154 (9%)
 Frame = +3

Query  135  DQNIGRMENQMAGSGLQAQYMDPMYIQYLLQ--FASHN--DPS---MDRNYLGNSYTDL-  290
            +Q++ R+ N++ G GL +  MDP YIQ+L +  +A+ N  +PS   + +N+ G  + DL 
Sbjct  509  EQSLNRLGNKV-GPGLHSSVMDPSYIQFLQRTDYAARNVTNPSGYPLSKNHFGTLHGDLE  567

Query  291  -LQKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSP  467
             LQKAY+ ++L+ +K QY++ +  K+ G  +HGYYGNP + +G+ YPG+ + + + P+  
Sbjct  568  GLQKAYLEALLAQRKQQYDLSILGKS-GGFNHGYYGNPPYGLGM-YPGNPMANSLHPS--  623

Query  468  VGPGSPIRCSDYNMRVGGGMRNFGVGVIGPWNLD  569
            +G GSP+  S+   R    +R+   G +  WN D
Sbjct  624  IGYGSPMFESEKIARFNSMLRSSMGGSVSSWNSD  657



>ref|XP_008233289.1| PREDICTED: pumilio homolog 4 [Prunus mume]
 ref|XP_008233290.1| PREDICTED: pumilio homolog 4 [Prunus mume]
Length=1021

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 96/168 (57%), Gaps = 18/168 (11%)
 Frame = +3

Query  99   MFTGSNLNSASL-----DQNIGRMENQMAGSGLQAQYMDPMYIQYLLQ--FASHNDPSMD  257
            M   ++L++A+L       ++ R+ N++ GSGL +  MDP YIQ+L +  +A+ N  S  
Sbjct  491  MTINNHLDAAALPGSGDGHSMNRLGNKV-GSGLHSSVMDPSYIQFLQRADYATRNVTSPS  549

Query  258  -----RNYLGNSYTDL--LQKAYVGSMLSPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVG  416
                 +N+ G  + DL  LQKAY+ ++L+ QK QY +    K+ G  +HGYYGNP + +G
Sbjct  550  GYSPSKNHFGTLHGDLEGLQKAYLEALLAQQKQQYELSFLGKS-GGFNHGYYGNPSYGLG  608

Query  417  LSYPGSLLTSPVIPNSPVGPGSPIRCSDYNMRVGGGMRNFGVGVIGPW  560
            ++YPG+ + + V P+  VG  SP+  ++   R    +R+   G +  W
Sbjct  609  MTYPGNPMANSVHPS--VGSSSPMFQNEKIERFNSMLRSSMGGSVSSW  654



>gb|AAX58753.1| PUF-domain RNA-binding protein [Physcomitrella patens]
Length=1118

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 84/150 (56%), Gaps = 24/150 (16%)
 Frame = +3

Query  108  GSNLNSASLDQNIGRMENQMAGSGLQAQYMDPMYIQYLL---QFASHNDPSMDRNYLGNS  278
            GS+ +SA   QN+     + AG  L  Q  DPMY+QY+      A+  DPS+ RNY+G  
Sbjct  583  GSSAHSAVDIQNL----YKYAGRAL-PQIHDPMYLQYIRMAESTAAALDPSLLRNYMGGD  637

Query  279  YTDL--LQKAYVGSML----SPQKSQYN------VPLSSKNMGSGHHGYYGNPGFRVGLS  422
              D   LQK  + SML    + QKS++       VP++S+  GS   GYYG+P    G+ 
Sbjct  638  PLDTVNLQKKQLSSMLGVYGAEQKSEFGRTGTMGVPITSQKSGSVSPGYYGSPP---GVP  694

Query  423  YPGSLLTSPVIPNSPVGPGS-PIRCSDYNM  509
            Y  S LTSPV+P SPVG GS PIR  D N+
Sbjct  695  YNNSPLTSPVLPGSPVGLGSYPIRRDDRNL  724



>ref|XP_001767745.1| predicted protein [Physcomitrella patens]
 gb|EDQ67496.1| predicted protein [Physcomitrella patens]
Length=1148

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 74/136 (54%), Gaps = 18/136 (13%)
 Frame = +3

Query  177  GLQAQYMDPMYIQYLLQFASHN----DPSMDRNYLGNSYTDL--LQKAYVGSML----SP  326
            G   Q  DPMY+QY+           DPS+ RNY+G    D+  LQK  + +ML    + 
Sbjct  618  GASPQMHDPMYLQYMRAAEEARAAALDPSVLRNYMGGGPVDMVELQKNQLSAMLGGYSAE  677

Query  327  QKSQYN------VPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGS-P  485
            QKSQ+       +P++S+  GS    YYG+P   VG+ Y  S LTSPV+P SPVG GS P
Sbjct  678  QKSQFGRAGSMGIPIASQKSGSMSPAYYGSPPG-VGMPYNNSPLTSPVLPGSPVGAGSFP  736

Query  486  IRCSDYNMRVGGGMRN  533
            +R  + NMR+    R 
Sbjct  737  MRRDERNMRLSSASRT  752



>ref|XP_008800533.1| PREDICTED: pumilio homolog 1-like [Phoenix dactylifera]
 ref|XP_008800534.1| PREDICTED: pumilio homolog 1-like [Phoenix dactylifera]
Length=1026

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 88/153 (58%), Gaps = 9/153 (6%)
 Frame = +3

Query  153  MENQMAGSGLQAQYMDPMYIQYL--LQFASHNDPSMDRNYLGNSYTDL--LQKAYVGSML  320
            M     GSG Q   MDP+Y QYL     A+ +  S  RNYLG S+ DL   Q+AY+G++L
Sbjct  525  MNGNQVGSGFQLPIMDPLYAQYLHNTSNAAIHAASSGRNYLGTSHMDLSEYQRAYLGALL  584

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            + QK QY +P   K+ GS +HG+ G     +G+ YP S L+S V   S +G G+P   ++
Sbjct  585  AQQKLQYGMPFLGKS-GSLNHGFVGGHAVGLGMPYPASPLSSSV--LSSLGSGNPAMQNE  641

Query  501  YNMRVGGGMRNFGVGVIGPWNLDN--MENSFAS  593
            +  R    MR+  VG +G WN ++  ME ++AS
Sbjct  642  HLSRSPSFMRSAAVGSMGSWNREDGVMEENYAS  674



>ref|XP_001767683.1| predicted protein [Physcomitrella patens]
 gb|EDQ67434.1| predicted protein [Physcomitrella patens]
Length=1085

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 74/136 (54%), Gaps = 18/136 (13%)
 Frame = +3

Query  177  GLQAQYMDPMYIQYLLQFASHN----DPSMDRNYLGNSYTDL--LQKAYVGSML----SP  326
            G   Q  DPMY+QY+           DPS+ RNY+G    D+  LQK  + +ML    + 
Sbjct  618  GASPQMHDPMYLQYMRAAEEARAAALDPSVLRNYMGGGPVDMVELQKNQLSAMLGGYSAE  677

Query  327  QKSQYN------VPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGS-P  485
            QKSQ+       +P++S+  GS    YYG+P   VG+ Y  S LTSPV+P SPVG GS P
Sbjct  678  QKSQFGRAGSMGIPIASQKSGSMSPAYYGSPPG-VGMPYNNSPLTSPVLPGSPVGAGSFP  736

Query  486  IRCSDYNMRVGGGMRN  533
            +R  + NMR+    R 
Sbjct  737  MRRDERNMRLSSASRT  752



>ref|XP_008789554.1| PREDICTED: pumilio homolog 4-like [Phoenix dactylifera]
Length=1031

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 87/153 (57%), Gaps = 14/153 (9%)
 Frame = +3

Query  168  AGSGLQAQYMDPMYIQYL-------LQFASHNDPSMDRNYLGNSYTDL--LQKAYVGSML  320
             GSG Q   MDP+  QYL       +  A+  DPS+ RNYL  S+ DL   QKAY+G++L
Sbjct  530  VGSGFQLPIMDPLCAQYLQSTSDAAMHSAASLDPSLGRNYLSTSHMDLPKYQKAYLGALL  589

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            + QK QY +P   K+ G  ++ +YG     +G+ YP S L+S     SP+G GSP+R ++
Sbjct  590  AEQKFQYGMPFLGKS-GGLNNDFYGGQAVSLGMPYPASPLSSSF--LSPLGSGSPVRKNE  646

Query  501  YNMRVGGGMRNFGVGVIGPWNLDN--MENSFAS  593
            +  R    MR+   G +G  N +N  ME ++AS
Sbjct  647  WLSRAPSLMRSAATGSMGSRNPENGVMEENYAS  679



>ref|XP_009396181.1| PREDICTED: pumilio homolog 1-like [Musa acuminata subsp. malaccensis]
Length=1011

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 80/144 (56%), Gaps = 11/144 (8%)
 Frame = +3

Query  168  AGSGLQAQYMDPMYIQYLLQFAS-------HNDPSMDRNYLGNSYTDL--LQKAYVGSML  320
             GSG Q   MD +Y QYL   +        + D     NYLG+S  +L   Q AY+G++L
Sbjct  509  VGSGFQGPIMDSLYAQYLRSTSDSLVRGPGNLDHYSGMNYLGSSQMNLPEYQTAYLGALL  568

Query  321  SPQKSQYNVPLSSKNMGSGHHGYYGNPGFRVGLSYPGSLLTSPVIPNSPVGPGSPIRCSD  500
            + QK QY++PL SK+ G  +HG+  +  F +G+ YPGS  +S  I +  +G GSP+R ++
Sbjct  569  AQQKLQYSMPLLSKS-GGLNHGFSSSHAFGIGMPYPGS-PSSTTIHSPNLGSGSPVRLNE  626

Query  501  YNMRVGGGMRNFGVGVIGPWNLDN  572
               R+   MR+   G IG W  +N
Sbjct  627  RLSRIPSSMRSAPGGSIGSWITEN  650



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160