BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP001C02 413 bp,:Filtered:mask_remained

Length=299
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK27969.1|AF242373_1  cysteine protease                           81.3    5e-16   Ipomoea batatas [batate]
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II  81.3    5e-16   Ipomoea batatas [batate]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I   81.3    6e-16   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I   81.3    6e-16   Ipomoea batatas [batate]
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like            81.3    6e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II  80.9    6e-16   Ipomoea batatas [batate]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...  80.5    9e-16   Ipomoea batatas [batate]
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  80.1    2e-15   Sesamum indicum [beniseed]
ref|XP_003606998.1|  Cysteine proteinase                              79.3    2e-15   Medicago truncatula
ref|XP_003607110.1|  Cysteine proteinase                              78.6    3e-15   Medicago truncatula
ref|XP_007042077.1|  Papain family cysteine protease                  79.3    4e-15   Theobroma cacao [chocolate]
gb|ACI04578.1|  cysteine protease-like protein                        78.6    4e-15   Robinia pseudoacacia [black locust]
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g           78.2    6e-15   Phaseolus vulgaris [French bean]
gb|KDP41743.1|  hypothetical protein JCGZ_26761                       78.2    7e-15   Jatropha curcas
gb|KEH30505.1|  papain family cysteine protease                       77.8    8e-15   Medicago truncatula
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like          78.2    8e-15   Glycine max [soybeans]
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like        78.2    8e-15   Nelumbo nucifera [Indian lotus]
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like          78.2    8e-15   Populus euphratica
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like        77.8    9e-15   Glycine max [soybeans]
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor   77.8    9e-15   Glycine max [soybeans]
gb|AIB06024.1|  CP2                                                   77.8    9e-15   Hevea brasiliensis [jebe]
gb|KHG24064.1|  Cysteinease RD19a -like protein                       77.8    1e-14   Gossypium arboreum [tree cotton]
gb|KHN45894.1|  Cysteine proteinase RD19a                             77.8    1e-14   Glycine soja [wild soybean]
gb|KHN39817.1|  Cysteine proteinase RD19a                             77.0    1e-14   Glycine soja [wild soybean]
ref|XP_002512963.1|  cysteine protease, putative                      77.8    1e-14   Ricinus communis
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A               77.8    1e-14   Vitis vinifera
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g           77.4    1e-14   Phaseolus vulgaris [French bean]
gb|AAX19661.1|  cysteine proteinase                                   77.4    1e-14   Populus tomentosa [Chinese white poplar]
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                77.4    1e-14   Phaseolus vulgaris [French bean]
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a             77.4    1e-14   Solanum lycopersicum
gb|KJB79047.1|  hypothetical protein B456_013G033800                  77.4    2e-14   Gossypium raimondii
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A               77.4    2e-14   
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like          77.0    2e-14   Fragaria vesca subsp. vesca
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like        77.0    2e-14   Glycine max [soybeans]
emb|CAE54306.1|  putative papain-like cysteine proteinase             77.0    2e-14   Gossypium hirsutum [American cotton]
gb|ABK94801.1|  unknown                                               77.0    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like        77.0    2e-14   Eucalyptus grandis [rose gum]
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like        77.0    2e-14   Solanum tuberosum [potatoes]
emb|CDP20652.1|  unnamed protein product                              77.0    2e-14   Coffea canephora [robusta coffee]
ref|XP_002313770.1|  cysteine proteinase A494 precursor               77.0    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like        77.0    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_003607150.1|  Cysteine proteinase                              76.3    2e-14   
gb|AES89347.2|  papain family cysteine protease                       76.3    2e-14   Medicago truncatula
gb|ABK92536.1|  unknown                                               76.6    2e-14   Populus trichocarpa [western balsam poplar]
gb|ABK96580.1|  unknown                                               76.6    2e-14   Populus trichocarpa x Populus deltoides
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like        76.6    3e-14   Cicer arietinum [garbanzo]
ref|XP_002510469.1|  cysteine protease, putative                      76.6    3e-14   Ricinus communis
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a             76.6    3e-14   Populus euphratica
gb|KHG15253.1|  Cysteinease RD19a -like protein                       76.6    3e-14   Gossypium arboreum [tree cotton]
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  76.6    4e-14   
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I             76.6    4e-14   Cucumis sativus [cucumbers]
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g           76.3    4e-14   Populus trichocarpa [western balsam poplar]
gb|KJB32561.1|  hypothetical protein B456_005G247000                  76.3    4e-14   Gossypium raimondii
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like        76.3    4e-14   Nicotiana tomentosiformis
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494     76.3    4e-14   Fragaria vesca subsp. vesca
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a             76.3    4e-14   Vitis vinifera
ref|XP_010105270.1|  Cysteine proteinase 15A                          76.3    4e-14   Morus notabilis
ref|XP_007017672.1|  Papain family cysteine protease                  76.6    4e-14   Theobroma cacao [chocolate]
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like        76.3    5e-14   
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like        75.9    5e-14   Populus euphratica
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like          75.9    5e-14   Glycine max [soybeans]
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494     75.9    5e-14   Eucalyptus grandis [rose gum]
ref|XP_002305451.2|  cysteine proteinase A494 precursor               75.9    5e-14   Populus trichocarpa [western balsam poplar]
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a             75.9    6e-14   Prunus mume [ume]
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like            75.9    6e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like        75.9    6e-14   Pyrus x bretschneideri [bai li]
gb|ABQ10201.1|  cysteine protease Cp3                                 75.5    7e-14   Actinidia deliciosa [Chinese gooseberry]
ref|NP_001267989.1|  cysteine protease precursor                      75.5    8e-14   Vitis vinifera
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg           75.5    8e-14   Prunus persica
gb|KHN22211.1|  Cysteine proteinase 15A                               75.5    8e-14   Glycine soja [wild soybean]
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like        75.5    8e-14   Cucumis melo [Oriental melon]
dbj|BAC41322.1|  hypothetical protein                                 75.1    8e-14   Lotus japonicus
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like            75.5    8e-14   Phoenix dactylifera
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like        75.5    9e-14   Sesamum indicum [beniseed]
gb|KHN25410.1|  Cysteine proteinase RD19a                             75.1    9e-14   Glycine soja [wild soybean]
gb|ABF46642.1|  papain-like cysteine proteinase                       75.1    1e-13   Pachysandra terminalis
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg              75.1    1e-13   Erythranthe guttata [common monkey flower]
gb|AIB06025.1|  CP3                                                   74.7    1e-13   Hevea brasiliensis [jebe]
dbj|BAJ53178.1|  JHL18I08.12                                          74.7    1e-13   Jatropha curcas
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                 74.7    1e-13   Citrus sinensis [apfelsine]
sp|P05993.1|PAPA5_CARPA  RecName: Full=Cysteine proteinase; AltNa...  71.2    1e-13   Carica papaya [mamon]
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like        74.7    1e-13   Citrus sinensis [apfelsine]
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like          74.7    1e-13   Populus euphratica
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1       74.3    2e-13   Lotus japonicus
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a             74.3    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a             74.3    2e-13   Malus domestica [apple tree]
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g           74.3    2e-13   Phaseolus vulgaris [French bean]
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg              74.3    2e-13   Erythranthe guttata [common monkey flower]
gb|AJA74415.1|  cysteine protease                                     74.3    2e-13   Cicer arietinum [garbanzo]
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor   74.3    2e-13   Cicer arietinum [garbanzo]
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg           74.3    2e-13   Citrus clementina
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like        74.3    2e-13   Cucumis sativus [cucumbers]
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like        74.3    2e-13   Cucumis melo [Oriental melon]
dbj|BAF98585.1|  CM0216.510.nc                                        73.9    2e-13   Lotus japonicus
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like        73.9    2e-13   Eucalyptus grandis [rose gum]
dbj|BAF98584.1|  CM0216.500.nc                                        73.9    3e-13   Lotus japonicus
dbj|BAF03553.1|  cysteine proteinase CP2                              73.9    3e-13   Phaseolus vulgaris [French bean]
gb|AAU81591.1|  cysteine proteinase                                   72.0    3e-13   Petunia x hybrida [garden petunia]
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2       73.9    3e-13   Lotus japonicus
gb|KJB29611.1|  hypothetical protein B456_005G110200                  73.6    3e-13   Gossypium raimondii
gb|KJB07487.1|  hypothetical protein B456_001G026600                  73.6    4e-13   Gossypium raimondii
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g           73.6    4e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210        73.6    4e-13   Amborella trichopoda
gb|AAU81589.1|  cysteine proteinase                                   72.0    5e-13   Petunia x hybrida [garden petunia]
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494     73.2    5e-13   Tarenaya hassleriana [spider flower]
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like        73.9    5e-13   Pyrus x bretschneideri [bai li]
gb|ACM80348.1|  cysteine proteinase                                   73.2    5e-13   Solanum lycopersicum
gb|AAO11786.1|  pre-pro cysteine proteinase                           73.2    5e-13   Vicia faba [broad bean]
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A               73.2    5e-13   Vitis vinifera
emb|CDQ51995.1|  Cysteine proteinase                                  70.9    6e-13   Fagus sylvatica
gb|AAL69389.1|AF462226_1  putative cysteine proteinase                70.5    6e-13   Narcissus pseudonarcissus
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like        73.6    6e-13   Pyrus x bretschneideri [bai li]
emb|CAA82995.1|  cysteine proteinase                                  72.8    6e-13   Vicia sativa [spring vetch]
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor               72.8    7e-13   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like            72.8    7e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like          72.8    7e-13   Citrus sinensis [apfelsine]
gb|AAB67878.1|  pre-pro-cysteine proteinase                           72.8    7e-13   Vicia faba [broad bean]
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like        72.8    8e-13   Brassica rapa
ref|XP_003589348.1|  Cysteine proteinase                              72.8    8e-13   Medicago truncatula
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...  72.4    8e-13   Pisum sativum [garden pea]
gb|KHG15062.1|  Cysteinease RD19a -like protein                       72.8    8e-13   Gossypium arboreum [tree cotton]
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like            72.8    8e-13   Elaeis guineensis
gb|AAR92156.1|  putative cysteine protease 3                          71.2    1e-12   Iris x hollandica [Dutch iris]
gb|ABK96252.1|  unknown                                               70.1    1e-12   Populus trichocarpa x Populus deltoides
gb|AAK07731.1|  CPR2-like cysteine proteinase                         72.4    1e-12   Nicotiana tabacum [American tobacco]
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like          72.4    1e-12   Nicotiana tomentosiformis
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                  72.4    1e-12   Nicotiana tabacum [American tobacco]
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                  72.4    1e-12   Nicotiana tabacum [American tobacco]
gb|KHN12668.1|  Cysteine proteinase 15A                               70.1    1e-12   Glycine soja [wild soybean]
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg           72.4    1e-12   Citrus clementina
dbj|BAF46302.1|  cysteine proteinase precursor                        72.4    1e-12   Ipomoea nil [qian niu]
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                 72.4    1e-12   Citrus sinensis [apfelsine]
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like          72.0    1e-12   Nicotiana sylvestris
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor               72.0    2e-12   Solanum melongena [aubergine]
gb|AAM65162.1|  cysteine proteinase RD19A                             72.0    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like        71.6    2e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS70818.1|  cysteine proteinase                                   71.6    2e-12   Genlisea aurea
ref|NP_568052.1|  cysteine proteinase RD19a                           71.6    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a             71.6    2e-12   Tarenaya hassleriana [spider flower]
gb|AAQ81938.1|  cysteine proteinase precursor                         71.6    2e-12   Ipomoea batatas [batate]
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like            71.2    2e-12   Phoenix dactylifera
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A               71.2    2e-12   Malus domestica [apple tree]
emb|CDY34441.1|  BnaC01g21920D                                        71.2    2e-12   Brassica napus [oilseed rape]
emb|CAB17075.1|  cysteine proteinase precursor                        71.2    2e-12   Phaseolus vulgaris [French bean]
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like          71.2    3e-12   Brassica rapa
gb|ACK57563.1|  cysteine protease-like protein                        70.9    4e-12   Arachis hypogaea [goober]
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like          70.9    4e-12   Solanum tuberosum [potatoes]
emb|CDY71205.1|  BnaCnng71840D                                        70.9    4e-12   Brassica napus [oilseed rape]
emb|CDY09707.1|  BnaC07g33540D                                        70.9    4e-12   Brassica napus [oilseed rape]
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like          70.9    4e-12   Sesamum indicum [beniseed]
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like          70.9    4e-12   Prunus mume [ume]
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease     70.9    4e-12   Brassica oleracea
dbj|BAD43619.1|  putative cysteine proteinase                         70.5    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like            70.5    4e-12   Elaeis guineensis
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg              70.5    5e-12   Erythranthe guttata [common monkey flower]
ref|NP_565512.1|  Papain family cysteine protease                     70.5    5e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ACX54787.2|  cysteine protease                                     70.5    5e-12   Arachis diogoi
gb|ABK93575.1|  unknown                                               68.2    5e-12   Populus trichocarpa [western balsam poplar]
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008           70.5    5e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A               70.5    5e-12   
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like        69.3    5e-12   Pyrus x bretschneideri [bai li]
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg           70.5    5e-12   Eutrema salsugineum
emb|CDX98179.1|  BnaC07g09190D                                        66.2    6e-12   Brassica napus [oilseed rape]
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like            70.5    6e-12   Brachypodium distachyon [annual false brome]
gb|KJB58164.1|  hypothetical protein B456_009G197400                  70.1    7e-12   Gossypium raimondii
dbj|BAA92495.1|  cysteine protease                                    69.7    8e-12   Vigna mungo [urad dal]
emb|CAB53397.1|  cysteine protease                                    68.2    8e-12   Medicago sativa [alfalfa]
gb|AJP16692.1|  cysteine protease                                     67.4    8e-12   Striga hermonthica [purple witchweed]
gb|ABK24153.1|  unknown                                               70.1    9e-12   Picea sitchensis
gb|AAB16996.1|  thiol protease isoform B                              69.3    9e-12   Glycine max [soybeans]
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                  69.7    9e-12   Arabis alpina [alpine rockcress]
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg           69.3    1e-11   Eutrema salsugineum
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A               69.3    1e-11   Pyrus x bretschneideri [bai li]
emb|CDX99593.1|  BnaC04g33500D                                        68.9    1e-11   Brassica napus [oilseed rape]
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg           69.3    1e-11   Prunus persica
dbj|BAD94010.1|  drought-inducible cysteine proteinase RD19A prec...  65.9    1e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CDX90537.1|  BnaA03g42440D                                        68.9    2e-11   Brassica napus [oilseed rape]
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg           68.9    2e-11   Capsella rubella
gb|AAB62937.1|  stress-induced cysteine proteinase                    67.0    2e-11   Lavatera thuringiaca
emb|CAH59428.1|  cysteine protease 2                                  67.0    2e-11   Plantago major [cart-track plant]
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like        68.6    2e-11   Brassica rapa
gb|AAZ32411.1|  cysteine proteinase glycinain type                    68.6    2e-11   Nicotiana benthamiana
emb|CAA78403.1|  pre-pro-cysteine proteinase                          68.6    2e-11   Solanum lycopersicum
emb|CDY15894.1|  BnaA04g12170D                                        68.6    3e-11   Brassica napus [oilseed rape]
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494     68.6    3e-11   Brassica rapa
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like        68.6    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like        68.2    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a             68.2    3e-11   Brassica rapa
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677           68.2    3e-11   Arabidopsis lyrata subsp. lyrata
gb|ABY75169.1|  cysteine protease                                     63.9    3e-11   Arachis diogoi
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a             68.2    3e-11   Camelina sativa [gold-of-pleasure]
emb|CDY41960.1|  BnaA01g05320D                                        68.2    3e-11   Brassica napus [oilseed rape]
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a             68.2    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg           68.2    4e-11   Eutrema salsugineum
emb|CDP07452.1|  unnamed protein product                              68.2    4e-11   Coffea canephora [robusta coffee]
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like          67.8    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like        67.8    4e-11   Cucumis melo [Oriental melon]
emb|CAA52403.1|  putative thiol protease                              67.4    4e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EEE60725.1|  hypothetical protein OsJ_14236                        67.8    5e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830        67.8    5e-11   Sorghum bicolor [broomcorn]
emb|CAD40319.2|  OSJNBb0054B09.3                                      67.8    5e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like          67.4    5e-11   Camelina sativa [gold-of-pleasure]
ref|NP_001059639.1|  Os07g0480900                                     67.4    6e-11   
ref|NP_001046828.1|  Os02g0469600                                     67.4    6e-11   
dbj|BAG16515.1|  putative cysteine proteinase                         67.4    6e-11   Capsicum chinense [bonnet pepper]
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like            67.4    7e-11   Brachypodium distachyon [annual false brome]
emb|CAQ00101.1|  papain-like cysteine proteinase                      67.4    7e-11   Hordeum vulgare subsp. vulgare [barley]
gb|ABK21238.1|  unknown                                               67.0    8e-11   Picea sitchensis
gb|EMT16425.1|  Cysteine proteinase 1                                 67.4    8e-11   Aegilops tauschii
gb|ABK24688.1|  unknown                                               67.0    8e-11   Picea sitchensis
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200             67.0    8e-11   Arabis alpina [alpine rockcress]
gb|ACN40679.1|  unknown                                               67.0    8e-11   Picea sitchensis
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270        67.0    9e-11   Sorghum bicolor [broomcorn]
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor          67.0    9e-11   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg           67.0    9e-11   Capsella rubella
gb|EAY93546.1|  hypothetical protein OsI_15336                        66.6    1e-10   Oryza sativa Indica Group [Indian rice]
ref|NP_001105685.1|  cysteine proteinase 1 precursor                  67.0    1e-10   Zea mays [maize]
gb|EPS65881.1|  cysteine proteinase                                   66.6    1e-10   Genlisea aurea
gb|EMT10192.1|  Cysteine proteinase 1                                 67.0    1e-10   Aegilops tauschii
gb|EMS53996.1|  Cysteine proteinase 1                                 67.0    1e-10   Triticum urartu
gb|ACF86683.1|  unknown                                               67.0    1e-10   Zea mays [maize]
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  66.2    2e-10   Oryza brachyantha
ref|NP_001052440.1|  Os04g0311400                                     66.2    2e-10   
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like            66.2    2e-10   Setaria italica
gb|AAW21813.1|  cysteine protease                                     65.9    2e-10   Triticum aestivum [Canadian hard winter wheat]
gb|EMS64962.1|  Cysteine proteinase 1                                 65.1    2e-10   Triticum urartu
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like            65.5    3e-10   
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like        65.5    3e-10   Cucumis sativus [cucumbers]
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like            65.5    4e-10   Setaria italica
ref|NP_567489.1|  papain family cysteine protease                     65.1    4e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CAQ00102.1|  papain-like cysteine proteinase                      65.1    4e-10   Hordeum vulgare subsp. vulgare [barley]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142           65.1    4e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A               64.7    6e-10   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA40800.1|  TPA: putative cysteine protease family protein       64.7    7e-10   Zea mays [maize]
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like            64.3    9e-10   Setaria italica
gb|AAB16997.1|  thiol protease isoform A                              63.5    9e-10   Glycine max [soybeans]
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like            62.0    9e-10   
gb|EMS59778.1|  Cysteine proteinase 15A                               61.6    1e-09   Triticum urartu
gb|AGS43121.1|  cysteine protease 1                                   60.5    1e-09   Zea mays [maize]
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494     63.5    1e-09   Brassica rapa
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a             63.2    2e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494     63.2    2e-09   Phoenix dactylifera
emb|CAA57675.1|  cysteine proteinase                                  60.8    2e-09   Zea mays [maize]
ref|XP_008776953.1|  PREDICTED: cysteine proteinase-like              60.5    3e-09   Phoenix dactylifera
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a             62.4    3e-09   Vitis vinifera
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg           62.4    3e-09   Capsella rubella
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like        62.4    3e-09   Nicotiana sylvestris
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274            62.4    4e-09   Selaginella moellendorffii
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583           61.6    5e-09   Selaginella moellendorffii
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like        60.1    5e-09   Phoenix dactylifera
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911           61.6    7e-09   Arabidopsis lyrata subsp. lyrata
dbj|BAD10859.1|  cysteine protease                                    61.6    7e-09   Tripolium pannonicum [sea starwort]
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like          61.2    8e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494     61.2    9e-09   Elaeis guineensis
emb|CDY13816.1|  BnaA09g43180D                                        60.5    9e-09   Brassica napus [oilseed rape]
gb|AEX97108.1|  cysteine proteinase                                   58.9    1e-08   Malus domestica [apple tree]
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A               60.8    1e-08   Nelumbo nucifera [Indian lotus]
dbj|BAD94378.1|  hypothetical protein                                 56.6    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                 60.8    2e-08   Brachypodium distachyon [annual false brome]
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                  60.5    2e-08   Arabis alpina [alpine rockcress]
gb|EEC82027.1|  hypothetical protein OsI_25996                        60.8    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_001781954.1|  predicted protein                                60.1    2e-08   Physcomitrella patens
gb|AAO12867.1|  papain-like cysteine proteinase                       56.2    2e-08   Vitis vinifera
emb|CDO99795.1|  unnamed protein product                              59.7    4e-08   Coffea canephora [robusta coffee]
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A               59.7    4e-08   Tarenaya hassleriana [spider flower]
gb|KJB73490.1|  hypothetical protein B456_011G235500                  58.9    6e-08   Gossypium raimondii
emb|CAB16316.1|  cysteine proteinase precursor                        58.9    7e-08   Vicia sativa [spring vetch]
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A               58.9    7e-08   Prunus mume [ume]
ref|NP_567010.5|  Papain family cysteine protease                     58.5    7e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CAB41090.1|  cysteine proteinase precursor-like protein           58.5    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A               58.5    8e-08   Malus domestica [apple tree]
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like          57.8    8e-08   Malus domestica [apple tree]
gb|KHG08355.1|  Cysteinease 1                                         58.5    8e-08   Gossypium arboreum [tree cotton]
gb|AEQ54770.1|  cysteine proteinase CP1                               58.5    9e-08   Coffea canephora [robusta coffee]
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg           58.5    9e-08   Prunus persica
gb|KHN00877.1|  Cysteine proteinase 15A                               57.8    1e-07   Glycine soja [wild soybean]
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like          57.8    2e-07   
gb|KEH43476.1|  papain family cysteine protease                       57.8    2e-07   Medicago truncatula
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like          57.8    2e-07   Cicer arietinum [garbanzo]
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like          57.8    2e-07   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A               57.8    2e-07   
ref|XP_001761980.1|  predicted protein                                57.4    2e-07   
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg           57.4    2e-07   
dbj|BAC57957.1|  thiol protease                                       55.1    3e-07   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg              56.6    4e-07   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A               56.2    5e-07   
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494     56.2    5e-07   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A               56.2    5e-07   
emb|CDY56961.1|  BnaA09g55030D                                        56.2    6e-07   
emb|CDX73424.1|  BnaC08g25790D                                        55.8    6e-07   
emb|CBY11269.1|  unnamed protein product                              55.8    6e-07   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A               56.2    6e-07   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                 55.8    6e-07   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like          55.8    8e-07   
gb|KHN37802.1|  Cysteine proteinase 1                                 55.5    9e-07   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg           55.5    9e-07   
ref|NP_001236888.1|  cysteine proteinase precursor                    55.5    1e-06   
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33         55.1    1e-06   
gb|AAB53103.1|  cysteine protease                                     52.4    1e-06   
ref|XP_010103534.1|  putative cysteine proteinase A494                55.1    1e-06   
gb|AEW08440.1|  hypothetical protein 2_9845_02                        51.6    1e-06   
gb|EPS63354.1|  hypothetical protein M569_11429                       54.7    2e-06   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A               54.7    2e-06   
emb|CBY31096.1|  unnamed protein product                              54.3    2e-06   
ref|XP_007010012.1|  Papain family cysteine protease                  54.3    3e-06   
ref|XP_002533377.1|  cysteine protease, putative                      54.3    3e-06   
emb|CAB17077.1|  cysteine proteinase precursor                        53.9    3e-06   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A               53.9    3e-06   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A               53.9    3e-06   
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g           54.3    3e-06   
emb|CAN64491.1|  hypothetical protein VITISV_015725                   53.5    3e-06   
dbj|BAD94768.1|  cysteine proteinase like protein                     50.1    4e-06   
ref|XP_002682087.1|  predicted protein                                53.1    6e-06   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A               53.1    6e-06   
emb|CBI31400.3|  unnamed protein product                              52.4    7e-06   
ref|XP_001894882.1|  cathepsin F-like cysteine proteinase             50.4    8e-06   
ref|XP_011493714.1|  AAEL017153-PA                                    53.5    8e-06   
ref|XP_003115597.1|  CRE-TAG-196 protein                              52.8    9e-06   
gb|ADY04361.1|  cysteine protease                                     50.4    1e-05   
gb|ADY04295.1|  cysteine protease                                     50.4    1e-05   
gb|ADY04268.1|  cysteine protease                                     50.4    1e-05   
gb|ADY04480.1|  cysteine protease                                     50.4    1e-05   
gb|ADY04358.1|  cysteine protease                                     50.4    1e-05   
gb|ADY04342.1|  cysteine protease                                     50.4    1e-05   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g           52.4    1e-05   
gb|ADY04293.1|  cysteine protease                                     50.4    1e-05   
gb|EGI66903.1|  Putative cysteine proteinase                          53.1    1e-05   
gb|ADY04336.1|  cysteine protease                                     50.4    1e-05   
gb|ADY04262.1|  cysteine protease                                     50.4    1e-05   
gb|ADY04457.1|  cysteine protease                                     50.4    1e-05   
gb|ADY04482.1|  cysteine protease                                     50.1    1e-05   
gb|ADY04414.1|  cysteine protease                                     50.1    1e-05   
ref|XP_011052455.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.1    1e-05   
gb|ADY04359.1|  cysteine protease                                     50.1    1e-05   
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163  52.8    1e-05   
gb|KFB38327.1|  AGAP002879-PB-like protein                            52.8    1e-05   
ref|XP_006007112.1|  PREDICTED: cathepsin F-like                      52.4    1e-05   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                       52.0    2e-05   
ref|XP_002635317.1|  C. briggsae CBR-TAG-196 protein                  52.4    2e-05   
ref|XP_003057227.1|  predicted protein                                51.6    2e-05   
ref|XP_312034.5|  AGAP002879-PA                                       52.8    2e-05   
ref|XP_003436277.1|  AGAP002879-PB                                    52.8    2e-05   
gb|AAT07059.1|  cathepsin F-like cysteine proteinase                  52.0    2e-05   
ref|NP_505215.2|  Protein TAG-196                                     52.0    2e-05   
gb|ETN61472.1|  hypothetical protein AND_006867                       52.8    2e-05   
ref|XP_003436276.1|  AGAP002879-PC                                    52.4    2e-05   
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163  52.4    2e-05   
emb|CAD43085.2|  putative cysteine proteinase                         48.1    2e-05   
ref|XP_005184487.1|  PREDICTED: putative cysteine proteinase CG12...  52.0    2e-05   
ref|XP_011169692.1|  PREDICTED: putative cysteine proteinase CG12163  52.0    2e-05   
ref|XP_005184486.1|  PREDICTED: putative cysteine proteinase CG12...  52.0    2e-05   
ref|XP_002988513.1|  hypothetical protein SELMODRAFT_128220           48.9    2e-05   
ref|XP_001844355.1|  conserved hypothetical protein                   52.0    3e-05   
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...  51.6    3e-05   
ref|XP_005184488.1|  PREDICTED: putative cysteine proteinase CG12...  51.6    3e-05   
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...  52.0    3e-05   
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...  51.6    3e-05   
gb|EFN80374.1|  Putative cysteine proteinase CG12163                  52.0    3e-05   
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896  52.0    3e-05   
gb|ADY04368.1|  cysteine protease                                     48.9    3e-05   
gb|ADE76932.1|  unknown                                               51.2    3e-05   
gb|EGT34543.1|  hypothetical protein CAEBREN_26318                    51.2    3e-05   
ref|XP_007056271.1|  PREDICTED: cathepsin W-like                      50.8    3e-05   
emb|CDP90584.1|  Protein BM-TAG-196                                   51.2    3e-05   
ref|XP_007510080.1|  unknown                                          51.2    3e-05   
ref|XP_005305646.1|  PREDICTED: cathepsin W-like                      50.8    4e-05   
gb|ACR08662.1|  cathepsin F                                           49.3    4e-05   
gb|EGT34572.1|  hypothetical protein CAEBREN_13324                    51.2    4e-05   
dbj|BAI44279.1|  cysteine proteinase inhibitor precursor              51.6    4e-05   
gb|EYC18288.1|  hypothetical protein Y032_0028g1777                   48.1    4e-05   
gb|KHN72698.1|  Putative cysteine proteinase                          48.5    4e-05   
gb|AFM37363.1|  cathepsin F1                                          50.8    4e-05   
gb|EJW79799.1|  cysteine protease 6                                   50.1    4e-05   
ref|NP_730901.1|  CG12163, isoform A                                  51.2    4e-05   
ref|XP_002000409.1|  GI10216                                          51.2    4e-05   
ref|XP_001994049.1|  GH22731                                          51.2    4e-05   
ref|XP_009111689.1|  PREDICTED: thiol protease aleurain-like          50.4    4e-05   
ref|XP_002073772.1|  GK14287                                          51.2    4e-05   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800        50.4    4e-05   
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620  51.2    4e-05   
gb|ERG79645.1|  cysteine proteinase                                   48.1    5e-05   
gb|KIH48456.1|  cysteine proteinase family protein                    47.4    5e-05   
ref|XP_002038380.1|  GM10654                                          50.8    5e-05   
gb|ELT97360.1|  hypothetical protein CAPTEDRAFT_147978                50.1    5e-05   
gb|ABE72973.1|  cathepsin L                                           50.1    5e-05   
ref|XP_001978897.1|  GG11133                                          50.8    5e-05   
ref|XP_002096026.1|  GE25302                                          50.8    5e-05   
ref|XP_002017233.1|  GL22196                                          50.8    5e-05   
ref|NP_649521.1|  CG12163, isoform B                                  50.4    6e-05   
ref|XP_002056575.1|  GJ11017                                          50.4    6e-05   
ref|XP_003578189.1|  PREDICTED: thiol protease aleurain               50.1    6e-05   
ref|XP_002137768.1|  GA27408, isoform A                               50.4    6e-05   
ref|XP_001955780.1|  GF16067                                          50.4    7e-05   
ref|XP_003736743.1|  GA27408, isoform B                               50.4    7e-05   
ref|XP_001607324.1|  PREDICTED: uncharacterized protein LOC100123649  50.8    7e-05   
ref|XP_004596891.1|  PREDICTED: cathepsin F                           50.4    7e-05   
ref|XP_002979143.1|  hypothetical protein SELMODRAFT_110288           48.9    8e-05   
ref|XP_011469621.1|  PREDICTED: cysteine proteinase 15A-like          48.9    8e-05   
ref|XP_005305525.1|  PREDICTED: cathepsin W-like                      49.7    8e-05   
emb|CDX88753.1|  BnaA03g08960D                                        49.7    8e-05   
ref|XP_003148243.1|  hypothetical protein LOAG_12683                  48.5    8e-05   
gb|EHJ64782.1|  cysteine proteinase inhibitor precursor               47.8    9e-05   
ref|XP_005770574.1|  hypothetical protein EMIHUDRAFT_349865           49.7    9e-05   
gb|EZA58965.1|  Putative cysteine proteinase                          50.4    9e-05   
gb|EFO15826.2|  hypothetical protein LOAG_12683                       48.5    9e-05   
ref|XP_003774588.1|  PREDICTED: cathepsin W                           49.7    9e-05   
ref|XP_002427787.1|  Cathepsin F precursor, putative                  49.7    9e-05   
ref|XP_006827472.1|  hypothetical protein AMTR_s00009p00129100        49.7    9e-05   
ref|XP_006121731.1|  PREDICTED: cathepsin W-like                      48.5    1e-04   
ref|XP_011331416.1|  PREDICTED: uncharacterized protein LOC105275911  50.4    1e-04   
ref|XP_006849385.1|  hypothetical protein AMTR_s01332p00008900        49.3    1e-04   
ref|XP_005109777.1|  PREDICTED: cysteine proteinase RD19a-like        49.7    1e-04   
ref|XP_004343021.1|  cathepsin L, putative                            49.3    1e-04   
ref|XP_010047474.1|  PREDICTED: thiol protease aleurain-like          49.3    1e-04   
ref|XP_007438969.1|  PREDICTED: cathepsin F-like                      48.1    1e-04   
ref|XP_006268168.1|  PREDICTED: cathepsin F-like                      49.7    1e-04   
gb|ELV09527.1|  Cathepsin F                                           49.7    1e-04   
gb|AAP33049.1|  cysteine proteinase 1                                 49.3    1e-04   
ref|XP_003378245.1|  cathepsin F                                      49.3    1e-04   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...  49.7    1e-04   
ref|XP_005305555.1|  PREDICTED: cathepsin F                           49.3    1e-04   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956           48.9    1e-04   
ref|XP_009131925.1|  PREDICTED: thiol protease aleurain-like          48.9    1e-04   
ref|XP_009035142.1|  hypothetical protein AURANDRAFT_22962            49.3    1e-04   
ref|XP_008821074.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      49.3    1e-04   
ref|XP_006980634.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      49.3    2e-04   
ref|XP_008271777.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      49.3    2e-04   
gb|KCW79401.1|  hypothetical protein EUGRSUZ_C00809                   48.9    2e-04   
gb|ABC48936.1|  cathepsin F like protease                             49.3    2e-04   
ref|XP_004596903.1|  PREDICTED: cathepsin W                           48.9    2e-04   
ref|XP_010047478.1|  PREDICTED: thiol protease aleurain-like          48.9    2e-04   
gb|EQB77684.1|  Cathepsin F precursor (CATSF)-like protein            48.9    2e-04   
ref|XP_005351748.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      49.3    2e-04   
gb|AET71138.1|  cysteine peptidase isoform b                          48.5    2e-04   
ref|XP_011309436.1|  PREDICTED: uncharacterized protein LOC105270293  49.3    2e-04   
ref|XP_001029851.1|  Papain family cysteine protease containing p...  48.5    2e-04   
ref|XP_010050440.1|  PREDICTED: thiol protease aleurain-like          48.5    2e-04   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708     49.3    2e-04   
emb|CEF60946.1|  Cathepsin L.1                                        48.5    2e-04   
gb|AAT09103.1|  digestive cysteine proteinase                         48.5    2e-04   
ref|XP_006036937.1|  PREDICTED: cathepsin F-like                      48.9    2e-04   
ref|XP_008577225.1|  PREDICTED: cathepsin F                           48.9    2e-04   
ref|XP_004051670.1|  PREDICTED: cathepsin F                           48.9    2e-04   
ref|XP_008531628.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      48.9    2e-04   
ref|XP_004656783.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      48.9    2e-04   
ref|XP_008177856.1|  PREDICTED: cathepsin W-like                      45.8    2e-04   
gb|AAY81948.1|  cysteine protease 11                                  48.5    2e-04   
gb|ACN56478.1|  cathepsin F                                           48.9    2e-04   
ref|XP_002755611.1|  PREDICTED: cathepsin F                           48.9    2e-04   
ref|XP_010364711.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      48.9    2e-04   
gb|KDR17524.1|  Putative cysteine proteinase                          49.3    2e-04   
ref|XP_004355074.1|  cathepsin L 2 precursor, putative                48.1    2e-04   
ref|XP_003777749.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      48.9    2e-04   
ref|XP_003273955.2|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      48.9    2e-04   
ref|XP_007972284.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      48.5    2e-04   
ref|XP_004437729.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      48.5    3e-04   
gb|AFQ01139.1|  cathepsin F-like protease                             48.5    3e-04   
ref|XP_003696602.1|  PREDICTED: putative cysteine proteinase CG12...  48.9    3e-04   
ref|XP_004563245.1|  PREDICTED: cathepsin F-like                      48.5    3e-04   
ref|XP_005577203.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      48.5    3e-04   
ref|XP_003741376.1|  PREDICTED: cathepsin S-like                      48.1    3e-04   
gb|ACK38176.1|  midgut cysteine peptidase                             48.1    3e-04   
ref|XP_007648967.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      48.5    3e-04   
ref|XP_010954979.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      48.5    3e-04   
ref|XP_003284553.1|  hypothetical protein DICPUDRAFT_96752            48.1    3e-04   
ref|XP_009183845.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      48.5    3e-04   
ref|XP_004040193.1|  nucleotide binding protein, putative             48.5    3e-04   
gb|EFN65613.1|  Putative cysteine proteinase CG12163                  48.9    3e-04   
gb|KCW79397.1|  hypothetical protein EUGRSUZ_C00804                   48.1    3e-04   
gb|AAB82455.1|  lymphopain                                            48.1    3e-04   
ref|NP_034115.2|  cathepsin W preproprotein                           48.1    3e-04   
ref|XP_011260522.1|  PREDICTED: uncharacterized protein LOC105253881  48.9    3e-04   
ref|XP_004338575.1|  cysteine proteinase                              48.1    3e-04   
gb|AAD41105.1|AF157961_1  cysteine proteinase                         48.1    3e-04   
ref|NP_003784.2|  cathepsin F precursor                               48.5    3e-04   
ref|XP_002074892.1|  GK22908                                          48.1    3e-04   
gb|EGW06365.1|  Cathepsin F                                           48.5    3e-04   
ref|XP_006210811.1|  PREDICTED: cathepsin F                           48.1    3e-04   
gb|KHN12281.1|  Thiol protease aleurain-like                          47.8    3e-04   
ref|XP_006937584.1|  PREDICTED: cathepsin W isoform X1                48.1    3e-04   
gb|AAF13146.1|AF136279_1  cathepsin F precursor                       48.1    3e-04   
gb|AHJ86278.1|  cysteine protease                                     48.1    3e-04   
gb|AAV38405.1|  cathepsin F                                           48.1    3e-04   
ref|XP_006911151.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin W      48.1    3e-04   
ref|NP_001029282.1|  cathepsin F precursor                            48.1    3e-04   
gb|AAG28508.1|AF197480_1  cathepsin F                                 48.1    3e-04   
ref|NP_063914.1|  cathepsin F precursor                               48.1    3e-04   
ref|XP_007056266.1|  PREDICTED: cathepsin F-like                      48.1    3e-04   
ref|XP_007202120.1|  hypothetical protein PRUPE_ppa006924mg           48.1    3e-04   
gb|ABC69429.1|  cysteine protease                                     47.8    4e-04   
ref|XP_004709011.1|  PREDICTED: dipeptidyl peptidase 1                48.1    4e-04   
ref|XP_011367167.1|  PREDICTED: cathepsin W                           47.8    4e-04   
ref|XP_006171430.1|  PREDICTED: cathepsin F                           48.1    4e-04   
ref|XP_007943152.1|  PREDICTED: cathepsin W                           47.8    4e-04   
ref|XP_006830175.1|  hypothetical protein AMTR_s00374p00012080        47.8    4e-04   
ref|XP_010346669.1|  PREDICTED: cathepsin F isoform X2                47.8    4e-04   
gb|ABC69431.1|  cysteine protease                                     47.8    4e-04   
gb|ABK91811.1|  cathepsin F precursor                                 47.8    4e-04   
gb|ABC69430.1|  cysteine protease                                     47.8    4e-04   
gb|EGV94494.1|  Ras-specific guanine nucleotide-releasing factor 1    48.5    4e-04   



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT*D  161
            I KNSWGESWGE GYYKICRGRN+CGV SMVSTVAAV+T T D
Sbjct  324  IIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT*D  161
            I KNSWGESWGE GYYKICRGRN+CGV SMVSTVAAV+T T D
Sbjct  326  IIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT*D  161
            I KNSWGESWGE GYYKICRGRN+CGV SMVSTVAAV+T T D
Sbjct  326  IIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT*D  161
            I KNSWGESWGE GYYKICRGRN+CGV SMVSTVAAV+T T D
Sbjct  326  IIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  6    IELNMNLICINKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I L      I KNSWGE+WGEKGYYKICRGRN+CGV SMVSTV A+NT
Sbjct  321  IRLKQKPFWIIKNSWGETWGEKGYYKICRGRNVCGVDSMVSTVTAINT  368



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT*D  161
            I KNSWGESWGE GYYKICRGRN+CGV SMVSTVAAV+T T D
Sbjct  324  IIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT*D  161
            I KNSWGESWGE GYYKICRGRN+CGV SMVSTVAAV+T T D
Sbjct  324  IIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE WGEKGYYKICRGRNICGV SMVSTVAAV+T
Sbjct  339  IIKNSWGEKWGEKGYYKICRGRNICGVDSMVSTVAAVST  377



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKICRGRNICGV SMVSTVAAV+T T
Sbjct  322  IIKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  362



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKICRGRNICGV SMVSTVAA +T T
Sbjct  290  IVKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAHTTT  330



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGESWGE G+YKICRGRNICGV SMVSTVAAV+T
Sbjct  354  IIKNSWGESWGEDGFYKICRGRNICGVDSMVSTVAAVDT  392



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGESWGE GYYKICRGRN+CGV SMVSTVAAV+T
Sbjct  294  IIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVHT  332



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKICRGRNICGV SMVSTVAAV+T T
Sbjct  320  IIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  360



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKICRGRN+CGV SMVSTVAAV T +
Sbjct  329  IIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS  369



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKICRGRNICGV SMVSTVAA +T T
Sbjct  289  IVKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAHTNT  329



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWGESWGE+GYYKICRGRN+CGV SMVSTVAA++
Sbjct  325  IIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWGE WGE GYYKICRGRN+CGV SMVSTVAAVN
Sbjct  329  IIKNSWGEGWGENGYYKICRGRNVCGVDSMVSTVAAVN  366



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRGRNICGV SMVSTVAA++T
Sbjct  326  IIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKICRGRNICGV SMVSTVAAV+T T
Sbjct  322  IIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  362



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWGESWGE+GYYKICRGRN+CGV SMVSTVAA++
Sbjct  325  IIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA-VNTPT  155
            I KNSWGE+WGE GYYKICRGRNICGV SMVSTVAA V TP+
Sbjct  330  IIKNSWGENWGESGYYKICRGRNICGVDSMVSTVAAVVQTPS  371



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRGRN+CGV S+VSTVAAVNT
Sbjct  333  IIKNSWGETWGENGYYKICRGRNVCGVDSLVSTVAAVNT  371



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWGESWGE+GYYKICRGRN+CGV SMVSTVAA++
Sbjct  325  IIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKICRGRNICGV SMVSTVAAV+T T
Sbjct  291  IIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  331



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKICRGRNICGV SMVSTVAAV T +
Sbjct  332  IIKNSWGENWGESGYYKICRGRNICGVDSMVSTVAAVQTAS  372



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGESWGE+GYYKICRG NICGV SMVSTVAA++T
Sbjct  330  IIKNSWGESWGEQGYYKICRGHNICGVDSMVSTVAAIHT  368



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGESWGE GYYKICRG N+CGV SMVSTVAA++T +
Sbjct  325  IIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAIHTSS  365



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGESWGE G+YKICRGRNICGV SMVSTVAAV T +
Sbjct  333  IIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQTSS  373



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGESWGE GYYKICRG N+CGV SMVSTVAA++T +
Sbjct  325  IIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAIHTSS  365



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE WGE GYYKICRGRN+CGV SMVSTVAAV+T +
Sbjct  328  IIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTVAAVSTSS  368



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE G+Y+ICRGRNICGV SMVSTVAAVNT
Sbjct  332  IIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAV  143
            I KNSWGESWGE GYYKICRGRN+CGV SMVSTVAA+
Sbjct  351  IIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  387



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG+SWGE+GYYKICRGRN+CGV SMVSTVAA++T
Sbjct  327  IIKNSWGQSWGEEGYYKICRGRNVCGVDSMVSTVAAMHT  365



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKICRGRNICGV SMVSTVA+V+T T
Sbjct  324  IIKNSWGENWGENGYYKICRGRNICGVDSMVSTVASVHTTT  364



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE G+Y+ICRGRNICGV SMVSTVAAVNT
Sbjct  332  IIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG++WGE GYYKICRGRNICGV SMVSTVAA++T
Sbjct  326  IIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRGR+ICGV SMVSTVAA++T
Sbjct  328  IIKNSWGENWGENGYYKICRGRDICGVDSMVSTVAAIHT  366



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE WGE GYYKICRGRN+CGV SMVSTVAAV+T +
Sbjct  328  IIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVSTSS  368



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE WGE GYYKICRG NICGV SMVSTVAAV+T T
Sbjct  332  IIKNSWGEHWGENGYYKICRGHNICGVDSMVSTVAAVHTST  372



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGESWGE G+YKICRGRNICGV SMVSTVAAV T
Sbjct  327  IIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGESWGE GYYKICRGR++CGV SMVSTVAA++T
Sbjct  328  IIKNSWGESWGENGYYKICRGRDVCGVDSMVSTVAAIHT  366



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I K+SWGE+WGE GYYKICRGRNICGV SMVSTVAA  T T
Sbjct  285  IVKSSWGETWGENGYYKICRGRNICGVDSMVSTVAAAQTTT  325



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I K+SWGE+WGE GYYKICRGRNICGV SMVSTVAA  T T
Sbjct  286  IVKSSWGETWGENGYYKICRGRNICGVDSMVSTVAAAQTTT  326



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGESWGE G+YKICRGRNICGV SMVSTVAAV T
Sbjct  327  IIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG++WGE GYYKICRGRNICGV SMVSTVAA++T
Sbjct  326  IIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE G+YKICRGRNICGV SMVSTVAAV+T T
Sbjct  322  IIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAVHTTT  362



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRGRN+CGV +MVSTVAA++T
Sbjct  325  IIKNSWGENWGENGYYKICRGRNVCGVDAMVSTVAAIHT  363



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGESWGE G+YKICRGRNICGV SMVSTVAAV T
Sbjct  327  IIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE G+Y+ICRGRNICGV SMVSTVAAVNT
Sbjct  332  IIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWGESWGE GYYKICRGRNICGV S+VSTVAAV+
Sbjct  330  IIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAVH  367



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWGESWGE GYYKICRGRNICGV S+VSTVAAV+
Sbjct  336  IIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAVH  373



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG++WGE GYYKICRGRNICGV SMVSTVAA++T
Sbjct  326  IIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE G+YKICRGRN+CGV S+VSTVAAVNT
Sbjct  333  IIKNSWGETWGENGFYKICRGRNVCGVDSLVSTVAAVNT  371



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE WGE GYYKICRGRN+CGV SMVSTVAAV+T +
Sbjct  328  IIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVSTSS  368



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAV  143
            I KNSWGE+WGEKG+YKICRGRNICGV SMVSTVAAV
Sbjct  334  IIKNSWGENWGEKGFYKICRGRNICGVDSMVSTVAAV  370



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGESWGE GYYKICRG N CGV SMVSTVAA+ T T
Sbjct  326  IIKNSWGESWGEDGYYKICRGHNACGVDSMVSTVAAIQTTT  366



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWGE+WGE+GYYKICRGRN+CGV SMVSTVAA++
Sbjct  326  IIKNSWGENWGEQGYYKICRGRNVCGVDSMVSTVAALH  363



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE+GYYKICRGRN+CGV SMVS+VAA+ T +
Sbjct  360  IIKNSWGENWGEEGYYKICRGRNVCGVDSMVSSVAALQTKS  400



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWGESWGE GYYKICRGRNICGV S+VSTVAAV+
Sbjct  336  IIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAVH  373



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE WGE G+YKICRGRN+CGV SMVSTVAAV T +
Sbjct  327  IIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTTS  367



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAV  143
            I KNSWGESWGE GYYKICRGRN+CGV SMVSTVAA+
Sbjct  326  IIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  362



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE G+YKICRGRNICGV SMVSTVAA++T
Sbjct  335  IIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAIHT  373



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE WGE G+YKICRGRN+CGV SMVSTVAAV T +
Sbjct  327  IIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTSS  367



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGEKG+YKIC+GRNICGV SMVSTVAA +  T
Sbjct  324  IIKNSWGENWGEKGFYKICKGRNICGVDSMVSTVAAASVET  364



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRGRNICGV SMVS+V+A++T
Sbjct  327  IIKNSWGENWGEHGYYKICRGRNICGVDSMVSSVSAIHT  365



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE G+YKICRGRNICGV SMVSTVAA +  T
Sbjct  328  IIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKT  368



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGESWGE G+YKIC+GRN+CGV SMVSTVAAV+T +
Sbjct  324  IIKNSWGESWGENGFYKICQGRNVCGVDSMVSTVAAVHTTS  364



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE G+YKICRGRN+CGV SMVSTVAAV+T +
Sbjct  336  IIKNSWGENWGENGFYKICRGRNVCGVDSMVSTVAAVHTTS  376



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGEKG+YKIC+GRNICGV SMVSTVAA +  T
Sbjct  324  IIKNSWGENWGEKGFYKICKGRNICGVDSMVSTVAAASVET  364



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWGESWGE+GYY ICRGRN+CGV SMVSTVAA++
Sbjct  325  IIKNSWGESWGEEGYYNICRGRNVCGVDSMVSTVAAIH  362



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWGE+WGE GYYKICRGRNICGV S+VSTVAAV+
Sbjct  334  IIKNSWGENWGENGYYKICRGRNICGVDSLVSTVAAVH  371



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRGRNICGV SMVSTVAA++T
Sbjct  319  IIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAALHT  357



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE WGE GYYKICRGRN+CGV SMVSTVAAV +
Sbjct  332  IIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVRS  370



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRG N+CGV SMVSTVAAV+T
Sbjct  338  IIKNSWGENWGENGYYKICRGHNVCGVDSMVSTVAAVST  376



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKICRGR+ICGV SMVSTVA+V+T T
Sbjct  324  IIKNSWGENWGENGYYKICRGRSICGVDSMVSTVASVHTTT  364



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGESWGEKGYYKICRGRNICG+ SMVS VAA   PT
Sbjct  333  IIKNSWGESWGEKGYYKICRGRNICGMDSMVSAVAAA-VPT  372



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWG +WGE GYYKICRGRNICGV SMVSTVAAV+T +
Sbjct  339  IIKNSWGPNWGEDGYYKICRGRNICGVDSMVSTVAAVSTTS  379



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRGRNICG+ +MVS+VAA++T
Sbjct  325  IIKNSWGENWGENGYYKICRGRNICGMDAMVSSVAAIHT  363



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWGESWGE GYY+ICRGRNICGV +MVS+VAA++
Sbjct  326  IIKNSWGESWGENGYYRICRGRNICGVDAMVSSVAAIH  363



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA  140
            I KNSWGESWGE GYYKICRGRN+CGV SMVSTVAA
Sbjct  336  IIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAA  371



>sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, 
partial [Carica papaya]
 emb|CAA27609.1| pot. cysteine proteinase [Carica papaya]
Length=96

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  6    IELNMNLICINKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I L      + KNSWGE+WGE GYYKICRGRNICGV SMVSTVAAV+T
Sbjct  46   IRLKEKPYWVIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHT  93



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA  140
            I KNSWGESWGE GYYKICRGRN+CGV SMVSTVAA
Sbjct  336  IIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAA  371



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWGE+WGE GYYKICR RNICGV SMVSTVAA++
Sbjct  326  IIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAIH  363



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRGRNICGV SMVSTVAA++T
Sbjct  320  IIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAALHT  358



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE G+YKICRGRNICGV SMVSTVAA +  T
Sbjct  328  IIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKT  368



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE G+YKICRGRNICGV SMVSTVAA +  T
Sbjct  328  IIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKT  368



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKICRGRN+CGV SMVSTV A++  T
Sbjct  324  IIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVGAIHAST  364



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG +WGEKGYYKIC+GRN+CGV SMVSTVAAV T
Sbjct  338  IIKNSWGPNWGEKGYYKICQGRNLCGVDSMVSTVAAVTT  376



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWG++WGE+GYYKICRGRNICGV SMVSTVAAV+
Sbjct  317  IIKNSWGQNWGEEGYYKICRGRNICGVDSMVSTVAAVH  354



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWG++WGE+GYYKICRGRNICGV SMVSTVAAV+
Sbjct  321  IIKNSWGQNWGEEGYYKICRGRNICGVDSMVSTVAAVH  358



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA  140
            I KNSWGESWGE GYYKICRGRN+CGV SMVST+AA
Sbjct  336  IIKNSWGESWGENGYYKICRGRNVCGVDSMVSTIAA  371



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG +WGE GYYKICRGRNICGV SMVSTVAAV+T
Sbjct  336  IIKNSWGANWGENGYYKICRGRNICGVDSMVSTVAAVHT  374



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG +WGE GYYKICRGRNICGV SMVSTVAAV+T
Sbjct  336  IIKNSWGANWGENGYYKICRGRNICGVDSMVSTVAAVHT  374



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRGRN+CGV SMVSTVAA++T
Sbjct  319  IIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAALHT  357



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA  140
            I KNSWGE+WGE GYYKICRGRNICGV SMVSTVAA
Sbjct  326  IIKNSWGETWGENGYYKICRGRNICGVDSMVSTVAA  361



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRGRNICGV SMVSTVAA++T
Sbjct  319  IIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAALHT  357



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKICRGRN+CGV SMVSTV A++  T
Sbjct  324  IIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVGAIHAST  364



>gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida]
Length=190

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE WGE GYYKICRGRN+CGV SMVSTVAAV+T +
Sbjct  150  IIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTVAAVSTSS  190



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRGRN+CGV SMVSTVAA++T
Sbjct  320  IIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAALHT  358



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWG +WGE GYYKICRGRN+CGV SMVS+VAA++T +
Sbjct  329  IIKNSWGANWGEDGYYKICRGRNVCGVDSMVSSVAALHTKS  369



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKICRG N+CGV S+VSTV A+NT +
Sbjct  336  IIKNSWGENWGENGYYKICRGSNVCGVDSLVSTVVALNTKS  376



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWGE+WGE GYYKICR RNICGV SMVSTVAA++
Sbjct  326  IIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAIH  363



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGEKGYYKICRG NICGV SMVSTVA++ +
Sbjct  327  IIKNSWGETWGEKGYYKICRGHNICGVDSMVSTVASIQS  365



>gb|AAU81589.1| cysteine proteinase [Petunia x hybrida]
Length=257

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  6    IELNMNLICINKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I L      I KNSWGESWGE+GYYKICRGRNICGV +MVSTV A +T
Sbjct  205  IRLKEKPYWIIKNSWGESWGEQGYYKICRGRNICGVDAMVSTVTAAHT  252



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA  140
            I KNSWGE+WGEKG+YKICRGRNICGV S+VSTVAA
Sbjct  325  IIKNSWGENWGEKGFYKICRGRNICGVDSLVSTVAA  360



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGESW E G+YKICRGRNICGV SMVSTVAA +  T
Sbjct  402  IIKNSWGESWRESGFYKICRGRNICGVDSMVSTVAAASVKT  442



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE WGE GYYKI RGRN+CGV SMVSTVAAV+T +
Sbjct  328  IIKNSWGEKWGESGYYKIRRGRNVCGVDSMVSTVAAVSTSS  368



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG++WGE+GYYKICRGRN+CGV SMVSTVAA  +
Sbjct  323  IVKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  39   KNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            KNSWG++WGE GYYKICRG NICGV SMVSTVAA+ + T
Sbjct  327  KNSWGQNWGEHGYYKICRGHNICGVDSMVSTVAAIQSAT  365



>emb|CDQ51995.1| Cysteine proteinase, partial [Fagus sylvatica]
Length=165

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  6    IELNMNLICINKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I L      I KNSWGE+WGE GYYKICRGRN+CGV SMVSTVAA+N
Sbjct  118  IRLKEKPFWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAIN  164



>gb|AAL69389.1|AF462226_1 putative cysteine proteinase [Narcissus pseudonarcissus]
Length=136

 Score = 70.5 bits (171),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT*D  161
            I KNSWGE+WGEKGYYKIC+GRN+CGV SMVSTV A++T   D
Sbjct  94   IIKNSWGENWGEKGYYKICKGRNVCGVDSMVSTVTAIHTTPKD  136



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGESW E G+YKICRGRNICGV SMVSTVAA +  T
Sbjct  404  IIKNSWGESWRESGFYKICRGRNICGVDSMVSTVAAASVKT  444



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG++WGE+GYYKICRGRN+CGV SMVSTVAA  +
Sbjct  318  IIKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  356



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRGRN+CGV SMVS+V+A +T
Sbjct  320  IIKNSWGENWGENGYYKICRGRNVCGVDSMVSSVSAFHT  358



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAV  143
            I KNSWGE+WGE GYYKICRGRNICGV SMVS+V A+
Sbjct  328  IIKNSWGENWGENGYYKICRGRNICGVDSMVSSVTAI  364



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKIC GRN+CGV SMVS+VAAV+T +
Sbjct  328  IIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAVHTTS  368



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG++WGE+GYYKICRGRN+CGV SMVSTVAA  +
Sbjct  323  IVKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE G+YKICRGRN+CGV S+VSTV A  +PT
Sbjct  327  IIKNSWGETWGENGFYKICRGRNVCGVDSLVSTVTAAVSPT  367



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG++WGE+GYYKICRGRN+CGV SMVSTVAA  +
Sbjct  326  IIKNSWGQNWGEEGYYKICRGRNVCGVDSMVSTVAAAQS  364



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG++WGE+GYYKICRGRN+CGV SMVSTVAA  +
Sbjct  323  IIKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWG +WGE GYY+ICRGRN+CGV SMVS+VAA++T +
Sbjct  329  IIKNSWGANWGEDGYYRICRGRNVCGVDSMVSSVAALHTKS  369



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKIC+GRN+CGV SMVSTV AV +
Sbjct  335  IIKNSWGENWGEDGYYKICKGRNVCGVDSMVSTVTAVRS  373



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  6    IELNMNLICINKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I L      I KNSWGE+WGE GYYKICRGRN+CGV SMVSTV A++T
Sbjct  240  IRLKEKPYWIIKNSWGETWGENGYYKICRGRNVCGVDSMVSTVTAIHT  287



>gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides]
Length=156

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE WGE G+YKICRGRN+CGV SMVSTVAAV T +
Sbjct  116  IIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTSS  156



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  6    IELNMNLICINKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I L      I KNSWGE+WGE GYYKICRG NICGV +MVSTV A +T
Sbjct  311  IRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  6    IELNMNLICINKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I L      I KNSWGE+WGE GYYKICRG NICGV +MVSTV A +T
Sbjct  311  IRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  6    IELNMNLICINKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I L      I KNSWGE+WGE GYYKICRG NICGV +MVSTV A +T
Sbjct  311  IRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  6    IELNMNLICINKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I L      I KNSWGE+WGE GYYKICRG NICGV +MVSTV A +T
Sbjct  313  IRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  360



>gb|KHN12668.1| Cysteine proteinase 15A [Glycine soja]
Length=156

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAV  143
            I KNSWGESWGE GYYKICRGRN+CGV SMVSTVAA+
Sbjct  115  IIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  151



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKIC GRN+CGV SMVS+VAA++T +
Sbjct  328  IIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAIHTTS  368



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE+GYYKICRG NICG+ SMVSTV A +T
Sbjct  328  IVKNSWGENWGEEGYYKICRGNNICGIDSMVSTVTAAST  366



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE GYYKIC GRN+CGV SMVS+VAA++T +
Sbjct  328  IIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAIHTTS  368



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  6    IELNMNLICINKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I L      I KNSWGE+WGE GYYKICRG NICGV +MVSTV A +T
Sbjct  313  IRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  360



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRG NICGV +MVSTV A +T
Sbjct  320  IIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTATHT  358



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE G+YKIC+GRNICGV SMVSTVAA  + T
Sbjct  326  IIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVSTT  366



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWG +WG++GYYKICRG N+CGV SMVSTVAAVN
Sbjct  333  IIKNSWGPNWGDQGYYKICRGHNVCGVDSMVSTVAAVN  370



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG++WGEKGYYKICRG NICGV SMVSTV A+++
Sbjct  317  IVKNSWGKNWGEKGYYKICRGSNICGVESMVSTVTAIHS  355



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE G+YKIC+GRNICGV SMVSTVAA  + T
Sbjct  326  IIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVSTT  366



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWG +WGE+GYYKIC GRN+CG+ +MVS+VAAV+T T
Sbjct  329  IIKNSWGANWGEEGYYKICHGRNLCGMDTMVSSVAAVHTST  369



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE+GYYKICRG NICGV SMVS+V A +T
Sbjct  330  IIKNSWGENWGEEGYYKICRGNNICGVDSMVSSVTAAST  368



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAV  143
            I KNSWGE+WGE GYYKICRG NICGV SMVSTV A+
Sbjct  330  IIKNSWGENWGEDGYYKICRGHNICGVESMVSTVTAI  366



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG+SWGE+GYYKICRG N CGV S+VSTVAA++T
Sbjct  324  ILKNSWGQSWGEQGYYKICRGYNSCGVDSLVSTVAALHT  362



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGR-NICGVGSMVSTVAAVNTPT  155
            I KNSWG +WGE GYYKICRGR NICG+ +MVSTVAAV+T T
Sbjct  326  IIKNSWGSTWGEDGYYKICRGRHNICGMDTMVSTVAAVHTST  367



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WG  GYYKICRGRN+CGV SMVSTV A++  T
Sbjct  324  IIKNSWGENWGGNGYYKICRGRNVCGVDSMVSTVGAIHAST  364



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGR-NICGVGSMVSTVAAVNTPT  155
            I KNSWG +WGE GYYKICRGR NICG+ +MVSTVAAV+T T
Sbjct  326  IIKNSWGSTWGEDGYYKICRGRHNICGMDTMVSTVAAVHTST  367



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRG N+CGV SMVSTV A++T
Sbjct  323  IIKNSWGENWGENGYYKICRGPNMCGVDSMVSTVIAIHT  361



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG++WGE GYYKICRG NICGV +MVSTV A +T
Sbjct  333  IIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTVTATHT  371



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTP  152
            I KNSWGE+WGE G+YKICRGRN+CGV S+VSTV A  +P
Sbjct  326  IIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTATVSP  365



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGR-NICGVGSMVSTVAAVNT  149
            I KNSWG  WGEKGYYKICRG  NICGV +MVSTVAAVNT
Sbjct  324  IIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAAVNT  363



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN-TP  152
            I KNSWGE+WGE GYYKICRG N+CGV SMVSTV A + TP
Sbjct  330  IIKNSWGENWGENGYYKICRGHNVCGVASMVSTVTAAHVTP  370



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG+SWGE+GYYKICRG N CGV S+VSTVA+++T
Sbjct  325  ILKNSWGQSWGEEGYYKICRGHNPCGVDSLVSTVASLHT  363



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTP  152
            I KNSWGE+WGE G+YKICRGRN+CGV S+VSTV A  +P
Sbjct  326  IIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTATVSP  365



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGESWGE G+YKIC+GRNICGV S+VSTVAA  +
Sbjct  323  IIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAATTS  361



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG +WGE GYYKICRG+NICGV SMVSTV AV T
Sbjct  332  IIKNSWGGNWGEDGYYKICRGQNICGVESMVSTVTAVRT  370



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGESWGE+GYYKIC+G N+CGV SMVS+V A++T +
Sbjct  332  IVKNSWGESWGEEGYYKICKGHNVCGVESMVSSVNAIHTTS  372



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGESWGE G+YKIC+GRNICGV S+VSTVAA  +
Sbjct  323  IIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAATTS  361



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA  140
            I KNSWGESWGE GYYKICRG+N+CGV SMVS+V A
Sbjct  317  IIKNSWGESWGEDGYYKICRGKNVCGVDSMVSSVVA  352



>gb|ABK93575.1| unknown [Populus trichocarpa]
Length=157

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  6    IELNMNLICINKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I        I KNSWGE+WGE GYYKICR RNICGV SMVSTVAA++ 
Sbjct  107  IRFKEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAIHA  154



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGESWGE G+YKIC+GRNICGV S+VSTVAA  +
Sbjct  322  IIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAAATS  360



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG++WGE GYYKICRG NICGV +MVSTV A +T
Sbjct  320  IIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTVTATHT  358



>ref|XP_009351218.1| PREDICTED: cysteine proteinase RD19a-like, partial [Pyrus x bretschneideri]
Length=282

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  6    IELNMNLICINKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I L      I KNSWGE+WGE G+YKICRGRNICGV SMVSTVAA +  T
Sbjct  230  IRLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKT  279



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGESWGE G+YKIC+GRNICGV S+VSTV+A  + T
Sbjct  331  IIKNSWGESWGENGFYKICKGRNICGVDSLVSTVSATVSTT  371



>emb|CDX98179.1| BnaC07g09190D [Brassica napus]
Length=72

 Score = 66.2 bits (160),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE G+YKICRGRN+CGV S+VSTV A  +P 
Sbjct  30   IIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTATVSPA  70



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 3/40 (8%)
 Frame = +3

Query  39   KNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVNT  149
            KNSWGE+WGEKGYYKICRG   RN CGV SMVSTVAA +T
Sbjct  334  KNSWGENWGEKGYYKICRGSNVRNKCGVDSMVSTVAAAHT  373



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWGE+WGE GYYKICRG N+CGV SMVS+V+A++
Sbjct  329  IIKNSWGENWGENGYYKICRGNNVCGVDSMVSSVSALH  366



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWGESWGE GYYKICRG+N CGV SMVSTV A++
Sbjct  323  IIKNSWGESWGENGYYKICRGQNACGVDSMVSTVGAIH  360



>emb|CAB53397.1| cysteine protease [Medicago sativa]
Length=209

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  6    IELNMNLICINKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I L      I KNSWG++WGE+GYYKICRGRN+CGV SMVSTVAA  +
Sbjct  162  IRLKEKPYWIIKNSWGQNWGEEGYYKICRGRNVCGVDSMVSTVAAAQS  209



>gb|AJP16692.1| cysteine protease, partial [Striga hermonthica]
Length=148

 Score = 67.4 bits (163),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA  140
            I KNSWGE+WGE GYYKICRGRN+CGV SMVSTVAA
Sbjct  113  IIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAA  148



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT*D  161
            I KNSWG  WGE GYYK+CRG N+CG+ +MVSTVAA N  T D
Sbjct  351  IIKNSWGPDWGEDGYYKLCRGHNVCGINTMVSTVAAANIQTDD  393



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAV  143
            I KNSWGESWGE GY +ICRGRN+CGV SMVSTVAA+
Sbjct  278  IIKNSWGESWGENGYDEICRGRNVCGVDSMVSTVAAI  314



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE G+YKIC+GRNICGV S+VSTVAA  + T
Sbjct  325  IIKNSWGETWGENGFYKICKGRNICGVDSLVSTVAATVSTT  365



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVA  137
            I KNSWGE+WGE GYYK+CRGRNICGV S+VSTVA
Sbjct  326  IIKNSWGETWGENGYYKLCRGRNICGVDSLVSTVA  360



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWG+SWGE+GYYKICRG N CGV S+VSTVAA++
Sbjct  325  ILKNSWGQSWGEQGYYKICRGYNSCGVDSLVSTVAALH  362



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA  140
            I KNSWGE+WGE G+YK+C+GRN+CGV SMVSTVAA
Sbjct  306  IIKNSWGETWGENGFYKLCKGRNVCGVDSMVSTVAA  341



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG+SWGE+G+YKICRG N CGV S+VSTVA+++T
Sbjct  326  ILKNSWGQSWGEEGFYKICRGHNSCGVDSLVSTVASLHT  364



>dbj|BAD94010.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
Length=86

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE G+YKIC+GRNICGV SMVSTVAA  + T
Sbjct  44   IIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVSTT  84



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGR-NICGVGSMVSTVAAVNT  149
            I KNSWG  WGEKGYYKICRG  NICGV +MVSTVAAV+T
Sbjct  324  IIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAAVHT  363



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE G+YKIC+GRNICGV S+VSTV+A  + T
Sbjct  326  IIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSATVSTT  366



>gb|AAB62937.1| stress-induced cysteine proteinase [Lavatera thuringiaca]
Length=175

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG +WGE GYYKICRGRN+CGV SMVS+VAA+ T
Sbjct  134  IIKNSWGANWGEDGYYKICRGRNVCGVDSMVSSVAALQT  172



>emb|CAH59428.1| cysteine protease 2 [Plantago major]
Length=245

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGESWGE GYYKICRGRN+CGV SMVS+V A +  T
Sbjct  204  IIKNSWGESWGESGYYKICRGRNVCGVESMVSSVTAAHFTT  244



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGR-NICGVGSMVSTVAAVNT  149
            I KNSWG  WGEKGYYKICRG  NICGV +MVSTVAAV+T
Sbjct  326  IIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAAVHT  365



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  6    IELNMNLICINKNSWGESWGEKGYYKICRGRNICGVGSMVSTV  134
            I L      I KNSWGE+WGE GYYKICRG NICGV +MVSTV
Sbjct  313  IRLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTV  355



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWG++WGE GYYKICRG +ICGV +MVSTV A +T
Sbjct  318  IIKNSWGKTWGEHGYYKICRGHHICGVDAMVSTVTATHT  356



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA  140
            I KNSWGE+WGE G+YK+C+GRN+CG+ SMVSTVAA
Sbjct  325  IIKNSWGETWGENGFYKLCKGRNVCGIDSMVSTVAA  360



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA  140
            I KNSWGE+WGE G+YK+C+GRN+CG+ SMVSTVAA
Sbjct  325  IIKNSWGETWGENGFYKLCKGRNVCGIDSMVSTVAA  360



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA  140
            I KNSWGE+WGE G+YKIC+GRNICGV S+VSTV+A
Sbjct  326  IIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSA  361



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG-RNICGVGSMVSTVAAVNTPT  155
            I KNSWG  WGE GYYKICRG  N+CG+ SMVSTVAAV+T T
Sbjct  323  IIKNSWGSMWGEHGYYKICRGPHNVCGMDSMVSTVAAVHTTT  364



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE G+YKIC+GRNICGV S+VSTV A  + T
Sbjct  325  IIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAAVSTT  365



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE G+YKIC+GRNICGV S+VSTV A  + T
Sbjct  326  IIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAAVSTT  366



>gb|ABY75169.1| cysteine protease, partial [Arachis diogoi]
Length=47

 Score = 63.9 bits (154),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  39   KNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAV  143
            KNSWGESWGE GYYKICRG+N+CGV SMVS+V A 
Sbjct  6    KNSWGESWGEDGYYKICRGKNVCGVDSMVSSVVAT  40



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA  140
            I KNSWGE+WGE G+YKIC+GRNICGV S+VSTV+A
Sbjct  325  IIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSA  360



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTPT  155
            I KNSWGE+WGE G+YKIC+GRNICGV S+VSTV A  + T
Sbjct  325  IIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAAVSTT  365



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA  140
            I KNSWGE+WGE G+YKIC+GRNICGV S+VSTV+A
Sbjct  325  IIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSA  360



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG-RNICGVGSMVSTVAAVNTPT  155
            I KNSWG  WGE GYYKICRG  NICG+ +MVSTVAAV T T
Sbjct  325  IIKNSWGSMWGEHGYYKICRGSHNICGMDTMVSTVAAVQTST  366



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG-RNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYK CR  RN+CGV SMVS+VAAV+T
Sbjct  337  IIKNSWGENWGENGYYKFCRADRNLCGVDSMVSSVAAVHT  376



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG-RNICGVGSMVSTVAAVNTPT  155
            I KNSWG  WGE GYYKICRG  N+CG+ SMVSTVAAV+T T
Sbjct  323  IIKNSWGSMWGEHGYYKICRGPHNMCGMDSMVSTVAAVHTTT  364



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTP  152
            I KNSWGE+WGE GYY IC+G+N+CG  SMVS+VAA  TP
Sbjct  333  IIKNSWGENWGENGYYFICKGKNVCGSESMVSSVAAAATP  372



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNT  149
            I KNSWGESWGE G+YKIC+GRNICGV S+VSTVAA  +
Sbjct  275  IIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAATTS  313



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 3/42 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGEKGYYKICRG   +N CGV SMVS+V A++T
Sbjct  318  IIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  359



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 3/42 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRG   RN CGV SMVSTV+AV T
Sbjct  327  IIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVRT  368



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 3/42 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGEKGYYKICRG   +N CGV SMVS+V A++T
Sbjct  335  IIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  376



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG-RNICGVGSMVSTVAAVNTPT  155
            I KNSWG  WGE GYYKICRG  N+CG+ SMVSTVAAV+T T
Sbjct  323  IIKNSWGSMWGEHGYYKICRGPHNMCGMDSMVSTVAAVHTTT  364



>ref|NP_001059639.1| Os07g0480900 [Oryza sativa Japonica Group]
 dbj|BAC45132.1| putative cysteine proteinase [Oryza sativa Japonica Group]
 dbj|BAF21553.1| Os07g0480900 [Oryza sativa Japonica Group]
 dbj|BAG88694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=376

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTP  152
            I KNSWG++WGE+GYY++CRGRN+CGV +MVS VA    P
Sbjct  336  IIKNSWGKAWGEQGYYRLCRGRNVCGVDTMVSAVAVAPPP  375



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 3/42 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRG   RN CGV SMVSTV+A++T
Sbjct  329  IIKNSWGENWGEHGYYKICRGSNVRNKCGVDSMVSTVSAIHT  370



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGR-NICGVGSMVSTVAAVNT  149
            I KNSWGE WGE GYYKICRG+ NICGV +MVSTV A +T
Sbjct  323  IIKNSWGEHWGEHGYYKICRGQHNICGVDAMVSTVTAAHT  362



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 3/42 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRG   +N CGV SMVSTV A++T
Sbjct  354  IIKNSWGENWGESGYYKICRGAHVKNKCGVDSMVSTVTAIHT  395



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 3/42 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRG   +N CGV SMVSTV A++T
Sbjct  336  IIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVTAIHT  377



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  39   KNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAV  143
            KNSWG +WGE GYYK+CRG N+CG+ +MVSTVAA+
Sbjct  332  KNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 3/42 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRG   +N CGV SMVSTV A++T
Sbjct  334  IIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVTAIHT  375



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  39   KNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAV  143
            KNSWG +WGE GYYK+CRG N+CG+ +MVSTVAA+
Sbjct  332  KNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGR-NICGVGSMVSTVAAVN-TP  152
            I KNSWG+ WGE GYYKICRGR NICG+ +MVSTVAAV  TP
Sbjct  330  IIKNSWGKMWGEHGYYKICRGRHNICGMDTMVSTVAAVQITP  371



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  39   KNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAV  143
            KNSWG +WGE GYYK+CRG N+CG+ +MVSTVAA+
Sbjct  332  KNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>ref|XP_002460693.1| hypothetical protein SORBIDRAFT_02g033270 [Sorghum bicolor]
 gb|EER97214.1| hypothetical protein SORBIDRAFT_02g033270 [Sorghum bicolor]
Length=373

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTP  152
            I KNSWGE WGE+GYY++CRG N+CGV SMVS VA    P
Sbjct  334  IIKNSWGERWGEQGYYRLCRGSNVCGVDSMVSAVAVAPVP  373



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 3/42 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVNT  149
            I KNSWGE+WG+KGYYKICRG   RN CGV SMVSTV+A ++
Sbjct  332  IIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHS  373



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG-RNICGVGSMVSTVAAVNTPT  155
            I KNSWG  WGE GYYKICRG  N+CG+ +MVSTVAAV+T T
Sbjct  323  IIKNSWGSMWGEHGYYKICRGPHNMCGMDTMVSTVAAVHTTT  364



>gb|EAY93546.1| hypothetical protein OsI_15336 [Oryza sativa Indica Group]
Length=348

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 3/42 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGEKGYYKICRG   +N CGV SMVS+V A++T
Sbjct  302  IIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  343



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 3/41 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVN  146
            I KNSWGE+WGE GYYKICRG   RN CGV SMVSTV+AV+
Sbjct  327  IIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVH  367



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA  140
            I KNSWGE+WGE+GYYKIC+G N+CGV S+VSTV A
Sbjct  300  IVKNSWGENWGEQGYYKICKGHNVCGVESLVSTVTA  335



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 3/41 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVN  146
            I KNSWGE+WG+KGYYKICRG   RN CGV SMVSTV+A +
Sbjct  324  IIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATH  364



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 3/42 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRG   +N CGV SMVSTV A++T
Sbjct  360  IIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVTAIHT  401



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 3/41 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVN  146
            I KNSWGE+WGE GYYKICRG   RN CGV SMVSTV+AV+
Sbjct  327  IIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVH  367



>ref|XP_006658557.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase 15A-like 
[Oryza brachyantha]
Length=346

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVA  137
            I KNSWG++WGE+GYY++CRGRN+CGV SMVS VA
Sbjct  308  IIKNSWGKAWGEQGYYRLCRGRNVCGVDSMVSAVA  342



>ref|NP_001052440.1| Os04g0311400 [Oryza sativa Japonica Group]
 dbj|BAF14354.1| Os04g0311400, partial [Oryza sativa Japonica Group]
Length=384

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 3/42 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGEKGYYKICRG   +N CGV SMVS+V A++T
Sbjct  338  IIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  379



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 3/41 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVN  146
            I KNSWGE+WGE GYYKICRG   RN CGV SMVSTV+A++
Sbjct  329  IIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAIH  369



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 3/41 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVN  146
            I KNSWGE+WG+KGYYKICRG   RN CGV SMVSTV+A +
Sbjct  332  IIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATH  372



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 3/41 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVN  146
            I KNSWGE+WG+KGYYKICRG   RN CGV SMVSTV+A +
Sbjct  257  IIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATH  297



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 3/42 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRG   +N CGV SMVSTV A++T
Sbjct  321  IIKNSWGENWGENGYYKICRGPHVQNKCGVDSMVSTVTAIHT  362



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAV  143
            I KNSWGE+WGE GYY IC+G+NICG  SMVS+VAA+
Sbjct  333  IIKNSWGENWGENGYYFICKGKNICGSESMVSSVAAI  369



>ref|XP_004959670.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  39   KNSWGESWGEKGYYKICRGRNICGVGSMVSTVA  137
            KNSWGE WGEKGYY++CRG N+CGV +MVS VA
Sbjct  334  KNSWGEQWGEKGYYRLCRGSNVCGVDTMVSAVA  366



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG-RNICGVGSMVSTVAAVNT  149
            I KNSWG  WGE GYYKICRG  N+CG+ +MVSTVAAV+T
Sbjct  331  IIKNSWGAMWGEHGYYKICRGPHNMCGMDTMVSTVAAVHT  370



>emb|CAQ00102.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=368

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  39   KNSWGESWGEKGYYKICRGRNICGVGSMVSTVA  137
            KNSWG  WGE GYYK+CRGRN+CGV SMVS VA
Sbjct  333  KNSWGAQWGEGGYYKLCRGRNVCGVDSMVSAVA  365



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG-RNICGVGSMVSTVAAVNT  149
            I KNSWG  WGE GYYKICRG  N+CG+ +MVSTVAAV+T
Sbjct  331  IIKNSWGAMWGEHGYYKICRGPHNMCGMDTMVSTVAAVHT  370



>ref|XP_009404192.1| PREDICTED: cysteine proteinase 15A [Musa acuminata subsp. malaccensis]
Length=361

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVN  146
            I KNSWG+ WGE+GYY++CRG NICG+ SMVS VAA +
Sbjct  324  IIKNSWGKQWGEQGYYRLCRGHNICGIDSMVSAVAAAS  361



>tpg|DAA40800.1| TPA: putative cysteine protease family protein [Zea mays]
Length=381

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVA  137
            I KNSWG+ WGE+GYY++CRG N+CGV SMVS VA
Sbjct  342  IIKNSWGKQWGEQGYYRLCRGSNVCGVDSMVSAVA  376



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 3/41 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVN  146
            I KNSWGE+WGE GYYK+CRG   +N CGV SMVSTV A++
Sbjct  343  IIKNSWGENWGENGYYKLCRGPFVKNKCGVDSMVSTVTAIH  383



>gb|AAB16997.1| thiol protease isoform A, partial [Glycine max]
Length=318

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 1/38 (3%)
 Frame = +3

Query  33   INKNSWGESWGEK-GYYKICRGRNICGVGSMVSTVAAV  143
            I KNSWGESWGE  GY +ICRGRN+CGV +MVSTVAA+
Sbjct  276  IIKNSWGESWGENDGYDEICRGRNVCGVDAMVSTVAAI  313



>ref|XP_006665032.1| PREDICTED: cysteine proteinase 1-like [Oryza brachyantha]
Length=191

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 3/42 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNI---CGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRG N+   CGV SMVSTV A++T
Sbjct  147  IIKNSWGENWGEHGYYKICRGSNVRDKCGVDSMVSTVTAIHT  188



>gb|EMS59778.1| Cysteine proteinase 15A [Triticum urartu]
Length=195

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  39   KNSWGESWGEKGYYKICRGRNICGVGSMVSTVA  137
            KNSWG+ WGE GYYK+CRGRN+CGV SMVS VA
Sbjct  160  KNSWGQQWGEGGYYKLCRGRNVCGVDSMVSAVA  192



>gb|AGS43121.1| cysteine protease 1, partial [Zea mays]
Length=90

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = +3

Query  6    IELNMNLICINKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVNT  149
            I L      I KNSWGE+WGE GYYKICRG   RN CGV SMVSTV+AV+ 
Sbjct  37   IRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVHA  87



>ref|XP_009117680.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=357

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTV  134
            I KNSWGE+WGE G++K+C+GRNICG GS+VSTV
Sbjct  324  IIKNSWGETWGESGFFKLCKGRNICGFGSLVSTV  357



>ref|XP_010690815.1| PREDICTED: cysteine proteinase RD19a [Beta vulgaris subsp. vulgaris]
Length=403

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 2/40 (5%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAVNTP  152
            I KNSWGE WGE GYY++CRG ++CGV ++VSTVA  +TP
Sbjct  365  IIKNSWGEYWGENGYYRLCRGYDLCGVNTLVSTVA--DTP  402



>ref|XP_008802783.1| PREDICTED: probable cysteine proteinase A494 [Phoenix dactylifera]
Length=389

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAA  140
            I KNSWG+ WGE GYY++CRG NICG+ SMVS VAA
Sbjct  347  IIKNSWGKHWGENGYYRLCRGHNICGIDSMVSAVAA  382



>emb|CAA57675.1| cysteine proteinase [Zea mays]
Length=145

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 3/42 (7%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRG---RNICGVGSMVSTVAAVNT  149
            I KNSWGE+WGE GYYKICRG   RN CGV SMVSTV+AV+ 
Sbjct  101  IIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVHA  142



>ref|XP_008776953.1| PREDICTED: cysteine proteinase-like [Phoenix dactylifera]
Length=144

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAV  143
            I KNSWG+ WGE GYY++CRG NICG+ SMVS VAA 
Sbjct  102  IIKNSWGKQWGENGYYRLCRGHNICGIDSMVSAVAAT  138



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVST-VAAVNTPT  155
            I KNSW + WGE GYY+ICRG+N+CGV SMVS+ VAA+ T +
Sbjct  326  ILKNSWSKYWGEHGYYRICRGQNMCGVDSMVSSVVAAIQTTS  367



>ref|XP_006293095.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
 gb|EOA25993.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
Length=367

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVA  137
            I KNSWG+ WGE GYYK+CRG +ICG+ SMVS VA
Sbjct  328  IIKNSWGKKWGEDGYYKLCRGHDICGINSMVSAVA  362



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSM  122
            I KNSWGE WGE GYYKICRGRN+CGV SM
Sbjct  329  IIKNSWGEKWGENGYYKICRGRNVCGVDSM  358



>ref|XP_002969223.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
 gb|EFJ29311.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
Length=367

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVA  137
            I KNSWG +WGE+GYYKICRG  +CG+ +MVSTVA
Sbjct  333  IIKNSWGATWGEQGYYKICRGHGMCGMNTMVSTVA  367



>ref|XP_002960585.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
 gb|EFJ38124.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
Length=330

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVA  137
            I KNSWG +WGE+GYYKICRG  +CG+ +MVSTVA
Sbjct  296  IIKNSWGATWGEQGYYKICRGHGMCGMNTMVSTVA  330



>ref|XP_008804021.1| PREDICTED: cysteine proteinase RD19a-like [Phoenix dactylifera]
Length=217

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  33   INKNSWGESWGEKGYYKICRGRNICGVGSMVSTVAAV  143
            I KNSWG+ WGE GYY++CRG NICG+ SMVS VAA 
Sbjct  175  IIKNSWGKHWGENGYYRLCRGHNICGIDSMVSAVAAT  211



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566700398000