BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP001B06 643 bp,

Length=597
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783307.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    132   6e-35   Nicotiana sylvestris
ref|XP_009591907.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    132   9e-35   Nicotiana tomentosiformis
ref|XP_004229612.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    132   1e-34   
ref|XP_006345468.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    126   1e-32   Solanum tuberosum [potatoes]
gb|ACR56827.1|  At3g12630-like protein                                  124   4e-32   Solanum hirtum
ref|XP_009631181.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    123   2e-31   Nicotiana tomentosiformis
gb|ACR56824.1|  At3g12630-like protein                                  121   5e-31   Solanum hirtum
gb|ACR56825.1|  At3g12630-like protein                                  120   2e-30   Solanum quitoense [lulo]
ref|XP_009773992.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    119   5e-30   Nicotiana sylvestris
ref|XP_008461273.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   1e-27   Cucumis melo [Oriental melon]
ref|XP_004135919.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   2e-26   Cucumis sativus [cucumbers]
ref|XP_008375146.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   4e-26   Malus domestica [apple tree]
ref|XP_009354712.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   4e-26   Pyrus x bretschneideri [bai li]
ref|XP_003546877.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   4e-25   Glycine max [soybeans]
ref|XP_009365003.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   6e-25   Pyrus x bretschneideri [bai li]
ref|XP_009365002.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   6e-25   Pyrus x bretschneideri [bai li]
ref|XP_009365004.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_011025412.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   2e-24   Populus euphratica
ref|XP_007218519.1|  hypothetical protein PRUPE_ppa012532mg             104   2e-24   Prunus persica
ref|XP_008231311.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   2e-24   Prunus mume [ume]
ref|XP_004306522.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   3e-24   Fragaria vesca subsp. vesca
emb|CDP07749.1|  unnamed protein product                                104   5e-24   Coffea canephora [robusta coffee]
ref|XP_008349960.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   5e-24   Malus domestica [apple tree]
ref|XP_002298442.1|  zinc finger family protein                         103   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010557789.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    102   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_002314027.1|  zinc finger family protein                         102   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010106958.1|  Zinc finger A20 and AN1 domain-containing st...    102   2e-23   Morus notabilis
gb|EYU27075.1|  hypothetical protein MIMGU_mgv1a014771mg                100   1e-22   Erythranthe guttata [common monkey flower]
ref|XP_010257261.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.0    4e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010547246.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.4    4e-22   Tarenaya hassleriana [spider flower]
gb|KDP43451.1|  hypothetical protein JCGZ_16738                       99.4    4e-22   Jatropha curcas
ref|XP_003633555.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  98.6    5e-22   Vitis vinifera
ref|XP_006482901.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.0    5e-22   Citrus sinensis [Valencia orange]
gb|KHN29214.1|  Zinc finger A20 and AN1 domain-containing stress-...  97.4    6e-22   Glycine soja [wild soybean]
ref|XP_006438985.1|  hypothetical protein CICLE_v10032882mg           98.6    7e-22   Citrus clementina
ref|XP_006298707.1|  hypothetical protein CARUB_v10014801mg           97.8    7e-22   Capsella rubella
ref|XP_011087429.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  97.8    9e-22   Sesamum indicum [beniseed]
ref|XP_006407313.1|  hypothetical protein EUTSA_v10021683mg           97.4    1e-21   Eutrema salsugineum
ref|XP_010067883.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  96.3    5e-21   Eucalyptus grandis [rose gum]
emb|CDY52666.1|  BnaC01g38560D                                        95.5    5e-21   Brassica napus [oilseed rape]
ref|XP_009120462.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.5    5e-21   Brassica rapa
ref|XP_004499868.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.5    6e-21   Cicer arietinum [garbanzo]
ref|XP_010279007.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.5    7e-21   Nelumbo nucifera [Indian lotus]
ref|XP_008461789.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.5    8e-21   Cucumis melo [Oriental melon]
ref|NP_001240258.1|  zinc finger A20 and AN1 domain-containing st...  95.1    1e-20   Glycine max [soybeans]
gb|KFK38611.1|  hypothetical protein AALP_AA3G136800                  94.7    1e-20   Arabis alpina [alpine rockcress]
ref|XP_010534277.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.1    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_007149048.1|  hypothetical protein PHAVU_005G036400g           96.7    2e-20   Phaseolus vulgaris [French bean]
ref|XP_007052561.1|  Zinc finger A20 and AN1 domain-containing st...  94.7    2e-20   Theobroma cacao [chocolate]
ref|NP_566429.1|  E3 ligase SAP5                                      93.6    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009146604.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.6    3e-20   Brassica rapa
emb|CDY08419.1|  BnaA05g26550D                                        93.6    3e-20   Brassica napus [oilseed rape]
emb|CDX73811.1|  BnaA03g32360D                                        93.2    4e-20   Brassica napus [oilseed rape]
ref|XP_009135242.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.2    4e-20   Brassica rapa
ref|XP_010489793.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.8    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_011025067.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.4    7e-20   Populus euphratica
gb|KJB25036.1|  hypothetical protein B456_004G173900                  92.8    9e-20   Gossypium raimondii
ref|XP_011093526.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.8    9e-20   Sesamum indicum [beniseed]
emb|CDY67538.1|  BnaUnng02260D                                        92.0    1e-19   Brassica napus [oilseed rape]
gb|KJB22229.1|  hypothetical protein B456_004G036200                  92.4    1e-19   Gossypium raimondii
emb|CDY00788.1|  BnaC03g37720D                                        91.7    1e-19   Brassica napus [oilseed rape]
ref|XP_002882783.1|  hypothetical protein ARALYDRAFT_478622           91.7    2e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_010499267.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  91.3    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009391817.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.1    6e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004149600.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.1    7e-19   Cucumis sativus [cucumbers]
gb|AIJ00004.1|  zinc finger A20 and AN1 domain-containing stress-...  90.5    7e-19   Gossypium hirsutum [American cotton]
ref|XP_010465038.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.4    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010497315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.6    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010913137.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    2e-17   Elaeis guineensis
gb|EYU31355.1|  hypothetical protein MIMGU_mgv1a014767mg              86.3    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_003599112.1|  Zinc finger A20 and AN1 domain-containing st...  84.7    6e-17   Medicago truncatula
gb|AAR83854.1|  induced stolon tip protein                            82.0    1e-16   Capsicum annuum
ref|XP_009418201.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  83.2    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT06701.1|  Zinc finger A20 and AN1 domain-containing stress-...  82.8    3e-16   Aegilops tauschii
ref|XP_008776561.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  82.4    4e-16   Phoenix dactylifera
gb|AGQ04323.1|  SAP1                                                  82.0    4e-16   Oryza punctata
ref|XP_010928494.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  81.6    9e-16   Elaeis guineensis
ref|XP_008795709.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  81.3    9e-16   Phoenix dactylifera
ref|XP_006660763.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  81.3    1e-15   Oryza brachyantha
gb|EAZ45178.1|  hypothetical protein OsJ_29820                        80.9    1e-15   Oryza sativa Japonica Group [Japonica rice]
gb|ACM68451.1|  stress-associated protein 1                           78.2    3e-15   Solanum pennellii
gb|AGQ04316.1|  SAP1                                                  79.7    3e-15   Oryza glumipatula
gb|AGQ04314.1|  SAP1                                                  79.7    3e-15   Oryza nivara
gb|EMT33843.1|  Zinc finger A20 and AN1 domain-containing stress-...  80.1    3e-15   Aegilops tauschii
gb|EAZ09556.1|  hypothetical protein OsI_31833                        80.1    3e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001063521.1|  Os09g0486500                                     80.1    3e-15   
dbj|BAK03526.1|  predicted protein                                    79.7    4e-15   Hordeum vulgare subsp. vulgare [barley]
gb|ADF80942.1|  zinc finger protein                                   78.6    1e-14   Phyllostachys praecox [zaozhu]
gb|AGQ04324.1|  SAP1                                                  76.6    3e-14   Oryza officinalis
dbj|BAJ88745.1|  predicted protein                                    77.0    4e-14   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010928202.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  77.0    4e-14   Elaeis guineensis
gb|ADF80943.1|  zinc finger protein                                   76.6    5e-14   Phyllostachys vivax
ref|XP_004798521.1|  PREDICTED: AN1-type zinc finger protein 6        75.9    9e-14   
gb|AGQ04319.1|  SAP1                                                  75.1    1e-13   Oryza meridionalis
gb|ACL01101.1|  zinc finger protein                                   75.5    1e-13   Phyllostachys edulis [kikko-chiku]
dbj|BAJ90521.1|  predicted protein                                    75.5    1e-13   Hordeum vulgare subsp. vulgare [barley]
ref|XP_005148802.1|  PREDICTED: AN1-type zinc finger protein 6 is...  75.5    1e-13   Melopsittacus undulatus
ref|XP_005521625.1|  PREDICTED: AN1-type zinc finger protein 6 is...  75.1    2e-13   
ref|XP_010018692.1|  PREDICTED: AN1-type zinc finger protein 6 is...  75.1    2e-13   Nestor notabilis
gb|AGQ04317.1|  SAP1                                                  74.3    3e-13   Oryza longistaminata [long-staminate rice]
ref|XP_002445913.1|  hypothetical protein SORBIDRAFT_07g027940        74.7    3e-13   Sorghum bicolor [broomcorn]
ref|XP_009942070.1|  PREDICTED: AN1-type zinc finger protein 6 is...  74.7    3e-13   Opisthocomus hoazin [hoatzin]
ref|XP_004973853.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  74.3    3e-13   Setaria italica
ref|XP_007133828.1|  hypothetical protein PHAVU_011G212300g           73.6    4e-13   Phaseolus vulgaris [French bean]
ref|XP_002460447.1|  hypothetical protein SORBIDRAFT_02g028240        74.3    4e-13   Sorghum bicolor [broomcorn]
ref|XP_011094369.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  73.6    6e-13   Sesamum indicum [beniseed]
ref|XP_010257702.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  73.6    6e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009507913.1|  PREDICTED: AN1-type zinc finger protein 6 is...  73.6    6e-13   Phalacrocorax carbo [common cormorant]
ref|XP_010925078.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  73.6    7e-13   Elaeis guineensis
ref|XP_010139451.1|  PREDICTED: AN1-type zinc finger protein 6 is...  73.6    7e-13   Buceros rhinoceros silvestris
ref|XP_008935048.1|  PREDICTED: AN1-type zinc finger protein 6 is...  73.6    7e-13   Merops nubicus
ref|XP_008490199.1|  PREDICTED: AN1-type zinc finger protein 6 is...  73.6    8e-13   Calypte anna
ref|XP_008794968.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  73.2    8e-13   Phoenix dactylifera
ref|XP_005419656.1|  PREDICTED: AN1-type zinc finger protein 6 is...  73.2    8e-13   Geospiza fortis
ref|XP_010157333.1|  PREDICTED: AN1-type zinc finger protein 6 is...  73.2    1e-12   Eurypyga helias
ref|XP_010174709.1|  PREDICTED: AN1-type zinc finger protein 6 is...  73.2    1e-12   Caprimulgus carolinensis
ref|XP_008923640.1|  PREDICTED: AN1-type zinc finger protein 6 is...  73.2    1e-12   Manacus vitellinus
ref|XP_009876598.1|  PREDICTED: AN1-type zinc finger protein 6 is...  73.2    1e-12   Apaloderma vittatum
ref|XP_010195894.1|  PREDICTED: AN1-type zinc finger protein 6 is...  72.8    1e-12   Colius striatus
ref|XP_009584789.1|  PREDICTED: AN1-type zinc finger protein 6 is...  72.8    2e-12   Fulmarus glacialis
gb|ABK90631.1|  zinc finger protein                                   72.4    2e-12   Aeluropus littoralis
ref|XP_010302402.1|  PREDICTED: AN1-type zinc finger protein 6 is...  72.4    2e-12   Balearica regulorum gibbericeps
ref|XP_005436662.1|  PREDICTED: AN1-type zinc finger protein 6 is...  72.4    2e-12   
ref|XP_002269276.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  71.6    2e-12   Vitis vinifera
ref|XP_009976938.1|  PREDICTED: AN1-type zinc finger protein 6 is...  72.0    3e-12   Tauraco erythrolophus
gb|AGQ04315.1|  SAP1                                                  71.2    3e-12   Oryza rufipogon [common wild rice]
ref|XP_003557532.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  71.6    3e-12   Brachypodium distachyon [annual false brome]
ref|XP_010286312.1|  PREDICTED: AN1-type zinc finger protein 6 is...  71.6    3e-12   Phaethon lepturus
ref|XP_008638302.1|  PREDICTED: AN1-type zinc finger protein 6 is...  71.6    3e-12   
ref|XP_010228315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  72.0    3e-12   
ref|XP_003542858.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  70.9    3e-12   Glycine max [soybeans]
ref|XP_009416648.1|  PREDICTED: zinc finger AN1 domain-containing...  71.2    4e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004288126.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  71.2    4e-12   Fragaria vesca subsp. vesca
ref|XP_010189201.1|  PREDICTED: AN1-type zinc finger protein 6 is...  71.2    4e-12   Mesitornis unicolor
ref|XP_009701714.1|  PREDICTED: AN1-type zinc finger protein 6 is...  71.2    4e-12   Cariama cristata
ref|XP_009415054.1|  PREDICTED: zinc finger AN1 domain-containing...  70.9    5e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004510979.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  70.5    6e-12   Cicer arietinum [garbanzo]
ref|XP_008808665.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  70.5    6e-12   Phoenix dactylifera
ref|XP_003606132.1|  Zinc finger A20 and AN1 domain-containing st...  70.5    6e-12   Medicago truncatula
ref|XP_009082778.1|  PREDICTED: AN1-type zinc finger protein 6 is...  70.5    8e-12   Acanthisitta chloris
ref|XP_002513177.1|  zinc finger protein, putative                    69.7    1e-11   Ricinus communis
ref|XP_006339126.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  70.1    1e-11   Solanum tuberosum [potatoes]
ref|XP_002306229.2|  zinc finger family protein                       70.1    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011046278.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  70.1    1e-11   Populus euphratica
ref|XP_010557404.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  69.7    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_010053387.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  69.7    1e-11   Eucalyptus grandis [rose gum]
ref|XP_002279037.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  68.9    1e-11   Vitis vinifera
ref|XP_002282913.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  69.3    2e-11   Vitis vinifera
ref|XP_007150082.1|  hypothetical protein PHAVU_005G125000g           69.3    2e-11   Phaseolus vulgaris [French bean]
ref|XP_006487967.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  69.3    2e-11   Citrus sinensis [Valencia orange]
ref|XP_004421951.1|  PREDICTED: AN1-type zinc finger protein 6 is...  69.3    2e-11   
ref|XP_006189680.1|  PREDICTED: AN1-type zinc finger protein 6 is...  69.3    2e-11   
ref|XP_007206025.1|  hypothetical protein PRUPE_ppa012468mg           69.3    2e-11   Prunus persica
ref|XP_004278382.1|  PREDICTED: AN1-type zinc finger protein 6 is...  68.9    2e-11   Orcinus orca [Orca]
ref|XP_007447131.1|  PREDICTED: AN1-type zinc finger protein 6 is...  68.9    2e-11   Lipotes vexillifer [baiji]
ref|XP_006427949.1|  hypothetical protein CICLE_v10026622mg           68.6    3e-11   Citrus clementina
ref|XP_010913090.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  68.2    4e-11   Elaeis guineensis
gb|AFK36400.1|  unknown                                               68.2    4e-11   Medicago truncatula
ref|XP_003627722.1|  Zinc finger A20 and AN1 domain-containing st...  68.2    4e-11   Medicago truncatula
ref|XP_009560016.1|  PREDICTED: AN1-type zinc finger protein 6 is...  68.6    4e-11   Cuculus canorus
ref|XP_009902209.1|  PREDICTED: AN1-type zinc finger protein 6 is...  68.2    5e-11   Picoides pubescens
ref|XP_008812241.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  67.8    5e-11   Phoenix dactylifera
gb|EPS60935.1|  induced stolon tip protein                            67.8    5e-11   Genlisea aurea
ref|XP_006842203.1|  hypothetical protein AMTR_s00078p00168800        67.8    5e-11   
ref|XP_009802017.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  67.8    5e-11   Nicotiana sylvestris
ref|XP_007066909.1|  PREDICTED: AN1-type zinc finger protein 6 is...  68.2    6e-11   Chelonia mydas [green seaturtle]
ref|XP_010261028.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  67.8    6e-11   Nelumbo nucifera [Indian lotus]
ref|XP_006888306.1|  PREDICTED: AN1-type zinc finger protein 6 is...  67.8    6e-11   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_010545575.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  67.8    6e-11   Tarenaya hassleriana [spider flower]
ref|XP_004249448.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  67.4    7e-11   Solanum lycopersicum
gb|ACM68446.1|  stress-associated protein 9                           67.4    7e-11   Solanum lycopersicum
ref|XP_009418488.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  67.4    7e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011080265.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  67.8    7e-11   Sesamum indicum [beniseed]
ref|XP_006345467.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  67.4    8e-11   Solanum tuberosum [potatoes]
dbj|BAJ94586.1|  predicted protein                                    67.0    9e-11   Hordeum vulgare subsp. vulgare [barley]
gb|KDO50474.1|  hypothetical protein CISIN_1g030772mg                 67.4    9e-11   Citrus sinensis [Valencia orange]
gb|ACM68454.1|  stress-associated protein 4                           67.0    9e-11   Solanum pennellii
ref|XP_006850149.1|  hypothetical protein AMTR_s00022p00236720        67.0    9e-11   Amborella trichopoda
ref|XP_004594633.1|  PREDICTED: AN1-type zinc finger protein 6 is...  67.4    9e-11   Ochotona princeps [southern American pika]
ref|XP_006660259.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  66.2    1e-10   
ref|XP_006046437.1|  PREDICTED: AN1-type zinc finger protein 6-li...  67.8    1e-10   Bubalus bubalis [domestic water buffalo]
gb|ACM68441.1|  stress-associated protein 4                           67.0    1e-10   Solanum lycopersicum
ref|XP_011093525.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  67.0    1e-10   Sesamum indicum [beniseed]
ref|XP_004229614.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  67.0    1e-10   
ref|XP_004957171.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  67.0    1e-10   Setaria italica
ref|XP_002312908.1|  zinc finger family protein                       66.6    1e-10   Populus trichocarpa [western balsam poplar]
gb|ABK21092.1|  unknown                                               67.0    1e-10   Picea sitchensis
ref|XP_002528717.1|  zinc finger protein, putative                    67.0    1e-10   Ricinus communis
ref|XP_011093524.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  67.0    1e-10   Sesamum indicum [beniseed]
ref|XP_003540534.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  66.2    1e-10   Glycine max [soybeans]
ref|NP_001229848.1|  AN1-type zinc finger protein 6 isoform d         67.0    1e-10   Homo sapiens [man]
ref|NP_001058985.1|  Os07g0168800                                     66.6    2e-10   
gb|EMT17725.1|  Zinc finger A20 and AN1 domain-containing stress-...  66.6    2e-10   Aegilops tauschii
ref|XP_007145317.1|  hypothetical protein PHAVU_007G228900g           66.6    2e-10   Phaseolus vulgaris [French bean]
gb|EYU31356.1|  hypothetical protein MIMGU_mgv1a014938mg              66.6    2e-10   Erythranthe guttata [common monkey flower]
gb|ACJ84133.1|  unknown                                               66.2    2e-10   Medicago truncatula
ref|XP_002466323.1|  hypothetical protein SORBIDRAFT_01g005640        66.6    2e-10   Sorghum bicolor [broomcorn]
ref|XP_010268591.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  66.2    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_004644513.1|  PREDICTED: AN1-type zinc finger protein 6 is...  66.2    2e-10   Octodon degus
ref|XP_004017839.1|  PREDICTED: AN1-type zinc finger protein 6 is...  66.6    2e-10   
dbj|BAK01503.1|  predicted protein                                    65.9    2e-10   Hordeum vulgare subsp. vulgare [barley]
ref|XP_009412393.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  66.2    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009601977.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  65.9    2e-10   Nicotiana tomentosiformis
ref|XP_004324566.1|  PREDICTED: AN1-type zinc finger protein 6-li...  66.2    2e-10   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_009412395.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  65.9    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS47592.1|  Zinc finger A20 and AN1 domain-containing stress-...  67.0    3e-10   Triticum urartu
ref|XP_003784626.1|  PREDICTED: AN1-type zinc finger protein 6-li...  66.2    3e-10   Otolemur garnettii
ref|XP_006870970.1|  PREDICTED: AN1-type zinc finger protein 6 is...  65.9    3e-10   Chrysochloris asiatica
ref|XP_005889815.1|  PREDICTED: AN1-type zinc finger protein 6 is...  66.2    3e-10   Bos mutus
ref|XP_004088382.1|  PREDICTED: AN1-type zinc finger protein 6        66.2    3e-10   Nomascus leucogenys [White-cheeked Gibbon]
gb|KDP35279.1|  hypothetical protein JCGZ_09438                       65.5    3e-10   Jatropha curcas
ref|XP_007950007.1|  PREDICTED: AN1-type zinc finger protein 6 is...  65.9    3e-10   Orycteropus afer afer
emb|CDJ89180.1|  Zinc finger domain containing protein                66.2    3e-10   Haemonchus contortus [red stomach worm]
ref|XP_004536532.1|  PREDICTED: AN1-type zinc finger protein 6-li...  65.9    3e-10   Ceratitis capitata
ref|XP_011044990.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  65.5    3e-10   Populus euphratica
gb|ADK63395.1|  AN1-like zinc finger protein                          65.5    3e-10   Brassica rapa
emb|CDY25219.1|  BnaC06g04440D                                        65.5    4e-10   Brassica napus [oilseed rape]
gb|AAQ84334.1|  stress-associated protein 8                           65.5    4e-10   Oryza sativa Indica Group [Indian rice]
ref|NP_001058066.1|  Os06g0612800                                     65.5    4e-10   
ref|XP_009589284.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  65.5    4e-10   Nicotiana tomentosiformis
gb|KEH43736.1|  zinc finger A20 and AN1 domain stress-associated ...  64.7    4e-10   Medicago truncatula
ref|NP_001288874.1|  zinc finger A20 and AN1 domain-containing st...  65.1    4e-10   Brassica rapa
ref|XP_004658309.1|  PREDICTED: AN1-type zinc finger protein 6 is...  65.5    5e-10   Jaculus jaculus
gb|EPY73931.1|  AN1-type zinc finger protein 5                        64.7    5e-10   Camelus ferus
ref|XP_010228642.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  64.7    5e-10   
ref|XP_010228638.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  65.1    5e-10   Brachypodium distachyon [annual false brome]
ref|XP_011188738.1|  PREDICTED: AN1-type zinc finger protein 6 is...  65.1    5e-10   Bactrocera cucurbitae [melon fruit fly]
ref|XP_010002353.1|  PREDICTED: AN1-type zinc finger protein 6 is...  65.1    6e-10   Chaetura pelagica
ref|XP_009958821.1|  PREDICTED: AN1-type zinc finger protein 6-like   65.1    6e-10   Leptosomus discolor
ref|XP_005180142.1|  PREDICTED: AN1-type zinc finger protein 5        65.1    6e-10   Musca domestica
ref|NP_001140650.1|  uncharacterized protein LOC100272725             64.7    6e-10   Zea mays [maize]
ref|XP_006657485.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  64.7    7e-10   Oryza brachyantha
ref|XP_009411960.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  64.3    7e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406414.1|  PREDICTED: zinc finger AN1 domain-containing...  64.7    7e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004738186.1|  PREDICTED: AN1-type zinc finger protein 6-li...  64.7    7e-10   
ref|XP_005077919.1|  PREDICTED: AN1-type zinc finger protein 6 is...  64.7    7e-10   
ref|XP_006424263.1|  hypothetical protein CICLE_v10029439mg           64.7    7e-10   Citrus clementina
ref|XP_007447130.1|  PREDICTED: AN1-type zinc finger protein 6 is...  65.1    7e-10   Lipotes vexillifer [baiji]
ref|XP_004017840.1|  PREDICTED: AN1-type zinc finger protein 6 is...  64.7    8e-10   
ref|XP_004278381.1|  PREDICTED: AN1-type zinc finger protein 6 is...  64.7    8e-10   
ref|XP_004617671.1|  PREDICTED: AN1-type zinc finger protein 6 is...  64.7    8e-10   Sorex araneus [Eurasian shrew]
ref|XP_010494181.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  64.3    8e-10   Camelina sativa [gold-of-pleasure]
ref|XP_004421950.1|  PREDICTED: AN1-type zinc finger protein 6 is...  64.7    8e-10   
ref|XP_010089848.1|  Zinc finger A20 and AN1 domain-containing st...  64.3    8e-10   Morus notabilis
ref|XP_005889816.1|  PREDICTED: AN1-type zinc finger protein 6 is...  64.7    9e-10   Bos mutus
ref|XP_004387551.1|  PREDICTED: AN1-type zinc finger protein 6 is...  64.3    9e-10   Trichechus manatus latirostris
ref|XP_009402699.1|  PREDICTED: zinc finger AN1 domain-containing...  63.9    9e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006576194.1|  PREDICTED: uncharacterized protein LOC100527...  64.3    1e-09   
gb|ACM68459.1|  stress-associated protein 9                           63.9    1e-09   Solanum pennellii
ref|NP_001229846.1|  AN1-type zinc finger protein 6 isoform b         64.7    1e-09   Homo sapiens [man]
ref|XP_006108289.1|  PREDICTED: AN1-type zinc finger protein 6-li...  64.3    1e-09   
ref|XP_004056692.1|  PREDICTED: AN1-type zinc finger protein 6 is...  64.7    1e-09   Gorilla gorilla gorilla [lowland gorilla]
ref|NP_194013.1|  A20/AN1-like zinc finger family protein             64.3    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008996765.1|  PREDICTED: AN1-type zinc finger protein 6 is...  64.3    1e-09   Callithrix jacchus [common marmoset]
ref|XP_004142122.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.9    1e-09   
ref|XP_006410805.1|  hypothetical protein EUTSA_v10017322mg           63.9    1e-09   Eutrema salsugineum
ref|XP_009770813.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.9    1e-09   Nicotiana sylvestris
ref|XP_009391886.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.9    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009376157.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.9    1e-09   Pyrus x bretschneideri [bai li]
ref|XP_002513466.1|  zinc finger protein, putative                    63.9    1e-09   Ricinus communis
gb|EAW99126.1|  zinc finger, A20 domain containing 3, isoform CRA_c   64.7    1e-09   Homo sapiens [man]
ref|XP_007155611.1|  hypothetical protein PHAVU_003G216400g           63.5    1e-09   Phaseolus vulgaris [French bean]
ref|XP_010928861.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.9    1e-09   Elaeis guineensis
ref|XP_008788284.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.5    1e-09   Phoenix dactylifera
ref|XP_011205403.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.9    2e-09   Bactrocera dorsalis
emb|CDY13347.1|  BnaC06g14100D                                        63.5    2e-09   Brassica napus [oilseed rape]
ref|XP_004148157.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.5    2e-09   
emb|CBI16411.3|  unnamed protein product                              63.2    2e-09   Vitis vinifera
gb|EYU46282.1|  hypothetical protein MIMGU_mgv1a014897mg              63.5    2e-09   Erythranthe guttata [common monkey flower]
ref|XP_008490198.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.9    2e-09   Calypte anna
ref|XP_008935047.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.9    2e-09   Merops nubicus
ref|XP_002285543.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.8    2e-09   Vitis vinifera
ref|XP_008344433.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.2    2e-09   Malus domestica [apple tree]
ref|XP_009758333.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.5    2e-09   Nicotiana sylvestris
ref|XP_004406082.1|  PREDICTED: AN1-type zinc finger protein 6-li...  63.5    2e-09   Odobenus rosmarus divergens
ref|XP_005148801.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.9    2e-09   Melopsittacus undulatus
ref|XP_006593451.1|  PREDICTED: uncharacterized protein LOC100802...  63.5    2e-09   Glycine max [soybeans]
ref|XP_008804805.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.5    2e-09   Phoenix dactylifera
ref|XP_008159435.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.5    2e-09   Eptesicus fuscus
ref|XP_008066695.1|  PREDICTED: AN1-type zinc finger protein 6        63.5    2e-09   
ref|XP_006189679.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.5    2e-09   
ref|XP_005419655.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.5    2e-09   
ref|NP_001242495.1|  uncharacterized protein LOC100802969             63.5    2e-09   
gb|EYC13969.1|  hypothetical protein Y032_0042g633                    63.5    2e-09   
ref|XP_010174701.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.5    2e-09   
gb|EEC76316.1|  hypothetical protein OsI_13859                        63.5    2e-09   
ref|XP_010045231.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.2    2e-09   
ref|XP_010123597.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.5    2e-09   
ref|XP_010555326.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.2    2e-09   
ref|XP_003434430.2|  PREDICTED: AN1-type zinc finger protein 6 is...  63.5    2e-09   
gb|EEE60081.1|  hypothetical protein OsJ_12913                        63.5    3e-09   
ref|XP_004160892.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.8    3e-09   
ref|XP_004387550.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.2    3e-09   
ref|XP_003557802.2|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.5    3e-09   
ref|XP_004930543.1|  PREDICTED: AN1-type zinc finger protein 6-li...  63.2    3e-09   
ref|NP_001051527.1|  Os03g0792900                                     62.8    3e-09   
ref|XP_009133889.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.8    3e-09   
ref|XP_004658308.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.5    3e-09   
ref|XP_006888305.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.2    3e-09   
ref|XP_008449732.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.8    3e-09   
ref|XP_004594631.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.2    3e-09   
ref|XP_005974069.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.2    3e-09   
ref|XP_010911243.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.4    3e-09   
ref|XP_004250869.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.8    3e-09   
ref|XP_009482427.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.2    3e-09   
ref|XP_004480728.1|  PREDICTED: AN1-type zinc finger protein 6 is...  63.2    4e-09   
ref|XP_006430236.1|  hypothetical protein CICLE_v10012937mg           62.8    4e-09   
ref|XP_010271706.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.8    4e-09   
ref|XP_009419155.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.8    4e-09   
ref|NP_001237386.1|  uncharacterized protein LOC100306347             62.4    4e-09   
ref|XP_005521624.1|  PREDICTED: AN1-type zinc finger protein 6 is...  62.8    4e-09   
ref|XP_003563629.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.4    4e-09   
emb|CDP15398.1|  unnamed protein product                              62.4    4e-09   
ref|XP_004617670.1|  PREDICTED: AN1-type zinc finger protein 6 is...  62.8    4e-09   
ref|XP_005077918.1|  PREDICTED: AN1-type zinc finger protein 6 is...  62.8    4e-09   
ref|XP_009107187.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.8    5e-09   
ref|XP_006354259.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.4    5e-09   
ref|XP_010076997.1|  PREDICTED: AN1-type zinc finger protein 6 is...  62.8    5e-09   
ref|XP_004158200.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.4    5e-09   
emb|CDP10084.1|  unnamed protein product                              63.5    5e-09   
ref|XP_009407895.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.4    5e-09   
dbj|BAG50058.1|  transcription factor C2H2                            62.0    5e-09   
ref|XP_006490455.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.0    5e-09   
ref|XP_004135920.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.0    5e-09   
ref|NP_001237029.1|  uncharacterized protein LOC100527251             62.0    5e-09   
gb|KEH16280.1|  zinc finger A20 and AN1 domain stress-associated ...  62.4    5e-09   
gb|KHN07399.1|  Zinc finger A20 and AN1 domain-containing stress-...  62.0    5e-09   
ref|XP_003431370.1|  PREDICTED: AN1-type zinc finger protein 6        62.4    5e-09   
gb|KEH16279.1|  zinc finger A20 and AN1 domain stress-associated ...  62.0    5e-09   
ref|XP_008461274.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.0    5e-09   
ref|XP_009107188.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.0    6e-09   
ref|XP_005695117.1|  PREDICTED: AN1-type zinc finger protein 6 is...  62.4    6e-09   
ref|XP_006365818.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.6    6e-09   
ref|XP_007255076.1|  PREDICTED: AN1-type zinc finger protein 5-like   62.4    6e-09   
ref|XP_006142699.1|  PREDICTED: AN1-type zinc finger protein 6 is...  62.4    6e-09   
ref|NP_565844.1|  zinc finger A20 and AN1 domain-containing stres...  61.6    7e-09   
emb|CAG38507.1|  AWP1                                                 62.4    7e-09   
ref|XP_001756532.1|  predicted protein                                61.6    7e-09   
emb|CAB66533.1|  hypothetical protein                                 62.4    7e-09   
ref|XP_009617203.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.6    7e-09   
ref|XP_004658306.1|  PREDICTED: AN1-type zinc finger protein 6 is...  62.4    8e-09   
ref|XP_010907320.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.6    8e-09   
ref|XP_008228954.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.6    8e-09   
ref|XP_004324565.1|  PREDICTED: AN1-type zinc finger protein 6-li...  62.0    8e-09   
gb|ACM68452.1|  stress-associated protein 2                           61.6    8e-09   
ref|XP_003540241.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.6    8e-09   
ref|XP_009081982.1|  PREDICTED: AN1-type zinc finger protein 6-like   61.6    8e-09   
ref|XP_005989640.1|  PREDICTED: AN1-type zinc finger protein 6 is...  62.0    8e-09   
ref|XP_008462560.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.6    8e-09   
ref|XP_008384532.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.6    8e-09   
ref|XP_006219718.1|  PREDICTED: AN1-type zinc finger protein 5-li...  61.6    9e-09   
ref|XP_008638301.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.6    9e-09   
gb|AFK46127.1|  unknown                                               61.6    9e-09   
gb|ABK24386.1|  unknown                                               61.2    1e-08   
ref|XP_004506164.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.2    1e-08   
ref|XP_001928215.1|  PREDICTED: AN1-type zinc finger protein 6 is...  62.0    1e-08   
ref|XP_005974070.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.6    1e-08   
ref|XP_003275455.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.6    1e-08   
gb|KGN57296.1|  hypothetical protein Csa_3G177400                     60.8    1e-08   
gb|EMT32776.1|  Zinc finger A20 and AN1 domain-containing stress-...  63.5    1e-08   
ref|XP_004143315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.2    1e-08   
ref|XP_007206046.1|  hypothetical protein PRUPE_ppa012588mg           61.2    1e-08   
ref|XP_004017836.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.6    1e-08   
ref|XP_005656313.1|  PREDICTED: AN1-type zinc finger protein 6 is...  62.0    1e-08   
gb|ACM68458.1|  stress-associated protein 8                           60.8    1e-08   
ref|XP_003921734.1|  PREDICTED: AN1-type zinc finger protein 6        61.6    1e-08   
ref|XP_005889813.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.6    1e-08   
ref|XP_007027699.1|  A20/AN1-like zinc finger family protein, put...  60.8    1e-08   
ref|XP_002387848.1|  hypothetical protein MPER_13207                  61.2    1e-08   
ref|XP_011372691.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.6    1e-08   
ref|XP_006905383.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.6    1e-08   
ref|XP_009459927.1|  PREDICTED: AN1-type zinc finger protein 6-li...  61.2    1e-08   
ref|XP_005521619.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.6    1e-08   
ref|XP_003986789.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.6    1e-08   
ref|XP_010018691.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.2    1e-08   
ref|XP_009088241.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.6    1e-08   
ref|NP_001127520.1|  AN1-type zinc finger protein 6                   61.6    1e-08   
ref|NP_001106259.1|  AN12                                             60.8    1e-08   
gb|ADL36641.1|  C2H2L domain class transcription factor               60.8    1e-08   
ref|NP_001029632.1|  AN1-type zinc finger protein 6                   61.6    1e-08   
ref|XP_007078244.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.6    1e-08   
ref|XP_010105325.1|  Zinc finger A20 and AN1 domain-containing st...  60.8    1e-08   
ref|XP_007950006.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.2    1e-08   
gb|ACG26325.1|  zinc finger A20 and AN1 domains-containing protein    60.8    1e-08   
ref|XP_007078243.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.6    2e-08   
ref|XP_009876590.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.2    2e-08   
ref|XP_009942056.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.2    2e-08   
ref|XP_009421133.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.5    2e-08   
gb|KFO85059.1|  AN1-type zinc finger protein 6                        60.5    2e-08   
ref|XP_002603180.1|  hypothetical protein BRAFLDRAFT_226485           60.8    2e-08   
ref|XP_010244455.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.5    2e-08   
gb|EMS48100.1|  Zinc finger A20 and AN1 domain-containing stress-...  62.8    2e-08   
ref|XP_009770817.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.5    2e-08   
ref|XP_001779169.1|  predicted protein                                60.5    2e-08   
ref|XP_011372688.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.6    2e-08   
ref|XP_005316938.1|  PREDICTED: AN1-type zinc finger protein 6 is...  61.2    2e-08   
ref|XP_007066908.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.8    2e-08   
ref|XP_006888301.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.8    2e-08   
ref|XP_002768890.1|  zinc finger protein A20 domain-containing pr...  60.5    2e-08   
ref|XP_004252868.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.5    2e-08   
gb|ABI23728.1|  stress-tolerance zinc finger protein                  60.5    2e-08   
gb|EYU35469.1|  hypothetical protein MIMGU_mgv1a022466mg              60.1    2e-08   
ref|XP_010018688.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.8    2e-08   
ref|XP_011037831.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.5    2e-08   
ref|XP_009507912.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.8    2e-08   
dbj|GAM26264.1|  hypothetical protein SAMD00019534_094390             60.1    2e-08   
ref|XP_002297783.1|  zinc finger family protein                       60.5    2e-08   
gb|ACM68460.1|  stress-associated protein 10                          60.1    2e-08   
ref|NP_001270499.1|  uncharacterized protein LOC101926213             60.5    2e-08   
ref|XP_002285530.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.1    2e-08   
gb|KDP22380.1|  hypothetical protein JCGZ_26211                       60.8    2e-08   
ref|XP_009128643.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.1    2e-08   
ref|XP_005148800.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.8    3e-08   
ref|XP_006076653.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.8    3e-08   
ref|XP_009416009.1|  PREDICTED: zinc finger AN1 domain-containing...  59.7    3e-08   
ref|XP_008923639.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.5    3e-08   
ref|XP_007162885.1|  hypothetical protein PHAVU_001G188800g           60.1    3e-08   
ref|XP_005618477.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.8    3e-08   
ref|XP_010650293.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  59.7    3e-08   
ref|XP_004139026.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.1    3e-08   
ref|XP_004738185.1|  PREDICTED: AN1-type zinc finger protein 6-li...  60.5    3e-08   
gb|KDO61115.1|  hypothetical protein CISIN_1g031015mg                 60.1    3e-08   
ref|XP_006720637.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.8    3e-08   
ref|XP_004421945.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.5    3e-08   
dbj|BAE88397.1|  unnamed protein product                              60.5    3e-08   
ref|XP_010542567.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  59.7    3e-08   
ref|XP_006481799.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  59.7    3e-08   
gb|ABK26062.1|  unknown                                               60.1    3e-08   
ref|XP_009902208.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.1    3e-08   
ref|XP_009209012.1|  PREDICTED: AN1-type zinc finger protein 6        60.5    3e-08   
ref|XP_003639021.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.5    3e-08   
ref|XP_007447126.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.5    3e-08   
ref|XP_007194289.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.5    3e-08   
ref|XP_004403632.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.5    3e-08   
ref|NP_001181364.1|  AN1-type zinc finger protein 6                   60.5    3e-08   
ref|XP_007130286.1|  PREDICTED: AN1-type zinc finger protein 6-li...  60.1    3e-08   
ref|XP_009393780.1|  PREDICTED: zinc finger AN1 domain-containing...  59.3    3e-08   
ref|XP_009088235.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.5    3e-08   
ref|XP_004278377.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.5    3e-08   
ref|XP_005427359.1|  PREDICTED: AN1-type zinc finger protein 6-li...  60.1    3e-08   
gb|ABK21003.1|  unknown                                               60.1    4e-08   
ref|NP_061879.2|  AN1-type zinc finger protein 6 isoform a            60.5    4e-08   
ref|NP_001135100.1|  AN1-type zinc finger protein 5                   60.5    4e-08   
ref|XP_010876178.1|  PREDICTED: AN1-type zinc finger protein 5-like   60.5    4e-08   
ref|XP_002749251.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.5    4e-08   
emb|CDY31184.1|  BnaC03g47070D                                        59.7    4e-08   
ref|XP_009115980.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  59.7    4e-08   
gb|KFQ91108.1|  AN1-type zinc finger protein 5                        59.7    4e-08   
ref|XP_007425365.1|  PREDICTED: AN1-type zinc finger protein 5        60.5    4e-08   
ref|XP_010157332.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.1    4e-08   
ref|XP_005618476.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.5    4e-08   
ref|XP_010139435.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.1    4e-08   
ref|XP_009507911.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.1    4e-08   
ref|XP_008935046.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.1    4e-08   
ref|XP_004892304.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.1    4e-08   
ref|NP_001233563.1|  AN1-type zinc finger protein 6                   60.1    4e-08   
ref|XP_008490197.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.1    4e-08   
gb|ACM68443.1|  stress-associated protein 6                           59.3    4e-08   
ref|XP_006272209.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.1    4e-08   
ref|XP_008101498.1|  PREDICTED: AN1-type zinc finger protein 5 is...  60.1    4e-08   
ref|XP_003216528.1|  PREDICTED: AN1-type zinc finger protein 5 is...  60.1    4e-08   
gb|KHJ79156.1|  AN1-like Zinc finger                                  58.9    4e-08   
ref|XP_006033509.1|  PREDICTED: LOW QUALITY PROTEIN: AN1-type zin...  60.1    4e-08   
ref|XP_004892314.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.1    4e-08   
ref|XP_010913940.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  59.7    4e-08   
ref|XP_010672748.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  59.7    4e-08   
ref|XP_008373747.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  59.7    4e-08   
ref|XP_006391804.1|  hypothetical protein EUTSA_v10023731mg           59.3    4e-08   
ref|XP_005618475.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.5    4e-08   
ref|XP_009876583.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.1    4e-08   
ref|XP_009584788.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.1    4e-08   
gb|KJB62167.1|  hypothetical protein B456_009G404700                  59.3    5e-08   
ref|NP_001264451.1|  AN1-type zinc finger protein 6                   60.1    5e-08   
ref|XP_010089512.1|  Zinc finger A20 and AN1 domain-containing st...  58.9    5e-08   
ref|NP_001080394.1|  zinc finger, AN1-type domain 6                   60.1    5e-08   
ref|XP_005436661.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.1    5e-08   
ref|XP_003784625.1|  PREDICTED: AN1-type zinc finger protein 6-li...  60.1    5e-08   
gb|KJB16635.1|  hypothetical protein B456_002G240900                  59.3    5e-08   
ref|XP_008923637.1|  PREDICTED: AN1-type zinc finger protein 6 is...  60.1    5e-08   
ref|XP_010302401.1|  PREDICTED: AN1-type zinc finger protein 6 is...  59.7    5e-08   
ref|XP_002199446.1|  PREDICTED: AN1-type zinc finger protein 6 is...  59.7    5e-08   
ref|NP_001232980.1|  uncharacterized protein LOC100168509             59.3    5e-08   
ref|XP_004487507.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  58.9    5e-08   
ref|XP_005051910.1|  PREDICTED: AN1-type zinc finger protein 6 is...  59.7    5e-08   
ref|XP_009082777.1|  PREDICTED: AN1-type zinc finger protein 6 is...  59.7    5e-08   
ref|XP_004365991.2|  zinc finger protein                              59.3    6e-08   
emb|CCA27656.1|  conserved hypothetical protein                       58.9    6e-08   
ref|XP_010286311.1|  PREDICTED: AN1-type zinc finger protein 6 is...  59.7    6e-08   
ref|XP_010036457.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  59.3    6e-08   
ref|XP_010157330.1|  PREDICTED: AN1-type zinc finger protein 6 is...  59.7    6e-08   
ref|XP_004972186.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  58.9    6e-08   
ref|XP_009405572.1|  PREDICTED: zinc finger AN1 domain-containing...  58.9    6e-08   
ref|XP_010476215.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  58.9    6e-08   
ref|XP_010325448.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  58.9    6e-08   
ref|XP_010174695.1|  PREDICTED: AN1-type zinc finger protein 6 is...  59.7    6e-08   
ref|XP_009589288.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  58.9    6e-08   
ref|XP_005051909.1|  PREDICTED: AN1-type zinc finger protein 6 is...  59.7    7e-08   
ref|XP_010189200.1|  PREDICTED: AN1-type zinc finger protein 6 is...  59.7    7e-08   
ref|XP_008579525.1|  PREDICTED: AN1-type zinc finger protein 6 is...  59.7    7e-08   
ref|XP_008159434.1|  PREDICTED: AN1-type zinc finger protein 6 is...  59.3    7e-08   



>ref|XP_009783307.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Nicotiana sylvestris]
Length=180

 Score =   132 bits (333),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 96/130 (74%), Gaps = 10/130 (8%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssv--aastvPIPHKFAEKSPRS----  391
            IT CVN+CGVTGNPATN+MCQKCFNATTAA+++S+     S V IPHKFAEK  RS    
Sbjct  19   ITLCVNNCGVTGNPATNNMCQKCFNATTAATSTSASSPTGSAVTIPHKFAEKLARSERSA  78

Query  392  --TFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCR  565
              +  R+SP R   DL++        ++K  ES P PAKREVNRCSGCRRKVGLTGFRCR
Sbjct  79   RFSSLRSSPERK-SDLERTSQHLTVKEDKLKESEP-PAKREVNRCSGCRRKVGLTGFRCR  136

Query  566  CGELFCGEHR  595
            CGELFCGEHR
Sbjct  137  CGELFCGEHR  146



>ref|XP_009591907.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Nicotiana tomentosiformis]
Length=180

 Score =   132 bits (332),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 96/130 (74%), Gaps = 10/130 (8%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssv--aastvPIPHKFAEKSPRS----  391
            IT CVN+CGVTGNPATN+MCQKCFNATTAA+++S+     S V IPHKFAEK  RS    
Sbjct  19   ITLCVNNCGVTGNPATNNMCQKCFNATTAATSTSASSPTGSVVTIPHKFAEKLARSERSA  78

Query  392  --TFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCR  565
              +  R+SP R   DL++        ++K  ES P PAKREVNRCSGCRRKVGLTGFRCR
Sbjct  79   RFSLLRSSPERK-SDLERTSQHLTVKEDKMKESVP-PAKREVNRCSGCRRKVGLTGFRCR  136

Query  566  CGELFCGEHR  595
            CG+LFCGEHR
Sbjct  137  CGDLFCGEHR  146



>ref|XP_004229612.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Solanum lycopersicum]
 gb|ABD57310.1| stress-associated protein 1 [Solanum lycopersicum]
Length=188

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 98/136 (72%), Gaps = 14/136 (10%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaast--vPIPHKFAEK------SP  385
            IT C+N+CGVTGNPATN+MCQKCFNATTAA+++SS + +   V IPH FAEK      S 
Sbjct  19   ITLCINNCGVTGNPATNNMCQKCFNATTAATSTSSSSPTGTSVTIPHNFAEKLVRSEKSA  78

Query  386  RSTFRRTSPGR------TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGL  547
            R +  R+SP R         DLKK+ D+    +E   ++S  PAKREVNRCSGCRRKVGL
Sbjct  79   RFSSLRSSPDRKSDLDRMSQDLKKVGDTMMVKEEDQLKASLPPAKREVNRCSGCRRKVGL  138

Query  548  TGFRCRCGELFCGEHR  595
            TGFRCRCGELFCGEHR
Sbjct  139  TGFRCRCGELFCGEHR  154



>ref|XP_006345468.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Solanum tuberosum]
Length=187

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 94/136 (69%), Gaps = 15/136 (11%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaast--vPIPHKFAEKSPRSTF--  397
            IT C+N CGVTGNPATN+MCQKCFNATTAA+++SS + +   V IPHKFAEK  RS    
Sbjct  19   ITLCIN-CGVTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPHKFAEKLVRSEKSA  77

Query  398  ----------RRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGL  547
                      R++   R   DLKK+ D     +E   + S  PAKREVNRCSGCRRKVGL
Sbjct  78   RFSSLRSLPDRKSDLDRMSQDLKKVGDWMMVKEEDQLKESLPPAKREVNRCSGCRRKVGL  137

Query  548  TGFRCRCGELFCGEHR  595
            TGFRCRCGELFCGEHR
Sbjct  138  TGFRCRCGELFCGEHR  153



>gb|ACR56827.1| At3g12630-like protein, partial [Solanum hirtum]
Length=151

 Score =   124 bits (312),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 94/121 (78%), Gaps = 5/121 (4%)
 Frame = +2

Query  245  NDCGVTGNPATNSMCQKCFNattaastsssvaast--vPIPHKFAEKSPRS--TFRRTSP  412
            ++CGVTGNPATN+MCQKCFNATTAA+++SS + +   V IP KFAEK  RS  + R +  
Sbjct  4    HNCGVTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPQKFAEKLARSEKSARFSLL  63

Query  413  GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  592
              +  DLKK+ D T K +++  ES P PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH
Sbjct  64   RSSSQDLKKVGDRTXKEEDQLKESLP-PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  122

Query  593  R  595
            R
Sbjct  123  R  123



>ref|XP_009631181.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=156

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 77/122 (63%), Gaps = 20/122 (16%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            +T CV  CGV GNPATN+MCQ CFNA+++              PHKFA    RST     
Sbjct  21   LTLCVKSCGVIGNPATNNMCQNCFNASSSKV----------AYPHKFANILTRST-----  65

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
                  DLKK  D   K D+K  ES  +PAK EVNRCSGCRRK+GLTGFRCRCGELFCGE
Sbjct  66   ----SSDLKKYVDRAVKDDDKAKES-VSPAKSEVNRCSGCRRKLGLTGFRCRCGELFCGE  120

Query  590  HR  595
            HR
Sbjct  121  HR  122



>gb|ACR56824.1| At3g12630-like protein, partial [Solanum hirtum]
Length=147

 Score =   121 bits (304),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 92/120 (77%), Gaps = 5/120 (4%)
 Frame = +2

Query  248  DCGVTGNPATNSMCQKCFNattaastsssvaast--vPIPHKFAEKSPRS--TFRRTSPG  415
            +CGVTGNPATN+MCQKCFNATTAA+++SS + +   V IP KFAEK  RS  + R +   
Sbjct  1    NCGVTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPQKFAEKLARSEKSARFSLLR  60

Query  416  RTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             +  DLKK+ D   K +++  ES P PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR
Sbjct  61   SSSQDLKKVGDRKVKEEDQLKESLP-PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  119



>gb|ACR56825.1| At3g12630-like protein, partial [Solanum quitoense]
 gb|ACR56826.1| At3g12630-like protein, partial [Solanum quitoense]
Length=150

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 93/122 (76%), Gaps = 5/122 (4%)
 Frame = +2

Query  242  VNDCGVTGNPATNSMCQKCFNattaastsssvaast--vPIPHKFAEKSPRS--TFRRTS  409
             ++CG TGNPATN+MCQKCFNATTAA+++SS + +   V IP KFAEK  RS  + R + 
Sbjct  2    AHNCGFTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPQKFAEKLARSEKSARFSL  61

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
               +  DLKK+ D T K +++  ES P PAKREV+RCSGCRRKVGLTGFRCRCGELFCGE
Sbjct  62   LRSSSQDLKKVGDRTVKEEDQLKESLP-PAKREVSRCSGCRRKVGLTGFRCRCGELFCGE  120

Query  590  HR  595
            HR
Sbjct  121  HR  122



>ref|XP_009773992.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana sylvestris]
Length=158

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 80/122 (66%), Gaps = 17/122 (14%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT CV +CGV GNPATN+MCQ C       S S+S ++S V  PHKFA    RST     
Sbjct  20   ITLCVKNCGVIGNPATNNMCQNC-------SNSTSASSSKVAYPHKFANILTRST-----  67

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
                  DLK   D   K D+K  ES  +PAKREVNRCSGCRRKVGLTGFRCRCGELFCGE
Sbjct  68   ----SSDLKNYVDRAVKDDDKVKES-VSPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  122

Query  590  HR  595
            HR
Sbjct  123  HR  124



>ref|XP_008461273.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Cucumis melo]
Length=159

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 86/124 (69%), Gaps = 18/124 (15%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFA-EKSPRSTFRRT  406
            IT CVN+CG+TGNPATN+MCQKCFNATT  ++          +  KF+ EKSPRST  R+
Sbjct  18   ITLCVNNCGLTGNPATNNMCQKCFNATTTTAS----------MAMKFSGEKSPRSTISRS  67

Query  407  -SPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  583
                R V + +++  + D+   K  ES    AKREVNRCSGCR++VGLTGFRCRCG+LFC
Sbjct  68   PEKFRFVSESRRIITAADR--PKPDES----AKREVNRCSGCRKRVGLTGFRCRCGDLFC  121

Query  584  GEHR  595
             EHR
Sbjct  122  AEHR  125



>ref|XP_004135919.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 ref|XP_004158204.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 gb|KGN45146.1| hypothetical protein Csa_7G428830 [Cucumis sativus]
Length=159

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 85/127 (67%), Gaps = 24/127 (19%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFA-EKSPRSTFRRT  406
            IT CVN+CG+TGNP TN+MCQKCFNATTA ++          +  KF+ EKSPRST  R+
Sbjct  18   ITLCVNNCGLTGNPTTNNMCQKCFNATTATAS----------MAIKFSGEKSPRSTTSRS  67

Query  407  -SPGRTVPDLKKLEDSTDKIDEKTGESSPAP---AKREVNRCSGCRRKVGLTGFRCRCGE  574
                R V + +++  + D+         P P   AKREVNRCSGCR++VGLTGFRCRCG+
Sbjct  68   PEKFRFVSESRRIITAADR---------PKPDESAKREVNRCSGCRKRVGLTGFRCRCGD  118

Query  575  LFCGEHR  595
            LFC EHR
Sbjct  119  LFCAEHR  125



>ref|XP_008375146.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
Length=165

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 88/125 (70%), Gaps = 14/125 (11%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKF-AEKSPRST--FR  400
            +T CVN+CGVTGNP+TN+MCQKCFNA +AA+T+SS ++S   +  KF AEKSPRST  F 
Sbjct  18   LTHCVNNCGVTGNPSTNNMCQKCFNAASAAATTSSSSSSAAIL--KFSAEKSPRSTSSFS  75

Query  401  RTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  580
              +P   V   +K   S      +   S  +P +R VNRCSGCRRKVGLTGFRCRCGELF
Sbjct  76   FEAP---VETFRKTTAS------EIARSDESPNRRVVNRCSGCRRKVGLTGFRCRCGELF  126

Query  581  CGEHR  595
            C EHR
Sbjct  127  CSEHR  131



>ref|XP_009354712.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Pyrus x bretschneideri]
Length=165

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 83/124 (67%), Gaps = 12/124 (10%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRST--FRR  403
            +T CVN+CGVTGNP+TN+MCQKCFNA +AA+T+SS ++S   +    AEKSPRST  F  
Sbjct  18   LTHCVNNCGVTGNPSTNNMCQKCFNAASAAATTSSSSSSAAILKFS-AEKSPRSTSSFSF  76

Query  404  TSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  583
             +   T      LE            S  +P +R VNRCSGCRRKVGLTGFRCRCG+LFC
Sbjct  77   EAQAETFRKTTALE---------IARSDESPNRRVVNRCSGCRRKVGLTGFRCRCGDLFC  127

Query  584  GEHR  595
             EHR
Sbjct  128  SEHR  131



>ref|XP_003546877.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Glycine max]
Length=161

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 77/122 (63%), Gaps = 12/122 (10%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT CVN+CGVTGNPATN+MCQKCF A+TA ++ +  A    P         P+       
Sbjct  18   ITLCVNNCGVTGNPATNNMCQKCFTASTATTSGAGGAGIASPATRSGVSARPQK------  71

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
              R+ P+    E S       + +++P+ AKR VNRCSGCRRKVGLTGFRCRCGELFC E
Sbjct  72   --RSFPE----EPSPVADPPSSDQTTPSEAKRVVNRCSGCRRKVGLTGFRCRCGELFCAE  125

Query  590  HR  595
            HR
Sbjct  126  HR  127



>ref|XP_009365003.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X2 [Pyrus x bretschneideri]
Length=168

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 82/123 (67%), Gaps = 10/123 (8%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKF-AEKSPRSTFRRT  406
            +T CVN+CGVTGNP+TN+MCQKCFNA +AA+ ++S ++S   +  KF AEKSPRS+    
Sbjct  21   LTHCVNNCGVTGNPSTNNMCQKCFNAASAAAAATSSSSSAAIL--KFSAEKSPRSSSSFN  78

Query  407  SPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  586
                  P  K       + DE        P +R VNRCSGCRRKVGLTGFRCRCGELFC 
Sbjct  79   FEAAPPPCRKTTASEIARSDE-------TPNRRVVNRCSGCRRKVGLTGFRCRCGELFCS  131

Query  587  EHR  595
            EHR
Sbjct  132  EHR  134



>ref|XP_009365002.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X1 [Pyrus x bretschneideri]
Length=168

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 82/123 (67%), Gaps = 10/123 (8%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKF-AEKSPRSTFRRT  406
            +T CVN+CGVTGNP+TN+MCQKCFNA +AA+ +++ ++S   +  KF AEKSPRS+    
Sbjct  21   LTHCVNNCGVTGNPSTNNMCQKCFNAASAAAAAATSSSSAAIL--KFSAEKSPRSSSSFN  78

Query  407  SPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  586
                  P  K       + DE        P +R VNRCSGCRRKVGLTGFRCRCGELFC 
Sbjct  79   FEAAPPPCRKTTASEIARSDE-------TPNRRVVNRCSGCRRKVGLTGFRCRCGELFCS  131

Query  587  EHR  595
            EHR
Sbjct  132  EHR  134



>ref|XP_009365004.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X3 [Pyrus x bretschneideri]
Length=167

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 80/122 (66%), Gaps = 9/122 (7%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            +T CVN+CGVTGNP+TN+MCQKCFNA +AA+ ++S +++   I    AEKSPRS+     
Sbjct  21   LTHCVNNCGVTGNPSTNNMCQKCFNAASAAAAATSSSSAA--ILKFSAEKSPRSSSSFNF  78

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
                 P  K       + DE        P +R VNRCSGCRRKVGLTGFRCRCGELFC E
Sbjct  79   EAAPPPCRKTTASEIARSDE-------TPNRRVVNRCSGCRRKVGLTGFRCRCGELFCSE  131

Query  590  HR  595
            HR
Sbjct  132  HR  133



>ref|XP_011025412.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
 ref|XP_011007335.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
Length=179

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 83/135 (61%), Gaps = 20/135 (15%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNatt-------------aastsssvaastvPIPHKF  370
            +T C+N+CGVTGNPATN+MCQKCFNATT                 +++ + S   I    
Sbjct  18   LTSCINNCGVTGNPATNNMCQKCFNATTSTSNSSSSSTATSMTFAATATSVSNNEILKFT  77

Query  371  AEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  550
             EKS RS+  R+     V D +K   S +K  +K    +   AK+EVNRCSGCRR+VGLT
Sbjct  78   GEKSARSSISRS----LVKDPQK---SPEKASDKERSCASHVAKKEVNRCSGCRRRVGLT  130

Query  551  GFRCRCGELFCGEHR  595
            GFRCRCGELFC EHR
Sbjct  131  GFRCRCGELFCWEHR  145



>ref|XP_007218519.1| hypothetical protein PRUPE_ppa012532mg [Prunus persica]
 gb|EMJ19718.1| hypothetical protein PRUPE_ppa012532mg [Prunus persica]
Length=165

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 83/124 (67%), Gaps = 15/124 (12%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFA-EKSPRST-FRR  403
            +T CVN+CGVTGNP+TN+MCQKCFNA++A +T++S +     +  KF+ EKSPRS+ F  
Sbjct  21   LTHCVNNCGVTGNPSTNNMCQKCFNASSATTTATSSS----AVTLKFSGEKSPRSSSFSF  76

Query  404  TSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  583
             +P          E +      +   S  +  +R VNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  77   EAPA---------EITRRTTASEIARSDESANRRVVNRCSGCRRKVGLTGFRCRCGELFC  127

Query  584  GEHR  595
             EHR
Sbjct  128  SEHR  131



>ref|XP_008231311.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Prunus mume]
Length=165

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 83/124 (67%), Gaps = 15/124 (12%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFA-EKSPRST-FRR  403
            +T CVN+CGVTGNP+TN+MCQKCFNA++A +T++S +     +  KF+ EKSPRS+ F  
Sbjct  21   LTHCVNNCGVTGNPSTNNMCQKCFNASSATTTATSSS----AVTLKFSGEKSPRSSSFSF  76

Query  404  TSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  583
             +P          E +      +   S  +  +R VNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  77   EAPA---------EITRRTTASEIARSDESANRRVVNRCSGCRRKVGLTGFRCRCGELFC  127

Query  584  GEHR  595
             EHR
Sbjct  128  SEHR  131



>ref|XP_004306522.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Fragaria vesca subsp. vesca]
Length=170

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 82/127 (65%), Gaps = 13/127 (10%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKF---AEKSPRST-F  397
            +T CVN+CGVTGNPATN+MCQKCFNATT+  T+ + A ++      F    EK PRS+ F
Sbjct  18   LTHCVNNCGVTGNPATNNMCQKCFNATTSTPTTVATATTSSTTAAVFKFSGEKVPRSSSF  77

Query  398  RRTSP-GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGE  574
            R  +P   T+       +ST         S  +  +R VNRCSGCRRKVGLTGFRCRCGE
Sbjct  78   RFDAPPSETIRKAAASAEST--------RSEESSMRRVVNRCSGCRRKVGLTGFRCRCGE  129

Query  575  LFCGEHR  595
            LFC EHR
Sbjct  130  LFCSEHR  136



>emb|CDP07749.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 93/137 (68%), Gaps = 15/137 (11%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPH---------KFAEKS  382
            ITPCVN+CGVTGNPATN+MCQKCFNAT++ASTSSS ++S+              KF EKS
Sbjct  19   ITPCVNNCGVTGNPATNNMCQKCFNATSSASTSSSSSSSSSTSSSVTSSVAGAIKFGEKS  78

Query  383  PRSTFRRTSPGRTVPDLKKL-EDSTDKIDEKTG-----ESSPAPAKREVNRCSGCRRKVG  544
            PRS+  +        DL ++  D  +++ E +       ++ A  KREVNRCSGCRRKVG
Sbjct  79   PRSSSSKRLSPERTTDLAEIRRDLKEEVKEASSAHATAPATAAAVKREVNRCSGCRRKVG  138

Query  545  LTGFRCRCGELFCGEHR  595
            LTGFRCRCGELFC EHR
Sbjct  139  LTGFRCRCGELFCAEHR  155



>ref|XP_008349960.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
 ref|XP_008349986.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
Length=169

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 80/122 (66%), Gaps = 7/122 (6%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            +T CVN+CGVTGNP+TN+MCQKC NA +AA+ +++ ++S+  I    AEKSPRS+   + 
Sbjct  21   LTHCVNNCGVTGNPSTNNMCQKCXNAASAAAAAATSSSSSAAILKFSAEKSPRSSSSFSF  80

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
                    K       + DE        P +R VNRCSGCRRKVGLTGFRCRCGELFC E
Sbjct  81   EAAAETCRKTTASEIARSDE-------TPNRRVVNRCSGCRRKVGLTGFRCRCGELFCSE  133

Query  590  HR  595
            HR
Sbjct  134  HR  135



>ref|XP_002298442.1| zinc finger family protein [Populus trichocarpa]
 gb|ABK94884.1| unknown [Populus trichocarpa]
 gb|EEE83247.1| zinc finger family protein [Populus trichocarpa]
Length=181

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 83/137 (61%), Gaps = 22/137 (16%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssva---------------astvPIPH  364
            +T C+N+CGVTGNPATN+MCQKCFNA+T+ S  SS                  ST  I  
Sbjct  18   LTLCINNCGVTGNPATNNMCQKCFNASTSTSNPSSSTTTTTTTITFAATTNGVSTNEILK  77

Query  365  KFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVG  544
              +EKS RS+  R SP +      K     ++ D      S + AK+EVNRCSGCRR+VG
Sbjct  78   FTSEKSLRSSISR-SPAKDHQRQPKTASDKERSD------SSSVAKKEVNRCSGCRRRVG  130

Query  545  LTGFRCRCGELFCGEHR  595
            LTGFRCRCGELFC EHR
Sbjct  131  LTGFRCRCGELFCWEHR  147



>ref|XP_010557789.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=175

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 83/129 (64%), Gaps = 12/129 (9%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHK-------FAEKSPR  388
            +T CVN+CGVTGNPATN+MCQKCFNATTA++ SS  +A+     +         A+K  R
Sbjct  18   LTLCVNNCGVTGNPATNNMCQKCFNATTASAVSSPPSAAAANNNNNSVKDGGLIAKKPAR  77

Query  389  STFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRC  568
             +  R+S  R+     K+  S ++     G  +    K+ VNRCSGCRRKVGLTGFRCRC
Sbjct  78   CSALRSSSDRSGLSAAKVIISRNR-----GNDAVEEEKKIVNRCSGCRRKVGLTGFRCRC  132

Query  569  GELFCGEHR  595
            GELFC EHR
Sbjct  133  GELFCAEHR  141



>ref|XP_002314027.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE87982.1| zinc finger family protein [Populus trichocarpa]
Length=179

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 81/135 (60%), Gaps = 20/135 (15%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNatt-------------aastsssvaastvPIPHKF  370
            +T C+N+CGVTGNPATN+MCQKCFNA+T                 +++ + S   I    
Sbjct  18   LTSCINNCGVTGNPATNNMCQKCFNASTSTSNSSSSSTATSMTFAATATSVSNNEILKFT  77

Query  371  AEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  550
             EKS RS+  R+        +K  + S +   +K    +   AK+EVNRCSGCRR+VGLT
Sbjct  78   GEKSARSSISRSL-------VKDPQKSPETASDKERSCAYHVAKKEVNRCSGCRRRVGLT  130

Query  551  GFRCRCGELFCGEHR  595
            GFRCRCGELFC EHR
Sbjct  131  GFRCRCGELFCWEHR  145



>ref|XP_010106958.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Morus notabilis]
 gb|EXC12840.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Morus notabilis]
Length=172

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT CVN+CGV GNPATN+MCQ CFNATT  + +S+   + +    + +  S  S+  R +
Sbjct  18   ITLCVNNCGVIGNPATNNMCQNCFNATTTTAAASTSTTANLKFSGEKSSSSAISSSSRPT  77

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
              R+    +    +T     ++ E    PAKR VNRCSGCRRKVGLTGFRCRCGELFC E
Sbjct  78   DRRSASPAENSRKTTAD-SARSEEDEAVPAKRVVNRCSGCRRKVGLTGFRCRCGELFCAE  136

Query  590  HR  595
            HR
Sbjct  137  HR  138



>gb|EYU27075.1| hypothetical protein MIMGU_mgv1a014771mg [Erythranthe guttata]
Length=178

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 80/133 (60%), Gaps = 19/133 (14%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaa----stvPIPHKFAEKSPRSTF  397
            I+ CV  CGV GN ATN++C  CFN+T  A+ +++ AA          H F EKS RS+ 
Sbjct  20   ISLCVK-CGVAGNCATNNLCHTCFNSTAPAAAAAAAAAAGGDKLPAASHVFVEKSFRSSS  78

Query  398  -------RRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGF  556
                   +R  P  T  DL+KL+DS           +  P KREVNRCSGCRRKVGLTGF
Sbjct  79   SVRLLPEKRIIPAETSRDLRKLDDSP-------AAEAALPLKREVNRCSGCRRKVGLTGF  131

Query  557  RCRCGELFCGEHR  595
            RCRCG+LFC +HR
Sbjct  132  RCRCGDLFCADHR  144



>ref|XP_010257261.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nelumbo nucifera]
Length=163

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 76/127 (60%), Gaps = 19/127 (15%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKS-PRSTFRRT  406
            +T C+N+CG  GNP TN+MCQ CF A+                P KF+ K  PRS+  R 
Sbjct  17   LTLCINNCGFPGNPTTNNMCQNCFKASAGVL-----------TPLKFSGKDKPRSSSVR-  64

Query  407  SPGRT----VPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGE  574
            SP R+     P++  L + T +      E + +  +REVNRCSGCRRKVGLTGFRCRCG+
Sbjct  65   SPERSDRPAEPEI--LREVTKRDTTAAAEVTSSVVRREVNRCSGCRRKVGLTGFRCRCGD  122

Query  575  LFCGEHR  595
            LFC EHR
Sbjct  123  LFCSEHR  129



>ref|XP_010547246.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=179

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 84/137 (61%), Gaps = 24/137 (18%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaast---------------vPIPH  364
            +T CVN+CGVTGNPATN+MCQKCFNATTA+S+SSSV++                  PI  
Sbjct  18   LTLCVNNCGVTGNPATNNMCQKCFNATTASSSSSSVSSIAGANNVVKEGGVGVGGGPISK  77

Query  365  KFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVG  544
            K A  S     R  S  R+  DL  ++     I  +  ES     ++ VNRCSGCRRKVG
Sbjct  78   KTARSSA---LRSLSKDRS--DLSPVK----VIIGRNRESDVTEVEKIVNRCSGCRRKVG  128

Query  545  LTGFRCRCGELFCGEHR  595
            LTGFRCRCGELFC EHR
Sbjct  129  LTGFRCRCGELFCAEHR  145



>gb|KDP43451.1| hypothetical protein JCGZ_16738 [Jatropha curcas]
Length=185

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 84/142 (59%), Gaps = 28/142 (20%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaast--------------------  349
            +T CVN+CG TGNPATN+MCQKCFNATT+ S S++V A+                     
Sbjct  18   LTLCVNNCGFTGNPATNNMCQKCFNATTSTSNSATVTAAVPANTTSTTTTTSSAAVVSSG  77

Query  350  vPIPHKFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGC  529
              I  K    S   +  R  P R     +K++ STD+      +S  A A+REVNRCSGC
Sbjct  78   SEILRKSPRSSLSRSPIR-DPLRQTN--QKVQTSTDR-----EKSDAAVARREVNRCSGC  129

Query  530  RRKVGLTGFRCRCGELFCGEHR  595
            RRKVGLTGFRCRCGELFC EHR
Sbjct  130  RRKVGLTGFRCRCGELFCWEHR  151



>ref|XP_003633555.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Vitis vinifera]
Length=172

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 72/122 (59%), Gaps = 1/122 (1%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            +  CVN+CG TGNPATN+MCQKCF+A+ +A+ +++  A              RS+  R S
Sbjct  18   LALCVNNCGFTGNPATNNMCQKCFSASASAAAAAAAGALKSSHKVSGGAADARSSSAR-S  76

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
            P R     +   D T               KREVNRCSGCRRKVGLTGFRCRCG+LFC E
Sbjct  77   PERMDSLAETSLDRTKDAASAAAVEEVGKVKREVNRCSGCRRKVGLTGFRCRCGDLFCAE  136

Query  590  HR  595
            HR
Sbjct  137  HR  138



>ref|XP_006482901.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Citrus sinensis]
 gb|KDO36542.1| hypothetical protein CISIN_1g030404mg [Citrus sinensis]
Length=178

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 79/132 (60%), Gaps = 15/132 (11%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaast---------vPIPHKFAEKS  382
            +T CVN+CG TGNPATN+MCQKCFNAT   + S+   +ST         V I    +EKS
Sbjct  18   LTLCVNNCGFTGNPATNNMCQKCFNATATTTASAVAGSSTGGGGGGGSGVAIIKFSSEKS  77

Query  383  PRST-FRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFR  559
             RS    R+          + ++ TD+      E      KR VNRCSGCRRKVGLTGFR
Sbjct  78   LRSRPIIRSGSSDAAGTTGQNQELTDR-----REKEANVEKRVVNRCSGCRRKVGLTGFR  132

Query  560  CRCGELFCGEHR  595
            CRCGELFCGEHR
Sbjct  133  CRCGELFCGEHR  144



>gb|KHN29214.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Glycine soja]
Length=136

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 68/122 (56%), Gaps = 37/122 (30%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT CVN+CGVTGNPATN+MCQKCF A+TA ++ +  A    P                T 
Sbjct  18   ITLCVNNCGVTGNPATNNMCQKCFTASTATTSGAGGAGIASPA---------------TR  62

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
             G T                      P+ AKR VNRCSGCRRKVGLTGFRCRCGELFC E
Sbjct  63   SGTT----------------------PSEAKRVVNRCSGCRRKVGLTGFRCRCGELFCAE  100

Query  590  HR  595
            HR
Sbjct  101  HR  102



>ref|XP_006438985.1| hypothetical protein CICLE_v10032882mg [Citrus clementina]
 gb|ESR52225.1| hypothetical protein CICLE_v10032882mg [Citrus clementina]
Length=179

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 79/133 (59%), Gaps = 16/133 (12%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaast----------vPIPHKFAEK  379
            +T CVN+CG TGNPATN+MCQKCFNAT   + S+   +ST          V I    +EK
Sbjct  18   LTLCVNNCGFTGNPATNNMCQKCFNATATTTASAVAGSSTSGGGGGGGSGVAIIKFSSEK  77

Query  380  SPRST-FRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGF  556
            S RS    R+          + ++ TD+      E      KR VNRCSGCRRKVGLTGF
Sbjct  78   SLRSRPIIRSGSSDAAGTTGQNQELTDR-----REKEANVEKRVVNRCSGCRRKVGLTGF  132

Query  557  RCRCGELFCGEHR  595
            RCRCGELFCGEHR
Sbjct  133  RCRCGELFCGEHR  145



>ref|XP_006298707.1| hypothetical protein CARUB_v10014801mg [Capsella rubella]
 gb|EOA31605.1| hypothetical protein CARUB_v10014801mg [Capsella rubella]
Length=163

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 74/117 (63%), Gaps = 17/117 (15%)
 Frame = +2

Query  245  NDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRTV  424
            N+CGVT NPATN+MCQKCFNA+  ++ +S V   T  I     ++S RS   R+SP + V
Sbjct  30   NNCGVTANPATNNMCQKCFNASLVSAATSGVVVDTGSI----LKRSARSVNLRSSPAKVV  85

Query  425  PDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
              ++  E    K D++            VNRCSGCR+KVGLTGFRCRCGELFC EHR
Sbjct  86   --IRPREMDAVKRDQQV-----------VNRCSGCRKKVGLTGFRCRCGELFCSEHR  129



>ref|XP_011087429.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Sesamum indicum]
Length=170

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 78/125 (62%), Gaps = 10/125 (8%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHK---FAEKSPRSTFR  400
            I+ CVN CGV GN A N++CQKCFN TTA++ +S+ A S     H    F EKS RS   
Sbjct  19   ISLCVN-CGVAGNSAANNLCQKCFNTTTASTAASAAATSPGGAKHVNNVFVEKSFRSI--  75

Query  401  RTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  580
              SP R         D++  +  +  E    P KR+VNRCSGCRRKVGLTGFRCRCGELF
Sbjct  76   TCSPERKFDSA----DTSGDLKIEAAEVEAPPVKRQVNRCSGCRRKVGLTGFRCRCGELF  131

Query  581  CGEHR  595
            C +HR
Sbjct  132  CADHR  136



>ref|XP_006407313.1| hypothetical protein EUTSA_v10021683mg [Eutrema salsugineum]
 gb|ESQ48766.1| hypothetical protein EUTSA_v10021683mg [Eutrema salsugineum]
Length=158

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 74/119 (62%), Gaps = 22/119 (18%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CGVT NPATN+MCQKCFNA+ AA+   S +           ++S RS   R++P +
Sbjct  28   CSNNCGVTANPATNNMCQKCFNASVAAAGVESGS---------MLKRSARSVNLRSTPAK  78

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V  ++  E    K D++T           VNRCSGCR+KVGLTGFRCRCG+LFC EHR
Sbjct  79   VV--IRSREIDPVKRDQQT-----------VNRCSGCRKKVGLTGFRCRCGDLFCAEHR  124



>ref|XP_010067883.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Eucalyptus grandis]
 gb|KCW66121.1| hypothetical protein EUGRSUZ_G03392 [Eucalyptus grandis]
Length=190

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 83/145 (57%), Gaps = 29/145 (20%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssva------------------astvP  355
            +T CVN+CG  GNPATN+MCQKCFNA++++S+SS+                     +  P
Sbjct  18   LTLCVNNCGFAGNPATNNMCQKCFNASSSSSSSSTTTSTTASTASSAPTTSSSAGLTGGP  77

Query  356  IPHKFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAP-----AKREVNRC  520
               KF+ +       R+ P    PD   L  +   I   TG S P+      A+REVNRC
Sbjct  78   SVLKFSAER----IHRSGPFSRSPDRSGL--AMGMIRRDTGASPPSSTESNSARREVNRC  131

Query  521  SGCRRKVGLTGFRCRCGELFCGEHR  595
            SGCR++VGLTGFRCRCGELFC EHR
Sbjct  132  SGCRKRVGLTGFRCRCGELFCAEHR  156



>emb|CDY52666.1| BnaC01g38560D [Brassica napus]
Length=155

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 74/119 (62%), Gaps = 22/119 (18%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CGVT NPATN+MCQKCFNA+ AA+   S +           ++S RS   R++P +
Sbjct  25   CSNNCGVTANPATNNMCQKCFNASVAAAGVDSTS---------ILKRSARSVNLRSTPAK  75

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V  ++  E    K D++T           +NRCSGCR+KVGLTGFRCRCG+LFC EHR
Sbjct  76   VV--IRPREIDPVKRDQQT-----------INRCSGCRKKVGLTGFRCRCGDLFCAEHR  121



>ref|XP_009120462.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Brassica rapa]
 emb|CDY50536.1| BnaA01g30440D [Brassica napus]
Length=156

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 74/119 (62%), Gaps = 22/119 (18%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CGVT NPATN+MCQKCFNA+ AA+   S +           ++S RS   R++P +
Sbjct  26   CSNNCGVTANPATNNMCQKCFNASVAAAGVDSTS---------ILKRSARSVNLRSTPAK  76

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V  ++  E    K D++T           +NRCSGCR+KVGLTGFRCRCG+LFC EHR
Sbjct  77   VV--IRPREIDPVKRDQQT-----------INRCSGCRKKVGLTGFRCRCGDLFCAEHR  122



>ref|XP_004499868.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cicer arietinum]
Length=165

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 82/125 (66%), Gaps = 14/125 (11%)
 Frame = +2

Query  230  ITPCVNDCGVT--GNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRR  403
            IT C+N+CGVT  GN ATN+MCQ CF A+TA ++S+   +S        +  S RS    
Sbjct  18   ITVCINNCGVTVTGNAATNNMCQNCFTASTATTSSTVGISSQSSRSGVISVNSVRS----  73

Query  404  TSPGRTVPDLKKLEDSTDKIDEKTG-ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  580
              P R++P     E+S++  D  +  +++ + AKR V+RCSGCRRKVGLTGFRCRCG+LF
Sbjct  74   --PKRSLP-----EESSEITDRNSSDQTTISEAKRVVSRCSGCRRKVGLTGFRCRCGDLF  126

Query  581  CGEHR  595
            C EHR
Sbjct  127  CSEHR  131



>ref|XP_010279007.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nelumbo nucifera]
Length=164

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 72/125 (58%), Gaps = 14/125 (11%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKS-PRSTFRRT  406
            +T C+N+CG  GNP TN+MCQ CF A+                P KF+ K  PRS+  R+
Sbjct  17   LTLCINNCGFPGNPTTNNMCQNCFKASAGVL-----------TPLKFSGKDKPRSSSVRS  65

Query  407  SPGRTVPDLKKLEDSTDKID--EKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  580
                  P   ++     K D    +  +S A  KREVNRCSGCRRKVGLTGFRCRCGELF
Sbjct  66   PERSDRPAETRIFKEVTKRDTTAASEAASAAVVKREVNRCSGCRRKVGLTGFRCRCGELF  125

Query  581  CGEHR  595
            C EHR
Sbjct  126  CSEHR  130



>ref|XP_008461789.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis melo]
Length=169

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 82/125 (66%), Gaps = 10/125 (8%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHK---FAEKSPRSTFR  400
            IT CVN+CG TGNP TN+MCQKCFNATTA +T+++ ++S   I        EKS RS  R
Sbjct  18   ITLCVNNCGFTGNPTTNNMCQKCFNATTATATTTATSSSNTGISSSRKLSGEKSLRS--R  75

Query  401  RTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  580
              SP   + D  +       +D    E S   AKR+VNRCSGCR++VGLTGFRCRCGELF
Sbjct  76   SRSP--VLMDSVRDNSRNMSMDRFKSEES---AKRQVNRCSGCRKRVGLTGFRCRCGELF  130

Query  581  CGEHR  595
            C EHR
Sbjct  131  CAEHR  135



>ref|NP_001240258.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
5-like [Glycine max]
 gb|ADK25058.1| AN1-like transcription factor [Glycine max]
Length=164

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 76/122 (62%), Gaps = 9/122 (7%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT CVN+CGVTGNPATN+MCQKCF A T ++ ++S A          A  + RS      
Sbjct  18   ITLCVNNCGVTGNPATNNMCQKCFTAFTTSTATTSGAGG-----AGIASPATRSGI----  68

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
              R +      E S       + +++P+ AKR VNRCSGCRRKVGLTGFRCRCGELFC E
Sbjct  69   SARPLKRSFPEEPSPPADPPSSDQTTPSEAKRVVNRCSGCRRKVGLTGFRCRCGELFCAE  128

Query  590  HR  595
            HR
Sbjct  129  HR  130



>gb|KFK38611.1| hypothetical protein AALP_AA3G136800 [Arabis alpina]
Length=160

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 75/117 (64%), Gaps = 21/117 (18%)
 Frame = +2

Query  245  NDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRTV  424
            N+CGVT NPATN+MCQKCFNA+ A +++ S +           ++S RS   R+S  + V
Sbjct  31   NNCGVTANPATNNMCQKCFNASIAVASADSGS---------ILKRSARSVNLRSSQTKVV  81

Query  425  PDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
               +++ DS+ K D++            VNRCSGCR+KVGLTGFRCRCG+LFC EHR
Sbjct  82   IRNREI-DSSVKRDQQI-----------VNRCSGCRKKVGLTGFRCRCGDLFCSEHR  126



>ref|XP_010534277.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=189

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 81/145 (56%), Gaps = 30/145 (21%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaas-----------------------tsssva  340
            +T CVN+CGVTGNPA N+MCQKCFNATTA S                             
Sbjct  18   LTLCVNNCGVTGNPANNNMCQKCFNATTATSSSSSAAASASASSLPSAAATSASNGVKDG  77

Query  341  astvPIPHKFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRC  520
            A  + +    ++KS RS+  R+S  R+ P L K+    ++      ES     K+ VNRC
Sbjct  78   AFGLGVGGPISKKSLRSSAIRSSD-RSGPYLAKVTIIRNR------ESDGTEEKKIVNRC  130

Query  521  SGCRRKVGLTGFRCRCGELFCGEHR  595
            SGCRRKVGLTGFRCRCGELFC EHR
Sbjct  131  SGCRRKVGLTGFRCRCGELFCAEHR  155



>ref|XP_007149048.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris]
 gb|ESW21042.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris]
Length=301

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 81/122 (66%), Gaps = 9/122 (7%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT CVN+CGVTGNPATN+MCQ CF A TA++ ++S AAS        +  S RS      
Sbjct  155  ITLCVNNCGVTGNPATNNMCQNCFTAFTASTATTSSAASA-----GISSPSARSVASARP  209

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
              R+ P+    E S+      + +++P+ AKR VNRCSGCRRKVGLTGFRCRCG+LFC E
Sbjct  210  QKRSFPE----EPSSAADPPSSDQNAPSEAKRVVNRCSGCRRKVGLTGFRCRCGDLFCAE  265

Query  590  HR  595
            HR
Sbjct  266  HR  267



>ref|XP_007052561.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5, putative [Theobroma cacao]
 gb|EOX96718.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5, putative [Theobroma cacao]
Length=192

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 85/141 (60%), Gaps = 19/141 (13%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPI--------------PHK  367
            +T C+N+CGVTGNPATN+MCQKCFNATTA  +SSS ++S+                 P  
Sbjct  18   LTLCINNCGVTGNPATNNMCQKCFNATTATPSSSSSSSSSATSPSATGGAIAGGASIPKF  77

Query  368  FAEKSPRSTFRRTSPGRTVPD----LKKLEDSTDKIDEKTGESSPAPA-KREVNRCSGCR  532
              ++S RST  R+   R+          + +S      ++G    A A K+ VNRCSGCR
Sbjct  78   SDDQSSRSTPSRSQQNRSDSSPPTTAATVTNSRTTAWNRSGNDPAAAAEKKVVNRCSGCR  137

Query  533  RKVGLTGFRCRCGELFCGEHR  595
            ++VGLTGFRCRCGELFC EHR
Sbjct  138  KRVGLTGFRCRCGELFCAEHR  158



>ref|NP_566429.1| E3 ligase SAP5 [Arabidopsis thaliana]
 sp|Q9LHJ8.1|SAP5_ARATH RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 5; Short=AtSAP5 [Arabidopsis thaliana]
 gb|AAG51008.1|AC069474_7 unknown protein; 15087-14605 [Arabidopsis thaliana]
 dbj|BAB02254.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM61324.1| unknown [Arabidopsis thaliana]
 gb|AAP88348.1| At3g12630 [Arabidopsis thaliana]
 dbj|BAF00270.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75226.1| E3 ligase SAP5 [Arabidopsis thaliana]
Length=160

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 72/114 (63%), Gaps = 18/114 (16%)
 Frame = +2

Query  254  GVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRTVPDL  433
            GVT NPATN+MCQKCFNA+  ++ +  V + +        ++S RS   R+SP + V   
Sbjct  31   GVTANPATNNMCQKCFNASLVSAAAGVVESGS------ILKRSARSVNLRSSPAKVVIRP  84

Query  434  KKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            +++ D+  K D++            VNRCSGCR+KVGLTGFRCRCGELFC EHR
Sbjct  85   REI-DAVKKRDQQI-----------VNRCSGCRKKVGLTGFRCRCGELFCSEHR  126



>ref|XP_009146604.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Brassica rapa]
Length=159

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 74/119 (62%), Gaps = 22/119 (18%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CGVT NPATN+MCQKCFNA+ AA+   S +          ++++ RS   R SP +
Sbjct  29   CSNNCGVTANPATNNMCQKCFNASIAAAGVDSGST---------SKRASRSVNLRPSPAK  79

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V  ++  E    K D++T           VNRCSGCR+KVGLTGFRCRCG+LFC EHR
Sbjct  80   VV--IRPREIDPVKRDQQT-----------VNRCSGCRKKVGLTGFRCRCGDLFCSEHR  125



>emb|CDY08419.1| BnaA05g26550D [Brassica napus]
Length=159

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 74/119 (62%), Gaps = 22/119 (18%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CGVT NPATN+MCQKCFNA+ AA+   S +          ++++ RS   R SP +
Sbjct  29   CSNNCGVTANPATNNMCQKCFNASIAAAGVDSGST---------SKRASRSVNLRPSPAK  79

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V  ++  E    K D++T           VNRCSGCR+KVGLTGFRCRCG+LFC EHR
Sbjct  80   VV--IRPREIDPVKRDQQT-----------VNRCSGCRKKVGLTGFRCRCGDLFCSEHR  125



>emb|CDX73811.1| BnaA03g32360D [Brassica napus]
Length=159

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 70/119 (59%), Gaps = 22/119 (18%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CGVT +P+TN+MCQKCFNA+ +              P    ++S RS   R++P R
Sbjct  28   CSNNCGVTASPSTNNMCQKCFNASVSGID-----------PTPIVKRSARSVSLRSTPAR  76

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V  ++  E    K D           ++ VNRCSGCR+KVGLTGFRCRCG+LFC EHR
Sbjct  77   AV--IRPRETDPVKRDHH---------QQTVNRCSGCRKKVGLTGFRCRCGDLFCSEHR  124



>ref|XP_009135242.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Brassica rapa]
Length=159

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 70/119 (59%), Gaps = 22/119 (18%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CGVT +P+TN+MCQKCFNA+ +              P    ++S RS   R++P R
Sbjct  28   CSNNCGVTASPSTNNMCQKCFNASVSGID-----------PTPIVKRSARSVSLRSTPAR  76

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V  ++  E    K D           ++ +NRCSGCR+KVGLTGFRCRCG+LFC EHR
Sbjct  77   AV--IRPRETDPVKRDHH---------QQTINRCSGCRKKVGLTGFRCRCGDLFCAEHR  124



>ref|XP_010489793.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=152

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 75/117 (64%), Gaps = 17/117 (15%)
 Frame = +2

Query  245  NDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRTV  424
            N+CGVT NPATN+MCQKCFNA+  ++T+S V  S   +     ++S RS   R+SP + V
Sbjct  34   NNCGVTANPATNNMCQKCFNASLVSATASVVVDSGSSV----LKRSARSVNLRSSPAKVV  89

Query  425  PDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
              ++  E    K D++            VNRCSGCR+KVGLTGFRCRCG+LFC EHR
Sbjct  90   --IRPREIDAVKRDQQI-----------VNRCSGCRKKVGLTGFRCRCGDLFCSEHR  133



>ref|XP_011025067.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
Length=249

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 77/134 (57%), Gaps = 12/134 (9%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEK-------SPR  388
            +T C+N+CGVTGNPATN+MCQKCFNA+T+ S  SS  ++T                 S  
Sbjct  82   LTLCINNCGVTGNPATNNMCQKCFNASTSTSNPSSTTSNTTAATTTTITFAATTNGVSTN  141

Query  389  STFRRTSP-----GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTG  553
               + TS        +    K  +       +K    S + AK+EVNRCSGCRR+VGLTG
Sbjct  142  EILKFTSEKSLRSSISRSLAKDHQKQPKTASDKERSDSSSVAKKEVNRCSGCRRRVGLTG  201

Query  554  FRCRCGELFCGEHR  595
            FRCRCGELFC EHR
Sbjct  202  FRCRCGELFCWEHR  215



>gb|KJB25036.1| hypothetical protein B456_004G173900 [Gossypium raimondii]
Length=180

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 82/132 (62%), Gaps = 13/132 (10%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            +T CVN+CGVTGNPATN+MCQKCF+ATTAA++SSS + +         +KS RST  R+ 
Sbjct  18   LTLCVNNCGVTGNPATNNMCQKCFSATTAATSSSSSSTNNTATSAT-DDKSSRSTPTRSQ  76

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPA----------KREVNRCSGCRRKVGLTGFR  559
              R+  D      +          +SP  A          K+ VNRCSGCR++VGLTGFR
Sbjct  77   DNRS--DSAPPTTAATTATATATTNSPMTASNRSGYDTAEKKSVNRCSGCRKRVGLTGFR  134

Query  560  CRCGELFCGEHR  595
            CRCGELFC +HR
Sbjct  135  CRCGELFCSDHR  146



>ref|XP_011093526.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Sesamum indicum]
Length=177

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 76/127 (60%), Gaps = 7/127 (6%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastv-----PIPHKFAEKSPRST  394
            IT CV  CGV GN ATN++CQ C++   AASTS+    +       P  H F  KS RS+
Sbjct  19   ITLCVK-CGVAGNSATNNLCQTCYSTPAAASTSAVGTPAASAGGPKPKNHVFVGKSFRSS  77

Query  395  FRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGE  574
                S      ++ +      K   +T + +P P KREVNRCSGCRRKVGLTGFRCRCGE
Sbjct  78   SSTRSSLERSLNMSETSGDLKKEASETADVAP-PVKREVNRCSGCRRKVGLTGFRCRCGE  136

Query  575  LFCGEHR  595
            LFC +HR
Sbjct  137  LFCADHR  143



>emb|CDY67538.1| BnaUnng02260D [Brassica napus]
Length=159

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 73/119 (61%), Gaps = 22/119 (18%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CGVT NPATN+MCQKCFNA+ AA+   S +           +++ RS   R +P +
Sbjct  29   CSNNCGVTANPATNNMCQKCFNASIAAAGVDSGSTL---------KRASRSVNLRPTPAK  79

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V  ++  E    K D++T           VNRCSGCR+KVGLTGFRCRCG+LFC EHR
Sbjct  80   VV--IRPREIDPVKRDQQT-----------VNRCSGCRKKVGLTGFRCRCGDLFCSEHR  125



>gb|KJB22229.1| hypothetical protein B456_004G036200 [Gossypium raimondii]
Length=173

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 80/124 (65%), Gaps = 4/124 (3%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAE-KSPRSTFRRT  406
            +T CVNDCGV GNPATN+MCQ CFNATT  ST++ V++ST           + RST  R+
Sbjct  18   LTLCVNDCGVIGNPATNNMCQNCFNATTPKSTAAVVSSSTGGASSGGVSILNQRSTTSRS  77

Query  407  SPGRTVPDLKKLEDST-DKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  583
               R+  DL   + +T  +      +  P   K+ VNRCSGCR++VGLTGFRCRCGELFC
Sbjct  78   INKRS--DLSPPKTTTFVRSSGSRYDPEPGTEKKVVNRCSGCRKRVGLTGFRCRCGELFC  135

Query  584  GEHR  595
             +HR
Sbjct  136  ADHR  139



>emb|CDY00788.1| BnaC03g37720D [Brassica napus]
Length=155

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 69/119 (58%), Gaps = 25/119 (21%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CGVT +P+TN+MCQKCFNA               P P   A++S RS   R++P +
Sbjct  27   CSNNCGVTASPSTNNMCQKCFNAGID------------PTP--IAKRSARSVSLRSTPAK  72

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
                ++  E    K D           ++ VNRCSGCR+KVGLTGFRCRCG+LFC EHR
Sbjct  73   AA--IRPRETDPVKRDHH---------QQTVNRCSGCRKKVGLTGFRCRCGDLFCAEHR  120



>ref|XP_002882783.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59042.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. 
lyrata]
Length=160

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 19/114 (17%)
 Frame = +2

Query  254  GVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRTVPDL  433
            GVT NPATN+MCQKCFNA+  ++ +  V + +        ++S RS   R+SP + V  +
Sbjct  32   GVTANPATNNMCQKCFNASLVSAAAGVVESGS------ILKRSARSVNLRSSPAKVV--I  83

Query  434  KKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            +  E    K D++            VNRCSGCR+KVGLTGFRCRCGELFC EHR
Sbjct  84   RTREIDAVKRDQQI-----------VNRCSGCRKKVGLTGFRCRCGELFCSEHR  126



>ref|XP_010499267.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Camelina sativa]
Length=166

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 72/117 (62%), Gaps = 18/117 (15%)
 Frame = +2

Query  245  NDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRTV  424
            N+CGVT NPATN+MCQKCFNA+  ++    V + +  +     ++  RS   R+SP + V
Sbjct  34   NNCGVTANPATNNMCQKCFNASLVSTGVVVVDSGSSVL-----KRPARSVNLRSSPAKVV  88

Query  425  PDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
              ++  E    K D++            VNRCSGCR+KVGLTGFRCRCG+LFC EHR
Sbjct  89   --IRPREIDAVKRDQQI-----------VNRCSGCRKKVGLTGFRCRCGDLFCSEHR  132



>ref|XP_009391817.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Musa acuminata subsp. malaccensis]
Length=155

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 74/127 (58%), Gaps = 27/127 (21%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            +T CVN+CG  GNPATN+MCQ CF A+T A++         P PH     SPRS     S
Sbjct  17   LTLCVNNCGFPGNPATNNMCQSCFQASTIAAS---------PAPHSC---SPRSALPIRS  64

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAK-----REVNRCSGCRRKVGLTGFRCRCGE  574
            P          E + ++ D +T E+  A        R+V+RC  CR++VGLTGFRCRCG+
Sbjct  65   P----------ERAAEERDARTSEAPAAAVSAPAPARQVSRCFSCRKRVGLTGFRCRCGD  114

Query  575  LFCGEHR  595
            LFCGEHR
Sbjct  115  LFCGEHR  121



>ref|XP_004149600.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 ref|XP_004173024.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 gb|KGN58601.1| hypothetical protein Csa_3G697940 [Cucumis sativus]
Length=169

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 81/123 (66%), Gaps = 6/123 (5%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT CVN+CG TGNP TN+MCQKCFNATTA +T+++ ++S   I    +     S  + + 
Sbjct  18   ITLCVNNCGFTGNPTTNNMCQKCFNATTATATTTATSSSNTGI----SSSRKLSGEKSSR  73

Query  410  PGRTVPDL-KKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  586
                 P L   + DS+  I     +S  + AKR+VNRCSGCR++VGLTGFRCRCGELFC 
Sbjct  74   SRSRSPVLMDSVRDSSRNISMDRFKSEES-AKRQVNRCSGCRKRVGLTGFRCRCGELFCA  132

Query  587  EHR  595
            EHR
Sbjct  133  EHR  135



>gb|AIJ00004.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
1 [Gossypium hirsutum]
Length=180

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 84/131 (64%), Gaps = 11/131 (8%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAE-KSPRSTFRRT  406
            +T CVN+CGVTGNPATN+MCQKCF+ATTAA++SSS ++ST        + KS RST  R+
Sbjct  18   LTLCVNNCGVTGNPATNNMCQKCFSATTAATSSSSSSSSTNNTATSATDDKSSRSTPTRS  77

Query  407  SPGRT--------VPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRC  562
               R+                +S      ++G  +    K+ VNRCSGCR++VGLTGFRC
Sbjct  78   QDNRSDSAPPTTAATTATATTNSPMTASNRSGYDTAE--KKSVNRCSGCRKRVGLTGFRC  135

Query  563  RCGELFCGEHR  595
            RCGELFC +HR
Sbjct  136  RCGELFCSDHR  146



>ref|XP_010465038.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=213

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 74/121 (61%), Gaps = 22/121 (18%)
 Frame = +2

Query  245  NDCGVTGNPATNS-MCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRT  421
            N+CGVT NPATN+ MCQKCFNA+  ++T+  V   +        ++S RS   R+SP + 
Sbjct  77   NNCGVTANPATNNNMCQKCFNASLVSATTGVVVVDSGS--SSVLKRSARSVNLRSSPAKV  134

Query  422  VPDLKKLEDSTDKIDEKTGESSPAPAKRE---VNRCSGCRRKVGLTGFRCRCGELFCGEH  592
            V   ++++                P KR+   VNRCSGCR+KVGLTGFRCRCGELFC EH
Sbjct  135  VIRPREID----------------PVKRDQQIVNRCSGCRKKVGLTGFRCRCGELFCSEH  178

Query  593  R  595
            R
Sbjct  179  R  179



>ref|XP_010497315.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=170

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 73/118 (62%), Gaps = 16/118 (14%)
 Frame = +2

Query  245  NDCGVTGNPATNS-MCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGRT  421
            N+CGVT NPATN+ MCQKCFNA+  ++T+  V   +        ++S RS   R+SP + 
Sbjct  34   NNCGVTANPATNNNMCQKCFNASLVSATTGVVVVDSGSSSV--LKRSARSVNLRSSPAKV  91

Query  422  VPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            V  ++  E    K D++            VNRCSGCR+KVGLTGFRCRCG+LFC EHR
Sbjct  92   V--IRPREIDAVKRDQQI-----------VNRCSGCRKKVGLTGFRCRCGDLFCSEHR  136



>ref|XP_010913137.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Elaeis guineensis]
Length=158

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 71/122 (58%), Gaps = 13/122 (11%)
 Frame = +2

Query  233  TPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRST-FRRTS  409
            T CVN+CG  GNPATN+MCQ CF A   AS+SS  + S          + PRS  FR   
Sbjct  15   TLCVNNCGFYGNPATNNMCQACFQAAGFASSSSPPSCS--------GHEKPRSAPFRLPD  66

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
            P        ++E    K        +PA   R+VNRC+GCR++VGLTGFRCRCGELFC E
Sbjct  67   PA-AEGGRGRVEGPAAKAVAAATRLAPA---RQVNRCAGCRKRVGLTGFRCRCGELFCAE  122

Query  590  HR  595
            HR
Sbjct  123  HR  124



>gb|EYU31355.1| hypothetical protein MIMGU_mgv1a014767mg [Erythranthe guttata]
Length=179

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 80/129 (62%), Gaps = 9/129 (7%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaast-------vPIPHKFAEKSPR  388
            I  CV  CGV GN A N++CQKCF++TTA +++S+VAA+         P    F EKS R
Sbjct  19   IALCVK-CGVPGNSAANNLCQKCFSSTTAEASTSAVAAAPASSSGGAKPKSLVFGEKSFR  77

Query  389  STFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRC  568
            S     S      +L       +K      +++P PAKREVNRC+GCRRKVGLTGFRCRC
Sbjct  78   SRSSTRSSPERRLNLPVTVLDLEKNPSAVADAAP-PAKREVNRCTGCRRKVGLTGFRCRC  136

Query  569  GELFCGEHR  595
            GELFC +HR
Sbjct  137  GELFCADHR  145



>ref|XP_003599112.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Medicago truncatula]
 gb|AES69363.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
 gb|AFK37674.1| unknown [Medicago truncatula]
Length=163

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 65/122 (53%), Gaps = 18/122 (15%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            I  C+ +CGV GNP+TN+MCQ CF A+T     SS  +   P   +    S       T 
Sbjct  26   INLCIKNCGVVGNPSTNNMCQNCFTASTTILPPSSSRSVRSPKRSRQESSSSSEEEGSTD  85

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
                           D +DEKT     +  KR V+RCSGCRRKVGL GFRCRCGELFC +
Sbjct  86   H--------------DLVDEKT----VSEVKRVVSRCSGCRRKVGLAGFRCRCGELFCAD  127

Query  590  HR  595
            HR
Sbjct  128  HR  129



>gb|AAR83854.1| induced stolon tip protein [Capsicum annuum]
Length=88

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 45/56 (80%), Gaps = 5/56 (9%)
 Frame = +2

Query  428  DLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            DLKK++   D++     + S  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR
Sbjct  4    DLKKVKQEDDQL-----KDSLPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  54



>ref|XP_009418201.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Musa acuminata subsp. malaccensis]
Length=155

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 69/127 (54%), Gaps = 27/127 (21%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            +  C+N+CG  G+PATN+MCQ CF A+ AA+                +   PRS  RR++
Sbjct  17   LALCINNCGFPGDPATNNMCQTCFQASPAAA----------------SSSLPRSCSRRSA  60

Query  410  PGRTVPDLKKLEDSTDKIDEK-----TGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGE  574
            P    PD        D+ +E+        S      R+VNRC  CR++VG TGFRCRCGE
Sbjct  61   PSIRSPD------PADRAEEQGAPTAALASPAPAPARKVNRCLSCRKRVGFTGFRCRCGE  114

Query  575  LFCGEHR  595
            LFCGEHR
Sbjct  115  LFCGEHR  121



>gb|EMT06701.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
1 [Aegilops tauschii]
Length=165

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 69/122 (57%), Gaps = 9/122 (7%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A  A+++ SS ++S+  +P      +P     R  
Sbjct  19   ITLCANSCGFPGNPATQNLCQNCFLAGPASTSPSSSSSSSSSLP---GVSAPTPVIDRPR  75

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
            P     +L +         E        PA+  VNRCS CR++VGLTGFRCRCG++FCGE
Sbjct  76   PAPLEAELARPAVDLAPATEAK------PARTSVNRCSSCRKRVGLTGFRCRCGDMFCGE  129

Query  590  HR  595
            HR
Sbjct  130  HR  131



>ref|XP_008776561.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Phoenix dactylifera]
Length=160

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 68/121 (56%), Gaps = 9/121 (7%)
 Frame = +2

Query  233  TPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP  412
            T CVN+CG  GNPATN+MCQ CF A   A+ SS  + S        + + PRS   R+  
Sbjct  15   TLCVNNCGFYGNPATNNMCQACFQAAGFAAPSSPPSCS--------SHEKPRSAPARSPD  66

Query  413  GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  592
                    +      K D     +    AKR VNRC+GCR++VGLTGFRCRCGELFC EH
Sbjct  67   PAAEGGWGEARGPPAKPDAAAAAAGVTLAKR-VNRCAGCRKRVGLTGFRCRCGELFCAEH  125

Query  593  R  595
            R
Sbjct  126  R  126



>gb|AGQ04323.1| SAP1, partial [Oryza punctata]
Length=146

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 68/124 (55%), Gaps = 15/124 (12%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A +A+++S S      P+     +K PR       
Sbjct  2    ITLCANSCGFPGNPATQNLCQSCFLAASASTSSLSSLPGLSPV----LDKPPRPA-----  52

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKR--EVNRCSGCRRKVGLTGFRCRCGELFC  583
                 P ++        ++E     +PA A +   VNRCS CR++V LTGFRCRCG LFC
Sbjct  53   ----TPLVESQAPLPPPVEEMVSAPAPALAAKTSAVNRCSRCRKRVSLTGFRCRCGHLFC  108

Query  584  GEHR  595
            GEHR
Sbjct  109  GEHR  112



>ref|XP_010928494.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Elaeis guineensis]
Length=161

 Score = 81.6 bits (200),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 66/124 (53%), Gaps = 12/124 (10%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            +T CVN+CG  GNPATN+MCQ CF A    S S          P +   + P ST  R S
Sbjct  14   LTLCVNNCGFYGNPATNNMCQACFQAAGFTSPSP---------PSRSGHEKPSSTPTR-S  63

Query  410  PGRTVPDLKKLEDS--TDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  583
            P   V   +   +S            +    + R VNRC+GCR++VGLTGFRCRCG LFC
Sbjct  64   PDPAVEAGRGGAESPAAKTDAATAAAAVGVASARRVNRCAGCRKRVGLTGFRCRCGNLFC  123

Query  584  GEHR  595
             EHR
Sbjct  124  VEHR  127



>ref|XP_008795709.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Phoenix dactylifera]
 ref|XP_008778992.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Phoenix dactylifera]
Length=157

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 69/123 (56%), Gaps = 14/123 (11%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSP-RSTFRRT  406
            +T CVN+CG  GNPATN+MCQ CF A   AS S    +S     H+ A  +P RS     
Sbjct  14   LTLCVNNCGFYGNPATNNMCQACFQAAGFASPSPPSRSS-----HEKASSAPARSLDPAA  68

Query  407  SPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  586
              GR        E +     +    ++     R V+RC+GCR++VGLTGFRCRCG+LFC 
Sbjct  69   EAGR--------EGAEGPAGKADAAAAVVSPARRVSRCAGCRKRVGLTGFRCRCGKLFCA  120

Query  587  EHR  595
            +HR
Sbjct  121  QHR  123



>ref|XP_006660763.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Oryza brachyantha]
Length=166

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 70/123 (57%), Gaps = 9/123 (7%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A +A+++S +      P+  K A   P ++     
Sbjct  18   ITLCANSCGFPGNPATQNLCQNCFLAASASTSSPASLPGLSPVLDKAAR--PATSLVEAQ  75

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAK-REVNRCSGCRRKVGLTGFRCRCGELFCG  586
                   +++L      ++ K      APAK   VNRCS CR++VGLTGFRCRCG LFCG
Sbjct  76   AAPAAAPVEELASPAPALEVK------APAKTSAVNRCSRCRKRVGLTGFRCRCGYLFCG  129

Query  587  EHR  595
            EHR
Sbjct  130  EHR  132



>gb|EAZ45178.1| hypothetical protein OsJ_29820 [Oryza sativa Japonica Group]
Length=164

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 71/124 (57%), Gaps = 14/124 (11%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A TA ++S S  +S V       ++ PR       
Sbjct  19   ITLCANSCGFPGNPATQNLCQNCFLAATAFTSSPSSLSSPV-----LDKQPPRPAAPLVE  73

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKR--EVNRCSGCRRKVGLTGFRCRCGELFC  583
            P   +P    +E+    +      ++PAP  +   VNRCS CR++VGLTGFRCRCG LFC
Sbjct  74   PQAPLP--PPVEEMASAL-----ATAPAPVAKTSAVNRCSRCRKRVGLTGFRCRCGHLFC  126

Query  584  GEHR  595
            GEHR
Sbjct  127  GEHR  130



>gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii]
Length=87

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  437  KLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            K+ D     +E   ++S  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR
Sbjct  1    KVGDRMMVKEEDQLKASLPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  53



>gb|AGQ04316.1| SAP1, partial [Oryza glumipatula]
Length=147

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 72/124 (58%), Gaps = 14/124 (11%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A TA+++S S  +S V       ++ PR       
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPV-----LDKQPPRPAAPLVE  56

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKR--EVNRCSGCRRKVGLTGFRCRCGELFC  583
            P   +P    +E+    +      ++PAP  +   VNRCS CR++VGLTGFRCRCG LFC
Sbjct  57   PQAPLP--PPVEEMASAL-----ATAPAPVAKTSAVNRCSRCRKRVGLTGFRCRCGHLFC  109

Query  584  GEHR  595
            GEHR
Sbjct  110  GEHR  113



>gb|AGQ04314.1| SAP1, partial [Oryza nivara]
 gb|AGQ04318.1| SAP1, partial [Oryza barthii]
 gb|AGQ04320.1| SAP1, partial [Oryza glaberrima]
 gb|AGQ04321.1| SAP1, partial [Oryza sativa Indica Group]
 gb|AGQ04322.1| SAP1, partial [Oryza sativa Japonica Group]
Length=147

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 72/124 (58%), Gaps = 14/124 (11%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A TA+++S S  +S V       ++ PR       
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPV-----LDKQPPRPAAPLVE  56

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKR--EVNRCSGCRRKVGLTGFRCRCGELFC  583
            P   +P    +E+    +      ++PAP  +   VNRCS CR++VGLTGFRCRCG LFC
Sbjct  57   PQAPLP--PPVEEMASAL-----ATAPAPVAKTSAVNRCSRCRKRVGLTGFRCRCGHLFC  109

Query  584  GEHR  595
            GEHR
Sbjct  110  GEHR  113



>gb|EMT33843.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
11 [Aegilops tauschii]
Length=172

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 67/123 (54%), Gaps = 6/123 (5%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A++++ + S+ +  +       +  +    F +  
Sbjct  21   ITLCANSCGFPGNPATKNLCQNCFLASSSSPSPSAASPPS-----PSSSPAAFPLFDKLR  75

Query  410  PGRTVPDLKKLEDSTDKIDE-KTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  586
            P      L +       +D    G + P  +K  VNRC  CR++VGLTGFRCRCGE+FCG
Sbjct  76   PAAVASPLLQAAPVYMAVDRPAAGPADPKASKSSVNRCHNCRKRVGLTGFRCRCGEMFCG  135

Query  587  EHR  595
             HR
Sbjct  136  AHR  138



>gb|EAZ09556.1| hypothetical protein OsI_31833 [Oryza sativa Indica Group]
Length=164

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 72/124 (58%), Gaps = 14/124 (11%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A TA+++S S  +S V       ++ PR       
Sbjct  19   ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPV-----LDKQPPRPAAPLVE  73

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKR--EVNRCSGCRRKVGLTGFRCRCGELFC  583
            P   +P    +E+    +      ++PAP  +   VNRCS CR++VGLTGFRCRCG LFC
Sbjct  74   PQAPLP--PPVEEMASAL-----ATAPAPVAKTSAVNRCSRCRKRVGLTGFRCRCGHLFC  126

Query  584  GEHR  595
            GEHR
Sbjct  127  GEHR  130



>ref|NP_001063521.1| Os09g0486500 [Oryza sativa Japonica Group]
 sp|A2Z2J6.1|SAP1_ORYSI RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 1; Short=OsSAP1; AltName: Full=Multiple 
stress-responsive zinc finger protein ISAP1; Short=OsiSAP1 
[Oryza sativa Indica Group]
 sp|A3C039.2|SAP1_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 1; Short=OsSAP1; AltName: Full=Multiple 
stress-responsive zinc finger protein ISAP1; Short=OsiSAP1 
[Oryza sativa Japonica Group]
 gb|AAF74344.1|AF140722_1 multiple stress-responsive zinc-finger protein [Oryza sativa 
Indica Group]
 gb|AAN15744.1| multiple stress-associated zinc-finger protein [Oryza sativa 
Indica Group]
 dbj|BAF25435.1| Os09g0486500 [Oryza sativa Japonica Group]
 gb|EAZ09557.1| hypothetical protein OsI_31835 [Oryza sativa Indica Group]
 gb|ABQ12733.1| Zn-finger protein [Oryza sativa Indica Group]
 gb|ABR26098.1| multiple stress-responsive zinc-finger protein isap1 [Oryza sativa 
Indica Group]
 dbj|BAG87708.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91792.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97589.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99795.1| unnamed protein product [Oryza sativa Japonica Group]
Length=164

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 72/124 (58%), Gaps = 14/124 (11%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A TA+++S S  +S V       ++ PR       
Sbjct  19   ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPV-----LDKQPPRPAAPLVE  73

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKR--EVNRCSGCRRKVGLTGFRCRCGELFC  583
            P   +P    +E+    +      ++PAP  +   VNRCS CR++VGLTGFRCRCG LFC
Sbjct  74   PQAPLP--PPVEEMASAL-----ATAPAPVAKTSAVNRCSRCRKRVGLTGFRCRCGHLFC  126

Query  584  GEHR  595
            GEHR
Sbjct  127  GEHR  130



>dbj|BAK03526.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00339.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=163

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 67/122 (55%), Gaps = 11/122 (9%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A  A+++ SS            +   P ++     
Sbjct  19   ITLCANSCGFPGNPATQNLCQNCFLAGPASTSPSSS-----------SSSLPGASVSTPV  67

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
              R  P     E +   +D +   +   PA+  VNRCS CR++VGLTGFRCRCG++FCGE
Sbjct  68   LDRPRPAPVDAELAHPAVDYRATATEAKPARTSVNRCSSCRKRVGLTGFRCRCGDVFCGE  127

Query  590  HR  595
            HR
Sbjct  128  HR  129



>gb|ADF80942.1| zinc finger protein [Phyllostachys praecox]
Length=165

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 68/122 (56%), Gaps = 8/122 (7%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF+A +A+++S              +  S  S+    S
Sbjct  18   ITLCANGCGFPGNPATQNLCQNCFSAASASTSSPPSP-------SSSSSSSSSSSLPGLS  70

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
            P    P    +E ++  +D        A  K  VNRCS CR++VGLTGFRCRCGELFCGE
Sbjct  71   PVVDKPRPAPVELASPAVDRAPAVEVKA-GKTSVNRCSSCRKRVGLTGFRCRCGELFCGE  129

Query  590  HR  595
            HR
Sbjct  130  HR  131



>gb|AGQ04324.1| SAP1, partial [Oryza officinalis]
Length=145

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 69/123 (56%), Gaps = 14/123 (11%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPR-STFRRT  406
            IT C N CG  GNPAT ++CQ CF A +A+++S S  A   P+     +K PR +T    
Sbjct  2    ITLCANSCGFPGNPATQNLCQSCFLAASASTSSPSSLAGLSPV----LDKPPRPATPLVE  57

Query  407  SPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  586
            +     P  +++  +      KT           VNRCS CR++VGLTGFRCRCG LFCG
Sbjct  58   AKAPLPPPAEEMASAPAPAPAKTSA---------VNRCSRCRKRVGLTGFRCRCGHLFCG  108

Query  587  EHR  595
            EHR
Sbjct  109  EHR  111



>dbj|BAJ88745.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=163

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 66/122 (54%), Gaps = 11/122 (9%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A  A+++ SS            +   P ++     
Sbjct  19   ITLCANSCGFPGNPATQNLCQNCFLAGPASTSPSSS-----------SSSLPGASVSTPV  67

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
              R  P     E +   +D +   +   PA+  VNRCS CR++VGLTGFRCRCG++FCG 
Sbjct  68   LDRPRPAPVDAELAHPAVDYRATATEAKPARTSVNRCSSCRKRVGLTGFRCRCGDVFCGG  127

Query  590  HR  595
            HR
Sbjct  128  HR  129



>ref|XP_010928202.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Elaeis guineensis]
Length=164

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 65/124 (52%), Gaps = 18/124 (15%)
 Frame = +2

Query  233  TPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP  412
            T C N+CG  G+PATN++C KC+     + + +S+    VP P               + 
Sbjct  22   TLCANNCGFFGSPATNNLCSKCYKDYFLSKSKASIETLVVPPP---------------AE  66

Query  413  GRTVPDLKKLEDSTDKIDEKTGESSPA---PAKREVNRCSGCRRKVGLTGFRCRCGELFC  583
             + V +     D   K++    E +P+   PAK+  NRCS C +KVGL GF+CRCGE+FC
Sbjct  67   AKKVEEKAAGGDGEAKVESFAEEGAPSGESPAKKPTNRCSFCNKKVGLMGFKCRCGEVFC  126

Query  584  GEHR  595
              HR
Sbjct  127  SLHR  130



>gb|ADF80943.1| zinc finger protein [Phyllostachys vivax]
Length=163

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 69/122 (57%), Gaps = 10/122 (8%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A +A+++S    +S+          SP     R +
Sbjct  18   ITLCANSCGFPGNPATQNLCQNCFLAASASTSSPPSPSSSSSSSSSLPGLSPVVDKPRPA  77

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
            P   V       D    ++ K G++S       VNRCS CR+++GLTGFRCRCGELFCGE
Sbjct  78   P---VELASPAVDRVPAVEVKAGKTS-------VNRCSSCRKRLGLTGFRCRCGELFCGE  127

Query  590  HR  595
            HR
Sbjct  128  HR  129



>ref|XP_004798521.1| PREDICTED: AN1-type zinc finger protein 6 [Mustela putorius furo]
Length=170

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 65/125 (52%), Gaps = 8/125 (6%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHK--FAEKSPRSTFRRTSP  412
            C   CG  GNP TN MC  C+        +SS      P+ ++   +E    S    TS 
Sbjct  14   CSTGCGFYGNPRTNGMCSVCY-KEHLQRQNSSXXXXXSPVSNQSLLSESVASSQVDSTSV  72

Query  413  GRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  580
             + VPD + L+    D+  +  E+  +S   P K++ NRC  CR+KVGLTGF CRCG ++
Sbjct  73   DKAVPDTEDLQASVSDTAQQPSEEQSKSLEKP-KQKKNRCFMCRKKVGLTGFECRCGNVY  131

Query  581  CGEHR  595
            CG HR
Sbjct  132  CGVHR  136



>gb|AGQ04319.1| SAP1, partial [Oryza meridionalis]
Length=146

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 69/123 (56%), Gaps = 13/123 (11%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A TA+++S S  +S         +K PR       
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSS------PVLDKPPRPAAPLVE  55

Query  410  PGRTVPD-LKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  586
            P   +P  ++++  +         ++S       VNRCS CR++VGLTGFRCRCG LFCG
Sbjct  56   PQAPLPPPVEEMASALAPAPAPVVKTS------AVNRCSRCRKRVGLTGFRCRCGHLFCG  109

Query  587  EHR  595
            EHR
Sbjct  110  EHR  112



>gb|ACL01101.1| zinc finger protein [Phyllostachys edulis]
Length=164

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 65/122 (53%), Gaps = 9/122 (7%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A +A+++S    +S+                +   
Sbjct  18   ITLCANSCGFPGNPATQNLCQNCFLAASASTSSPPSPSSSSSSSSSSLPGLSPVVDK---  74

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
                 P    +E ++  +D        A  K  VNRCS CR++VGLTGFRCRCGELFCGE
Sbjct  75   -----PRPAPMELASPAVDRAPAVEVKA-GKTSVNRCSSCRKRVGLTGFRCRCGELFCGE  128

Query  590  HR  595
            HR
Sbjct  129  HR  130



>dbj|BAJ90521.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 63/122 (52%), Gaps = 15/122 (12%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A++++  S S +    P+            F +  
Sbjct  21   ITLCANSCGFPGNPATKNLCQNCFLASSSSPPSPSSSPPAFPL------------FDKPR  68

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
            P        +       +D     + P  +K  VNRC  CR++VGLTGFRCRCGE+FCG 
Sbjct  69   PAAAASPALQAPPVYMAVDR---PADPKASKSSVNRCHNCRKRVGLTGFRCRCGEMFCGA  125

Query  590  HR  595
            HR
Sbjct  126  HR  127



>ref|XP_005148802.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Melopsittacus 
undulatus]
Length=180

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 63/133 (47%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSP-----------  385
            C   CG  GNP TN MC  C+        S+   +   P      E  P           
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAPSVSSITESLPVQCTEGSTQET  73

Query  386  RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
            +ST   T+  +TVP+ ++L+ S     E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAADKTVPETEELQASVSGNAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_005521625.1| PREDICTED: AN1-type zinc finger protein 6 isoform X7 [Pseudopodoces 
humilis]
Length=180

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 70/133 (53%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKS---P  385
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S   P
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAASVSSITESLPVQCTEGSAQEP  73

Query  386  RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
            +ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEGLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_010018692.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Nestor 
notabilis]
Length=180

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 61/133 (46%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSP-----------  385
            C   CG  GNP TN MC  C+        S+   +   P      E  P           
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAPSVSSITESLPVQCTEGSTQET  73

Query  386  RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPA---KREVNRCSGCRRKVGLTGF  556
            +ST   T+  +TVP+ + L+ S     E T E         K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLESTAADKTVPETEDLQASVSGNAEPTPEEQDKTLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>gb|AGQ04317.1| SAP1, partial [Oryza longistaminata]
Length=147

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 66/122 (54%), Gaps = 10/122 (8%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A TA+++S S  +S V       ++ PR       
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPV-----LDKQPPRPAAPLVE  56

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
            P   +P   +   S           + A     VNRCS CR++VGLTGFRCRCG LFCGE
Sbjct  57   PQAPLPPPVEEVSSALATAPAPAAKTSA-----VNRCSRCRKRVGLTGFRCRCGHLFCGE  111

Query  590  HR  595
            HR
Sbjct  112  HR  113



>ref|XP_002445913.1| hypothetical protein SORBIDRAFT_07g027940 [Sorghum bicolor]
 gb|EES15408.1| hypothetical protein SORBIDRAFT_07g027940 [Sorghum bicolor]
Length=176

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 69/134 (51%), Gaps = 22/134 (16%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            +T C N CG  GNPATN++CQ CF A TA+S S+SV+  +       +     + F+   
Sbjct  19   LTLCANSCGFPGNPATNNLCQACFQAATASSASASVSPPSP----SSSLSPSPAVFKFDE  74

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAK------------REVNRCSGCRRKVGLTG  553
                 P       +T    ++  E  PAPA               VNRC  CR++VGLTG
Sbjct  75   QQHARPS------ATAVFADRPAEQPPAPASARPIRTTSTSSSSSVNRCQSCRKRVGLTG  128

Query  554  FRCRCGELFCGEHR  595
            FRCRCGELFCG HR
Sbjct  129  FRCRCGELFCGAHR  142



>ref|XP_009942070.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Opisthocomus 
hoazin]
Length=180

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 62/133 (47%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSP-----------  385
            C   CG  GNP TN MC  C+        S+   +   P      E  P           
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAPSVSSITESLPVQCTEGSAQET  73

Query  386  RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPA---PAKREVNRCSGCRRKVGLTGF  556
            +ST   T+  +TVP+ + L+ S  +  E T E         K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKLLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_004973853.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Setaria italica]
Length=178

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 65/126 (52%), Gaps = 4/126 (3%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRT-  406
            +T C N CG  GNPAT ++CQ CF A +A++++S    S  P     A   P        
Sbjct  19   LTLCANSCGFPGNPATKNLCQNCFLAASASASASVSPPSPSPSTTTAAFDKPWPAAASAF  78

Query  407  ---SPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGEL  577
               +P   V       D       ++  S+ AP    VNRC  CR++VGLTGFRCRCGEL
Sbjct  79   SAPTPLAVVAPFSPAVDRPAGGPVESSSSNKAPRTSSVNRCHNCRKRVGLTGFRCRCGEL  138

Query  578  FCGEHR  595
            FCG HR
Sbjct  139  FCGAHR  144



>ref|XP_007133828.1| hypothetical protein PHAVU_011G212300g [Phaseolus vulgaris]
 gb|AAA33773.1| PVPR3 [Phaseolus vulgaris]
 gb|ESW05822.1| hypothetical protein PHAVU_011G212300g [Phaseolus vulgaris]
Length=137

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 54/79 (68%), Gaps = 10/79 (13%)
 Frame = +2

Query  359  PHKFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRK  538
            P +F + +  +T  R SP R++P    LED+ +   ++T  S P   KR VNRCSGCRR+
Sbjct  35   PSRFFDAATPATSSR-SPKRSLP----LEDAANA--DRTVASEP---KRAVNRCSGCRRR  84

Query  539  VGLTGFRCRCGELFCGEHR  595
            VGLTGFRCRCG+LFC EHR
Sbjct  85   VGLTGFRCRCGDLFCAEHR  103



>ref|XP_002460447.1| hypothetical protein SORBIDRAFT_02g028240 [Sorghum bicolor]
 gb|EER96968.1| hypothetical protein SORBIDRAFT_02g028240 [Sorghum bicolor]
Length=172

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 69/123 (56%), Gaps = 3/123 (2%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N+CG  GNPAT ++CQ CF+A TA+ +SS  + ++       ++  P +     +
Sbjct  18   ITLCANNCGFPGNPATQNLCQSCFSAATASRSSSPSSPTSSSSASAVSQPRPAALVDAAA  77

Query  410  PGRTV-PDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  586
                   D   +  S + +      ++ A     VNRCS CR++VGLTGFRCRCGELFCG
Sbjct  78   VELLASADAAAVGQSMEVVAAAP--AATAARSSAVNRCSSCRKRVGLTGFRCRCGELFCG  135

Query  587  EHR  595
             HR
Sbjct  136  AHR  138



>ref|XP_011094369.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 isoform X1 [Sesamum indicum]
 ref|XP_011094370.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 isoform X2 [Sesamum indicum]
Length=160

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 60/119 (50%), Gaps = 8/119 (7%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G+PAT +MC KC+   +   ++     ST P P   A+ S  S  +  S   
Sbjct  16   CVNNCGFFGSPATQNMCSKCYRDLSIKKSADFSTPSTAPPPSTAAQLSLSSPDKAESSVA  75

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            TV        +         + +    +   NRCS CR+KVGLTGFRCRCG  FCG HR
Sbjct  76   TV--------AAQSPPMPVQQQAQPQPQPPTNRCSTCRKKVGLTGFRCRCGITFCGSHR  126



>ref|XP_010257702.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nelumbo nucifera]
Length=170

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 62/119 (52%), Gaps = 6/119 (5%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G+ ATN++C KC+            A++  P+  K       ST  +  P  
Sbjct  24   CANNCGFFGSAATNNLCSKCYRDMFMKQQQQFKASTVTPVAEKV---QATSTLVQLEPVV  80

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
               +   +E+   K+  + G S+    K+  NRC  C+++VGLTGF+CRCG +FCG HR
Sbjct  81   GRVNNNNIEE---KLTLQEGSSTYETNKQPPNRCLACQKRVGLTGFKCRCGGIFCGVHR  136



>ref|XP_009507913.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Phalacrocorax 
carbo]
Length=180

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 69/133 (52%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaa----------stsssvaastvPIP-HKFAEKSP  385
            C   CG  GNP TN MC  C+                +TS S    ++P+P  + + +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVPCTEGSAQET  73

Query  386  RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
            +ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_010925078.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Elaeis guineensis]
Length=164

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 64/121 (53%), Gaps = 12/121 (10%)
 Frame = +2

Query  233  TPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP  412
            T C N+CG  G+PATN++C KC+     + + +S+    VP P +      +   ++++ 
Sbjct  22   TLCANNCGFFGSPATNNLCSKCYKDYFLSKSKASIETLLVPPPVE-----AKKVEKKSAG  76

Query  413  GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  592
            G         E       E+   S  AP K+  NRCS C +KVGL GF+CRCGE+FC  H
Sbjct  77   GDG-------EAKDGSFTEEGAPSGGAPVKKPPNRCSFCNKKVGLMGFKCRCGEVFCSVH  129

Query  593  R  595
            R
Sbjct  130  R  130



>ref|XP_010139451.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Buceros 
rhinoceros silvestris]
Length=180

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 69/133 (52%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  388
            C   CG  GNP TN MC  C+                ++SVA+ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVASITESLPVQCTEGSAQET  73

Query  389  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
             ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG +FCG HR
Sbjct  134  ECRCGNVFCGMHR  146



>ref|XP_008935048.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Merops 
nubicus]
Length=180

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 68/133 (51%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  388
            C   CG  GNP TN MC  C+                ++SV + T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVTSITESLPVQCTEGSAQET  73

Query  389  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
             ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG +FCG HR
Sbjct  134  ECRCGNVFCGMHR  146



>ref|XP_008490199.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Calypte 
anna]
Length=180

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 62/133 (47%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSP-----------  385
            C   CG  GNP TN MC  C+        S+   +          E  P           
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAASVSSLTESLPVQCTEGSAQET  73

Query  386  RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
            +ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTALDKTVPETEDLQASVSESAEPTPEEQDKSLEKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_008794968.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
Length=164

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 63/121 (52%), Gaps = 12/121 (10%)
 Frame = +2

Query  233  TPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP  412
            T C N+CG  G+PATN++C KC+     + + +S+  S VP P   A+K+          
Sbjct  22   TLCANNCGFFGSPATNNLCSKCYKDCFLSKSKASIETSVVP-PSAEAKKAEEK-------  73

Query  413  GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  592
                P     E       E+   S  +PAK   NRCS C ++VGL GF+CRCGELFC  H
Sbjct  74   ----PLGGNGEAKVGSFAEEGASSGESPAKETPNRCSFCNKRVGLMGFKCRCGELFCSLH  129

Query  593  R  595
            R
Sbjct  130  R  130



>ref|XP_005419656.1| PREDICTED: AN1-type zinc finger protein 6 isoform X7 [Geospiza 
fortis]
 ref|XP_009088242.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Serinus 
canaria]
Length=180

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 70/133 (53%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  388
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAASVSSITESLPVQCTEGSAQET  73

Query  389  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
             ST   T+  +TVP+ ++L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEELQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_010157333.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Eurypyga 
helias]
Length=180

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 69/133 (52%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  388
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSAQEA  73

Query  389  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
             ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAADKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_010174709.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Caprimulgus 
carolinensis]
Length=180

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 65/133 (49%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssv----aastvPIPHKF-------AEKSP  385
            C   CG  GNP TN MC  C+        S+      A S   IP          + +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSIPESLPVQCTEGSTQET  73

Query  386  RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
            +ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAADKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_008923640.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Manacus 
vitellinus]
Length=180

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 63/133 (47%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSP-----------  385
            C   CG  GNP TN MC  C+        S+   +          E  P           
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAASVSSITESLPVQCTEGSTQET  73

Query  386  RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
            +ST   T+  +TVP+ ++L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEELQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_009876598.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Apaloderma 
vittatum]
Length=180

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 68/133 (51%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  388
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSAQET  73

Query  389  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPA---PAKREVNRCSGCRRKVGLTGF  556
             ST   T+  +TVP+ + L+ S  +  E T E         K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAADKTVPETEDLQASVSENAESTPEEQDKLLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_010195894.1| PREDICTED: AN1-type zinc finger protein 6 isoform X4 [Colius 
striatus]
Length=180

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 69/133 (52%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  388
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAASVSSITESLPVQCTEGSAQET  73

Query  389  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
             ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_009584789.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Fulmarus 
glacialis]
 ref|XP_009634160.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Egretta 
garzetta]
 ref|XP_009805410.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Gavia stellata]
 ref|XP_009884403.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Charadrius 
vociferus]
Length=180

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 69/133 (52%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  388
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSAQET  73

Query  389  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
             ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>gb|ABK90631.1| zinc finger protein [Aeluropus littoralis]
Length=159

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 57/119 (48%), Gaps = 12/119 (10%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C+N+CG  G+  TN+MC KC+          +       I    +   P  T ++     
Sbjct  19   CINNCGFFGSSMTNNMCSKCYRDFVKLMEMDAPVVDKKLITTASSSTVPFETAKQDD---  75

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            TVPD   ++D          + +  P K   NRCS CR+KVGLTGF+CRCG  FC  HR
Sbjct  76   TVPDAAAMDDK---------QPAQEPPKPPSNRCSTCRKKVGLTGFQCRCGGTFCSLHR  125



>ref|XP_010302402.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Balearica 
regulorum gibbericeps]
Length=180

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 69/133 (52%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  388
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSAQET  73

Query  389  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
             ST   T+  +T+P+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTIPETQDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_005436662.1| PREDICTED: AN1-type zinc finger protein 6 isoform X4 [Falco cherrug]
 ref|XP_009482428.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Pelecanus 
crispus]
 ref|XP_009468362.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Nipponia 
nippon]
 ref|XP_009945661.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Leptosomus 
discolor]
 ref|XP_010076998.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Pterocles 
gutturalis]
 ref|XP_010123598.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Chlamydotis 
macqueenii]
Length=180

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 69/133 (52%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  388
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSTQET  73

Query  389  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
             ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_002269276.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1 [Vitis vinifera]
 emb|CBI24503.3| unnamed protein product [Vitis vinifera]
Length=152

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP-G  415
            CVN CG  G PAT ++C KC+         ++ A +      K  EK+  ST   TS   
Sbjct  6    CVNGCGFFGTPATQNLCSKCYKDFLKEEEEAAKAKT------KSMEKAMGSTVASTSSVD  59

Query  416  RTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
              V  + +L  S++  + K   S  +  K++V RC  C++KVG+ GF+CRCG +FC EHR
Sbjct  60   DVVTSMTQLSLSSE--NTKKTISDDSSTKKKVERCETCKKKVGIIGFKCRCGSMFCAEHR  117



>ref|XP_009976938.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Tauraco 
erythrolophus]
Length=180

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 68/133 (51%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsss--------vaastvPIPHKFAEKSPR--  388
            C   CG  GNP TN MC  C+        S+         V++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATPVSSITESLPVQCTEGSAQET  73

Query  389  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
             ST   T+  +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>gb|AGQ04315.1| SAP1, partial [Oryza rufipogon]
Length=149

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 66/122 (54%), Gaps = 8/122 (7%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N CG  GNPAT ++CQ CF A TA+++S S  +S V       ++ PR       
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPV-----LDKQPPRPAAPLVE  56

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
            P   +P   +   S           +   A   VNRCS CR++VGLTGFRCRCG LFCGE
Sbjct  57   PQAPLPPPVEEMASALATATAPAPVAKTSA---VNRCSRCRKRVGLTGFRCRCGHLFCGE  113

Query  590  HR  595
            HR
Sbjct  114  HR  115



>ref|XP_003557532.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
 ref|XP_003557533.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
 ref|XP_010228317.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
Length=160

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 57/119 (48%), Gaps = 14/119 (12%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  GN  TN+MC KC+      +T +       P+  K A  +  S+     P +
Sbjct  22   CVNNCGFFGNSMTNNMCSKCYRDFIKVTTMAV------PVVEKKAFAAASSSMVPLEPAK  75

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
                    ED          +++  P K   NRC  CR+KVGLTGF+CRCG  FC  HR
Sbjct  76   --------EDEVPAAAVVDSQAAQEPPKPPSNRCLSCRKKVGLTGFQCRCGGTFCSMHR  126



>ref|XP_010286312.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Phaethon 
lepturus]
Length=180

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 68/133 (51%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  388
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSTQET  73

Query  389  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPA---KREVNRCSGCRRKVGLTGF  556
             ST   T+  +TVP+ + L+ S  +  E T E         K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPEEQDKTLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_008638302.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Corvus 
brachyrhynchos]
Length=180

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 69/133 (52%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  388
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAASVSSITESLPVQCTEGSAQET  73

Query  389  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
             ST   T+  +TVP+ ++L+ S  +  E   E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEELQASVSENAEPAPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_010228315.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X1 [Brachypodium distachyon]
 ref|XP_010228316.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X1 [Brachypodium distachyon]
Length=205

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 57/119 (48%), Gaps = 14/119 (12%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  GN  TN+MC KC+      +T +       P+  K A  +  S+     P +
Sbjct  67   CVNNCGFFGNSMTNNMCSKCYRDFIKVTTMAV------PVVEKKAFAAASSSMVPLEPAK  120

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
                    ED          +++  P K   NRC  CR+KVGLTGF+CRCG  FC  HR
Sbjct  121  --------EDEVPAAAVVDSQAAQEPPKPPSNRCLSCRKKVGLTGFQCRCGGTFCSMHR  171



>ref|XP_003542858.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Glycine max]
Length=137

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 53/81 (65%), Gaps = 14/81 (17%)
 Frame = +2

Query  359  PHKFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDE--KTGESSPAPAKREVNRCSGCR  532
            P +F + +  +T  R SP R++P           +DE  +T +++ +  KR VNRCSGCR
Sbjct  35   PSRFFDATTPATSSR-SPKRSLP-----------LDEESQTDQTTSSEPKRAVNRCSGCR  82

Query  533  RKVGLTGFRCRCGELFCGEHR  595
            R+VGLTGFRCRCG+LFC EHR
Sbjct  83   RRVGLTGFRCRCGDLFCAEHR  103



>ref|XP_009416648.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
 ref|XP_009416649.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=153

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 45/72 (63%), Gaps = 6/72 (8%)
 Frame = +2

Query  389  STFRRTSPGRTVPDLKKLEDSTDKIDE---KTGESSPAPAKREVNRCSGCRRKVGLTGFR  559
            ST  R  P    P +     ST K+DE   K GE SP P  R  NRCS CR+KVGLTGFR
Sbjct  51   STIHR--PESPAPAMTVAASSTTKLDEESSKPGEESPTPV-RFSNRCSTCRKKVGLTGFR  107

Query  560  CRCGELFCGEHR  595
            CRCG+LFCG HR
Sbjct  108  CRCGDLFCGRHR  119



>ref|XP_004288126.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Fragaria vesca subsp. vesca]
 ref|XP_004288127.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Fragaria vesca subsp. vesca]
Length=167

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 67/119 (56%), Gaps = 9/119 (8%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G+  TN +C KC+       +  +V  + + + +K  E    +   ++   +
Sbjct  24   CVNNCGYYGSAKTNDLCSKCYKEFLLTQSKGAVEGTVI-VENKVGEGGA-NVVNKSHVEQ  81

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V ++++      +++E  G +S  P KR  NRCS CR++VGLTGF+CRCG+ FC  HR
Sbjct  82   VVEEVRQ-----SQVEE--GTTSENPEKRPANRCSFCRKRVGLTGFKCRCGDTFCSLHR  133



>ref|XP_010189201.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Mesitornis 
unicolor]
Length=180

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 68/133 (51%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  388
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSAQET  73

Query  389  -STFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
             ST   T   +TVP+ + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTPVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_009701714.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Cariama 
cristata]
Length=180

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 69/133 (52%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  388
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSTQET  73

Query  389  -STFRRTSPGRTVPDLKKLEDSTDKIDEKT---GESSPAPAKREVNRCSGCRRKVGLTGF  556
             ST   T+  +TVP+ + L+ S  +  E T    + S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTAVDKTVPETEDLQASVSENAEPTPDEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_009415054.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
 gb|AAR96005.1| hypothetical protein [Musa acuminata]
Length=157

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 4/61 (7%)
 Frame = +2

Query  422  VPDLKKLEDSTDKIDEKT---GESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  592
             P +     ST K+DE+    GE SPAP  R  NRCS CR+KVGLTGFRCRCG+LFCG H
Sbjct  64   APTITFAASSTPKLDEEPSNPGEESPAPV-RFSNRCSACRKKVGLTGFRCRCGDLFCGRH  122

Query  593  R  595
            R
Sbjct  123  R  123



>ref|XP_004510979.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cicer arietinum]
Length=160

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 50/81 (62%), Gaps = 10/81 (12%)
 Frame = +2

Query  359  PHKFAE--KSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCR  532
            P +F E   + RS     SP R+ P        +D   +   +++ + AKR VNRCSGCR
Sbjct  54   PSRFFEDKSTARSATSSRSPKRSHP--------SDDDTQVQPQTTSSEAKRAVNRCSGCR  105

Query  533  RKVGLTGFRCRCGELFCGEHR  595
            R+VGLTGFRCRCG+LFC EHR
Sbjct  106  RRVGLTGFRCRCGDLFCSEHR  126



>ref|XP_008808665.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
 ref|XP_008808673.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
 ref|XP_008808683.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
Length=164

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 64/124 (52%), Gaps = 18/124 (15%)
 Frame = +2

Query  233  TPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP  412
            T C N+CG  G+PATN++C KC+     + + +SV    VP P +               
Sbjct  22   TLCANNCGFFGSPATNNLCSKCYKDYFLSKSKASVETLLVPPPVE---------------  66

Query  413  GRTVPDLKKLEDSTDKIDEKTGESSPA---PAKREVNRCSGCRRKVGLTGFRCRCGELFC  583
             + V +     D   K    T E++P+   P K+  NRCS C ++VGL GF+CRCGE+FC
Sbjct  67   AKKVEEKPAGGDGEAKGGSFTDEAAPSEGSPVKKPPNRCSFCNKRVGLMGFKCRCGEVFC  126

Query  584  GEHR  595
              HR
Sbjct  127  SLHR  130



>ref|XP_003606132.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Medicago truncatula]
 gb|AES88329.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
Length=170

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 61/125 (49%), Gaps = 8/125 (6%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCF---NattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            C N+CG  G+PA   +C KC+         S+S+ +  +   IP +    S  +      
Sbjct  14   CANNCGFFGSPAMQDLCSKCYRDLQMKEQRSSSAKLVLNQTLIPQQSNSSSLDTGI--IH  71

Query  410  PGRTVPDLKKLEDSTDKID---EKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  580
            P  T P +  +  ST  ++      G S   P K + NRC  CRR+VGLTGF+CRCG   
Sbjct  72   PSSTSPSVMIVSSSTPTVELVAAAAGPSEAEPPKVQPNRCGTCRRRVGLTGFKCRCGLTL  131

Query  581  CGEHR  595
            CG HR
Sbjct  132  CGTHR  136



>ref|XP_009082778.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Acanthisitta 
chloris]
Length=180

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 70/133 (53%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPR--  388
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPAASVSSITESLPVQCTEGSAQET  73

Query  389  -STFRRTSPGRTVPDLKKLEDSTDKIDE---KTGESSPAPAKREVNRCSGCRRKVGLTGF  556
             ST   ++  +TVP+ ++L+ S  +  E   +  + S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSSAADKTVPETEELQASVSENAEPGPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_002513177.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF49168.1| zinc finger protein, putative [Ricinus communis]
Length=140

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +2

Query  416  RTVPDLKKLEDSTDKIDEKTGE---SSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  586
            R+   L  + D   +  E T +   +    AKR+VNRCSGCRRKVGLTGFRCRCG+LFC 
Sbjct  44   RSSASLMVIRDPQPETSESTADREKNDVLVAKRDVNRCSGCRRKVGLTGFRCRCGDLFCW  103

Query  587  EHR  595
            EHR
Sbjct  104  EHR  106



>ref|XP_006339126.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like [Solanum tuberosum]
Length=159

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 60/120 (50%), Gaps = 11/120 (9%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G+P T + C KC+N                PI   F  + P  +  ++S   
Sbjct  16   CANNCGFFGSPTTQNFCSKCYNEVYIKGGQQK------PIDSLFPPQLPIPS--QSSSVL  67

Query  419  TVPDLKKLEDSTDKIDEKTGES-SPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             +P+   +E+  + +      +  P PA+   NRCS CR+KVGL GF+CRCG  FCG HR
Sbjct  68   VLPEPAAVEEKPEVVIAAVTAAVQPMPAQS--NRCSACRKKVGLIGFKCRCGTTFCGTHR  125



>ref|XP_002306229.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE86740.2| zinc finger family protein [Populus trichocarpa]
Length=166

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 65/129 (50%), Gaps = 20/129 (16%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G+ AT ++C KC+     +           P+ H+    S  S    +S   
Sbjct  14   CVNNCGFYGSQATENLCSKCYRDLHQSQ----------PLNHQLLNPSSSSAASVSSFAS  63

Query  419  TVPDLKKLEDST---------DKIDE-KTGESSPAPAKREVNRCSGCRRKVGLTGFRCRC  568
               D+ K+  +          DK DE K GE +    +++ +RC  CRR+VGLTGF+CRC
Sbjct  64   PAVDVLKVNTNQKAPVVVVGDDKKDEVKAGEPAVVKQQQQPSRCLTCRRRVGLTGFKCRC  123

Query  569  GELFCGEHR  595
            G +FCG HR
Sbjct  124  GMVFCGTHR  132



>ref|XP_011046278.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 3 [Populus euphratica]
Length=167

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 65/132 (49%), Gaps = 25/132 (19%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRST--------  394
            CVN+CG  G+ AT ++C KC+     +           P+ H+    S  S+        
Sbjct  14   CVNNCGFYGSQATENLCSKCYRDLHQSQ----------PLNHQLLNPSSSSSAASVSSFS  63

Query  395  -----FRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFR  559
                   + +  +  P +   +D  D++  K GE +    +++ NRC  CRR+VGLTGF+
Sbjct  64   SPAVDVLKVNTNQKAPVVVVGDDKKDEV--KAGEPAIVKQQQQPNRCLTCRRRVGLTGFK  121

Query  560  CRCGELFCGEHR  595
            CRCG +FCG HR
Sbjct  122  CRCGMVFCGTHR  133



>ref|XP_010557404.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger A20 and AN1 domain-containing 
stress-associated protein 3 [Tarenaya hassleriana]
Length=155

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 61/118 (52%), Gaps = 10/118 (8%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G+PAT S+C KCF        +SS          K A      +   ++P  
Sbjct  13   CANNCGFFGSPATXSLCSKCFCDLQIKQQNSSP---------KLAHYQTLVSTSASTPSI  63

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  592
               D   ++ S  K ++ T  + P P +++ +R S CRR+VGLTGF CRCG ++CG H
Sbjct  64   LAVDSTAVKVSRSKSEDPTAVTQPQP-QQDPDRWSSCRRRVGLTGFXCRCGFVYCGSH  120



>ref|XP_010053387.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1 [Eucalyptus grandis]
 ref|XP_010053388.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1 [Eucalyptus grandis]
 ref|XP_010053389.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1 [Eucalyptus grandis]
 gb|KCW77665.1| hypothetical protein EUGRSUZ_D01966 [Eucalyptus grandis]
Length=165

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 57/122 (47%), Gaps = 10/122 (8%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNat---taastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            C N+CG  GNPAT  +C KC+         + ++  A      P         ST    S
Sbjct  17   CANNCGFWGNPATMGLCSKCYKDLCLREQRAAAAKAAMEKSLAPDAAPAPQETSTRAAAS  76

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
            P + +P +     S+ +    +GE    P  +  NRC  C RKVGLTGF C+CG  FCG 
Sbjct  77   PSQAMPGVGA---SSSEFPPTSGE----PKSKATNRCEACNRKVGLTGFNCKCGSTFCGA  129

Query  590  HR  595
            HR
Sbjct  130  HR  131



>ref|XP_002279037.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 [Vitis vinifera]
 emb|CAN73104.1| hypothetical protein VITISV_042893 [Vitis vinifera]
Length=141

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 59/119 (50%), Gaps = 27/119 (23%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G+ ATN++C KC+                     +F  K  +      +   
Sbjct  16   CANNCGFFGSAATNNLCSKCY--------------------KEFVIKQSKEASVVENENN  55

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            TV      E+S   I+E  G ++ +P K   NRCS CR++VGLTGF+CRCG+ FC  HR
Sbjct  56   TVG-----ENSGSGIEE--GAAAGSPEKCPANRCSFCRKRVGLTGFKCRCGQTFCSMHR  107



>ref|XP_002282913.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 [Vitis vinifera]
 ref|XP_010654069.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 [Vitis vinifera]
Length=161

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 63/119 (53%), Gaps = 7/119 (6%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G+PAT ++C KC+         +S A S V    K    +  ST   + P  
Sbjct  16   CANNCGFFGSPATLNLCSKCYRDLRLKEEQASSAKSAV---EKSLSAASSSTAPLSPPAL  72

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            T+P+      +   +      + P+P+  + NRCS CR++VGLTGFRCRCG  FCG HR
Sbjct  73   TLPEAA----NEITVPAAVTAAVPSPSATQPNRCSTCRKRVGLTGFRCRCGITFCGVHR  127



>ref|XP_007150082.1| hypothetical protein PHAVU_005G125000g [Phaseolus vulgaris]
 gb|ESW22076.1| hypothetical protein PHAVU_005G125000g [Phaseolus vulgaris]
Length=156

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 9/119 (8%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G+PAT ++C KC+         SS A     +       +P +   + S  +
Sbjct  13   CVNNCGFFGSPATQNLCSKCYRDLQLKEQQSSNAKMV--LNQSLVLPAPPALVSQPSSSK  70

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            T      L+ +  +   +  + + AP +   NRC  CRR+VGLTGF+CRCG + CG HR
Sbjct  71   TA----DLDSAVVEEAPRAADEAKAPQQ---NRCMTCRRRVGLTGFKCRCGMMLCGTHR  122



>ref|XP_006487967.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 3-like [Citrus sinensis]
Length=156

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 58/125 (46%), Gaps = 21/125 (17%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G+P T ++C KCF      +  SS               S +    +T    
Sbjct  13   CVNNCGFFGSPTTQNLCSKCFRDLQLKAQQSS---------------SAKHALNQTLISS  57

Query  419  TVPDLKKLED-STDKIDEKTGESSPAPAKREV-----NRCSGCRRKVGLTGFRCRCGELF  580
            +  DL   E  +TD       E  PA     V     NRC  CRR+VGLTGF+CRCG +F
Sbjct  58   SSVDLSLRERPATDVEVAAEAEKPPAEVAAPVQSTAANRCMTCRRRVGLTGFKCRCGSVF  117

Query  581  CGEHR  595
            CG HR
Sbjct  118  CGTHR  122



>ref|XP_004421951.1| PREDICTED: AN1-type zinc finger protein 6 isoform 7 [Ceratotherium 
simum simum]
Length=181

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 70/135 (52%), Gaps = 17/135 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastss---------svaastvPIPHKFAEKS---  382
            C   CG  GNP TN MC  C+        SS         SV++ +  +P +  + S   
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGSVPE  73

Query  383  PRSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  550
             +ST   TS  + +P+ + L+    D+  +  E+  +S   P K++ NRC  CR+KVGLT
Sbjct  74   AQSTLDSTSVDKAIPETEDLQASVSDTAQQPSEEQSKSLEKP-KQKKNRCFMCRKKVGLT  132

Query  551  GFRCRCGELFCGEHR  595
            GF CRCG ++CG HR
Sbjct  133  GFECRCGNVYCGVHR  147



>ref|XP_006189680.1| PREDICTED: AN1-type zinc finger protein 6 isoform X4 [Camelus 
ferus]
 ref|XP_006208861.1| PREDICTED: AN1-type zinc finger protein 6 isoform X4 [Vicugna 
pacos]
Length=181

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 66/135 (49%), Gaps = 17/135 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaast-vPIPHKFAEKSP----------  385
            C   CG  GNP TN MC  C+        SS+   S   P     +E  P          
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAPSVSSLSESLPVQCTDGSVPE  73

Query  386  -RSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  550
             +S+   TS  + +P+ + L+    D+  +  E+  +S   P K++ NRC  CR+KVGLT
Sbjct  74   AQSSLDSTSVDKAIPETEDLQASVSDTAQQPSEEQSKSLEKP-KQKKNRCFMCRKKVGLT  132

Query  551  GFRCRCGELFCGEHR  595
            GF CRCG ++CG HR
Sbjct  133  GFECRCGNVYCGVHR  147



>ref|XP_007206025.1| hypothetical protein PRUPE_ppa012468mg [Prunus persica]
 gb|EMJ07224.1| hypothetical protein PRUPE_ppa012468mg [Prunus persica]
Length=168

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 64/123 (52%), Gaps = 17/123 (14%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPG-  415
            CVN+CG  G+  TN++C KC+       +             K A        ++ S G 
Sbjct  24   CVNNCGFFGSEKTNNLCSKCYKDFLLKQS-------------KTAADDTAVVGKKVSAGD  70

Query  416  RTVPDLKKLEDSTDKIDE---KTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  586
            + + + + ++   +++ +   + G +S  P KR  NRC+ CR++VGLTGF+CRCG+ FC 
Sbjct  71   QDLENKRHVQQVLEEVKQSQVEEGTTSENPEKRPANRCNFCRKRVGLTGFKCRCGQTFCS  130

Query  587  EHR  595
             HR
Sbjct  131  LHR  133



>ref|XP_004278382.1| PREDICTED: AN1-type zinc finger protein 6 isoform 6 [Orcinus 
orca]
Length=181

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 63/134 (47%), Gaps = 15/134 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaast-vPIPHKFAEKSP----------  385
            C   CG  GNP TN MC  C+        SS+   S   P     +E  P          
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAPSVSSLSESLPVQCTDGSVPE  73

Query  386  -RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTG  553
             +S    TS  + +P+ + L+ S  +  ++  E    S    K++ NRC  CR+KVGLTG
Sbjct  74   TQSALDSTSVDKAIPETEDLQASVSETAQQPSEEESKSLEKPKQKKNRCFMCRKKVGLTG  133

Query  554  FRCRCGELFCGEHR  595
            F CRCG ++CG HR
Sbjct  134  FECRCGNVYCGVHR  147



>ref|XP_007447131.1| PREDICTED: AN1-type zinc finger protein 6 isoform X6 [Lipotes 
vexillifer]
Length=181

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 63/134 (47%), Gaps = 15/134 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaast-vPIPHKFAEKSP----------  385
            C   CG  GNP TN MC  C+        SS+   S   P     +E  P          
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAPSVSSLSESLPVQCTDGSVPE  73

Query  386  -RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTG  553
             +S    TS  + +P+ + L+ S  +  ++  E    S    K++ NRC  CR+KVGLTG
Sbjct  74   TQSALDSTSVDKAIPETEDLQASVSETAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTG  133

Query  554  FRCRCGELFCGEHR  595
            F CRCG ++CG HR
Sbjct  134  FECRCGNVYCGVHR  147



>ref|XP_006427949.1| hypothetical protein CICLE_v10026622mg [Citrus clementina]
 ref|XP_006464510.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Citrus sinensis]
 gb|ESR41189.1| hypothetical protein CICLE_v10026622mg [Citrus clementina]
Length=171

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 61/123 (50%), Gaps = 13/123 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFR----RT  406
            C N+CG  G+ +TN++C KC+           +  S  P P    E+  ++         
Sbjct  24   CANNCGFFGSASTNNLCSKCY-------KDYLLKQSKNPNPSPIEEEKNKNKMNIEQIEA  76

Query  407  SPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  586
            +P   V + +        +DE  G SS  P KR  NRCS CR+++GLTGF+CRC + FC 
Sbjct  77   NPVGGVVENRDPAAQVVVVDE--GASSENPEKRPANRCSFCRKRIGLTGFKCRCEQTFCS  134

Query  587  EHR  595
             HR
Sbjct  135  LHR  137



>ref|XP_010913090.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Elaeis guineensis]
Length=145

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 19/125 (15%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G+PAT ++C KC++        ++ A           EKS  +T     P  
Sbjct  14   CANNCGFFGSPATLNLCSKCYHNFRLKEDQATSAKIA-------VEKSLSTTATTVVPPP  66

Query  419  TV------PDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  580
            T+      P ++ L       +EK  +      +R  NRC+ C++++GLTGFRCRCGE +
Sbjct  67   TIMLAAADPVVRTLGGIASPTEEKQQQ------ERRSNRCAACQKRMGLTGFRCRCGETY  120

Query  581  CGEHR  595
            CG HR
Sbjct  121  CGAHR  125



>gb|AFK36400.1| unknown [Medicago truncatula]
Length=151

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  479  ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            +++ + AKR VNRCSGCR++VGLTGFRCRCG+LFC EHR
Sbjct  79   QTTSSEAKRAVNRCSGCRKRVGLTGFRCRCGDLFCSEHR  117



>ref|XP_003627722.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Medicago truncatula]
 gb|AET02198.1| AN1-like zinc finger protein [Medicago truncatula]
 gb|AFK41885.1| unknown [Medicago truncatula]
Length=151

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  479  ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            +++ + AKR VNRCSGCR++VGLTGFRCRCG+LFC EHR
Sbjct  79   QTTSSEAKRAVNRCSGCRKRVGLTGFRCRCGDLFCSEHR  117



>ref|XP_009560016.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Cuculus 
canorus]
Length=180

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 67/133 (50%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaasts--------ssvaastvPIPHKFAEKSP---  385
            C   CG  GNP TN MC  C+        S        +SV++ T  +P +  E S    
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPETSVSSITESLPVQCTEGSTEET  73

Query  386  RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
            +ST   T   +TV + + L+ S  +  E T E    S    K++ NRC  CR+KVGLTGF
Sbjct  74   QSTLDSTPVDKTVSETEDLQASVSESAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGF  133

Query  557  RCRCGELFCGEHR  595
             CRCG ++CG HR
Sbjct  134  ECRCGNVYCGMHR  146



>ref|XP_009902209.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Picoides 
pubescens]
Length=180

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 67/133 (50%), Gaps = 14/133 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPRST  394
            C   CG  GNP TN MC  C+                ++SV + T  +P +  E S + T
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVTSITESLPVQCTEGSTQET  73

Query  395  ---FRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTGF  556
                  T+  +TVP+ ++L+ S  +  E T E    S    K++ NRC  CR+KVGLTG 
Sbjct  74   QSPLDSTAVDKTVPETEELQASVSENAEPTPEEQDKSLDKPKQKKNRCFMCRKKVGLTGK  133

Query  557  RCRCGELFCGEHR  595
             CRCG +FCG HR
Sbjct  134  ECRCGNVFCGMHR  146



>ref|XP_008812241.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Phoenix dactylifera]
Length=157

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 55/119 (46%), Gaps = 9/119 (8%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G+PAT ++C KC+         ++ A           EKS  +T     P  
Sbjct  14   CANNCGFFGSPATLNLCSKCYRDFRLKEDQAASAMIA-------VEKSLSAT--AAVPPS  64

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
                L   E     + E+         +R  NRC  CR++VGLTGFRCRCG  +CG HR
Sbjct  65   PAVALVAAEPVVGTLAEQAAPPLQQQQERRSNRCGACRKRVGLTGFRCRCGATYCGAHR  123



>gb|EPS60935.1| induced stolon tip protein [Genlisea aurea]
Length=156

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  494  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            P +R VNRCSGCR+KVGLTGFRCRCGELFC EHR
Sbjct  89   PLERSVNRCSGCRKKVGLTGFRCRCGELFCAEHR  122



>ref|XP_006842203.1| hypothetical protein AMTR_s00078p00168800 [Amborella trichopoda]
 gb|ERN03878.1| hypothetical protein AMTR_s00078p00168800 [Amborella trichopoda]
Length=168

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 55/123 (45%), Gaps = 16/123 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N CG  G+ +TN++C KC+              +   IP                P  
Sbjct  24   CANKCGFFGSASTNNLCSKCYKDFYLKQLKEDENITDKVIP-----------CLNNEPNA  72

Query  419  TVPDLKKLEDSTDKIDEK----TGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  586
             V D   L++S D    K     G SS  P K+  NRC  CR++VGL GFRCRCG LFC 
Sbjct  73   KV-DAANLQNSEDGKKNKGVVVDGTSSEEPQKQAPNRCRLCRKRVGLAGFRCRCGGLFCS  131

Query  587  EHR  595
             HR
Sbjct  132  THR  134



>ref|XP_009802017.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger A20 and AN1 domain-containing 
stress-associated protein 4 [Nicotiana sylvestris]
Length=152

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 57/119 (48%), Gaps = 16/119 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G+  T + C KC++    A  S        PI   F  + P      +S   
Sbjct  16   CANNCGFFGSSTTQNFCSKCYHEIXLAQQSQQK-----PIDSLFPLQPPVPA--ASSSVV  68

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             +P+L K+E     + E   +          NRCS CR+KVGLTGF+CRCG  FCG HR
Sbjct  69   VLPELLKVEKKPAAVVEPVVQP---------NRCSVCRKKVGLTGFKCRCGTTFCGTHR  118



>ref|XP_007066909.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Chelonia 
mydas]
Length=181

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 68/134 (51%), Gaps = 15/134 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastss---------svaastvPIPHKFAEKS-PR  388
            C   CG  GNP TN MC  C+        SS         SV++ T  +P +  E S P 
Sbjct  14   CSTGCGFYGNPRTNGMCSICYKEHLQRQNSSNGRISPPATSVSSITESLPVQHTEGSVPE  73

Query  389  --STFRRTSPGRTVP---DLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTG  553
              ST   T+  +TVP   DL+ L   + +   +  + S    K++ NRC  CR+KVGLTG
Sbjct  74   TPSTLDSTAVDKTVPETEDLQALVSESAESTSEEQDKSLDKPKQKKNRCFMCRKKVGLTG  133

Query  554  FRCRCGELFCGEHR  595
            F CRCG ++CG HR
Sbjct  134  FECRCGNVYCGVHR  147



>ref|XP_010261028.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nelumbo nucifera]
Length=164

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 60/119 (50%), Gaps = 12/119 (10%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G+PATN++C KC+       + +  A +        AEK    +   T    
Sbjct  24   CANNCGFFGSPATNNLCSKCYRDFFLKQSKAVAALTV------VAEKKVGESIVETKGQS  77

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V      E     ++E  G +S  P K   NRCS C+++VGLTGF+CRCG+ FC  HR
Sbjct  78   GVGP----EAKATLVEE--GTTSGDPGKLPANRCSFCKKRVGLTGFKCRCGQTFCSLHR  130



>ref|XP_006888306.1| PREDICTED: AN1-type zinc finger protein 6 isoform X6 [Elephantulus 
edwardii]
Length=181

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 70/135 (52%), Gaps = 17/135 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastss---------svaastvPIPHKFAEKS---  382
            C   CG  GNP TN MC  C+        SS         SV++ +  +P +  + +   
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGTVPE  73

Query  383  PRSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  550
             +S+   TS  + +PD + L+    D+  +  E+  +S   P K++ NRC  CR+KVGLT
Sbjct  74   AQSSLDFTSLDKAIPDTEDLQASVPDTAQQPSEEQNKSLEKP-KQKKNRCFMCRKKVGLT  132

Query  551  GFRCRCGELFCGEHR  595
            GF CRCG ++CG HR
Sbjct  133  GFECRCGNVYCGVHR  147



>ref|XP_010545575.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2-like [Tarenaya hassleriana]
Length=170

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 67/124 (54%), Gaps = 10/124 (8%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKC-----FNattaastsssvaastvPIPHKFAEKSPRSTFRR  403
            C+N+CG  G+PAT +MC KC     F     A  +S V+ S+  I +   E S  S   +
Sbjct  18   CINNCGFFGSPATMNMCSKCHKAMLFQQEQGAKLASVVSGSSSSI-NASKETSVASADVQ  76

Query  404  TSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  583
              P    P+   L+ S+   D  TG +  A  K   +RCS C ++VGLTGF+CRCG LFC
Sbjct  77   AKP--VEPNAGFLQSSSSATD--TGVAVEAKPKEGPSRCSTCNKRVGLTGFKCRCGILFC  132

Query  584  GEHR  595
            G HR
Sbjct  133  GSHR  136



>ref|XP_004249448.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like [Solanum lycopersicum]
Length=159

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 57/124 (46%), Gaps = 19/124 (15%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G+P T + C KC+N                PI   F    P S      P  
Sbjct  16   CANNCGFFGSPTTQNFCSKCYNEVYIKGGQQK------PIDSLF----PPSQL----PIP  61

Query  419  TVPDLKKLEDSTDKIDE-----KTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  583
            +   +  L++ST   +E          +  P   + NRCS CR+KVGLTGF+CRCG  FC
Sbjct  62   STSSILVLQESTAAEEEPEVVTAAVTVAVQPISAQPNRCSACRKKVGLTGFKCRCGTTFC  121

Query  584  GEHR  595
            G HR
Sbjct  122  GTHR  125



>gb|ACM68446.1| stress-associated protein 9 [Solanum lycopersicum]
Length=149

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 59/126 (47%), Gaps = 23/126 (18%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS--P  412
            C N+CG  G+P T + C KC+N                 +  K  ++ P  +    S  P
Sbjct  16   CANNCGFFGSPTTQNFCSKCYNE----------------VYIKGGQQKPIDSLFPPSQLP  59

Query  413  GRTVPDLKKLEDSTDKIDE-----KTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGEL  577
              +   +  L++ST   +E          +  P   + NRCS CR+KVGLTGF+CRCG  
Sbjct  60   IPSTSSILVLQESTAAEEEPEVVTAAVTVAVQPISAQPNRCSACRKKVGLTGFKCRCGTT  119

Query  578  FCGEHR  595
            FCG HR
Sbjct  120  FCGTHR  125



>ref|XP_009418488.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Musa acuminata subsp. malaccensis]
Length=164

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 65/120 (54%), Gaps = 7/120 (6%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C+N+CG  G+ AT +MC KC          + + AS+  I +  + K P  T      G 
Sbjct  17   CINNCGFFGSAATMNMCSKCHKDMMLKQEQAKLDASS--IGNLASGKGPVIT-GNADVGT  73

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREV-NRCSGCRRKVGLTGFRCRCGELFCGEHR  595
               + K L     ++ +++G S    AK E  NRC+ CR++VGLTGFRCRCG+LFC  HR
Sbjct  74   GYLEAKSL---LAQVSDESGSSDIREAKAEGPNRCNTCRKRVGLTGFRCRCGDLFCSVHR  130



>ref|XP_011080265.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
 ref|XP_011080266.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
Length=172

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 61/134 (46%), Gaps = 28/134 (21%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G+ A  +MC KC+         +           K A  S  +    +S G 
Sbjct  18   CVNNCGFFGSAANMNMCSKCYKDLILKQEQA-----------KLAASSIENIVNGSSSGN  66

Query  419  ----TVPDLKKLEDSTDKIDEKT-----------GESSPAPAKREVNRCSGCRRKVGLTG  553
                 V D   ++  TD ++ K             E++    K   NRCS C+++VGLTG
Sbjct  67   EQESVVADAAIMQ--TDLVEAKAISLPSINTSSFAEAAEPKTKEGPNRCSTCKKRVGLTG  124

Query  554  FRCRCGELFCGEHR  595
            F+CRCG LFCG HR
Sbjct  125  FKCRCGYLFCGSHR  138



>ref|XP_006345467.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum tuberosum]
Length=167

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 54/133 (41%), Gaps = 30/133 (23%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G  AT +MC KC+         +            FA  S  S    +S   
Sbjct  17   CVNNCGFFGTAATMNMCSKCYKDMIFKQEQA-----------NFAASSIESFVNGSSSAS  65

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAP--------------AKREVNRCSGCRRKVGLTGF  556
                  K  D    + E   ES   P              AK   NRCS CRR+VGLTGF
Sbjct  66   V-----KAVDVAVTVQEGPAESLVIPTQVAAPVESVQVEKAKEGPNRCSTCRRRVGLTGF  120

Query  557  RCRCGELFCGEHR  595
             CRCG LFC  HR
Sbjct  121  NCRCGNLFCSAHR  133



>dbj|BAJ94586.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99722.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=160

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 58/121 (48%), Gaps = 18/121 (15%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G+  TN+MC KC+     A+T          I    AEK     F   S   
Sbjct  22   CVNNCGFFGSSMTNNMCSKCYRDFIKATT----------IAAPVAEKK---VFTVASSSN  68

Query  419  TVPDLKKLED--STDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  592
               +  K ++  +   +D +  +  P P     NRC  CR+KVGLTGF+CRCG  FC  H
Sbjct  69   VTLEQAKADEVGAVPLVDSQAAQEPPKPPS---NRCLSCRKKVGLTGFQCRCGGTFCSMH  125

Query  593  R  595
            R
Sbjct  126  R  126



>gb|KDO50474.1| hypothetical protein CISIN_1g030772mg [Citrus sinensis]
Length=171

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 58/119 (49%), Gaps = 5/119 (4%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G+  TN++C KC+          S   +  PI  +  +          +P  
Sbjct  24   CANNCGFFGSANTNNLCSKCY---KDYLLKQSKNPNPSPIEEEKNKNKTNIEQNEANPVG  80

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V + +        +DE  G SS  P KR  NRCS CR+++GLTGF+CRC + FC  HR
Sbjct  81   GVVENRDPAAQVVVVDE--GASSENPEKRPANRCSFCRKRIGLTGFKCRCEQTFCSLHR  137



>gb|ACM68454.1| stress-associated protein 4 [Solanum pennellii]
Length=161

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 61/125 (49%), Gaps = 14/125 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G  AT +MC KC+         ++ AAS++     F   S  ++ +      
Sbjct  11   CVNNCGFFGTAATMNMCSKCYKDMIFKQEQANFAASSI---ESFVNGSSNASVKAVDVAV  67

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAP------AKREVNRCSGCRRKVGLTGFRCRCGELF  580
            TV      E   + +   T  ++P        AK   NRCS CRR+VGLTGF CRCG LF
Sbjct  68   TVQ-----EGPAESLVIPTQVAAPVESEQVEKAKEGPNRCSTCRRRVGLTGFNCRCGNLF  122

Query  581  CGEHR  595
            C  HR
Sbjct  123  CSAHR  127



>ref|XP_006850149.1| hypothetical protein AMTR_s00022p00236720 [Amborella trichopoda]
 gb|ERN11730.1| hypothetical protein AMTR_s00022p00236720 [Amborella trichopoda]
Length=145

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  449  STDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            S++KI  K  E SP    R  NRC  CR++VGLTGFRCRCG+LFCGEHR
Sbjct  63   SSEKISRKRPEESPENPTRYPNRCQSCRKRVGLTGFRCRCGDLFCGEHR  111



>ref|XP_004594633.1| PREDICTED: AN1-type zinc finger protein 6 isoform X4 [Ochotona 
princeps]
Length=181

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 64/135 (47%), Gaps = 17/135 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIP-HKFAEKSP----------  385
            C   CG  GNP TN MC  C+        SS+   S    P  + +E  P          
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEYLQRQNSSNGRISPPAAPASRLSESLPAQCADGSGPE  73

Query  386  -RSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  550
              S    TS  +  P+ + L+    D+  +  E+  +S   P K++ NRC  CR+KVGLT
Sbjct  74   ASSQVDSTSVDKAAPETEDLQASVSDAAQQPSEEQNKSLEKP-KQKKNRCFMCRKKVGLT  132

Query  551  GFRCRCGELFCGEHR  595
            GF CRCG ++CG HR
Sbjct  133  GFECRCGNVYCGVHR  147



>ref|XP_006660259.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Oryza brachyantha]
Length=118

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 49/122 (40%), Gaps = 56/122 (46%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            +T C N CG  GNPAT ++CQ CF                  +      K+ RS+     
Sbjct  19   MTLCANSCGFPGNPATKNLCQNCF------------------LAASMESKASRSS-----  55

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
                                             VNRC  CR++VGLTGFRCRCGELFCG 
Sbjct  56   ---------------------------------VNRCHSCRKRVGLTGFRCRCGELFCGA  82

Query  590  HR  595
            HR
Sbjct  83   HR  84



>ref|XP_006046437.1| PREDICTED: AN1-type zinc finger protein 6-like isoform X2 [Bubalus 
bubalis]
Length=240

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 63/134 (47%), Gaps = 15/134 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaast-vPIPHKFAEKSP----------  385
            C   CG  GNP TN MC  C+        SS+   S   P     +E  P          
Sbjct  73   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAPSVTSLSESLPVQCTDGSVPE  132

Query  386  -RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTG  553
             +S    TS  + +P+ + L+ S  +  ++  E    S    K++ NRC  CR+KVGLTG
Sbjct  133  AQSALDSTSVDKAIPETEDLQASVSETAQQASEEQSKSLEKPKQKKNRCFMCRKKVGLTG  192

Query  554  FRCRCGELFCGEHR  595
            F C+CG ++CG HR
Sbjct  193  FECQCGNVYCGVHR  206



>gb|ACM68441.1| stress-associated protein 4 [Solanum lycopersicum]
Length=161

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 56/133 (42%), Gaps = 30/133 (23%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G  AT +MC KC+         +            FA  S  S F   S   
Sbjct  11   CVNNCGFFGTAATMNMCSKCYKDMIFKQEQA-----------NFAASSIES-FVNGSSNA  58

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAP--------------AKREVNRCSGCRRKVGLTGF  556
            +V    K  D    + E   ES   P              AK   NRCS CRR+VGLTGF
Sbjct  59   SV----KAVDVAVTVQEGPAESLVIPTQVAVPVESEQVEKAKEGPNRCSTCRRRVGLTGF  114

Query  557  RCRCGELFCGEHR  595
             CRCG LFC  HR
Sbjct  115  NCRCGNLFCSAHR  127



>ref|XP_011093525.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Sesamum indicum]
Length=168

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 60/129 (47%), Gaps = 21/129 (16%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP--  412
            CVN+CG  G  AT +MC KC+         +           K A  S +S    +S   
Sbjct  17   CVNNCGFFGTAATMNMCSKCYKDLVMKQEQA-----------KLAASSIQSIVNGSSSIE  65

Query  413  GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVN--------RCSGCRRKVGLTGFRCRC  568
            G  V  +K+ + ++ ++   T + S A    E +        RC  CR++VGLTGF CRC
Sbjct  66   GTNVAVVKEAQAASSEVTVATIQISSASPASETSEEVKDGPKRCGACRKRVGLTGFICRC  125

Query  569  GELFCGEHR  595
            G ++C  HR
Sbjct  126  GSIYCAVHR  134



>ref|XP_004229614.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Solanum lycopersicum]
Length=167

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 56/133 (42%), Gaps = 30/133 (23%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G  AT +MC KC+         +            FA  S  S F   S   
Sbjct  17   CVNNCGFFGTAATMNMCSKCYKDMIFKQEQA-----------NFAASSIES-FVNGSSNA  64

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREV--------------NRCSGCRRKVGLTGF  556
            +V    K  D    + E   ES   P +  V              NRCS CRR+VGLTGF
Sbjct  65   SV----KAVDVAVTVQEGPAESLVIPTQVAVPVESEQVEKAKEGPNRCSTCRRRVGLTGF  120

Query  557  RCRCGELFCGEHR  595
             CRCG LFC  HR
Sbjct  121  NCRCGNLFCSAHR  133



>ref|XP_004957171.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Setaria italica]
Length=169

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 65/122 (53%), Gaps = 4/122 (3%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS  409
            IT C N+CG  GNPAT ++CQ CF+A TA+ +S + ++S+                   +
Sbjct  18   ITLCANNCGFPGNPATQNLCQSCFSAATASMSSPTSSSSS----VPAPAAVAAQPRPALA  73

Query  410  PGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  589
                V  +     + D         +P  A+  VNRCS CR++VGLTGF CRCGELFCG 
Sbjct  74   GAPPVELVSPAGAAADWPAAAAPAPAPEAARASVNRCSSCRKRVGLTGFWCRCGELFCGA  133

Query  590  HR  595
            HR
Sbjct  134  HR  135



>ref|XP_002312908.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE86863.1| zinc finger family protein [Populus trichocarpa]
Length=159

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 62/124 (50%), Gaps = 17/124 (14%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G+PAT ++C KC+     +           P+    A  S  S    +SP  
Sbjct  14   CVNNCGFFGSPATQNLCSKCYGDLRQSQ----------PLNQLLAPSSSASVSSFSSP--  61

Query  419  TVPDLKK-----LEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  583
            TV  +K      L    D+  E   E +    +++ NRC  CRR+VGLTGF CRCG +FC
Sbjct  62   TVDVIKNQIAPVLVVEGDEKGEFKAEPTVVVPQQKPNRCLTCRRRVGLTGFNCRCGMVFC  121

Query  584  GEHR  595
            G HR
Sbjct  122  GTHR  125



>gb|ABK21092.1| unknown [Picea sitchensis]
 gb|ABR17716.1| unknown [Picea sitchensis]
Length=181

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 59/128 (46%), Gaps = 9/128 (7%)
 Frame = +2

Query  233  TPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP  412
            T C N+CG  G+ AT ++C KC+         ++ A +   +   FA  SP      +SP
Sbjct  22   TLCANNCGFFGSSATRNLCSKCYRDLIMKEAQATSAMAA--VEKSFAAGSPMDEVPLSSP  79

Query  413  GRTVPDLKKL-------EDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCG  571
               V   +           S    D  +  SSP P     NRC  CR++VGLTGF+CRC 
Sbjct  80   DAIVQQNRVQISAAVAGVSSVQLADSGSSSSSPQPPAETPNRCFSCRKRVGLTGFKCRCE  139

Query  572  ELFCGEHR  595
              FCG HR
Sbjct  140  NTFCGLHR  147



>ref|XP_002528717.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF33629.1| zinc finger protein, putative [Ricinus communis]
Length=166

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 60/120 (50%), Gaps = 2/120 (2%)
 Frame = +2

Query  236  PCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPG  415
            PCVN+CG  G+ AT ++C KC+              ++  I    +  SP S        
Sbjct  15   PCVNNCGFFGSAATMNLCSKCYRDYCLKEQHQHQQEAS--IKASLSVPSPSSAAAIVDNS  72

Query  416  RTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            +  P    +  S + ++E+      A  +++ NRC  CR++VGLTGFRCRC  +FCG HR
Sbjct  73   QPAPSPDDVLRSPEAVEEEVKVVVTAIEQKQPNRCFVCRKRVGLTGFRCRCESMFCGAHR  132



>ref|XP_011093524.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X1 [Sesamum indicum]
Length=173

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 63/129 (49%), Gaps = 21/129 (16%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP--  412
            CVN+CG  G  AT +MC KC+         +           K A  S +S    +S   
Sbjct  22   CVNNCGFFGTAATMNMCSKCYKDLVMKQEQA-----------KLAASSIQSIVNGSSSIE  70

Query  413  GRTVPDLKKLEDSTDKIDEKTGE-SSPAPAKR---EVN----RCSGCRRKVGLTGFRCRC  568
            G  V  +K+ + ++ ++   T + SS +PA     EV     RC  CR++VGLTGF CRC
Sbjct  71   GTNVAVVKEAQAASSEVTVATIQISSASPASETSEEVKDGPKRCGACRKRVGLTGFICRC  130

Query  569  GELFCGEHR  595
            G ++C  HR
Sbjct  131  GSIYCAVHR  139



>ref|XP_003540534.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Glycine max]
Length=135

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 10/79 (13%)
 Frame = +2

Query  359  PHKFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRK  538
            P +F + +  +T  R SP R++P    L+D +     +T +++ +  KR V+RCS CRR+
Sbjct  33   PSRFFDATTPATSSR-SPKRSLP----LDDES-----QTDQTASSEPKRVVSRCSCCRRR  82

Query  539  VGLTGFRCRCGELFCGEHR  595
            VGLTGFRCRCG+LFC EHR
Sbjct  83   VGLTGFRCRCGDLFCAEHR  101



>ref|NP_001229848.1| AN1-type zinc finger protein 6 isoform d [Homo sapiens]
Length=181

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 69/135 (51%), Gaps = 17/135 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastss---------svaastvPIPHKFAEKS---  382
            C   CG  GNP TN MC  C+        SS         SV++ +  +P +  + S   
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGSVPE  73

Query  383  PRSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  550
             +S    TS  + VP+ + ++    D+  +  E+  +S   P K++ NRC  CR+KVGLT
Sbjct  74   AQSALDSTSVDKAVPETEDVQASVSDTAQQPSEEQSKSLEKP-KQKKNRCFMCRKKVGLT  132

Query  551  GFRCRCGELFCGEHR  595
            GF CRCG ++CG HR
Sbjct  133  GFECRCGNVYCGVHR  147



>ref|NP_001058985.1| Os07g0168800 [Oryza sativa Japonica Group]
 sp|Q7Y1W9.1|SAP9_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 9; Short=OsSAP9 [Oryza sativa Japonica 
Group]
 gb|AAP37480.1| putative A20/AN1-type zinc finger protein ZFP177 [Oryza sativa 
Japonica Group]
 dbj|BAD31780.1| putative zinc finger protein 216 [Oryza sativa Japonica Group]
 dbj|BAF20899.1| Os07g0168800 [Oryza sativa Japonica Group]
 gb|EAZ02907.1| hypothetical protein OsI_25046 [Oryza sativa Indica Group]
 gb|EAZ38825.1| hypothetical protein OsJ_23237 [Oryza sativa Japonica Group]
 dbj|BAH00672.1| unnamed protein product [Oryza sativa Japonica Group]
Length=161

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 59/119 (50%), Gaps = 14/119 (12%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G+  TN+MC KC+      +T ++      P+  K A     S+     P +
Sbjct  23   CVNNCGFFGSSMTNNMCSKCYRDFVKVTTMAA------PVVEKKAFTPASSSKTPLEPAK  76

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
              PD        DK      +++  P K   NRC  CR+KVGLTGF+CRCG  FC  HR
Sbjct  77   --PDEVPAAAVEDK------QAAQEPPKPPSNRCLSCRKKVGLTGFQCRCGGTFCSTHR  127



>gb|EMT17725.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
6 [Aegilops tauschii]
Length=161

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 63/120 (53%), Gaps = 16/120 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C+N+CG  GN  T +MC KC+  T  A + + +      + +K A          +SP  
Sbjct  23   CINNCGFFGNRMTENMCSKCYRDTVKAKSMALL------VENKTAAAVA------SSPTP  70

Query  419  TVPDLKKLEDSTDKIDEKTG-ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V ++K    ++ K  ++   E +P P     NRC  CR+KVGLTGF+CRCG+ FC  HR
Sbjct  71   MVAEIKDEASASAKEGKRVAEEEAPKPPS---NRCLSCRKKVGLTGFKCRCGDTFCSMHR  127



>ref|XP_007145317.1| hypothetical protein PHAVU_007G228900g [Phaseolus vulgaris]
 gb|ESW17311.1| hypothetical protein PHAVU_007G228900g [Phaseolus vulgaris]
Length=171

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 62/125 (50%), Gaps = 9/125 (7%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G+ AT ++C KC+ A        +   ST+      + K+P ST   + P  
Sbjct  16   CVNNCGFFGSSATMNLCSKCYGAIRLKEQDDATTKSTIEAALSSSAKTPLST---SPPAA  72

Query  419  TVPDLKKL------EDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  580
             V  L K       E +     +    SS      + NRC+ CR++VGLTGF+CRCG  F
Sbjct  73   AVDVLVKASPPLPAEVTVAVPVQVPVTSSSITGSAQPNRCAACRKRVGLTGFKCRCGVTF  132

Query  581  CGEHR  595
            CG HR
Sbjct  133  CGAHR  137



>gb|EYU31356.1| hypothetical protein MIMGU_mgv1a014938mg [Erythranthe guttata]
Length=173

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 61/134 (46%), Gaps = 26/134 (19%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP-G  415
            CVN+CG  G PAT +MC KC+         +           +FA  S +S    +S  G
Sbjct  17   CVNNCGFFGTPATLNMCSKCYKDVVLKQERA-----------EFAASSFQSIINGSSKNG  65

Query  416  RTVPDLKKL------EDSTDKIDEKTGESSPAPA--------KREVNRCSGCRRKVGLTG  553
              V D            S+D ++     SS +PA        K+   RC  C ++VGLTG
Sbjct  66   AKVSDAATAVIAEANAISSDSMEASRRTSSESPAIGGSDEANKQGPKRCGACNKRVGLTG  125

Query  554  FRCRCGELFCGEHR  595
            F CRCG +FCG HR
Sbjct  126  FNCRCGSMFCGVHR  139



>gb|ACJ84133.1| unknown [Medicago truncatula]
Length=151

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  479  ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            +++ + AKR VNRCSGCR++VGLTGF CRCG+LFC EHR
Sbjct  79   QTTSSEAKRAVNRCSGCRKRVGLTGFHCRCGDLFCSEHR  117



>ref|XP_002466323.1| hypothetical protein SORBIDRAFT_01g005640 [Sorghum bicolor]
 gb|EER93321.1| hypothetical protein SORBIDRAFT_01g005640 [Sorghum bicolor]
Length=180

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 60/135 (44%), Gaps = 28/135 (21%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNat--------------taastsssvaastvPIPHKFAE  376
            C N CG  GN AT  MC KC+                     T+++ A S  P P   AE
Sbjct  24   CANGCGYFGNAATGGMCSKCYRKHAAAGATATSTSTTTADKKTTTAQAVSETPAP---AE  80

Query  377  KSPR--STFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  550
            K  +       +SPG  V +       +         + P P K+  NRCS CR+KVGL 
Sbjct  81   KKAKIACAVASSSPGGGVDNAGAARAPS---------TEPQPVKQTANRCSACRKKVGLL  131

Query  551  GFRCRCGELFCGEHR  595
            GFRC CGE FCG HR
Sbjct  132  GFRCCCGETFCGAHR  146



>ref|XP_010268591.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nelumbo nucifera]
Length=163

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 54/119 (45%), Gaps = 13/119 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G PATN++C KC+       +             K A  S  +  +   P  
Sbjct  24   CSNNCGFFGTPATNNLCSKCYRDFFLKQS-------------KVAAASVVAERKVEEPIV  70

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
                   +         + G +S  P K   NRCS CR++VGLTGF+CRCG+ FC  HR
Sbjct  71   EKAGQVGVGQEAKATLSEEGTTSGDPGKLPANRCSFCRKRVGLTGFKCRCGQTFCSLHR  129



>ref|XP_004644513.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Octodon 
degus]
Length=182

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 66/136 (49%), Gaps = 18/136 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssv-----aastvPIPHKFAEK--------  379
            C   CG  GNP TN MC  C+        SSS      AAS   +P     +        
Sbjct  14   CSTGCGFCGNPRTNGMCSVCYKEHLQRQNSSSGRISPPAASVSSLPESLPAQCTGGSMPE  73

Query  380  SPRSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGL  547
            +P +    TS  +  P+ + L+    D+  +  E+  +S   P K++ NRC  CR+KVGL
Sbjct  74   APSALVDNTSVDKAAPENEDLQASASDTAQQPSEEQSKSLEKP-KQKKNRCLMCRKKVGL  132

Query  548  TGFRCRCGELFCGEHR  595
            TGF CRCG ++CG HR
Sbjct  133  TGFECRCGNVYCGVHR  148



>ref|XP_004017839.1| PREDICTED: AN1-type zinc finger protein 6 isoform 4 [Ovis aries]
Length=196

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 66/149 (44%), Gaps = 30/149 (20%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNa-------------------------ttaastsssvaa  343
            C   CG  GNP TN MC  C+                             +A  S++ + 
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPVQCTDGSVPEAQSALDSAASSM  73

Query  344  stvPIPHK--FAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKRE  508
               P+ ++   +E    S    TS  + +P+ + L+ S  +  ++  E    S    K++
Sbjct  74   QPSPVSNQSLLSESVASSQVDSTSVDKAIPETEALQASVSETAQQASEEQSKSLEKPKQK  133

Query  509  VNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             NRC  CR+KVGLTGF CRCG ++CG HR
Sbjct  134  KNRCFMCRKKVGLTGFECRCGNVYCGVHR  162



>dbj|BAK01503.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 62/120 (52%), Gaps = 16/120 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  GN  T +MC KC+  T  A   +++      + +K A          +SP  
Sbjct  23   CVNNCGFFGNRMTENMCSKCYRDTAKAKRMATL------VENKTAAAVA------SSPTP  70

Query  419  TVPDLKKLEDSTDKIDEKTG-ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V ++K     + K  ++   E +P P     NRC  CR+KVGLTGF+CRCG+ FC  HR
Sbjct  71   LVAEMKDEASGSAKEGKQVAEEEAPKPPS---NRCLSCRKKVGLTGFKCRCGDTFCSMHR  127



>ref|XP_009412393.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412394.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=191

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 62/121 (51%), Gaps = 14/121 (12%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS--P  412
            C N+CG  G+PATN++C KC+     + + +S+    +P         P    +R    P
Sbjct  49   CANNCGFFGSPATNNLCSKCYKDYFLSKSKASMETLVIP---------PALESKRVDEKP  99

Query  413  GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  592
            G      K +  S +    + G   P P K+  NRCS C ++VGL GF+CRCGE+FC  H
Sbjct  100  GGDDGIAKSVNSSEEGATSEGG--GPLP-KKNPNRCSFCNKRVGLMGFKCRCGEVFCSIH  156

Query  593  R  595
            R
Sbjct  157  R  157



>ref|XP_009601977.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 [Nicotiana tomentosiformis]
Length=152

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 56/119 (47%), Gaps = 16/119 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G+  T + C KC++    A  S        PI   F  + P      +S   
Sbjct  16   CANNCGFFGSSTTQNFCSKCYHEIYLAQQSQQK-----PIDSLFPLQPPVPA--ASSSVV  68

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             +P+  KLE     + E   +          NRCS CR+KVGLTGF+CRCG  FCG HR
Sbjct  69   VLPEPLKLEKKPAAVVEPVVQP---------NRCSVCRKKVGLTGFKCRCGTTFCGTHR  118



>ref|XP_004324566.1| PREDICTED: AN1-type zinc finger protein 6-like isoform 3 [Tursiops 
truncatus]
Length=181

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 62/134 (46%), Gaps = 15/134 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaast-vPIPHKFAEKSP----------  385
            C   CG  GNP TN MC  C+        SS+   S   P     +E  P          
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAPSVSSLSESLPVQCTDGSVPE  73

Query  386  -RSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGCRRKVGLTG  553
             +S    TS  + + + + L+ S  +  ++  E    S    K++ NRC  CR+KVGLTG
Sbjct  74   TQSALDSTSVDKAISETEDLQASVSETAQQPSEEESKSLEKPKQKKNRCFMCRKKVGLTG  133

Query  554  FRCRCGELFCGEHR  595
            F CRCG ++CG HR
Sbjct  134  FECRCGNVYCGVHR  147



>ref|XP_009412395.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009412396.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009412397.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009412398.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=166

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 62/121 (51%), Gaps = 14/121 (12%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTS--P  412
            C N+CG  G+PATN++C KC+     + + +S+    +P         P    +R    P
Sbjct  24   CANNCGFFGSPATNNLCSKCYKDYFLSKSKASMETLVIP---------PALESKRVDEKP  74

Query  413  GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  592
            G      K +  S +    + G   P P K+  NRCS C ++VGL GF+CRCGE+FC  H
Sbjct  75   GGDDGIAKSVNSSEEGATSEGG--GPLP-KKNPNRCSFCNKRVGLMGFKCRCGEVFCSIH  131

Query  593  R  595
            R
Sbjct  132  R  132



>gb|EMS47592.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
6 [Triticum urartu]
Length=267

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 62/120 (52%), Gaps = 16/120 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C+N+CG  GN  T +MC KC+  T  A   + +      + +K A          +SP  
Sbjct  129  CINNCGFFGNRMTENMCSKCYRDTVKAKKMALL------VENKTAAAVA------SSPTP  176

Query  419  TVPDLKKLEDSTDKIDEKTG-ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V ++K    ++ K  ++   E +P P     NRC  CR+KVGLTGF+CRCG+ FC  HR
Sbjct  177  MVAEIKDEASASAKEGKQVAEEEAPKPPS---NRCLSCRKKVGLTGFKCRCGDTFCSMHR  233



>ref|XP_003784626.1| PREDICTED: AN1-type zinc finger protein 6-like isoform 2 [Otolemur 
garnettii]
Length=181

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 64/135 (47%), Gaps = 17/135 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsss------------vaastvPIPHKFAEKS  382
            C   CG  GNP TN MC  C+        SS+            ++ S        +E  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPXXXXXXSESV  73

Query  383  PRSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  550
              S    TS  + VP+ + L+    D+  +  E+  +S   P K++ NRC  CR+KVGLT
Sbjct  74   ASSQVDSTSVDKAVPETEDLQASVSDTAQQPSEEQSKSLEKP-KQKKNRCFMCRKKVGLT  132

Query  551  GFRCRCGELFCGEHR  595
            GF CRCG ++CG HR
Sbjct  133  GFECRCGNVYCGVHR  147



>ref|XP_006870970.1| PREDICTED: AN1-type zinc finger protein 6 isoform X6 [Chrysochloris 
asiatica]
Length=181

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 70/135 (52%), Gaps = 17/135 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast---------sssvaastvPIPHKFAEKS---  382
            C   CG  GNP TN MC  C+                 ++SV++ +  +P + ++ S   
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAASVSSLSESLPVQCSDGSVPE  73

Query  383  PRSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  550
             +S+   TS  + + + + L+    D+  +  E+  +S   P K++ NRC  CR+KVGLT
Sbjct  74   AQSSLDSTSLDKAISETEDLQASVPDTAQQPSEEQTKSLEKP-KQKKNRCFMCRKKVGLT  132

Query  551  GFRCRCGELFCGEHR  595
            GF CRCG ++CG HR
Sbjct  133  GFECRCGNIYCGAHR  147



>ref|XP_005889815.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Bos mutus]
Length=196

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 66/149 (44%), Gaps = 30/149 (20%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNa-------------------------ttaastsssvaa  343
            C   CG  GNP TN MC  C+                             +A  S++ + 
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPVQCTDGSVPEAQSALDSTASSM  73

Query  344  stvPIPHK--FAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKRE  508
               P+ ++   +E    S    TS  + +P+ + L+ S  +  ++  E    S    K++
Sbjct  74   QPSPVSNQSLLSESVASSQVDSTSVDKAIPETEDLQASVSETAQQASEEQSKSLEKPKQK  133

Query  509  VNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             NRC  CR+KVGLTGF CRCG ++CG HR
Sbjct  134  KNRCFMCRKKVGLTGFECRCGNVYCGVHR  162



>ref|XP_004088382.1| PREDICTED: AN1-type zinc finger protein 6 [Nomascus leucogenys]
 ref|XP_004088384.1| PREDICTED: AN1-type zinc finger protein 6 [Nomascus leucogenys]
Length=195

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 67/149 (45%), Gaps = 31/149 (21%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNa------------------------ttaastsssvaas  346
            C   CG  GNP TN MC  C+                            +   S+S +  
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPVQCTDGSVPEAQSTLDSTSSSMQ  73

Query  347  tvPIPHK--FAEKSPRSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKRE  508
              P+ ++   +E    S    TS  + VP+ + L+    D+  +  E+  +S   P K++
Sbjct  74   PSPVSNQSLLSESVASSQLDSTSVDKAVPETEDLQASVSDTAQRPSEEQSKSLEKP-KQK  132

Query  509  VNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             NRC  CR+KVGLTGF CRCG ++CG HR
Sbjct  133  KNRCFMCRKKVGLTGFECRCGNVYCGVHR  161



>gb|KDP35279.1| hypothetical protein JCGZ_09438 [Jatropha curcas]
Length=133

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 59/126 (47%), Gaps = 45/126 (36%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  GN  TN++C KC+                     KF  K P+ T        
Sbjct  12   CVNNCGFFGNAKTNNLCSKCY--------------------KKFLLKQPQQT--------  43

Query  419  TVPDLKKLEDSTDKI--DEKTGESS-----PAPAKREVNRCSGCRRKVGLTGFRCRCGEL  577
                  ++E +   +   E+TG +S     PA A    NRCS CR++VGLTGF CRCG+ 
Sbjct  44   ------QIESTIAPVAGGEQTGANSSENRPPAAA----NRCSFCRKRVGLTGFNCRCGQT  93

Query  578  FCGEHR  595
            FC  HR
Sbjct  94   FCSLHR  99



>ref|XP_007950007.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Orycteropus 
afer afer]
Length=181

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 70/135 (52%), Gaps = 17/135 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastss---------svaastvPIPHKFAEKS---  382
            C   CG  GNP TN MC  C+        SS         SV++ +  +P +  + +   
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPANSVSSLSESLPVQCTDGNVPE  73

Query  383  PRSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLT  550
             +S+   TS  + +P+ + L+    D+  +  E+  +S   P K++ NRC  CR+KVGLT
Sbjct  74   AQSSLDFTSLDKAIPETEDLQASVPDTAQQPSEEQNKSLEKP-KQKKNRCFMCRKKVGLT  132

Query  551  GFRCRCGELFCGEHR  595
            GF CRCG ++CG HR
Sbjct  133  GFECRCGNVYCGVHR  147



>emb|CDJ89180.1| Zinc finger domain containing protein [Haemonchus contortus]
Length=211

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 64/140 (46%), Gaps = 22/140 (16%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N CG  G+ A   +C KCF  +   +  ++  + TVP+P   +            P +
Sbjct  39   CRNGCGFFGSQANEGLCSKCFKDSIKRNQDTARLSPTVPMPMTASSSLMSDCPMSEPPAQ  98

Query  419  T-------VPDLKKLEDSTDKIDEKTGESS--------------PAPAKREVNRCSGCRR  535
            T         D+    +S + I     ESS              PAP K+  NRC  C++
Sbjct  99   TCAQAAHAASDVTAKLESAEAIAASQPESSCALMSESSTTSVDAPAPVKK-ANRCQMCKK  157

Query  536  KVGLTGFRCRCGELFCGEHR  595
            +VGLTGF CRCG L+CGEHR
Sbjct  158  RVGLTGFTCRCGGLYCGEHR  177



>ref|XP_004536532.1| PREDICTED: AN1-type zinc finger protein 6-like isoform X2 [Ceratitis 
capitata]
 ref|XP_004536533.1| PREDICTED: AN1-type zinc finger protein 6-like isoform X3 [Ceratitis 
capitata]
Length=192

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 67/154 (44%), Gaps = 42/154 (27%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C + CG  GNPAT+ +C  C+  +        V+++ V +P       P  TF   SP  
Sbjct  12   CRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVP----SPQPSPTF---SPAI  64

Query  419  TV-----PDLKKLEDSTDKIDEKTGESSPAPAKREV------------------------  511
            T+     P ++ L+   ++I EK  E S A    E                         
Sbjct  65   TITNTAQPTVQSLQQQHNEIKEKINEESAAKTSTEAAAAAGPSTSTSQTAEEDKDKEEDK  124

Query  512  ------NRCSGCRRKVGLTGFRCRCGELFCGEHR  595
                  NRC+ CR+KVGLTGF+CRCG L+C  HR
Sbjct  125  DAKKKKNRCAECRKKVGLTGFQCRCGGLYCAVHR  158



>ref|XP_011044990.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 3-like [Populus euphratica]
 ref|XP_011044999.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 3-like [Populus euphratica]
Length=159

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 62/125 (50%), Gaps = 19/125 (15%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G+PAT ++C KC+     +           P+    A  S  S    +SP  
Sbjct  14   CVNNCGFFGSPATQNLCSKCYGDLRRSQ----------PLNQLLAPSSSASVSSFSSP--  61

Query  419  TVPDLKK------LEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  580
             + D+ K      L    D+  E   E +    +++ NRC  CRR+VGLTGF CRCG +F
Sbjct  62   -IVDVIKNQIAPVLVVEGDEKGEFKAEPTVVVPQQKPNRCLTCRRRVGLTGFNCRCGMVF  120

Query  581  CGEHR  595
            CG HR
Sbjct  121  CGTHR  125



>gb|ADK63395.1| AN1-like zinc finger protein [Brassica rapa]
Length=168

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 61/125 (49%), Gaps = 14/125 (11%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C+N+CG  G+ AT +MC KC           +  AS           SP +  + T    
Sbjct  18   CINNCGFFGSAATMNMCSKCHKTILFQQEHGAKLASA-------VSGSPSNILKETFTAA  70

Query  419  TV----PDLKKLEDSTDKIDEKT--GESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELF  580
             V      ++ +  S   + E    GES+  P K   +RC+ C ++VGLTGF+CRCG+LF
Sbjct  71   LVDAGTKSIEPVAVSVQAVAEVVAPGESAAKP-KEGPSRCTTCNKRVGLTGFKCRCGDLF  129

Query  581  CGEHR  595
            CG HR
Sbjct  130  CGTHR  134



>emb|CDY25219.1| BnaC06g04440D [Brassica napus]
Length=168

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 59/124 (48%), Gaps = 12/124 (10%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C+N+CG  G+ AT +MC KC           +  AS           SP +  + T    
Sbjct  18   CINNCGFFGSAATMNMCSKCHKTMLFQQEQGAKLASA-------VSGSPSNILKETFTAA  70

Query  419  TV----PDLKKLEDSTDKIDEKTG-ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  583
             V      ++ +  S   + E    E + A  K   +RC+ C ++VGLTGF+CRCG+LFC
Sbjct  71   LVDAETKSVEPMAVSVQAVAEVVAPEEAAAKPKEGPSRCTTCNKRVGLTGFKCRCGDLFC  130

Query  584  GEHR  595
            G HR
Sbjct  131  GTHR  134



>gb|AAQ84334.1| stress-associated protein 8 [Oryza sativa Indica Group]
Length=171

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 58/132 (44%), Gaps = 24/132 (18%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C+N+CG  G+ AT +MC KC          +           K A  S  S       G+
Sbjct  17   CINNCGFFGSAATMNMCSKCHKEMIMKQEQA-----------KLAASSIDSIVNGGDSGK  65

Query  419  TVPDLKKLEDSTDKIDEKTGESSPA------------PAKREV-NRCSGCRRKVGLTGFR  559
                    E +  +++ KT  + PA            P  RE  NRCS CR++VGLTGF 
Sbjct  66   EPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTCRKRVGLTGFN  125

Query  560  CRCGELFCGEHR  595
            CRCG L+C  HR
Sbjct  126  CRCGNLYCAMHR  137



>ref|NP_001058066.1| Os06g0612800 [Oryza sativa Japonica Group]
 sp|A2YEZ6.2|SAP8_ORYSI RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 8; Short=OsSAP8; AltName: Full=Stress-associated 
protein 3 [Oryza sativa Indica Group]
 sp|A3BDI8.1|SAP8_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 8; Short=OsSAP8; AltName: Full=Stress-associated 
protein 3 [Oryza sativa Japonica Group]
 dbj|BAD35521.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 dbj|BAD35553.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 dbj|BAF19980.1| Os06g0612800 [Oryza sativa Japonica Group]
 gb|EAZ37627.1| hypothetical protein OsJ_21962 [Oryza sativa Japonica Group]
 dbj|BAG96476.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91568.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96788.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96826.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87267.1| unnamed protein product [Oryza sativa Japonica Group]
Length=171

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 58/132 (44%), Gaps = 24/132 (18%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C+N+CG  G+ AT +MC KC          +           K A  S  S       G+
Sbjct  17   CINNCGFFGSAATMNMCSKCHKEMIMKQEQA-----------KLAASSIDSIVNGGDSGK  65

Query  419  TVPDLKKLEDSTDKIDEKTGESSPA------------PAKREV-NRCSGCRRKVGLTGFR  559
                    E +  +++ KT  + PA            P  RE  NRCS CR++VGLTGF 
Sbjct  66   EPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTCRKRVGLTGFN  125

Query  560  CRCGELFCGEHR  595
            CRCG L+C  HR
Sbjct  126  CRCGNLYCAMHR  137



>ref|XP_009589284.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
 ref|XP_009589285.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
Length=172

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 2/121 (2%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvP--IPHKFAEKSPRSTFRRTSP  412
            C+N+CG  G+ A  +MC KC+  T      + +AA+++   +    A +           
Sbjct  18   CINNCGFFGSAANMNMCSKCYKDTILKQEQAKLAATSIENLVNGSIASEKGPVVVGSVDV  77

Query  413  GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  592
               + + K +   +       GE++   AK   +RCS C++KVGLTGF+CRCG L+CG H
Sbjct  78   QPAMLETKSVVVLSSPPSSSAGEAAELKAKVGPSRCSSCKKKVGLTGFKCRCGNLYCGSH  137

Query  593  R  595
            R
Sbjct  138  R  138



>gb|KEH43736.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
Length=141

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 56/121 (46%), Gaps = 18/121 (15%)
 Frame = +2

Query  233  TPCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSP  412
            T C+N CG  G+P+ N++C KC+N     +                 +KS   +F   S 
Sbjct  4    TLCLNGCGFYGSPSKNNLCSKCYNDYLKEN----------------IKKSNEESFVHES-  46

Query  413  GRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH  592
              T P    + D  D + E          K++ NRC  C +KVG  GF CRCG++FCG H
Sbjct  47   SSTCPSKNPINDFCDVV-EAISLIDNENMKKKKNRCKSCNKKVGPLGFECRCGDVFCGMH  105

Query  593  R  595
            R
Sbjct  106  R  106



>ref|NP_001288874.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
2 [Brassica rapa]
 gb|ABV89666.1| zinc finger an1-like family protein [Brassica rapa]
 emb|CDY22831.1| BnaA06g02460D [Brassica napus]
Length=168

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 60/124 (48%), Gaps = 12/124 (10%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C+N+CG  G+ AT +MC KC           +  AS           SP +  + T    
Sbjct  18   CINNCGFFGSAATMNMCSKCHKTILFQQEQGAKLASA-------VSGSPSNILKETFTAA  70

Query  419  TV-PDLKKLED---STDKIDEKTG-ESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFC  583
             V  + K +E    S   + E    E + A  K   +RC+ C ++VGLTGF+CRCG+LFC
Sbjct  71   LVDAETKSIEPVAVSVQAVAEVVAPEEAAAKPKEGPSRCTTCNKRVGLTGFKCRCGDLFC  130

Query  584  GEHR  595
            G HR
Sbjct  131  GTHR  134



>ref|XP_004658309.1| PREDICTED: AN1-type zinc finger protein 6 isoform X5 [Jaculus 
jaculus]
Length=182

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 69/136 (51%), Gaps = 18/136 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast---------sssvaastvPIPHKFAE----K  379
            C   CG  GNP TN MC  C+                 ++SV++ +  +P +  E     
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAASVSSLSESLPVQCTEGNVSD  73

Query  380  SPRSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGL  547
            +  +    TS  + VP+ + L+    D+T +  E+  ++   P K++ NRC  CR+KVGL
Sbjct  74   AQSALDSTTSVDKAVPETEDLQASVSDTTQQPSEEQSKNLEKP-KQKKNRCFMCRKKVGL  132

Query  548  TGFRCRCGELFCGEHR  595
            TGF CRCG ++CG HR
Sbjct  133  TGFECRCGNVYCGVHR  148



>gb|EPY73931.1| AN1-type zinc finger protein 5 [Camelus ferus]
Length=141

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 55/119 (46%), Gaps = 25/119 (21%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C   CG  GNP TN MC  C+                     K   +  +++ R +    
Sbjct  14   CSTGCGFYGNPRTNGMCSVCY---------------------KEHLQRQQNSGRMSPMVV  52

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            T P     + ST + +EK  E  P P K   NRC  CR+KVGLTGF CRCG LFCG HR
Sbjct  53   TQPSPSVSQPSTSQSEEKAPEL-PKPKK---NRCFMCRKKVGLTGFDCRCGNLFCGLHR  107



>ref|XP_010228642.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X3 [Brachypodium distachyon]
Length=155

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 56/119 (47%), Gaps = 16/119 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C+N+CG  G+  T +MC KC+  T    T ++            AEK        TS   
Sbjct  19   CINNCGFFGSRMTENMCSKCYRDTVKVKTVAA-----------VAEKKVAVASSSTSLVA  67

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             + D    E S    D K      AP K   NRC  CR+KVGLTGFRCRCG+ FC  HR
Sbjct  68   EIED----EVSVPVKDGKQAVEEEAP-KPPSNRCLSCRKKVGLTGFRCRCGDTFCSMHR  121



>ref|XP_010228638.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X2 [Brachypodium distachyon]
Length=163

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 56/119 (47%), Gaps = 16/119 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C+N+CG  G+  T +MC KC+  T    T ++            AEK        TS   
Sbjct  27   CINNCGFFGSRMTENMCSKCYRDTVKVKTVAA-----------VAEKKVAVASSSTSLVA  75

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             + D    E S    D K      AP K   NRC  CR+KVGLTGFRCRCG+ FC  HR
Sbjct  76   EIED----EVSVPVKDGKQAVEEEAP-KPPSNRCLSCRKKVGLTGFRCRCGDTFCSMHR  129



>ref|XP_011188738.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Bactrocera 
cucurbitae]
Length=191

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 67/153 (44%), Gaps = 41/153 (27%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C + CG  GNPAT+ +C  C+  +        V+++ V +P       P  TF   SP  
Sbjct  12   CRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVP----SPQPSPTF---SPAI  64

Query  419  TV-----PDLKKLEDSTDKIDEKTGESSPAPAKREV------------------------  511
            T+     P ++ L+   ++I EK  E S A    E                         
Sbjct  65   TITNTAQPTVQSLQLQHNEIKEKINEESAAKTSTEAAAVAGPSTSSQTAEDDKDKEEDKD  124

Query  512  -----NRCSGCRRKVGLTGFRCRCGELFCGEHR  595
                 NRC+ CR+KVGLTGF+CRCG L+C  HR
Sbjct  125  AKKKKNRCAECRKKVGLTGFQCRCGGLYCAVHR  157



>ref|XP_010002353.1| PREDICTED: AN1-type zinc finger protein 6 isoform X3 [Chaetura 
pelagica]
Length=189

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 68/142 (48%), Gaps = 23/142 (16%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast--------sssvaastvPIPHKFAEKSPRST  394
            C   CG  GNP TN MC  C+                ++SV++ T  +P +  E S + T
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSNGRISPPATSVSSITESLPVQCTEGSAQET  73

Query  395  ---FRRTSPG---------RTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGC  529
                  TS           +TVP+ + L+ S  +  E T E    S    K++ NRC  C
Sbjct  74   QSALDSTSTSSMQPSSAVDKTVPETEDLQASVSENAEPTPEEQDKSLDKPKQKKNRCFMC  133

Query  530  RRKVGLTGFRCRCGELFCGEHR  595
            R+KVGLTGF CRCG ++CG HR
Sbjct  134  RKKVGLTGFECRCGNVYCGMHR  155



>ref|XP_009958821.1| PREDICTED: AN1-type zinc finger protein 6-like [Leptosomus discolor]
Length=178

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 58/131 (44%), Gaps = 12/131 (9%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastss----------svaastvPIPHKFAEKSPR  388
            C   CG  G+P TN MC  C+        SS              S +P+         R
Sbjct  14   CTTGCGFYGSPRTNGMCSVCYKEFLQRQQSSDRISPAGRGVLSEKSHLPVNCTEGSLEVR  73

Query  389  STFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAK--REVNRCSGCRRKVGLTGFRC  562
            +          VP+  +L+ +  +I + + E   A  K  ++ NRC  CR+K+GLTGF C
Sbjct  74   TALSSAVAENAVPETDELQAALLEIPQNSAEGKTASEKPKQKKNRCFTCRKKIGLTGFDC  133

Query  563  RCGELFCGEHR  595
            RCG LFC  HR
Sbjct  134  RCGNLFCAIHR  144



>ref|XP_005180142.1| PREDICTED: AN1-type zinc finger protein 5 [Musca domestica]
 ref|XP_005180143.1| PREDICTED: AN1-type zinc finger protein 5 [Musca domestica]
Length=191

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 64/148 (43%), Gaps = 31/148 (21%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C + CG  GNPAT+ +C  C+  +        V ++ V +P    + SP  +   T P  
Sbjct  12   CRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVGSTPVSVPS--PQPSPTFSPAITIPSA  69

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREV-----------------------------  511
              P ++ L+   ++I +K  E + A    E                              
Sbjct  70   AQPTVQSLQQQHNEIKDKINEENSAKTSSETAASAGPSTSTEPAEEDKDKEDDKDSKKKK  129

Query  512  NRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            NRCS CR+KVGLTGF CRCG L+C  HR
Sbjct  130  NRCSECRKKVGLTGFLCRCGGLYCAVHR  157



>ref|NP_001140650.1| uncharacterized protein LOC100272725 [Zea mays]
 gb|ACF84270.1| unknown [Zea mays]
 tpg|DAA47934.1| TPA: multiple stress-responsive zinc-finger protein ISAP1 [Zea 
mays]
Length=176

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 68/129 (53%), Gaps = 12/129 (9%)
 Frame = +2

Query  230  ITPCVNDCGVTGNPATNSMCQKCF-------NattaastsssvaastvPIPHKFAEKSPR  388
            +T C N CG  GNPATN++CQ CF       +A+ + S     ++S+ P   +F E+  +
Sbjct  19   LTLCANSCGFPGNPATNNLCQACFLAATASSSASASVSPPPPSSSSSSPAVLQFDEQQQQ  78

Query  389  STFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRC  568
               R  +P  + P      +   +    +  +    +   V RC  CR++VGLTGFRCRC
Sbjct  79   QNPRPRAPAASGP-----TEEPPRPARASAPAPAPASSSSVRRCQTCRKRVGLTGFRCRC  133

Query  569  GELFCGEHR  595
            G+LFCG HR
Sbjct  134  GDLFCGAHR  142



>ref|XP_006657485.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like isoform X1 [Oryza brachyantha]
 ref|XP_006657486.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like isoform X2 [Oryza brachyantha]
Length=160

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 56/119 (47%), Gaps = 15/119 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G+  TN+MC KC+      +T         P+  K    +  S+     P +
Sbjct  23   CVNNCGFFGSSMTNNMCSKCYRDFIKVTTMV-------PVVDKKVFTAASSSKTPLEPAK  75

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
              PD        DK      + +  P K   NRC  CR+KVGLTGF+CRCG  FC  HR
Sbjct  76   --PDEVPAAAVEDK------QEAQEPPKPPSNRCLSCRKKVGLTGFQCRCGGTFCSTHR  126



>ref|XP_009411960.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Musa acuminata subsp. malaccensis]
 ref|XP_009411961.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Musa acuminata subsp. malaccensis]
Length=151

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 56/120 (47%), Gaps = 15/120 (13%)
 Frame = +2

Query  236  PCVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPG  415
            PC N+C   G+PAT ++C KC+         ++ A   V I                SP 
Sbjct  13   PCANNCSFFGSPATLNLCSKCYRDFRLKEEQAASAKLAVEI--------------SLSPP  58

Query  416  RTVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             +         +     EK  E++  PA R   RC  CR++VGLTGFRCRCG  +CG+HR
Sbjct  59   PSSAATVSSSTAPSSPSEKPSEAAAEPAPRPT-RCKSCRKRVGLTGFRCRCGSTYCGQHR  117



>ref|XP_009406414.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=161

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  389  STFRRTSPGRTVPDLKKLEDSTDKIDEKTGESSPAPAK----REVNRCSGCRRKVGLTGF  556
            +T RR  P    P +     S+ K+DE++  S P        R   RCS CR+KVGLTGF
Sbjct  55   TTERRERPEIPAPAMTFTASSSSKLDEESESSKPDEESHTPVRFSKRCSTCRKKVGLTGF  114

Query  557  RCRCGELFCGEHR  595
            RCRCG+LFCG HR
Sbjct  115  RCRCGDLFCGRHR  127



>ref|XP_004738186.1| PREDICTED: AN1-type zinc finger protein 6-like isoform X2 [Mustela 
putorius furo]
Length=185

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 63/139 (45%), Gaps = 21/139 (15%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIP-HKFAEKSP----------  385
            C   CG  GNP TN MC  C+        SS+   S         +E  P          
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAASVSSLSESLPVQCVDGGGPD  73

Query  386  -----RSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRK  538
                  S    TS  + VPD + L+    D+  +  E+  +S   P K++ NRC  CR+K
Sbjct  74   VQCPLDSALDSTSVDKAVPDPEDLQASVSDTAQQPSEEQSKSLEKP-KQKKNRCFMCRKK  132

Query  539  VGLTGFRCRCGELFCGEHR  595
            VGLTGF CRCG ++CG HR
Sbjct  133  VGLTGFECRCGNVYCGVHR  151



>ref|XP_005077919.1| PREDICTED: AN1-type zinc finger protein 6 isoform X4 [Mesocricetus 
auratus]
Length=182

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 60/139 (43%), Gaps = 24/139 (17%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C   CG  GNP TN MC  C+        SSS   S    P   +  S   +        
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSSGRIS----PPAASVSSLSESLPVQCTDG  69

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPA--------------------KREVNRCSGCRRK  538
            +VPD +   +ST  +D+   E+    A                    K++ NRC  CR+K
Sbjct  70   SVPDAQSALESTTSVDKAVSETEDLQASVSDTTQQPSEEQSKSLEKPKQKKNRCFMCRKK  129

Query  539  VGLTGFRCRCGELFCGEHR  595
            VGLTGF CRCG ++CG HR
Sbjct  130  VGLTGFECRCGNVYCGVHR  148



>ref|XP_006424263.1| hypothetical protein CICLE_v10029439mg [Citrus clementina]
 gb|ESR37503.1| hypothetical protein CICLE_v10029439mg [Citrus clementina]
Length=162

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 60/124 (48%), Gaps = 13/124 (10%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN+CG  G+P T ++C KCF      +  SS A        K A      +   +SP  
Sbjct  13   CVNNCGFFGSPTTQNLCSKCFRDLQLKAQQSSSA--------KHALNQTLISSSSSSPSP  64

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREV-----NRCSGCRRKVGLTGFRCRCGELFC  583
            +V    +   +TD       E  PA     V     NRC  CRR+VGLTGF+CRCG +FC
Sbjct  65   SVDLSLRERPATDVEVAAEAEKPPAEVAAPVQSTAANRCITCRRRVGLTGFKCRCGSVFC  124

Query  584  GEHR  595
            G HR
Sbjct  125  GTHR  128



>ref|XP_007447130.1| PREDICTED: AN1-type zinc finger protein 6 isoform X5 [Lipotes 
vexillifer]
Length=196

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 67/149 (45%), Gaps = 30/149 (20%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNa-------------------------ttaastsssvaa  343
            C   CG  GNP TN MC  C+                           T +A  S+S + 
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPVQCTDGSVPETQSALDSTSSSM  73

Query  344  stvPIPHK--FAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKRE  508
               P+ ++   +E    S    TS  + +P+ + L+ S  +  ++  E    S    K++
Sbjct  74   QPSPVSNQSLLSESVASSQVDSTSVDKAIPETEDLQASVSETAQQPSEEQSKSLEKPKQK  133

Query  509  VNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             NRC  CR+KVGLTGF CRCG ++CG HR
Sbjct  134  KNRCFMCRKKVGLTGFECRCGNVYCGVHR  162



>ref|XP_004017840.1| PREDICTED: AN1-type zinc finger protein 6 isoform 5 [Ovis aries]
Length=189

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 63/142 (44%), Gaps = 23/142 (16%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaas--------------------tvPI  358
            C   CG  GNP TN MC  C+        SS+   S                    +VP 
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAPSVTSLSESLPVQCTDGSVPE  73

Query  359  PHKFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGC  529
                 + +  S    TS  + +P+ + L+ S  +  ++  E    S    K++ NRC  C
Sbjct  74   AQSALDSAASSMQPSTSVDKAIPETEALQASVSETAQQASEEQSKSLEKPKQKKNRCFMC  133

Query  530  RRKVGLTGFRCRCGELFCGEHR  595
            R+KVGLTGF CRCG ++CG HR
Sbjct  134  RKKVGLTGFECRCGNVYCGVHR  155



>ref|XP_004278381.1| PREDICTED: AN1-type zinc finger protein 6 isoform 5 [Orcinus 
orca]
Length=196

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 67/149 (45%), Gaps = 30/149 (20%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNa-------------------------ttaastsssvaa  343
            C   CG  GNP TN MC  C+                           T +A  S+S + 
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPVQCTDGSVPETQSALDSTSSSM  73

Query  344  stvPIPHK--FAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKRE  508
               P+ ++   +E    S    TS  + +P+ + L+ S  +  ++  E    S    K++
Sbjct  74   QPSPVSNQSLLSESVASSQVDSTSVDKAIPETEDLQASVSETAQQPSEEESKSLEKPKQK  133

Query  509  VNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             NRC  CR+KVGLTGF CRCG ++CG HR
Sbjct  134  KNRCFMCRKKVGLTGFECRCGNVYCGVHR  162



>ref|XP_004617671.1| PREDICTED: AN1-type zinc finger protein 6 isoform X2 [Sorex araneus]
Length=182

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 69/136 (51%), Gaps = 18/136 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaast---------sssvaastvPIPHKFAE---KS  382
            C   CG  GNP TN MC  C+                 ++SV++ +  +P   ++    +
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAASVSSLSDSLPGPCSDGGVAA  73

Query  383  PRSTFRRT-SPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGL  547
             RS    T S  + VP+ + L+    D+  +  E+  +S   P K++ NRC  CR+KVGL
Sbjct  74   ARSALESTTSVDKAVPEAEDLQASVSDTAQQPSEEQSKSLEKP-KQKKNRCFMCRKKVGL  132

Query  548  TGFRCRCGELFCGEHR  595
            TGF CRCG ++CG HR
Sbjct  133  TGFECRCGNVYCGVHR  148



>ref|XP_010494181.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Camelina sativa]
Length=161

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 56/120 (47%), Gaps = 12/120 (10%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            CVN CG  G+P+  ++C KC+         ++ A     +        P+   ++++PG 
Sbjct  19   CVNGCGFFGSPSNMNLCSKCYRDILTKEEQAASAKVA--VEKSLNPNKPKIQLQQSTPGV  76

Query  419  TVPDLKKLEDSTDKIDEKTGESSPA-PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V                 GE++P  P K    RC  C +KVG+TGF+C+CG  FCG HR
Sbjct  77   VVESGSSTSG---------GEAAPVDPPKPTATRCLSCNKKVGVTGFKCKCGSTFCGAHR  127



>ref|XP_004421950.1| PREDICTED: AN1-type zinc finger protein 6 isoform 6 [Ceratotherium 
simum simum]
Length=196

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 67/150 (45%), Gaps = 32/150 (21%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNa-------------------------ttaastsssvaa  343
            C   CG  GNP TN MC  C+                             +   S+S + 
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPVQCTDGSVPEAQSTLDSTSSSM  73

Query  344  stvPIPHK--FAEKSPRSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKR  505
               P+ ++   +E    S    TS  + +P+ + L+    D+  +  E+  +S   P K+
Sbjct  74   QPSPVSNQSLLSESVASSQVDSTSVDKAIPETEDLQASVSDTAQQPSEEQSKSLEKP-KQ  132

Query  506  EVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            + NRC  CR+KVGLTGF CRCG ++CG HR
Sbjct  133  KKNRCFMCRKKVGLTGFECRCGNVYCGVHR  162



>ref|XP_010089848.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
3 [Morus notabilis]
 gb|EXB38464.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
3 [Morus notabilis]
Length=161

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 58/120 (48%), Gaps = 6/120 (5%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G+PAT ++C KCF               T+ I    +  S  S     S   
Sbjct  13   CANNCGFFGSPATQNLCSKCFRDLQLKEQQELALNQTL-ISSSASSSSSVSPSTSISVQS  71

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREV-NRCSGCRRKVGLTGFRCRCGELFCGEHR  595
              P L    ++    +EK    + APA   V  RC  CRR+VGLTGF+CRCG +FCG HR
Sbjct  72   PAPILSMEVEA----EEKVRVEADAPAVMAVPRRCGTCRRRVGLTGFKCRCGMMFCGSHR  127



>ref|XP_005889816.1| PREDICTED: AN1-type zinc finger protein 6 isoform X4 [Bos mutus]
Length=189

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 63/142 (44%), Gaps = 23/142 (16%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaas--------------------tvPI  358
            C   CG  GNP TN MC  C+        SS+   S                    +VP 
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAPSVTSLSESLPVQCTDGSVPE  73

Query  359  PHKFAEKSPRSTFRRTSPGRTVPDLKKLEDSTDKIDEKTGES---SPAPAKREVNRCSGC  529
                 + +  S    TS  + +P+ + L+ S  +  ++  E    S    K++ NRC  C
Sbjct  74   AQSALDSTASSMQPSTSVDKAIPETEDLQASVSETAQQASEEQSKSLEKPKQKKNRCFMC  133

Query  530  RRKVGLTGFRCRCGELFCGEHR  595
            R+KVGLTGF CRCG ++CG HR
Sbjct  134  RKKVGLTGFECRCGNVYCGVHR  155



>ref|XP_004387551.1| PREDICTED: AN1-type zinc finger protein 6 isoform 6 [Trichechus 
manatus latirostris]
Length=184

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 70/138 (51%), Gaps = 20/138 (14%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastss---------svaastvPIPHKFAEKS-PR  388
            C   CG  GNP TN MC  C+        SS         SV++ +  +P +  + S P 
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGSVPE  73

Query  389  S-----TFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKREVNRCSGCRRKV  541
            +     T   TS  + +P+ + L+    D+  +  E+  +S   P K++ NRC  CR+KV
Sbjct  74   AQSLDFTLDSTSLDKAIPETEDLQASVPDTAQQPPEEQNKSLEKP-KQKKNRCFMCRKKV  132

Query  542  GLTGFRCRCGELFCGEHR  595
            GLTGF CRCG ++CG HR
Sbjct  133  GLTGFECRCGNVYCGVHR  150



>ref|XP_009402699.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
 ref|XP_009402700.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=145

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  422  VPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            VP++ +   +   +  +   S  AP  R +NRCS CR+KVGLTGFRCRCG+LFC  HR
Sbjct  54   VPEMPENSGNAAALSFEMKISKQAPPLRYINRCSTCRKKVGLTGFRCRCGDLFCASHR  111



>ref|XP_006576194.1| PREDICTED: uncharacterized protein LOC100527251 isoform X1 [Glycine 
max]
Length=160

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 57/123 (46%), Gaps = 16/123 (13%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G+PAT ++C KC+                     +   KS   T    S   
Sbjct  16   CSNNCGFFGSPATMNLCSKCYRDIRLKEE------------EQAKTKSTIETALSGSSSA  63

Query  419  TVP---DLKKLEDSTDKIDEKTGESSP-APAKREVNRCSGCRRKVGLTGFRCRCGELFCG  586
            TV     +  L    + + + +  SSP   A  + NRC  CR++VGLTGF+CRCG  FCG
Sbjct  64   TVAVASAVDSLPAPVESLPQPSVVSSPDVAAPVQANRCGACRKRVGLTGFKCRCGTTFCG  123

Query  587  EHR  595
             HR
Sbjct  124  THR  126



>gb|ACM68459.1| stress-associated protein 9 [Solanum pennellii]
Length=156

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 53/119 (45%), Gaps = 10/119 (8%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNattaastsssvaastvPIPHKFAEKSPRSTFRRTSPGR  418
            C N+CG  G+P T + C KC+N                PI   F  + P  +    +   
Sbjct  16   CANNCGFFGSPTTQNFCSKCYNEVYIKGGLQK------PIDSLFPPQLPIPS----TSSI  65

Query  419  TVPDLKKLEDSTDKIDEKTGESSPAPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
             V       +   ++       +  P   + NRCS CR+KVGLTGF+CRCG  FCG HR
Sbjct  66   LVLQESAAAEEEPEVVTAAVAVAVQPIPAQPNRCSACRKKVGLTGFKCRCGTTFCGTHR  124



>ref|NP_001229846.1| AN1-type zinc finger protein 6 isoform b [Homo sapiens]
 gb|EAW99123.1| zinc finger, A20 domain containing 3, isoform CRA_b [Homo sapiens]
 gb|EAW99125.1| zinc finger, A20 domain containing 3, isoform CRA_b [Homo sapiens]
Length=196

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 68/150 (45%), Gaps = 32/150 (21%)
 Frame = +2

Query  239  CVNDCGVTGNPATNSMCQKCFNa-------------------------ttaastsssvaa  343
            C   CG  GNP TN MC  C+                             +A  S+S + 
Sbjct  14   CSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPVQCTDGSVPEAQSALDSTSSSM  73

Query  344  stvPIPHK--FAEKSPRSTFRRTSPGRTVPDLKKLE----DSTDKIDEKTGESSPAPAKR  505
               P+ ++   +E    S    TS  + VP+ + ++    D+  +  E+  +S   P K+
Sbjct  74   QPSPVSNQSLLSESVASSQLDSTSVDKAVPETEDVQASVSDTAQQPSEEQSKSLEKP-KQ  132

Query  506  EVNRCSGCRRKVGLTGFRCRCGELFCGEHR  595
            + NRC  CR+KVGLTGF CRCG ++CG HR
Sbjct  133  KKNRCFMCRKKVGLTGFECRCGNVYCGVHR  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510