BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP001B02 395 bp,:Filtered

Length=395
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK27969.1|AF242373_1  cysteine protease                             167   3e-47   Ipomoea batatas [batate]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I     167   4e-47   Ipomoea batatas [batate]
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II    167   4e-47   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I     167   4e-47   Ipomoea batatas [batate]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II    166   4e-47   Ipomoea batatas [batate]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...    166   5e-47   Ipomoea batatas [batate]
ref|XP_007042077.1|  Papain family cysteine protease                    166   9e-47   Theobroma cacao [chocolate]
gb|KDP41743.1|  hypothetical protein JCGZ_26761                         162   3e-45   Jatropha curcas
ref|XP_002512963.1|  cysteine protease, putative                        161   5e-45   Ricinus communis
gb|KHG24064.1|  Cysteinease RD19a -like protein                         160   1e-44   Gossypium arboreum [tree cotton]
sp|P05993.1|PAPA5_CARPA  RecName: Full=Cysteine proteinase; AltNa...    152   2e-44   Carica papaya [mamon]
gb|AAX19661.1|  cysteine proteinase                                     160   2e-44   Populus tomentosa [Chinese white poplar]
gb|AIB06024.1|  CP2                                                     160   2e-44   Hevea brasiliensis [jebe]
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a               159   3e-44   Populus euphratica
gb|KJB32561.1|  hypothetical protein B456_005G247000                    159   3e-44   Gossypium raimondii
gb|ABK96252.1|  unknown                                                 153   4e-44   Populus trichocarpa x Populus deltoides
gb|ABQ10201.1|  cysteine protease Cp3                                   159   4e-44   Actinidia deliciosa [Chinese gooseberry]
gb|KJB79047.1|  hypothetical protein B456_013G033800                    159   5e-44   Gossypium raimondii
emb|CAE54306.1|  putative papain-like cysteine proteinase               158   6e-44   Gossypium hirsutum [American cotton]
emb|CDP20652.1|  unnamed protein product                                158   6e-44   Coffea canephora [robusta coffee]
gb|KHG15253.1|  Cysteinease RD19a -like protein                         158   8e-44   Gossypium arboreum [tree cotton]
ref|XP_002313770.1|  cysteine proteinase A494 precursor                 157   1e-43   Populus trichocarpa [western balsam poplar]
gb|ABK92536.1|  unknown                                                 157   1e-43   Populus trichocarpa [western balsam poplar]
ref|NP_001267989.1|  cysteine protease precursor                        158   1e-43   Vitis vinifera
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                   157   3e-43   Citrus sinensis [apfelsine]
ref|XP_003606998.1|  Cysteine proteinase                                156   3e-43   Medicago truncatula
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like          157   3e-43   Citrus sinensis [apfelsine]
gb|KHN39817.1|  Cysteine proteinase RD19a                               155   3e-43   Glycine soja [wild soybean]
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like          157   3e-43   Pyrus x bretschneideri [bai li]
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like          154   3e-43   Pyrus x bretschneideri [bai li]
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like          156   4e-43   Nelumbo nucifera [Indian lotus]
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like          156   4e-43   Glycine max [soybeans]
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494       156   5e-43   Fragaria vesca subsp. vesca
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg             156   5e-43   Citrus clementina
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a               156   5e-43   Pyrus x bretschneideri [bai li]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a               156   5e-43   Malus domestica [apple tree]
gb|ACI04578.1|  cysteine protease-like protein                          155   5e-43   Robinia pseudoacacia [black locust]
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg             156   5e-43   Prunus persica
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a               155   6e-43   Prunus mume [ume]
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like          155   6e-43   Populus euphratica
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like          155   6e-43   Eucalyptus grandis [rose gum]
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    156   7e-43   Sesamum indicum [beniseed]
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like          155   7e-43   Cicer arietinum [garbanzo]
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like            155   7e-43   Populus euphratica
ref|XP_002305451.2|  cysteine proteinase A494 precursor                 155   9e-43   Populus trichocarpa [western balsam poplar]
gb|AAR92156.1|  putative cysteine protease 3                            153   1e-42   Iris x hollandica [Dutch iris]
gb|AAL69389.1|AF462226_1  putative cysteine proteinase                  148   1e-42   Narcissus pseudonarcissus
gb|ABK96580.1|  unknown                                                 155   1e-42   Populus trichocarpa x Populus deltoides
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494       155   2e-42   Eucalyptus grandis [rose gum]
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like          155   2e-42   Sesamum indicum [beniseed]
gb|ABK94801.1|  unknown                                                 154   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like              154   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g             154   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like          155   2e-42   Pyrus x bretschneideri [bai li]
ref|XP_007017672.1|  Papain family cysteine protease                    154   3e-42   Theobroma cacao [chocolate]
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like          155   4e-42   Pyrus x bretschneideri [bai li]
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g             153   6e-42   Phaseolus vulgaris [French bean]
gb|ABK93575.1|  unknown                                                 147   7e-42   Populus trichocarpa [western balsam poplar]
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like          152   9e-42   Eucalyptus grandis [rose gum]
ref|XP_002510469.1|  cysteine protease, putative                        152   9e-42   Ricinus communis
gb|AAU81591.1|  cysteine proteinase                                     147   1e-41   Petunia x hybrida [garden petunia]
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I               152   1e-41   Cucumis sativus [cucumbers]
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    152   1e-41   
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like          152   1e-41   
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like          152   2e-41   Glycine max [soybeans]
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like          152   2e-41   Nelumbo nucifera [Indian lotus]
emb|CDQ51995.1|  Cysteine proteinase                                    146   2e-41   Fagus sylvatica
dbj|BAD94010.1|  drought-inducible cysteine proteinase RD19A prec...    144   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb|AJP16692.1|  cysteine protease                                       145   2e-41   Striga hermonthica [purple witchweed]
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like          151   5e-41   Cucumis sativus [cucumbers]
gb|AAU81589.1|  cysteine proteinase                                     148   5e-41   Petunia x hybrida [garden petunia]
dbj|BAJ53178.1|  JHL18I08.12                                            150   5e-41   Jatropha curcas
gb|ABF46642.1|  papain-like cysteine proteinase                         150   5e-41   Pachysandra terminalis
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like            150   6e-41   Glycine max [soybeans]
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a               150   6e-41   Tarenaya hassleriana [spider flower]
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor     150   6e-41   Glycine max [soybeans]
gb|KHN45894.1|  Cysteine proteinase RD19a                               150   8e-41   Glycine soja [wild soybean]
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like              150   1e-40   Elaeis guineensis
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494       150   1e-40   Tarenaya hassleriana [spider flower]
gb|KHN25410.1|  Cysteine proteinase RD19a                               150   1e-40   Glycine soja [wild soybean]
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like              150   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like              150   1e-40   Phoenix dactylifera
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg                150   1e-40   Erythranthe guttata [common monkey flower]
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like            149   1e-40   Populus euphratica
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like          150   2e-40   Cucumis melo [Oriental melon]
dbj|BAC41322.1|  hypothetical protein                                   149   2e-40   Lotus japonicus
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g             149   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a               149   2e-40   Vitis vinifera
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like          149   2e-40   Nicotiana tomentosiformis
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg                149   2e-40   Erythranthe guttata [common monkey flower]
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A                 149   2e-40   Vitis vinifera
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor                 149   2e-40   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like          149   2e-40   Brassica rapa
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1         149   2e-40   Lotus japonicus
gb|KJB07487.1|  hypothetical protein B456_001G026600                    149   3e-40   Gossypium raimondii
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like          149   3e-40   Cucumis melo [Oriental melon]
dbj|BAF98584.1|  CM0216.500.nc                                          148   3e-40   Lotus japonicus
gb|KHN22211.1|  Cysteine proteinase 15A                                 149   3e-40   Glycine soja [wild soybean]
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like          149   3e-40   Solanum tuberosum [potatoes]
gb|AAB62937.1|  stress-induced cysteine proteinase                      143   3e-40   Lavatera thuringiaca
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a               148   3e-40   Solanum lycopersicum
ref|XP_010105270.1|  Cysteine proteinase 15A                            148   4e-40   Morus notabilis
gb|AAM65162.1|  cysteine proteinase RD19A                               148   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like            148   4e-40   Fragaria vesca subsp. vesca
gb|KHN12668.1|  Cysteine proteinase 15A                                 142   4e-40   Glycine soja [wild soybean]
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like            148   4e-40   Citrus sinensis [apfelsine]
ref|NP_568052.1|  cysteine proteinase RD19a                             148   5e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g             148   5e-40   Phaseolus vulgaris [French bean]
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2         148   5e-40   Lotus japonicus
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                  148   5e-40   Phaseolus vulgaris [French bean]
gb|AIB06025.1|  CP3                                                     148   6e-40   Hevea brasiliensis [jebe]
dbj|BAF98585.1|  CM0216.510.nc                                          147   6e-40   Lotus japonicus
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                   147   7e-40   Citrus sinensis [apfelsine]
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like            147   7e-40   Sesamum indicum [beniseed]
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like            147   7e-40   Brassica rapa
emb|CDY71205.1|  BnaCnng71840D                                          147   8e-40   Brassica napus [oilseed rape]
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease       147   8e-40   Brassica oleracea
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210          147   9e-40   Amborella trichopoda
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg             147   9e-40   Citrus clementina
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg             147   9e-40   Eutrema salsugineum
emb|CDY34441.1|  BnaC01g21920D                                          147   9e-40   Brassica napus [oilseed rape]
gb|ABK24153.1|  unknown                                                 147   1e-39   Picea sitchensis
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                    147   1e-39   Arabis alpina [alpine rockcress]
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A                 147   1e-39   Malus domestica [apple tree]
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like              147   1e-39   Brachypodium distachyon [annual false brome]
dbj|BAF46302.1|  cysteine proteinase precursor                          147   2e-39   Ipomoea nil [qian niu]
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg             146   2e-39   Capsella rubella
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g             146   3e-39   Phaseolus vulgaris [French bean]
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677             146   3e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like              146   3e-39   Phoenix dactylifera
gb|ACX54787.2|  cysteine protease                                       145   3e-39   Arachis diogoi
dbj|BAF03553.1|  cysteine proteinase CP2                                145   3e-39   Phaseolus vulgaris [French bean]
gb|EMS53996.1|  Cysteine proteinase 1                                   146   3e-39   Triticum urartu
emb|CDY41960.1|  BnaA01g05320D                                          145   4e-39   Brassica napus [oilseed rape]
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like          145   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a               145   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a               145   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like          145   6e-39   Camelina sativa [gold-of-pleasure]
emb|CAB53397.1|  cysteine protease                                      141   6e-39   Medicago sativa [alfalfa]
emb|CAA52403.1|  putative thiol protease                                144   6e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like            145   6e-39   Camelina sativa [gold-of-pleasure]
dbj|BAA92495.1|  cysteine protease                                      145   6e-39   Vigna mungo [urad dal]
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like              140   7e-39   
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like              145   8e-39   Elaeis guineensis
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like            145   8e-39   Camelina sativa [gold-of-pleasure]
dbj|BAD43619.1|  putative cysteine proteinase                           145   8e-39   Arabidopsis thaliana [mouse-ear cress]
gb|ACK57563.1|  cysteine protease-like protein                          145   8e-39   Arachis hypogaea [goober]
ref|NP_565512.1|  Papain family cysteine protease                       144   9e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a               145   9e-39   Brassica rapa
emb|CDY09707.1|  BnaC07g33540D                                          144   9e-39   Brassica napus [oilseed rape]
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A                 145   1e-38   
gb|ACM80348.1|  cysteine proteinase                                     144   1e-38   Solanum lycopersicum
emb|CDP07452.1|  unnamed protein product                                144   1e-38   Coffea canephora [robusta coffee]
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like            144   1e-38   Glycine max [soybeans]
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A                 144   2e-38   Vitis vinifera
gb|AAQ81938.1|  cysteine proteinase precursor                           144   2e-38   Ipomoea batatas [batate]
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like              144   2e-38   
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like          144   3e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003589348.1|  Cysteine proteinase                                143   3e-38   Medicago truncatula
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008             143   3e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A                 143   3e-38   Pyrus x bretschneideri [bai li]
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor                 143   3e-38   Solanum melongena [aubergine]
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like            143   4e-38   Prunus mume [ume]
gb|KJB29611.1|  hypothetical protein B456_005G110200                    143   4e-38   Gossypium raimondii
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg             143   4e-38   Capsella rubella
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg             142   5e-38   Eutrema salsugineum
emb|CAB17075.1|  cysteine proteinase precursor                          142   5e-38   Phaseolus vulgaris [French bean]
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like          142   5e-38   Brassica rapa
emb|CDX90537.1|  BnaA03g42440D                                          142   6e-38   Brassica napus [oilseed rape]
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg             142   7e-38   Prunus persica
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...    142   7e-38   Pisum sativum [garden pea]
gb|KHG15062.1|  Cysteinease RD19a -like protein                         142   9e-38   Gossypium arboreum [tree cotton]
gb|AGS43121.1|  cysteine protease 1                                     134   9e-38   Zea mays [maize]
emb|CAA82995.1|  cysteine proteinase                                    142   9e-38   Vicia sativa [spring vetch]
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830          142   1e-37   Sorghum bicolor [broomcorn]
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg             142   1e-37   Eutrema salsugineum
emb|CDX99593.1|  BnaC04g33500D                                          141   1e-37   Brassica napus [oilseed rape]
gb|AAO11786.1|  pre-pro cysteine proteinase                             142   1e-37   Vicia faba [broad bean]
gb|AAB67878.1|  pre-pro-cysteine proteinase                             142   1e-37   Vicia faba [broad bean]
emb|CAD40319.2|  OSJNBb0054B09.3                                        142   1e-37   Oryza sativa Japonica Group [Japonica rice]
emb|CAA57675.1|  cysteine proteinase                                    136   1e-37   Zea mays [maize]
gb|EAY93546.1|  hypothetical protein OsI_15336                          141   1e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like          142   1e-37   Cucumis melo [Oriental melon]
gb|EMT16425.1|  Cysteine proteinase 1                                   142   1e-37   Aegilops tauschii
gb|EEE60725.1|  hypothetical protein OsJ_14236                          141   1e-37   Oryza sativa Japonica Group [Japonica rice]
emb|CDY15894.1|  BnaA04g12170D                                          141   1e-37   Brassica napus [oilseed rape]
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494       141   1e-37   Brassica rapa
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor     141   2e-37   Cicer arietinum [garbanzo]
gb|KJB58164.1|  hypothetical protein B456_009G197400                    141   2e-37   Gossypium raimondii
gb|AJA74415.1|  cysteine protease                                       141   2e-37   Cicer arietinum [garbanzo]
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like            141   2e-37   Nicotiana tomentosiformis
gb|AEX97108.1|  cysteine proteinase                                     135   2e-37   Malus domestica [apple tree]
gb|AAK07731.1|  CPR2-like cysteine proteinase                           141   2e-37   Nicotiana tabacum [American tobacco]
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like              141   2e-37   Setaria italica
ref|NP_001052440.1|  Os04g0311400                                       141   2e-37   
emb|CAH59428.1|  cysteine protease 2                                    138   2e-37   Plantago major [cart-track plant]
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200               141   2e-37   Arabis alpina [alpine rockcress]
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                    141   2e-37   Nicotiana tabacum [American tobacco]
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                    140   2e-37   Nicotiana tabacum [American tobacco]
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like            140   3e-37   Nicotiana sylvestris
ref|NP_567489.1|  papain family cysteine protease                       140   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142             140   4e-37   Arabidopsis lyrata subsp. lyrata
gb|AAB16996.1|  thiol protease isoform B                                139   6e-37   Glycine max [soybeans]
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg                140   6e-37   Erythranthe guttata [common monkey flower]
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like              140   7e-37   Setaria italica
ref|NP_001105685.1|  cysteine proteinase 1 precursor                    139   8e-37   Zea mays [maize]
gb|ACF86683.1|  unknown                                                 139   9e-37   Zea mays [maize]
ref|XP_003607110.1|  Cysteine proteinase                                139   1e-36   Medicago truncatula
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like              139   1e-36   Brachypodium distachyon [annual false brome]
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like              139   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH30505.1|  papain family cysteine protease                         138   1e-36   Medicago truncatula
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like          139   2e-36   Cucumis sativus [cucumbers]
gb|ABK24688.1|  unknown                                                 138   2e-36   Picea sitchensis
gb|ABK21238.1|  unknown                                                 138   2e-36   Picea sitchensis
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A                 138   2e-36   
gb|ACN40679.1|  unknown                                                 138   2e-36   Picea sitchensis
ref|NP_001046828.1|  Os02g0469600                                       138   4e-36   
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like            137   4e-36   Solanum tuberosum [potatoes]
dbj|BAG16515.1|  putative cysteine proteinase                           137   5e-36   Capsicum chinense [bonnet pepper]
gb|EMS64962.1|  Cysteine proteinase 1                                   136   5e-36   Triticum urartu
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor            137   6e-36   Hordeum vulgare subsp. vulgare [barley]
gb|EMT10192.1|  Cysteine proteinase 1                                   136   1e-35   Aegilops tauschii
gb|ADY04293.1|  cysteine protease                                       130   1e-35   Clarkia xantiana subsp. xantiana
emb|CAA78403.1|  pre-pro-cysteine proteinase                            136   1e-35   Solanum lycopersicum
gb|AAW21813.1|  cysteine protease                                       136   1e-35   Triticum aestivum [Canadian hard winter wheat]
gb|ADY04361.1|  cysteine protease                                       130   2e-35   Clarkia xantiana subsp. xantiana
ref|XP_003607150.1|  Cysteine proteinase                                135   2e-35   
gb|AES89347.2|  papain family cysteine protease                         135   2e-35   Medicago truncatula
gb|ADY04342.1|  cysteine protease                                       130   2e-35   Clarkia xantiana subsp. xantiana
gb|ADY04336.1|  cysteine protease                                       130   2e-35   Clarkia xantiana subsp. xantiana
gb|ADY04262.1|  cysteine protease                                       130   2e-35   Clarkia xantiana subsp. xantiana
gb|ADY04414.1|  cysteine protease                                       130   2e-35   Clarkia xantiana subsp. xantiana
gb|AAZ32411.1|  cysteine proteinase glycinain type                      135   2e-35   Nicotiana benthamiana
gb|ADY04457.1|  cysteine protease                                       130   2e-35   Clarkia xantiana subsp. xantiana
gb|ADY04359.1|  cysteine protease                                       130   2e-35   Clarkia xantiana subsp. xantiana
dbj|BAD10859.1|  cysteine protease                                      135   3e-35   Tripolium pannonicum [sea starwort]
gb|ADY04482.1|  cysteine protease                                       129   3e-35   Clarkia xantiana subsp. xantiana
gb|ADY04358.1|  cysteine protease                                       129   4e-35   Clarkia xantiana subsp. xantiana
gb|ADY04368.1|  cysteine protease                                       129   4e-35   Clarkia xantiana subsp. xantiana
gb|EPS70818.1|  cysteine proteinase                                     134   5e-35   Genlisea aurea
gb|ADY04480.1|  cysteine protease                                       129   6e-35   Clarkia xantiana subsp. xantiana
gb|ADY04268.1|  cysteine protease                                       129   6e-35   Clarkia xantiana subsp. xantiana
gb|AAB16997.1|  thiol protease isoform A                                133   7e-35   Glycine max [soybeans]
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like          134   8e-35   Nicotiana sylvestris
emb|CAQ00101.1|  papain-like cysteine proteinase                        134   9e-35   Hordeum vulgare subsp. vulgare [barley]
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a               134   1e-34   Vitis vinifera
gb|ADY04295.1|  cysteine protease                                       128   1e-34   Clarkia xantiana subsp. xantiana
gb|EPS65881.1|  cysteine proteinase                                     133   2e-34   Genlisea aurea
dbj|BAC57957.1|  thiol protease                                         128   3e-34   Tripolium pannonicum [sea starwort]
gb|AAB53103.1|  cysteine protease                                       123   2e-33   Brassica napus [oilseed rape]
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a               130   3e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583             129   5e-33   Selaginella moellendorffii
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274              129   6e-33   Selaginella moellendorffii
emb|CDX98179.1|  BnaC07g09190D                                          120   2e-32   Brassica napus [oilseed rape]
emb|CCA95098.1|  putative responsive to dehydration 19                  119   6e-31   Liriodendron tulipifera
gb|ADY04490.1|  cysteine protease                                       118   8e-31   Clarkia xantiana subsp. xantiana
gb|KEH43476.1|  papain family cysteine protease                         123   1e-30   Medicago truncatula
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like            122   1e-30   Camelina sativa [gold-of-pleasure]
gb|AEQ54770.1|  cysteine proteinase CP1                                 123   2e-30   Coffea canephora [robusta coffee]
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg             122   2e-30   Capsella rubella
emb|CAB41090.1|  cysteine proteinase precursor-like protein             122   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911             122   3e-30   Arabidopsis lyrata subsp. lyrata
ref|NP_567010.5|  Papain family cysteine protease                       122   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                    121   5e-30   Arabis alpina [alpine rockcress]
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like            121   5e-30   Cicer arietinum [garbanzo]
gb|KHN00877.1|  Cysteine proteinase 15A                                 120   5e-30   Glycine soja [wild soybean]
emb|CDO99795.1|  unnamed protein product                                121   6e-30   Coffea canephora [robusta coffee]
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494       120   9e-30   Brassica rapa
emb|CAB16316.1|  cysteine proteinase precursor                          119   2e-29   Vicia sativa [spring vetch]
emb|CDY13816.1|  BnaA09g43180D                                          118   3e-29   Brassica napus [oilseed rape]
gb|KHN37802.1|  Cysteine proteinase 1                                   119   4e-29   Glycine soja [wild soybean]
ref|XP_008776953.1|  PREDICTED: cysteine proteinase-like                114   4e-29   Phoenix dactylifera
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A                 119   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like            117   5e-29   Malus domestica [apple tree]
gb|EMS59778.1|  Cysteine proteinase 15A                                 115   5e-29   Triticum urartu
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33           118   6e-29   Glycine max [soybeans]
ref|NP_001236888.1|  cysteine proteinase precursor                      118   6e-29   Glycine max [soybeans]
ref|NP_001059639.1|  Os07g0480900                                       118   6e-29   
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A                 118   7e-29   Malus domestica [apple tree]
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like            118   8e-29   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like            118   8e-29   
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494       117   9e-29   
emb|CDY56961.1|  BnaA09g55030D                                          117   1e-28   
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g             118   1e-28   
emb|CDX73424.1|  BnaC08g25790D                                          117   1e-28   
gb|ADE76932.1|  unknown                                                 117   1e-28   
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270          117   1e-28   
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like          114   2e-28   
gb|ABO93617.1|  papain-like cysteine proteinase                         112   2e-28   
ref|XP_001781954.1|  predicted protein                                  116   4e-28   
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A                 116   4e-28   
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg                115   6e-28   
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like              115   6e-28   
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A                 115   7e-28   
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg             115   7e-28   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A                 115   9e-28   
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg             115   1e-27   
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A                 115   1e-27   
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494       115   1e-27   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A                 115   1e-27   
emb|CCA95082.1|  putative responsive to dehydration 19                  110   1e-27   
ref|XP_001761980.1|  predicted protein                                  114   1e-27   
tpg|DAA40800.1|  TPA: putative cysteine protease family protein         114   1e-27   
emb|CAQ00102.1|  papain-like cysteine proteinase                        114   2e-27   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A                 114   2e-27   
gb|KJB73490.1|  hypothetical protein B456_011G235500                    114   2e-27   
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                   114   3e-27   
gb|KHG08355.1|  Cysteinease 1                                           114   3e-27   
gb|EEC82027.1|  hypothetical protein OsI_25996                          116   3e-27   
emb|CAB17077.1|  cysteine proteinase precursor                          113   3e-27   
ref|XP_007510080.1|  unknown                                            114   5e-27   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A                 112   7e-27   
emb|CBI31400.3|  unnamed protein product                                111   8e-27   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800          112   8e-27   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like            112   2e-26   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                         111   3e-26   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A                 110   3e-26   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                   110   3e-26   
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494       110   4e-26   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg             110   4e-26   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A                 110   5e-26   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site               110   7e-26   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A                 110   8e-26   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g             109   8e-26   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A                 108   2e-25   
emb|CAN64491.1|  hypothetical protein VITISV_015725                     108   2e-25   
ref|XP_010103534.1|  putative cysteine proteinase A494                  108   3e-25   
ref|XP_007010012.1|  Papain family cysteine protease                    108   4e-25   
ref|XP_008647122.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin 7-...    106   8e-25   
ref|XP_002533377.1|  cysteine protease, putative                        106   1e-24   
ref|XP_003081549.1|  Cysteine proteinase Cathepsin F (ISS)              104   3e-24   
gb|AFW72358.1|  putative cysteine protease family protein               107   4e-24   
ref|XP_001419933.1|  predicted protein                                  103   9e-24   
ref|XP_011469621.1|  PREDICTED: cysteine proteinase 15A-like            100   3e-23   
gb|EPS63354.1|  hypothetical protein M569_11429                         102   3e-23   
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    100   2e-22   
ref|XP_011169692.1|  PREDICTED: putative cysteine proteinase CG12163    100   2e-21   
ref|XP_003057227.1|  predicted protein                                97.1    2e-21   
ref|XP_006608091.1|  PREDICTED: uncharacterized protein LOC102680728  99.4    4e-21   
gb|EFN80374.1|  Putative cysteine proteinase CG12163                  99.4    4e-21   
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896  99.4    4e-21   
emb|CAN80141.1|  hypothetical protein VITISV_038978                   96.7    4e-21   
ref|XP_003696602.1|  PREDICTED: putative cysteine proteinase CG12...  99.0    5e-21   
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163  98.6    7e-21   
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...  98.6    7e-21   
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163  98.6    7e-21   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904  98.6    9e-21   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...  96.7    2e-20   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708     97.4    2e-20   
ref|XP_392381.3|  PREDICTED: putative cysteine proteinase CG12163...  97.4    2e-20   
ref|XP_006567715.1|  PREDICTED: putative cysteine proteinase CG12...  97.4    2e-20   
emb|CAN71324.1|  hypothetical protein VITISV_013970                   95.5    3e-20   
ref|XP_005184487.1|  PREDICTED: putative cysteine proteinase CG12...  95.9    5e-20   
ref|XP_011493714.1|  AAEL017153-PA                                    96.3    6e-20   
ref|XP_005184486.1|  PREDICTED: putative cysteine proteinase CG12...  95.9    6e-20   
gb|KFB38327.1|  AGAP002879-PB-like protein                            95.9    8e-20   
gb|EFN65613.1|  Putative cysteine proteinase CG12163                  95.5    9e-20   
ref|XP_001607324.1|  PREDICTED: uncharacterized protein LOC100123649  95.5    9e-20   
dbj|BAI44279.1|  cysteine proteinase inhibitor precursor              95.9    1e-19   
ref|XP_001994049.1|  GH22731                                          94.7    1e-19   
ref|XP_011260522.1|  PREDICTED: uncharacterized protein LOC105253881  95.5    1e-19   
gb|EGI66903.1|  Putative cysteine proteinase                          95.1    1e-19   
ref|XP_001844355.1|  conserved hypothetical protein                   95.5    1e-19   
ref|XP_011052455.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  95.1    1e-19   
ref|XP_002000409.1|  GI10216                                          94.4    1e-19   
ref|XP_008550537.1|  PREDICTED: uncharacterized protein LOC103573287  94.7    2e-19   
ref|XP_002017233.1|  GL22196                                          94.0    2e-19   
ref|XP_002056575.1|  GJ11017                                          94.0    2e-19   
ref|XP_002137768.1|  GA27408, isoform A                               94.0    2e-19   
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620  94.4    3e-19   
ref|XP_002096026.1|  GE25302                                          93.6    3e-19   
ref|NP_730901.1|  CG12163, isoform A                                  93.2    3e-19   
ref|XP_002988513.1|  hypothetical protein SELMODRAFT_128220           87.8    4e-19   
ref|XP_002038380.1|  GM10654                                          93.2    4e-19   
ref|XP_001978897.1|  GG11133                                          93.2    4e-19   
ref|XP_001955780.1|  GF16067                                          93.2    4e-19   
gb|ETN61472.1|  hypothetical protein AND_006867                       93.6    5e-19   
gb|AJF94882.1|  C1 family cathepsin F10                               93.6    5e-19   
ref|XP_003736743.1|  GA27408, isoform B                               92.0    5e-19   
ref|NP_649521.1|  CG12163, isoform B                                  91.3    8e-19   
ref|XP_002505924.1|  cysteine endopeptidase                           89.4    1e-18   
gb|AFQ01139.1|  cathepsin F-like protease                             91.7    1e-18   
ref|XP_312034.5|  AGAP002879-PA                                       92.8    1e-18   
ref|XP_003436277.1|  AGAP002879-PB                                    92.8    1e-18   
gb|EZA58965.1|  Putative cysteine proteinase                          92.4    1e-18   
ref|XP_002073772.1|  GK14287                                          91.7    1e-18   
emb|CAN81617.1|  hypothetical protein VITISV_001998                   89.0    1e-18   
ref|XP_011331416.1|  PREDICTED: uncharacterized protein LOC105275911  92.4    1e-18   
gb|ACR08662.1|  cathepsin F                                           87.4    2e-18   
ref|XP_002979143.1|  hypothetical protein SELMODRAFT_110288           88.2    2e-18   
ref|XP_008195657.1|  PREDICTED: uncharacterized protein LOC662417...  92.0    2e-18   
ref|XP_008195656.1|  PREDICTED: uncharacterized protein LOC662417...  92.0    2e-18   
emb|CAN81619.1|  hypothetical protein VITISV_002000                   88.2    3e-18   
gb|ABE72973.1|  cathepsin L                                           87.8    3e-18   
emb|CBY11269.1|  unnamed protein product                              88.2    4e-18   
ref|XP_003436276.1|  AGAP002879-PC                                    90.5    5e-18   
emb|CBI23088.3|  unnamed protein product                              85.5    5e-18   
gb|EHJ64782.1|  cysteine proteinase inhibitor precursor               84.3    1e-17   
ref|XP_011309436.1|  PREDICTED: uncharacterized protein LOC105270293  89.4    1e-17   
ref|XP_005184488.1|  PREDICTED: putative cysteine proteinase CG12...  87.0    3e-17   
gb|KDR17524.1|  Putative cysteine proteinase                          88.2    3e-17   
ref|XP_011434326.1|  PREDICTED: uncharacterized protein LOC105333...  87.4    5e-17   
ref|XP_011434325.1|  PREDICTED: uncharacterized protein LOC105333...  87.4    5e-17   
gb|EKC42097.1|  Cathepsin F                                           87.0    5e-17   
emb|CBY31096.1|  unnamed protein product                              84.7    7e-17   
gb|ENN81374.1|  hypothetical protein YQE_02191                        87.4    7e-17   
gb|ERG79645.1|  cysteine proteinase                                   80.5    1e-16   
gb|KHN72698.1|  Putative cysteine proteinase                          80.9    1e-16   
gb|AEW08440.1|  hypothetical protein 2_9845_02                        79.7    1e-16   
gb|ABC48936.1|  cathepsin F like protease                             85.1    1e-16   
ref|XP_002427787.1|  Cathepsin F precursor, putative                  84.3    2e-16   
emb|CDX82031.1|  BnaC08g35700D                                        82.4    2e-16   
gb|ERL92611.1|  hypothetical protein D910_09924                       84.3    2e-16   
ref|XP_009047014.1|  hypothetical protein LOTGIDRAFT_172186           82.0    4e-16   
gb|AFM37363.1|  cathepsin F1                                          83.6    4e-16   
gb|AII16490.1|  cathepsin F                                           81.6    6e-16   
emb|CDJ26737.1|  cathepsin F-like cysteine peptidase protein          83.2    7e-16   
ref|NP_001156454.1|  cathepsin F isoform 2 precursor                  83.6    8e-16   
ref|XP_003115597.1|  CRE-TAG-196 protein                              82.0    2e-15   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956           80.5    2e-15   
gb|ELT97360.1|  hypothetical protein CAPTEDRAFT_147978                79.7    3e-15   
ref|NP_505215.2|  Protein TAG-196                                     81.6    3e-15   
gb|KFM67613.1|  putative cysteine proteinase                          80.9    4e-15   
ref|XP_003389037.1|  PREDICTED: cathepsin L1-like                     79.7    4e-15   
ref|NP_001156453.1|  cathepsin F isoform 1 precursor                  81.3    5e-15   
ref|XP_002635317.1|  C. briggsae CBR-TAG-196 protein                  80.5    6e-15   
gb|EGT34543.1|  hypothetical protein CAEBREN_26318                    80.5    7e-15   
gb|EYC18288.1|  hypothetical protein Y032_0028g1777                   75.5    8e-15   
ref|XP_002682087.1|  predicted protein                                79.0    9e-15   
gb|EGT34572.1|  hypothetical protein CAEBREN_13324                    79.7    1e-14   
emb|CAC94443.1|  cysteine proteinase                                  76.3    1e-14   
gb|AAF21461.1|U69120_1  cysteine proteinase PWCP1                     79.0    2e-14   
gb|KIH48456.1|  cysteine proteinase family protein                    73.6    2e-14   
ref|XP_009161938.1|  hypothetical protein T265_00017                  76.3    2e-14   
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...  78.6    3e-14   
dbj|GAA47436.1|  cathepsin L                                          76.6    3e-14   
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...  78.6    3e-14   
dbj|BAN20819.1|  cysteine-type endopeptidase                          79.3    3e-14   
ref|XP_635374.1|  cysteine protease                                   77.0    4e-14   
ref|XP_002610214.1|  hypothetical protein BRAFLDRAFT_216923           75.9    5e-14   
ref|XP_002119872.3|  PREDICTED: cathepsin L-like                      77.4    7e-14   
ref|XP_003284553.1|  hypothetical protein DICPUDRAFT_96752            75.9    1e-13   
ref|XP_004351999.1|  cysteine protease                                75.9    1e-13   
ref|XP_635417.1|  cysteine proteinase 1                               75.5    1e-13   
emb|CAA26255.1|  cysteine proteinase I precursor                      75.5    1e-13   
gb|EFX71333.1|  hypothetical protein DAPPUDRAFT_189155                74.7    1e-13   
ref|XP_009034680.1|  hypothetical protein AURANDRAFT_22129            75.1    2e-13   
gb|ABY75169.1|  cysteine protease                                     70.9    2e-13   
ref|XP_003148243.1|  hypothetical protein LOAG_12683                  73.6    2e-13   
gb|EFO15826.2|  hypothetical protein LOAG_12683                       73.6    2e-13   
gb|AAR27011.1|  cysteine protease                                     73.9    3e-13   
gb|AAT07059.1|  cathepsin F-like cysteine proteinase                  75.5    3e-13   
ref|XP_003375070.1|  viral cathepsin                                  75.5    4e-13   
ref|XP_009035714.1|  hypothetical protein AURANDRAFT_53321            74.3    4e-13   
ref|XP_006121731.1|  PREDICTED: cathepsin W-like                      73.2    4e-13   
ref|XP_005305646.1|  PREDICTED: cathepsin W-like                      73.9    5e-13   
emb|CAC94444.1|  cysteine proteinase                                  71.6    5e-13   
ref|XP_009064230.1|  hypothetical protein LOTGIDRAFT_204652           73.6    6e-13   
ref|XP_008472006.1|  PREDICTED: putative cysteine proteinase CG12163  72.0    6e-13   
ref|XP_003747496.1|  PREDICTED: cathepsin L-like                      73.6    6e-13   
dbj|GAM23991.1|  hypothetical protein SAMD00019534_071660             73.6    6e-13   
ref|XP_001029851.1|  Papain family cysteine protease containing p...  73.6    6e-13   
ref|XP_006268168.1|  PREDICTED: cathepsin F-like                      74.7    7e-13   
ref|XP_002978562.1|  hypothetical protein SELMODRAFT_109056           73.6    8e-13   
ref|XP_006007112.1|  PREDICTED: cathepsin F-like                      74.3    8e-13   
dbj|BAF94154.1|  cathepsin F-like cysteine protease                   75.1    8e-13   
ref|XP_002681317.1|  cysteine protease                                73.2    1e-12   
ref|XP_002970484.1|  hypothetical protein SELMODRAFT_93661            73.2    1e-12   
emb|CDP90584.1|  Protein BM-TAG-196                                   73.9    1e-12   
ref|XP_006036937.1|  PREDICTED: cathepsin F-like                      73.6    1e-12   
emb|CAX69889.1|  Temporarily Assigned Gene name                       73.6    1e-12   
gb|AAW25775.1|  SJCHGC00511 protein                                   73.6    1e-12   
gb|AAT09103.1|  digestive cysteine proteinase                         72.8    2e-12   
gb|AAB01769.1|  cysteine proteinase homolog                           72.4    2e-12   
ref|XP_007438969.1|  PREDICTED: cathepsin F-like                      70.9    2e-12   
ref|XP_005101893.1|  PREDICTED: cathepsin F-like isoform X1           73.2    2e-12   
emb|CDQ07779.1|  Protein Bm12113, isoform a                           69.3    2e-12   
ref|XP_008177856.1|  PREDICTED: cathepsin W-like                      68.6    3e-12   
emb|CEF60946.1|  Cathepsin L.1                                        71.6    3e-12   
ref|XP_011406938.1|  PREDICTED: silicatein-like                       70.1    3e-12   
gb|ELW65130.1|  Cathepsin W                                           72.8    4e-12   
emb|CEF63690.1|  Cathepsin F                                          72.0    4e-12   
ref|XP_006980634.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      72.4    4e-12   
ref|XP_004364962.1|  cysteine proteinase 7                            71.6    4e-12   
gb|KGB33519.1|  Cathepsin L                                           71.2    4e-12   
gb|ELV09527.1|  Cathepsin F                                           72.8    4e-12   
ref|XP_005351748.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      72.4    4e-12   
ref|XP_001894882.1|  cathepsin F-like cysteine proteinase             68.9    4e-12   
gb|EPY22055.1|  cysteine peptidase A                                  72.4    5e-12   
ref|XP_001898698.1|  fibroinase precursor                             69.7    5e-12   
gb|ENN81994.1|  hypothetical protein YQE_01705                        71.6    5e-12   
gb|AEE62591.1|  unknown                                               71.6    5e-12   
emb|CDQ05036.1|  Protein Bm9835                                       69.7    5e-12   
gb|EGW06365.1|  Cathepsin F                                           72.0    5e-12   
ref|XP_007648967.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      72.0    5e-12   
ref|XP_010765827.1|  PREDICTED: cathepsin W                           72.4    5e-12   
ref|XP_002117255.1|  hypothetical protein TRIADDRAFT_61245            71.2    6e-12   
ref|NP_001133678.1|  Cathepsin F precursor                            72.0    6e-12   
gb|ERE78742.1|  cathepsin F                                           71.6    6e-12   
ref|XP_008577225.1|  PREDICTED: cathepsin F                           72.0    7e-12   



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICR
Sbjct  284  YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICR  343

Query  183  GRNICGVGSMVSTVAAVNTPTSD  251
            GRN+CGV SMVSTVAAV+T TSD
Sbjct  344  GRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICR
Sbjct  286  YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICR  345

Query  183  GRNICGVGSMVSTVAAVNTPTSD  251
            GRN+CGV SMVSTVAAV+T TSD
Sbjct  346  GRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICR
Sbjct  286  YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICR  345

Query  183  GRNICGVGSMVSTVAAVNTPTSD  251
            GRN+CGV SMVSTVAAV+T TSD
Sbjct  346  GRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICR
Sbjct  286  YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICR  345

Query  183  GRNICGVGSMVSTVAAVNTPTSD  251
            GRN+CGV SMVSTVAAV+T TSD
Sbjct  346  GRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICR
Sbjct  284  YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICR  343

Query  183  GRNICGVGSMVSTVAAVNTPTSD  251
            GRN+CGV SMVSTVAAV+T TSD
Sbjct  344  GRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score =   166 bits (421),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE GYYKICR
Sbjct  284  YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGYYKICR  343

Query  183  GRNICGVGSMVSTVAAVNTPTSD  251
            GRN+CGV SMVSTVAAV+T TSD
Sbjct  344  GRNVCGVDSMVSTVAAVSTTTSD  366



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score =   166 bits (421),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 71/79 (90%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YI GVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGESWGE G+YKICR
Sbjct  314  YIKGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGESWGEDGFYKICR  373

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAAV+T
Sbjct  374  GRNICGVDSMVSTVAAVDT  392



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score =   162 bits (409),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  289  YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGESGYYKICR  348

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV SMVSTVAAV T + 
Sbjct  349  GRNVCGVDSMVSTVAAVQTSSQ  370



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  292  YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGENWGESGYYKICR  351

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAAV T + 
Sbjct  352  GRNICGVDSMVSTVAAVQTASE  373



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  293  YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGYYKICR  352

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRN+CGV S+VSTVAAVNT
Sbjct  353  GRNVCGVDSLVSTVAAVNT  371



>sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, 
partial [Carica papaya]
 emb|CAA27609.1| pot. cysteine proteinase [Carica papaya]
Length=96

 Score =   152 bits (383),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RL+HGVLLVGYGSAGYAPIRLKEKPYW+IKNSWGE+WGE GYYKICR
Sbjct  15   YIGGVSCPYICSRRLNHGVLLVGYGSAGYAPIRLKEKPYWVIKNSWGENWGENGYYKICR  74

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAAV+T + 
Sbjct  75   GRNICGVDSMVSTVAAVHTTSQ  96



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RLDHGVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YKICR
Sbjct  293  YIGGVSCPYICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYKICR  352

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            GRNICGV SMVSTVAAV T +
Sbjct  353  GRNICGVDSMVSTVAAVQTSS  373



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 78/83 (94%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+RLKEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  290  YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRLKEKPYWIIKNSWGENWGESGYYKICR  349

Query  183  GRNICGVGSMVSTVAA-VNTPTS  248
            GRNICGV SMVSTVAA V TP+ 
Sbjct  350  GRNICGVDSMVSTVAAVVQTPSQ  372



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RLDHGVLLVGYGSAGYAP+R+KEKPYWIIKNSWGESWGE G+YKICR
Sbjct  287  YIGGVSCPYICSRRLDHGVLLVGYGSAGYAPVRMKEKPYWIIKNSWGESWGENGFYKICR  346

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAAV T
Sbjct  347  GRNICGVDSMVSTVAAVQT  365



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLK+KPYWIIKNSWGE+WGE G+YKICR
Sbjct  293  YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKDKPYWIIKNSWGETWGENGFYKICR  352

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRN+CGV S+VSTVAAVNT
Sbjct  353  GRNVCGVDSLVSTVAAVNT  371



>gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides]
Length=156

 Score =   153 bits (386),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RLDHGVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YKICR
Sbjct  76   YIGGVSCPYICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYKICR  135

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            GRN+CGV SMVSTVAAV T +
Sbjct  136  GRNVCGVDSMVSTVAAVQTSS  156



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+KEKPYWIIKNSWGESWGE G+YKIC+
Sbjct  284  YVGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKEKPYWIIKNSWGESWGENGFYKICQ  343

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV SMVSTVAAV+T ++
Sbjct  344  GRNVCGVDSMVSTVAAVHTTSN  365



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score =   159 bits (401),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICR
Sbjct  292  YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICR  351

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAAVNT
Sbjct  352  GRNICGVDSMVSTVAAVNT  370



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score =   158 bits (400),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICR
Sbjct  292  YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICR  351

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAAVNT
Sbjct  352  GRNICGVDSMVSTVAAVNT  370



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   158 bits (400),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGS+GYAPIR+KEKPYWIIKNSWGE WGE GYYKICR
Sbjct  292  YIGGVSCPYICSKRLDHGVLLVGYGSSGYAPIRMKEKPYWIIKNSWGEHWGENGYYKICR  351

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            G NICGV SMVSTVAAV+T T
Sbjct  352  GHNICGVDSMVSTVAAVHTST  372



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score =   158 bits (400),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGSAGYAP+R+K+KPYWIIKNSWGE+WGE G+Y+ICR
Sbjct  292  YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPVRMKDKPYWIIKNSWGENWGENGFYRICR  351

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAAVNT
Sbjct  352  GRNICGVDSMVSTVAAVNT  370



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RLDHGVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YKICR
Sbjct  287  YIGGVSCPYICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYKICR  346

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAAV T
Sbjct  347  GRNICGVDSMVSTVAAVQT  365



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RLDHGVLLVGYGSA YAP+R+KEKPYWIIKNSWGESWGE G+YKICR
Sbjct  287  YIGGVSCPYICSRRLDHGVLLVGYGSAAYAPVRMKEKPYWIIKNSWGESWGENGFYKICR  346

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAAV T
Sbjct  347  GRNICGVDSMVSTVAAVQT  365



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE G+YKICR
Sbjct  296  YVGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGENWGENGFYKICR  355

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV SMVSTVAAV+T ++
Sbjct  356  GRNVCGVDSMVSTVAAVHTTSN  377



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICR
Sbjct  296  YIGGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICR  355

Query  183  GRNICGVGSMVSTVAAV  233
            GRN+CGV SMVSTVAA 
Sbjct  356  GRNVCGVDSMVSTVAAA  372



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGS  Y+PIRLKEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  282  YVGGVSCPYICSKRLDHGVLLVGYGSGAYSPIRLKEKPYWIIKNSWGETWGENGYYKICR  341

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            GRNICGV SMVSTVAAV+T T
Sbjct  342  GRNICGVDSMVSTVAAVHTTT  362



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICR
Sbjct  296  YIGGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICR  355

Query  183  GRNICGVGSMVSTVAAV  233
            GRN+CGV SMVSTVAA 
Sbjct  356  GRNVCGVDSMVSTVAAA  372



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICR
Sbjct  251  YIGGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICR  310

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAAV+T T 
Sbjct  311  GRNICGVDSMVSTVAAVHTTTQ  332



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICR
Sbjct  288  YVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICR  347

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAA +  T+
Sbjct  348  GRNICGVDSMVSTVAAASVKTN  369



>ref|XP_009351218.1| PREDICTED: cysteine proteinase RD19a-like, partial [Pyrus x bretschneideri]
Length=282

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICR
Sbjct  199  YVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICR  258

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAA +  T+
Sbjct  259  GRNICGVDSMVSTVAAASVKTN  280



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/78 (92%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGS GYAPIRLK+KPYWIIKNSWGE WGE GYYKICR
Sbjct  289  YIGGVSCPYICSKRLDHGVLLVGYGSEGYAPIRLKDKPYWIIKNSWGEGWGENGYYKICR  348

Query  183  GRNICGVGSMVSTVAAVN  236
            GRN+CGV SMVSTVAAVN
Sbjct  349  GRNVCGVDSMVSTVAAVN  366



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICR
Sbjct  282  YIGGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICR  341

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAAV+T T 
Sbjct  342  GRNICGVDSMVSTVAAVHTTTQ  363



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGSAGY+P+R+KEKPYWIIKNSWGE+WGEKG+YKICR
Sbjct  294  YVGGVSCPYICSKRLDHGVLLVGYGSAGYSPVRMKEKPYWIIKNSWGENWGEKGFYKICR  353

Query  183  GRNICGVGSMVSTVAAVN  236
            GRNICGV SMVSTVAAV 
Sbjct  354  GRNICGVDSMVSTVAAVE  371



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE GYYKICR
Sbjct  296  YIGGVSCPYICSRRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICR  355

Query  183  GRNICGVGSMVSTVAAV  233
            GRN+CGV SMVST+AA 
Sbjct  356  GRNVCGVDSMVSTIAAA  372



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICR
Sbjct  288  YVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICR  347

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAA +  T+
Sbjct  348  GRNICGVDSMVSTVAAASVKTN  369



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGE+WGE G+YKICR
Sbjct  288  YVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGENWGENGFYKICR  347

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAA +  T+
Sbjct  348  GRNICGVDSMVSTVAAASVKTN  369



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score =   155 bits (392),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVLLVGYG AGYAPIRLKEKPYWIIKNSWGESWGE GYYKICR
Sbjct  254  YIGGVSCPYICGKNLDHGVLLVGYGKAGYAPIRLKEKPYWIIKNSWGESWGENGYYKICR  313

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRN+CGV SMVSTVAAV+T
Sbjct  314  GRNVCGVDSMVSTVAAVHT  332



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YKIC+
Sbjct  284  YVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYKICK  343

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAA +  T+
Sbjct  344  GRNICGVDSMVSTVAAASVETN  365



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score =   155 bits (393),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYG+AGY+PIR+KEKPYWIIKNSWGE+WGEKG+YKIC+
Sbjct  284  YVGGVSCPYICSKRLDHGVLLVGYGAAGYSPIRMKEKPYWIIKNSWGENWGEKGFYKICK  343

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAA +  T+
Sbjct  344  GRNICGVDSMVSTVAAASVETN  365



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score =   155 bits (393),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RLDHGVLLVGYGSAGY+PIR+K+KPYWIIKNSWGE WGE G+YKICR
Sbjct  287  YIGGVSCPYICSRRLDHGVLLVGYGSAGYSPIRMKDKPYWIIKNSWGEKWGENGFYKICR  346

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV SMVSTVAAV T + 
Sbjct  347  GRNVCGVDSMVSTVAAVQTTSQ  368



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score =   155 bits (393),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 77/84 (92%), Gaps = 2/84 (2%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIR+K+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  286  YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRMKDKPYWIIKNSWGETWGENGYYKICR  345

Query  183  GRNICGVGSMVSTVAAV--NTPTS  248
            GRNICGV SMVSTVAA    TP S
Sbjct  346  GRNICGVDSMVSTVAAAVHTTPGS  369



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCP ICSKRLDHGVLLVGYG AGYAPIR KEKPYWIIKNSWGE WGEKGYYKICR
Sbjct  299  YIGGVSCPLICSKRLDHGVLLVGYGEAGYAPIRRKEKPYWIIKNSWGEKWGEKGYYKICR  358

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAAV+T
Sbjct  359  GRNICGVDSMVSTVAAVST  377



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE G+YKICR
Sbjct  282  YVGGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGFYKICR  341

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAAV+T T 
Sbjct  342  GRNICGVDSMVSTVAAVHTTTQ  363



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR
Sbjct  286  YVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICR  345

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAA++T
Sbjct  346  GRNICGVDSMVSTVAAIHT  364



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   155 bits (392),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RLDHGVLLVGYGSAGY+P+R+KEKP+WIIKNSWGE WGE G+YKICR
Sbjct  287  YIGGVSCPYICSRRLDHGVLLVGYGSAGYSPVRMKEKPFWIIKNSWGEKWGENGFYKICR  346

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV SMVSTVAAV T + 
Sbjct  347  GRNVCGVDSMVSTVAAVQTSSQ  368



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  209  YIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGETWGENGYYKICR  268

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRN+CGV SMVSTV A++T
Sbjct  269  GRNVCGVDSMVSTVTAIHT  287



>gb|AAL69389.1|AF462226_1 putative cysteine proteinase [Narcissus pseudonarcissus]
Length=136

 Score =   148 bits (374),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVLLVGYGS+G+APIR KEKPYWIIKNSWGE+WGEKGYYKIC+
Sbjct  54   YIGGVSCPYICGKHLDHGVLLVGYGSSGWAPIRFKEKPYWIIKNSWGENWGEKGYYKICK  113

Query  183  GRNICGVGSMVSTVAAVNTPTSD  251
            GRN+CGV SMVSTV A++T   D
Sbjct  114  GRNVCGVDSMVSTVTAIHTTPKD  136



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICR
Sbjct  286  YVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICR  345

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAA++T
Sbjct  346  GRNICGVDSMVSTVAAIHT  364



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGSA Y+PIR+KEKPYWIIKNSWGE+WGE G+YKICR
Sbjct  295  YVGGVSCPYICSKRLDHGVLLVGYGSAAYSPIRMKEKPYWIIKNSWGENWGENGFYKICR  354

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAA++T
Sbjct  355  GRNICGVDSMVSTVAAIHT  373



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCP+ICSKRLDHGVLLVGYG+A YAPIRLKEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  298  YIGGVSCPFICSKRLDHGVLLVGYGAASYAPIRLKEKPYWIIKNSWGENWGENGYYKICR  357

Query  183  GRNICGVGSMVSTVAAVNT  239
            G N+CGV SMVSTVAAV+T
Sbjct  358  GHNVCGVDSMVSTVAAVST  376



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICR
Sbjct  286  YVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICR  345

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAA++T
Sbjct  346  GRNICGVDSMVSTVAAIHT  364



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGEKGYYKICR
Sbjct  290  YIGGVSCPYICGRHLDHGVLLVGYGSAGYSPIRLKQKPFWIIKNSWGETWGEKGYYKICR  349

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRN+CGV SMVSTV A+NT
Sbjct  350  GRNVCGVDSMVSTVTAINT  368



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKR DHGVLLVGYGSAGYAPIR KEKP+WIIKNSWG++WGE GYYKICR
Sbjct  286  YVGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRFKEKPFWIIKNSWGQNWGENGYYKICR  345

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAA++T
Sbjct  346  GRNICGVDSMVSTVAAIHT  364



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score =   155 bits (393),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVS PYICS+RLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YKICR
Sbjct  362  YVGGVSYPYICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYKICR  421

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAA +  T+
Sbjct  422  GRNICGVDSMVSTVAAASVKTN  443



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score =   154 bits (390),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+ GVSCPYIC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE+GYYKICR
Sbjct  320  YMKGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEEGYYKICR  379

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            GRN+CGV SMVS+VAA+ T +
Sbjct  380  GRNVCGVDSMVSSVAALQTKS  400



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score =   155 bits (392),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVS PYICS+RLDHGVLLVGYG+AGY+PIRLKEKPYWIIKNSWGESW E G+YKICR
Sbjct  364  YVGGVSYPYICSRRLDHGVLLVGYGAAGYSPIRLKEKPYWIIKNSWGESWRESGFYKICR  423

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAA +  T+
Sbjct  424  GRNICGVDSMVSTVAAASVKTN  445



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score =   153 bits (386),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+ GVSCPYICS+RLDHGVLLVGYGS  YAPIR+KEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  280  YMHGVSCPYICSRRLDHGVLLVGYGSGAYAPIRMKEKPYWIIKNSWGENWGENGYYKICR  339

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            GRNICGV SMVSTVAAV+T T
Sbjct  340  GRNICGVDSMVSTVAAVHTTT  360



>gb|ABK93575.1| unknown [Populus trichocarpa]
Length=157

 Score =   147 bits (371),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR
Sbjct  76   YIGGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICR  135

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
             RNICGV SMVSTVAA++    
Sbjct  136  ARNICGVDSMVSTVAAIHATAQ  157



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score =   152 bits (385),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  288  YIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKICR  347

Query  183  GRNICGVGSMVSTVAAVNT  239
            GR+ICGV SMVSTVAA++T
Sbjct  348  GRDICGVDSMVSTVAAIHT  366



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   152 bits (385),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKR DHGV+LVGYGSAGYAP+RLK+KP+WIIKNSWGE+WGE GYYKICR
Sbjct  285  YIGGVSCPYICSKRQDHGVVLVGYGSAGYAPVRLKDKPFWIIKNSWGENWGENGYYKICR  344

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRN+CGV +MVSTVAA++T
Sbjct  345  GRNVCGVDAMVSTVAAIHT  363



>gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida]
Length=190

 Score =   147 bits (372),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 75/81 (93%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKR DHGVLLVGYGS G+APIR+KEKPYWIIKNSWGE WGE GYYKICR
Sbjct  111  YVGGVSCPYICSKRQDHGVLLVGYGS-GFAPIRMKEKPYWIIKNSWGEKWGESGYYKICR  169

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            GRN+CGV SMVSTVAAV+T +
Sbjct  170  GRNVCGVDSMVSTVAAVSTSS  190



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICR
Sbjct  296  YIGGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICR  355

Query  183  GRNICGVGSMVSTVAAVN  236
            GRNICGV S+VSTVAAV+
Sbjct  356  GRNICGVDSLVSTVAAVH  373



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICR
Sbjct  290  YIGGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICR  349

Query  183  GRNICGVGSMVSTVAAVN  236
            GRNICGV S+VSTVAAV+
Sbjct  350  GRNICGVDSLVSTVAAVH  367



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCP+ICSKRLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGESWGE GYYKICR
Sbjct  296  YIGGVSCPFICSKRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGESWGENGYYKICR  355

Query  183  GRNICGVGSMVSTVAAVN  236
            GRNICGV S+VSTVAAV+
Sbjct  356  GRNICGVDSLVSTVAAVH  373



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPY+CS+RL+HGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICR
Sbjct  284  YIGGVSCPYVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICR  343

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVA+V+T T 
Sbjct  344  GRNICGVDSMVSTVASVHTTTQ  365



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RL+HGVLLVGYGS GY+PIR+K+KPYWIIKNSWGESWGE GYYKICR
Sbjct  288  YIGGVSCPYICSRRLNHGVLLVGYGSEGYSPIRMKDKPYWIIKNSWGESWGENGYYKICR  347

Query  183  GRNICGVGSMVSTVAAVNT  239
            GR++CGV SMVSTVAA++T
Sbjct  348  GRDVCGVDSMVSTVAAIHT  366



>emb|CDQ51995.1| Cysteine proteinase, partial [Fagus sylvatica]
Length=165

 Score =   146 bits (368),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+ GVSCPYIC + LDHGVLLVG+GSAGYAPIRLKEKP+WIIKNSWGE+WGE GYYKICR
Sbjct  87   YMKGVSCPYICGRHLDHGVLLVGFGSAGYAPIRLKEKPFWIIKNSWGENWGENGYYKICR  146

Query  183  GRNICGVGSMVSTVAAVN  236
            GRN+CGV SMVSTVAA+N
Sbjct  147  GRNVCGVDSMVSTVAAIN  164



>dbj|BAD94010.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
Length=86

 Score =   144 bits (362),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+
Sbjct  4    YIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICK  63

Query  183  GRNICGVGSMVSTVAAVNTPTSD  251
            GRNICGV SMVSTVAA  + T+ 
Sbjct  64   GRNICGVDSMVSTVAATVSTTAH  86



>gb|AJP16692.1| cysteine protease, partial [Striga hermonthica]
Length=148

 Score =   145 bits (367),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+ GVSCPYICSKRLDHGVLLVGYG +GYAPIR+K+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  73   YMKGVSCPYICSKRLDHGVLLVGYGESGYAPIRMKDKPYWIIKNSWGENWGENGYYKICR  132

Query  183  GRNICGVGSMVSTVAA  230
            GRN+CGV SMVSTVAA
Sbjct  133  GRNVCGVDSMVSTVAA  148



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score =   151 bits (381),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YI GVSCPYICSK LDHGVLLVGYGS GYAPIRLK+KPYWIIKNSWG +WGE GYYKICR
Sbjct  296  YIKGVSCPYICSKHLDHGVLLVGYGSDGYAPIRLKDKPYWIIKNSWGANWGENGYYKICR  355

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAAV+T
Sbjct  356  GRNICGVDSMVSTVAAVHT  374



>gb|AAU81589.1| cysteine proteinase [Petunia x hybrida]
Length=257

 Score =   148 bits (373),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCP IC KR DHGVLLVGYGSAG+APIRLKEKPYWIIKNSWGESWGE+GYYKICR
Sbjct  174  YVGGVSCPLICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGESWGEQGYYKICR  233

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV +MVSTV A +T
Sbjct  234  GRNICGVDAMVSTVTAAHT  252



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score =   150 bits (380),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKR DHGVLLVGYGSAGYAPIRLK+KP+WIIKNSWGESWGE GYY+ICR
Sbjct  286  YMGGVSCPYICSKRQDHGVLLVGYGSAGYAPIRLKDKPFWIIKNSWGESWGENGYYRICR  345

Query  183  GRNICGVGSMVSTVAAVN  236
            GRNICGV +MVS+VAA++
Sbjct  346  GRNICGVDAMVSSVAAIH  363



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score =   150 bits (380),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 75/82 (91%), Gaps = 2/82 (2%)
 Frame = +3

Query  3    YIGGVSCPYICSKRL-DHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            YIGGVSCPYICSKRL DHGVLLVGYGSAG+APIR KEKPYWIIKNSWGESWGEKGYYKIC
Sbjct  292  YIGGVSCPYICSKRLLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGESWGEKGYYKIC  351

Query  180  RGRNICGVGSMVSTVAAVNTPT  245
            RGRNICG+ SMVS VAA   PT
Sbjct  352  RGRNICGMDSMVSAVAAA-VPT  372



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score =   150 bits (379),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICR
Sbjct  285  YIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICR  344

Query  183  GRNICGVGSMVSTVAAVN  236
            GRN+CGV SMVSTVAA++
Sbjct  345  GRNVCGVDSMVSTVAAIH  362



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score =   150 bits (380),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSKR DHGVLLVGYGSAGY+PIRLKEKPYWIIKNSWG +WGE+GYYKIC 
Sbjct  289  YIGGVSCPYICSKRQDHGVLLVGYGSAGYSPIRLKEKPYWIIKNSWGANWGEEGYYKICH  348

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CG+ +MVS+VAAV+T T 
Sbjct  349  GRNLCGMDTMVSSVAAVHTSTQ  370



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score =   150 bits (379),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICR
Sbjct  285  YIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICR  344

Query  183  GRNICGVGSMVSTVAAVN  236
            GRN+CGV SMVSTVAA++
Sbjct  345  GRNVCGVDSMVSTVAAIH  362



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score =   150 bits (379),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYYKICR
Sbjct  285  YIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYKICR  344

Query  183  GRNICGVGSMVSTVAAVN  236
            GRN+CGV SMVSTVAA++
Sbjct  345  GRNVCGVDSMVSTVAAIH  362



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKIC+
Sbjct  295  YIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEDGYYKICK  354

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRN+CGV SMVSTV AV +
Sbjct  355  GRNVCGVDSMVSTVTAVRS  373



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RL+HGVLLVGYGSAGYAP R+KEKP+WIIKNSWGE+WGEKG+YKICR
Sbjct  285  YIGGVSCPYICSRRLNHGVLLVGYGSAGYAPARMKEKPFWIIKNSWGENWGEKGFYKICR  344

Query  183  GRNICGVGSMVSTVAA  230
            GRNICGV S+VSTVAA
Sbjct  345  GRNICGVDSLVSTVAA  360



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPY+CS+RL+HGVLLVGYGS  YAPIR+KEKP+WIIKNSWGE+WGE GYYKICR
Sbjct  284  YIGGVSCPYVCSRRLNHGVLLVGYGSGAYAPIRMKEKPFWIIKNSWGENWGENGYYKICR  343

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GR+ICGV SMVSTVA+V+T T 
Sbjct  344  GRSICGVDSMVSTVASVHTTTQ  365



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYGSAGY+PIRLK+KP+WIIKNSWGE+WGE GYYKICR
Sbjct  287  YIGGVSCPYICGRHLDHGVLLVGYGSAGYSPIRLKDKPFWIIKNSWGENWGEHGYYKICR  346

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVS+V+A++T
Sbjct  347  GRNICGVDSMVSSVSAIHT  365



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYGSA YAPIR KEKPYWIIKNSWGE WGE GYYKICR
Sbjct  292  YIGGVSCPYICGRHLDHGVLLVGYGSAAYAPIRFKEKPYWIIKNSWGEKWGENGYYKICR  351

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRN+CGV SMVSTVAAV +
Sbjct  352  GRNVCGVDSMVSTVAAVRS  370



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+ GVSCPYIC+KRLDHGVLLVGYG  GY+PIR+KEKPYWIIKNSWG +WGE GYYKICR
Sbjct  299  YMKGVSCPYICTKRLDHGVLLVGYGETGYSPIRMKEKPYWIIKNSWGPNWGEDGYYKICR  358

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            GRNICGV SMVSTVAAV+T +
Sbjct  359  GRNICGVDSMVSTVAAVSTTS  379



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR
Sbjct  286  YIGGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICR  345

Query  183  GRNICGVGSMVSTVAAVN  236
             RNICGV SMVSTVAA++
Sbjct  346  ARNICGVDSMVSTVAAIH  363



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCP+ICS RLDHGVLLVGYGSAGYAPIR+++K YWIIKNSWGE+WGE GYYKICR
Sbjct  294  YIGGVSCPFICSNRLDHGVLLVGYGSAGYAPIRMRDKDYWIIKNSWGENWGENGYYKICR  353

Query  183  GRNICGVGSMVSTVAAVN  236
            GRNICGV S+VSTVAAV+
Sbjct  354  GRNICGVDSLVSTVAAVH  371



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  279  YVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICR  338

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAA++T
Sbjct  339  GRNICGVDSMVSTVAALHT  357



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR KEKP+WIIKNSWGE+WGE GYYKICR
Sbjct  286  YIGGVSCPYICSKHQDHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICR  345

Query  183  GRNICGVGSMVSTVAAVN  236
             RNICGV SMVSTVAA++
Sbjct  346  ARNICGVDSMVSTVAAIH  363



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+ GVSCPYICS+ LDHGV+LVGYGSAGYAPIR KEKPYWIIKNSWGESWGE GYYKICR
Sbjct  286  YMKGVSCPYICSRNLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGESWGEDGYYKICR  345

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            G N CGV SMVSTVAA+ T T 
Sbjct  346  GHNACGVDSMVSTVAAIQTTTQ  367



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 76/81 (94%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICR
Sbjct  289  YVGGVSCPYICSKRLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICR  347

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            GRN+CGV SMVSTVAAV+T +
Sbjct  348  GRNVCGVDSMVSTVAAVSTSS  368



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCP+IC+KRLDHGVLLVGYG+  +APIR+KEKPYWIIKNSWG +WGEKGYYKIC+
Sbjct  298  YVGGVSCPFICAKRLDHGVLLVGYGAGAFAPIRMKEKPYWIIKNSWGPNWGEKGYYKICQ  357

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRN+CGV SMVSTVAAV T
Sbjct  358  GRNLCGVDSMVSTVAAVTT  376



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y  GVSCPYICS  LDHGVLLVGYGSAGY+PIR KEKPYWIIKNSWGESWGE+GYYKICR
Sbjct  290  YKSGVSCPYICSSTLDHGVLLVGYGSAGYSPIRFKEKPYWIIKNSWGESWGEQGYYKICR  349

Query  183  GRNICGVGSMVSTVAAVNT  239
            G NICGV SMVSTVAA++T
Sbjct  350  GHNICGVDSMVSTVAAIHT  368



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYIC K LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  280  YVGGVSCPYICGKHLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYYKICR  339

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRN+CGV SMVS+V+A +T
Sbjct  340  GRNVCGVDSMVSSVSAFHT  358



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICR
Sbjct  287  YIGGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICR  346

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV S+VSTV A  +PT+
Sbjct  347  GRNVCGVDSLVSTVTAAVSPTA  368



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  280  YVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICR  339

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAA++T
Sbjct  340  GRNICGVDSMVSTVAALHT  358



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCP+ICSK LDHGVLLVGYGSAGY+PI LK+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  296  YIGGVSCPFICSKHLDHGVLLVGYGSAGYSPIHLKDKPYWIIKNSWGENWGENGYYKICR  355

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            G N+CGV S+VSTV A+NT + 
Sbjct  356  GSNVCGVDSLVSTVVALNTKSQ  377



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YI GVSCPYICS+ LDHGVLLVGYGS GYAPIR+K+KPYWIIKNSWG +WGE GYYKICR
Sbjct  296  YIRGVSCPYICSRHLDHGVLLVGYGSEGYAPIRMKDKPYWIIKNSWGANWGENGYYKICR  355

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAAV+T  +
Sbjct  356  GRNICGVDSMVSTVAAVHTAAN  377



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  279  YVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICR  338

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV SMVSTVAA++T
Sbjct  339  GRNICGVDSMVSTVAALHT  357



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVLLVGYGS  YAPIR KEKPYWIIKNSWGESWGE+GYY ICR
Sbjct  285  YIGGVSCPYICGKHLDHGVLLVGYGSGAYAPIRFKEKPYWIIKNSWGESWGEEGYYNICR  344

Query  183  GRNICGVGSMVSTVAAVN  236
            GRN+CGV SMVSTVAA++
Sbjct  345  GRNVCGVDSMVSTVAAIH  362



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 76/81 (94%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICR
Sbjct  289  YVGGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICR  347

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            GRN+CGV SMVSTVAAV+T +
Sbjct  348  GRNVCGVDSMVSTVAAVSTSS  368



>gb|AAB62937.1| stress-induced cysteine proteinase [Lavatera thuringiaca]
Length=175

 Score =   143 bits (361),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYG+AGYAP+R KEKP+WIIKNSWG +WGE GYYKICR
Sbjct  94   YIGGVSCPYICFRSLDHGVLLVGYGAAGYAPVRFKEKPFWIIKNSWGANWGEDGYYKICR  153

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV SMVS+VAA+ T + 
Sbjct  154  GRNVCGVDSMVSSVAALQTKSQ  175



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 76/81 (94%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICR
Sbjct  289  YVGGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYKICR  347

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            GRN+CGV SMVSTVAAV+T +
Sbjct  348  GRNVCGVDSMVSTVAAVSTSS  368



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 75/79 (95%), Gaps = 1/79 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            YIGGVSCPYICSK  LDHGVLLVGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYYKIC
Sbjct  285  YIGGVSCPYICSKHMLDHGVLLVGYGTAGYAPIRFKDKPYWIIKNSWGENWGEQGYYKIC  344

Query  180  RGRNICGVGSMVSTVAAVN  236
            RGRN+CGV SMVSTVAA++
Sbjct  345  RGRNVCGVDSMVSTVAALH  363



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+
Sbjct  286  YIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICK  345

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAA  + T+
Sbjct  346  GRNICGVDSMVSTVAATVSTTA  367



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            YIGGVSCPYIC K  LDHGVLLVGYGS+GYAPIR KEKPYWIIKNSWG+SWGE+GYYKIC
Sbjct  286  YIGGVSCPYICGKNHLDHGVLLVGYGSSGYAPIRFKEKPYWIIKNSWGQSWGEEGYYKIC  345

Query  180  RGRNICGVGSMVSTVAAVNT  239
            RGRN+CGV SMVSTVAA++T
Sbjct  346  RGRNVCGVDSMVSTVAAMHT  365



>gb|KHN12668.1| Cysteine proteinase 15A [Glycine soja]
Length=156

 Score =   142 bits (359),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICR
Sbjct  75   YVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICR  134

Query  183  GRNICGVGSMVSTVAAV  233
            GRN+CGV SMVSTVAA+
Sbjct  135  GRNVCGVDSMVSTVAAI  151



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC 
Sbjct  288  YIGGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICM  347

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV SMVS+VAAV+T +S
Sbjct  348  GRNVCGVDSMVSSVAAVHTTSS  369



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC++RL+HGVLLVGYG+AGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+
Sbjct  286  YIGGVSCPYICTRRLNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICK  345

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAA  + T+
Sbjct  346  GRNICGVDSMVSTVAATVSTTA  367



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYKICR
Sbjct  285  YIGGVSCPYICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYKICR  344

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            G N+CGV SMVSTVAA++T +
Sbjct  345  GHNVCGVDSMVSTVAAIHTSS  365



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  280  YVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICR  339

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRN+CGV SMVSTVAA++T
Sbjct  340  GRNVCGVDSMVSTVAALHT  358



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVLLVGYG+  YAPIR KEKP+WIIKNSWGESWGE GYYKICR
Sbjct  285  YIGGVSCPYICGKHLDHGVLLVGYGAGAYAPIRFKEKPFWIIKNSWGESWGENGYYKICR  344

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            G N+CGV SMVSTVAA++T +
Sbjct  345  GHNVCGVDSMVSTVAAIHTSS  365



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSK  DHGVLLVGYG+AGYAPIR K+KP+WIIKNSWGE+WGE GYYKICR
Sbjct  285  YIGGVSCPYICSKSQDHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGENWGENGYYKICR  344

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICG+ +MVS+VAA++T
Sbjct  345  GRNICGMDAMVSSVAAIHT  363



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score =   147 bits (372),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPY+CSK+L+HGVLLVGYGS  YAPIR+K+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  279  YVGGVSCPYVCSKKLNHGVLLVGYGSESYAPIRMKQKPYWIIKNSWGENWGENGYYKICR  338

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRN+CGV SMVSTVAA++T
Sbjct  339  GRNVCGVDSMVSTVAALHT  357



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score =   147 bits (372),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC 
Sbjct  288  YIGGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICM  347

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV SMVS+VAA++T +S
Sbjct  348  GRNVCGVDSMVSSVAAIHTTSS  369



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score =   147 bits (372),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 73/81 (90%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVLLVGYG+AGYAPIRLKEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  290  YIGGVSCPYICGKHLDHGVLLVGYGAAGYAPIRLKEKPYWIIKNSWGENWGENGYYKICR  349

Query  183  GRNICGVGSMVSTVAAVN-TP  242
            G N+CGV SMVSTV A + TP
Sbjct  350  GHNVCGVASMVSTVTAAHVTP  370



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score =   147 bits (372),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYKICR
Sbjct  286  YIGGVSCPYICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYKICR  345

Query  183  GR-NICGVGSMVSTVAAVNTPTS  248
            GR NICG+ +MVSTVAAV+T T 
Sbjct  346  GRHNICGMDTMVSTVAAVHTSTQ  368



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score =   147 bits (372),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICR
Sbjct  286  YIGGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICR  345

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV S+VSTV A  +P +
Sbjct  346  GRNVCGVDSLVSTVTATVSPAA  367



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score =   147 bits (372),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKICR
Sbjct  286  YIGGVSCPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGEDGFYKICR  345

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV S+VSTV A  +P +
Sbjct  346  GRNVCGVDSLVSTVTATVSPAA  367



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score =   147 bits (371),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            YIGGVSCPYICSKR LDHGVL+VGYGSAGYAPIRLK+K YWIIKNSWGE+WGEKGYYKIC
Sbjct  286  YIGGVSCPYICSKRNLDHGVLIVGYGSAGYAPIRLKDKAYWIIKNSWGETWGEKGYYKIC  345

Query  180  RGRNICGVGSMVSTVAAVNT  239
            RG NICGV SMVSTVA++ +
Sbjct  346  RGHNICGVDSMVSTVASIQS  365



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score =   147 bits (372),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVL+VGYGS+G+APIR KEKPYWIIKNSWGE+WGE GYYKIC 
Sbjct  288  YIGGVSCPYICGKYLDHGVLIVGYGSSGFAPIRFKEKPYWIIKNSWGENWGENGYYKICM  347

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV SMVS+VAA++T +S
Sbjct  348  GRNVCGVDSMVSSVAAIHTTSS  369



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score =   147 bits (372),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGESWGE G+YKIC+
Sbjct  291  YIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGESWGENGFYKICK  350

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV S+VSTV+A  + T+
Sbjct  351  GRNICGVDSLVSTVSATVSTTA  372



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score =   147 bits (371),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG +WGE GYYKICR
Sbjct  286  YIGGVSCPYICSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSTWGEDGYYKICR  345

Query  183  GR-NICGVGSMVSTVAAVNTPT  245
            GR NICG+ +MVSTVAAV+T T
Sbjct  346  GRHNICGMDTMVSTVAAVHTST  367



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score =   147 bits (372),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 62/84 (74%), Positives = 72/84 (86%), Gaps = 1/84 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            Y+GGVSCPY+C+K+ LDHGVLLVGYG+AGYAP RLK KP+WIIKNSWG  WGE GYYK+C
Sbjct  310  YVGGVSCPYVCNKQNLDHGVLLVGYGAAGYAPGRLKNKPFWIIKNSWGPDWGEDGYYKLC  369

Query  180  RGRNICGVGSMVSTVAAVNTPTSD  251
            RG N+CG+ +MVSTVAA N  T D
Sbjct  370  RGHNVCGINTMVSTVAAANIQTDD  393



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+
Sbjct  285  YIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICK  344

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV S+VSTVAA  + T+
Sbjct  345  GRNICGVDSLVSTVAATVSTTA  366



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYIC KR+DHGVLLVGYGS+G+APIRLKEKPYWI+KNSWG+SWGE+GYYKICR
Sbjct  284  YVGGVSCPYICGKRIDHGVLLVGYGSSGFAPIRLKEKPYWILKNSWGQSWGEQGYYKICR  343

Query  183  GRNICGVGSMVSTVAAVNT  239
            G N CGV S+VSTVAA++T
Sbjct  344  GYNSCGVDSLVSTVAALHT  362



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score =   147 bits (372),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 65/86 (76%), Positives = 73/86 (85%), Gaps = 3/86 (3%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCP+IC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  314  YIGGVSCPFICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICR  373

Query  183  G---RNICGVGSMVSTVAAVNTPTSD  251
            G   +N CGV SMVSTV A++T   +
Sbjct  374  GAHVKNKCGVDSMVSTVTAIHTSNKE  399



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            YIGGVSCPYICSKR LDHGVLLVGYG+AGYAPIR K+KPYWI+KNSWGE+WGE+GYYKIC
Sbjct  287  YIGGVSCPYICSKRNLDHGVLLVGYGAAGYAPIRFKDKPYWIVKNSWGENWGEEGYYKIC  346

Query  180  RGRNICGVGSMVSTVAAVNT  239
            RG NICG+ SMVSTV A +T
Sbjct  347  RGNNICGIDSMVSTVTAAST  366



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+
Sbjct  286  YIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICK  345

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV S+VSTV+A  + T+
Sbjct  346  GRNICGVDSLVSTVSATVSTTA  367



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  284  YVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYKICR  343

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV SMVSTV A++  T 
Sbjct  344  GRNVCGVDSMVSTVGAIHASTQ  365



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+
Sbjct  286  YIGGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICK  345

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV S+VSTV A  + T+
Sbjct  346  GRNICGVDSLVSTVTAAVSTTA  367



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYGSAGYAPIR K+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  290  YIGGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGENWGEDGYYKICR  349

Query  183  GRNICGVGSMVSTVAAV  233
            G NICGV SMVSTV A+
Sbjct  350  GHNICGVESMVSTVTAI  366



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVLLVGYG+AGYAPIR K+KP+WIIKNSWGESWGE GYYKICR
Sbjct  277  YIGGVSCPYICGKNLDHGVLLVGYGAAGYAPIRFKDKPFWIIKNSWGESWGEDGYYKICR  336

Query  183  GRNICGVGSMVSTVAAVNTPTSD  251
            G+N+CGV SMVS+V A    +S+
Sbjct  337  GKNVCGVDSMVSSVVATTFTSSN  359



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  284  YVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGENGYYKICR  343

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV SMVSTV A++  T 
Sbjct  344  GRNVCGVDSMVSTVGAIHASTQ  365



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score =   146 bits (369),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 66/82 (80%), Positives = 72/82 (88%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  320  YIGGVSCPYICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICR  379

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   +N CGV SMVSTV A++T
Sbjct  380  GPHVKNKCGVDSMVSTVTAIHT  401



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score =   145 bits (367),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+
Sbjct  285  YIGGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICK  344

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV S+VSTV A  + T+
Sbjct  345  GRNICGVDSLVSTVTAAVSTTA  366



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+
Sbjct  286  YIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICK  345

Query  183  GRNICGVGSMVSTVAAV  233
            GRNICGV S+VSTV+A 
Sbjct  346  GRNICGVDSLVSTVSAT  362



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+
Sbjct  285  YIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICK  344

Query  183  GRNICGVGSMVSTVAAV  233
            GRNICGV S+VSTV+A 
Sbjct  345  GRNICGVDSLVSTVSAT  361



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC+
Sbjct  285  YIGGVSCPYICARRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKICK  344

Query  183  GRNICGVGSMVSTVAAV  233
            GRNICGV S+VSTV+A 
Sbjct  345  GRNICGVDSLVSTVSAT  361



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICR
Sbjct  283  YIGGVSCPYVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICR  342

Query  183  G-RNICGVGSMVSTVAAVNTPT  245
            G  N+CG+ SMVSTVAAV+T T
Sbjct  343  GPHNVCGMDSMVSTVAAVHTTT  364



>emb|CAB53397.1| cysteine protease [Medicago sativa]
Length=209

 Score =   141 bits (356),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            Y+ GVSCP+IC+K RLDHGVLLVG+GS GYAPIRLKEKPYWIIKNSWG++WGE+GYYKIC
Sbjct  130  YMSGVSCPHICAKARLDHGVLLVGFGSGGYAPIRLKEKPYWIIKNSWGQNWGEEGYYKIC  189

Query  180  RGRNICGVGSMVSTVAAVNT  239
            RGRN+CGV SMVSTVAA  +
Sbjct  190  RGRNVCGVDSMVSTVAAAQS  209



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score =   144 bits (363),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+
Sbjct  235  YIGGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICK  294

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV S+VSTVAA  +
Sbjct  295  GRNICGVDSLVSTVAATTS  313



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   145 bits (365),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICR
Sbjct  283  YIGGVSCPYVCSKNQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICR  342

Query  183  G-RNICGVGSMVSTVAAVNTPT  245
            G  N+CG+ SMVSTVAAV+T T
Sbjct  343  GPHNMCGMDSMVSTVAAVHTTT  364



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score =   145 bits (365),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC+KRLDHGV +VGYG +GYAPIR KEKPYWIIKNSWGESWGE GYYKICR
Sbjct  283  YIGGVSCPYICAKRLDHGVQIVGYGESGYAPIRFKEKPYWIIKNSWGESWGENGYYKICR  342

Query  183  GRNICGVGSMVSTVAAVNT  239
            G+N CGV SMVSTV A++ 
Sbjct  343  GQNACGVDSMVSTVGAIHA  361



>ref|XP_006665032.1| PREDICTED: cysteine proteinase 1-like [Oryza brachyantha]
Length=191

 Score =   140 bits (354),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVLLVGYGS+G+APIRLK+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  107  YIGGVSCPYICGKHLDHGVLLVGYGSSGFAPIRLKDKPYWIIKNSWGENWGEHGYYKICR  166

Query  183  GRNI---CGVGSMVSTVAAVNT  239
            G N+   CGV SMVSTV A++T
Sbjct  167  GSNVRDKCGVDSMVSTVTAIHT  188



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYGSAGYAPIR K+KPYWIIKNSWG +WGE GYYKICR
Sbjct  292  YIGGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKDKPYWIIKNSWGGNWGEDGYYKICR  351

Query  183  GRNICGVGSMVSTVAAVNT  239
            G+NICGV SMVSTV AV T
Sbjct  352  GQNICGVESMVSTVTAVRT  370



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPY+CSK  DHGVLLVG+GSAGYAPIRLKEKPYWIIKNSWG  WGE GYYKICR
Sbjct  283  YIGGVSCPYVCSKSQDHGVLLVGFGSAGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICR  342

Query  183  G-RNICGVGSMVSTVAAVNTPT  245
            G  N+CG+ SMVSTVAAV+T T
Sbjct  343  GPHNMCGMDSMVSTVAAVHTTT  364



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+
Sbjct  283  YIGGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICK  342

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV S+VSTVAA  +
Sbjct  343  GRNICGVDSLVSTVAATTS  361



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCP+IC K LDHGVLLVGYG+ GYAPIR KEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  283  YIGGVSCPFICGKHLDHGVLLVGYGAGGYAPIRFKEKPYWIIKNSWGENWGENGYYKICR  342

Query  183  GRNICGVGSMVSTVAAVNT  239
            G N+CGV SMVSTV A++T
Sbjct  343  GPNMCGVDSMVSTVIAIHT  361



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score =   144 bits (364),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RL+HGVLLVGYGSAG++  RLKEKPYWIIKNSWGESWGE G+YKIC+
Sbjct  283  YIGGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICK  342

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV S+VSTVAA  +
Sbjct  343  GRNICGVDSLVSTVAATTS  361



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score =   145 bits (365),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC++RL+HGVLLVGYGSAGYAP R KE+PYWIIKNSWGE+WGE G+YKIC+
Sbjct  285  YIGGVSCPYICTRRLNHGVLLVGYGSAGYAPARFKERPYWIIKNSWGETWGENGFYKICK  344

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV S+VSTV A  + T+
Sbjct  345  GRNICGVDSLVSTVTAAVSTTA  366



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score =   144 bits (364),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YI GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICR
Sbjct  284  YIAGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICR  343

Query  183  GR-NICGVGSMVSTVAAVNT  239
            G  NICGV +MVSTVAAVNT
Sbjct  344  GTPNICGVDTMVSTVAAVNT  363



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICR
Sbjct  311  YVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICR  370

Query  183  GRNICGVGSMVSTVAAV  233
            GRN+CGV SMVSTVAA+
Sbjct  371  GRNVCGVDSMVSTVAAI  387



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 1/81 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKI R
Sbjct  289  YVGGVSCPYICSKQLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGESGYYKIRR  347

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            GRN+CGV SMVSTVAAV+T +
Sbjct  348  GRNVCGVDSMVSTVAAVSTSS  368



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICSK  DHGVLLVGYG+AGYAPIRLK+KPYWIIKNSWGE+WGE GYYK CR
Sbjct  297  YIGGVSCPYICSKSQDHGVLLVGYGAAGYAPIRLKDKPYWIIKNSWGENWGENGYYKFCR  356

Query  183  G-RNICGVGSMVSTVAAVNT  239
              RN+CGV SMVS+VAAV+T
Sbjct  357  ADRNLCGVDSMVSSVAAVHT  376



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVL+VGYG   YAPIR K KPYWIIKNSWGESWGE GYYKICR
Sbjct  286  YIGGVSCPYICGKHLDHGVLIVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYYKICR  345

Query  183  GRNICGVGSMVSTVAAV  233
            GRN+CGV SMVSTVAA+
Sbjct  346  GRNVCGVDSMVSTVAAI  362



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y GGVSCP+ICS  L+HGVLLVGYGSAGY+PIR KEKPYW++KNSWG++WGE GYYKICR
Sbjct  285  YAGGVSCPFICSTSLNHGVLLVGYGSAGYSPIRFKEKPYWLLKNSWGQNWGEHGYYKICR  344

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            G NICGV SMVSTVAA+ + T
Sbjct  345  GHNICGVDSMVSTVAAIQSAT  365



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            YIGGVSCPYICSK+ LDHGVL+VGYG+AGYAPIR K+KPYWIIKNSWGE+WGE+GYYKIC
Sbjct  289  YIGGVSCPYICSKKNLDHGVLIVGYGAAGYAPIRFKDKPYWIIKNSWGENWGEEGYYKIC  348

Query  180  RGRNICGVGSMVSTVAAVNT  239
            RG NICGV SMVS+V A +T
Sbjct  349  RGNNICGVDSMVSSVTAAST  368



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 72/82 (88%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  281  YIGGVSCPYICGKHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKICR  340

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   +N CGV SMVSTV A++T
Sbjct  341  GPHVQNKCGVDSMVSTVTAIHT  362



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCP +C + LDHGV+LVGYGSAGYAPIR KEKPYWIIKNSWG +WG++GYYKICR
Sbjct  293  YIGGVSCPLVCLRSLDHGVVLVGYGSAGYAPIRFKEKPYWIIKNSWGPNWGDQGYYKICR  352

Query  183  GRNICGVGSMVSTVAAVN  236
            G N+CGV SMVSTVAAVN
Sbjct  353  GHNVCGVDSMVSTVAAVN  370



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            Y+ GVSCPYIC+K RLDHGVLL+G+G  GYAPIRLKEKPYWIIKNSWG++WGE+GYYKIC
Sbjct  285  YMSGVSCPYICAKARLDHGVLLLGFGQGGYAPIRLKEKPYWIIKNSWGQNWGEEGYYKIC  344

Query  180  RGRNICGVGSMVSTVAAVNT  239
            RGRN+CGV SMVSTVAA  +
Sbjct  345  RGRNVCGVDSMVSTVAAAQS  364



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RL+HGVLL+GYGS+GY+  RLKEKPYWIIKNSWGESWGE G+YKIC+
Sbjct  282  YIGGVSCPYICSRRLNHGVLLMGYGSSGYSQARLKEKPYWIIKNSWGESWGENGFYKICK  341

Query  183  GRNICGVGSMVSTVAAVNT  239
            GRNICGV S+VSTVAA  +
Sbjct  342  GRNICGVDSLVSTVAAATS  360



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYKICR
Sbjct  285  YVGGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEQGYYKICR  344

Query  183  GRNICGVGSMVSTVAAVN  236
            G N CGV S+VSTVAA++
Sbjct  345  GYNSCGVDSLVSTVAALH  362



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+ GVSCP IC KR DHGVLLVGYGSAG+APIRLKEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  280  YMRGVSCPLICFKRQDHGVLLVGYGSAGFAPIRLKEKPYWIIKNSWGENWGEHGYYKICR  339

Query  183  GRNICGVGSMVSTVAAVNT  239
            G NICGV +MVSTV A +T
Sbjct  340  GHNICGVDAMVSTVTATHT  358



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+ GVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+GYYKICR
Sbjct  285  YVKGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGYYKICR  344

Query  183  GRNICGVGSMVSTVAAVNT  239
            G N CGV S+VSTVA+++T
Sbjct  345  GHNPCGVDSLVSTVASLHT  363



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYIC + LDHGVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYYKICR
Sbjct  289  YMGGVSCPYICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYKICR  348

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV SMVS+VAA++T + 
Sbjct  349  GRNVCGVDSMVSSVAALHTKSQ  370



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICR
Sbjct  283  YIGGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGSMWGEHGYYKICR  342

Query  183  G-RNICGVGSMVSTVAAVNTPT  245
            G  N+CG+ +MVSTVAAV+T T
Sbjct  343  GPHNMCGMDTMVSTVAAVHTTT  364



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPY+CSK  DHGVLLVG+GS+GY+PIRLKEKPYWIIKNSWG  WGE GYYKICR
Sbjct  285  YIGGVSCPYVCSKSQDHGVLLVGFGSSGYSPIRLKEKPYWIIKNSWGSMWGEHGYYKICR  344

Query  183  G-RNICGVGSMVSTVAAVNTPTS  248
            G  NICG+ +MVSTVAAV T T 
Sbjct  345  GSHNICGMDTMVSTVAAVQTSTQ  367



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYIC K LDHGVLLVGYG   YAPIR KEKPYWIIKNSWGE+WG  GYYKICR
Sbjct  284  YVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKEKPYWIIKNSWGENWGGNGYYKICR  343

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV SMVSTV A++  T 
Sbjct  344  GRNVCGVDSMVSTVGAIHASTQ  365



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YI GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICR
Sbjct  286  YIAGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICR  345

Query  183  GR-NICGVGSMVSTVAAVNT  239
            G  NICGV +MVSTVAAV+T
Sbjct  346  GTPNICGVDTMVSTVAAVHT  365



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YI GVSCPY+CSK  DHGVLLVG+GSAGYAP+RL+EKPYWIIKNSWG  WGEKGYYKICR
Sbjct  284  YIAGVSCPYVCSKNQDHGVLLVGFGSAGYAPLRLEEKPYWIIKNSWGSMWGEKGYYKICR  343

Query  183  GR-NICGVGSMVSTVAAVNT  239
            G  NICGV +MVSTVAAV+T
Sbjct  344  GTPNICGVDTMVSTVAAVHT  363



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score =   142 bits (358),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+ GVSCPYIC KR+DHGVLLVGYGS+G+APIR KEKPYWI+KNSWG+SWGE+G+YKICR
Sbjct  286  YVKGVSCPYICGKRIDHGVLLVGYGSSGFAPIRFKEKPYWILKNSWGQSWGEEGFYKICR  345

Query  183  GRNICGVGSMVSTVAAVNT  239
            G N CGV S+VSTVA+++T
Sbjct  346  GHNSCGVDSLVSTVASLHT  364



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score =   142 bits (358),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            Y+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYYKIC
Sbjct  282  YMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYKIC  341

Query  180  RGRNICGVGSMVSTVAAVNT  239
            RGRN+CGV SMVSTVAA  +
Sbjct  342  RGRNVCGVDSMVSTVAAAQS  361



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score =   142 bits (358),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYIC + LDHGVLLVGYG+AGY+PIR K+KP+WIIKNSWG +WGE GYY+ICR
Sbjct  289  YMGGVSCPYICFRTLDHGVLLVGYGAAGYSPIRFKDKPFWIIKNSWGANWGEDGYYRICR  348

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV SMVS+VAA++T + 
Sbjct  349  GRNVCGVDSMVSSVAALHTKSQ  370



>gb|AGS43121.1| cysteine protease 1, partial [Zea mays]
Length=90

 Score =   134 bits (338),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  6    YIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICR  65

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   RN CGV SMVSTV+AV+ 
Sbjct  66   GSNVRNKCGVDSMVSTVSAVHA  87



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score =   142 bits (357),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            Y+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWIIKNSWG++WGE+GYYKIC
Sbjct  277  YMSGVSCPYVCAKARLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYKIC  336

Query  180  RGRNICGVGSMVSTVAAVNT  239
            RGRN+CGV SMVSTVAA  +
Sbjct  337  RGRNVCGVDSMVSTVAAAQS  356



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYG+AG+APIRLK+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  287  YIGGVSCPYICGRTLDHGVLLVGYGAAGFAPIRLKDKPYWIIKNSWGENWGENGYYKICR  346

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   RN CGV SMVSTV+AV T
Sbjct  347  GSNVRNKCGVDSMVSTVSAVRT  368



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYICS+RL+HGVLLVGYGSAG+A  RLK+KPYWIIKNSWGE+WGE GYYK+CR
Sbjct  286  YIGGVSCPYICSRRLNHGVLLVGYGSAGFAQARLKKKPYWIIKNSWGETWGENGYYKLCR  345

Query  183  GRNICGVGSMVSTVA  227
            GRNICGV S+VSTVA
Sbjct  346  GRNICGVDSLVSTVA  360



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+
Sbjct  266  YMGGVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCK  325

Query  183  GRNICGVGSMVSTVAAV  233
            GRN+CGV SMVSTVAA 
Sbjct  326  GRNVCGVDSMVSTVAAA  342



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            Y+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYYKIC
Sbjct  282  YMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYKIC  341

Query  180  RGRNICGVGSMVSTVAAVNT  239
            RGRN+CGV SMVSTVAA  +
Sbjct  342  RGRNVCGVDSMVSTVAAAQS  361



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            Y+ GVSCPY+C+K RLDHGVLLVG+G   YAPIRLKEKPYWI+KNSWG++WGE+GYYKIC
Sbjct  282  YMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIVKNSWGQNWGEQGYYKIC  341

Query  180  RGRNICGVGSMVSTVAAVNT  239
            RGRN+CGV SMVSTVAA  +
Sbjct  342  RGRNVCGVDSMVSTVAAAQS  361



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICR
Sbjct  295  YIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICR  354

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   +N CGV SMVS+V A++T
Sbjct  355  GPHDKNKCGVDSMVSSVTAIHT  376



>emb|CAA57675.1| cysteine proteinase [Zea mays]
Length=145

 Score =   136 bits (342),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 73/82 (89%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYG++G+AP+RLK+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  61   YIGGVSCPYICGRHLDHGVLLVGYGASGFAPMRLKDKPYWIIKNSWGENWGENGYYKICR  120

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   RN CGV SMVSTV+AV+ 
Sbjct  121  GSNVRNKCGVDSMVSTVSAVHA  142



>gb|EAY93546.1| hypothetical protein OsI_15336 [Oryza sativa Indica Group]
Length=348

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICR
Sbjct  262  YIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICR  321

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   +N CGV SMVS+V A++T
Sbjct  322  GPHDKNKCGVDSMVSSVTAIHT  343



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            Y+ GVSCPYICSKR LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWGE+WGE GYY IC
Sbjct  292  YMKGVSCPYICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGENWGENGYYFIC  351

Query  180  RGRNICGVGSMVSTVAAVNTPT  245
            +G+N+CG  SMVS+VAA  TP 
Sbjct  352  KGKNVCGSESMVSSVAAAATPN  373



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 72/82 (88%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  294  YIGGVSCPYICGRHLDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICR  353

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   +N CGV SMVSTV A++T
Sbjct  354  GPHVKNKCGVDSMVSTVTAIHT  375



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICR
Sbjct  278  YIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICR  337

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   +N CGV SMVS+V A++T
Sbjct  338  GPHDKNKCGVDSMVSSVTAIHT  359



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+
Sbjct  285  YMGGVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCK  344

Query  183  GRNICGVGSMVSTVAAV  233
            GRN+CG+ SMVSTVAA 
Sbjct  345  GRNVCGIDSMVSTVAAA  361



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRL+HGVLLVGYGSAG++  R KEKPYWIIKNSWGE+WGE G+YK+C+
Sbjct  285  YMGGVSCPYICSKRLNHGVLLVGYGSAGFSQARFKEKPYWIIKNSWGETWGENGFYKLCK  344

Query  183  GRNICGVGSMVSTVAAV  233
            GRN+CG+ SMVSTVAA 
Sbjct  345  GRNVCGIDSMVSTVAAA  361



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 76/83 (92%), Gaps = 2/83 (2%)
 Frame = +3

Query  3    YIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            Y+ GVSCPYIC+K RLDHGVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYYKIC
Sbjct  281  YMSGVSCPYICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYYKIC  339

Query  180  RGRNICGVGSMVSTVAAVNTPTS  248
            RGRNICGV SMVSTVAAV+   +
Sbjct  340  RGRNICGVDSMVSTVAAVHASNN  362



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YI GVSCPYIC K LDHGVLLVGYGSAGYAP+R K KPYWIIKNSWGE+WGE GYYKICR
Sbjct  289  YIHGVSCPYICGKHLDHGVLLVGYGSAGYAPVRFKNKPYWIIKNSWGENWGENGYYKICR  348

Query  183  GRNICGVGSMVSTVAAVN  236
            G N+CGV SMVS+V+A++
Sbjct  349  GNNVCGVDSMVSSVSALH  366



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 76/83 (92%), Gaps = 2/83 (2%)
 Frame = +3

Query  3    YIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            Y+ GVSCPYIC+K RLDHGVLLVG+G+ G+APIRLKEKPYWIIKNSWG++WGE+GYYKIC
Sbjct  277  YMSGVSCPYICAKSRLDHGVLLVGFGN-GFAPIRLKEKPYWIIKNSWGQNWGEEGYYKIC  335

Query  180  RGRNICGVGSMVSTVAAVNTPTS  248
            RGRNICGV SMVSTVAAV+   +
Sbjct  336  RGRNICGVDSMVSTVAAVHASNN  358



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICR
Sbjct  280  YVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICR  339

Query  183  GRNICGVGSMVSTVAAVNT  239
            G NICGV +MVSTV A +T
Sbjct  340  GHNICGVDAMVSTVTAAHT  358



>gb|AEX97108.1| cysteine proteinase, partial [Malus domestica]
Length=128

 Score =   135 bits (339),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 70/78 (90%), Gaps = 1/78 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            YI GVSCPYICSKR LDHGVLLVGYGSAG+APIR KEKPYWIIKNSWG++WGE GYY IC
Sbjct  11   YIKGVSCPYICSKRNLDHGVLLVGYGSAGFAPIRFKEKPYWIIKNSWGQNWGENGYYLIC  70

Query  180  RGRNICGVGSMVSTVAAV  233
            +GRNICG  SMVS+VAA 
Sbjct  71   KGRNICGSESMVSSVAAT  88



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICR
Sbjct  280  YVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICR  339

Query  183  GRNICGVGSMVSTVAAVNT  239
            G NICGV +MVSTV A +T
Sbjct  340  GHNICGVDAMVSTVTAAHT  358



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  289  YIGGVSCPYICGRHLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYKICR  348

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   RN CGV SMVSTV+A++ 
Sbjct  349  GSNVRNKCGVDSMVSTVSAIHA  370



>ref|NP_001052440.1| Os04g0311400 [Oryza sativa Japonica Group]
 dbj|BAF14354.1| Os04g0311400, partial [Oryza sativa Japonica Group]
Length=384

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCP+IC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGEKGYYKICR
Sbjct  298  YIGGVSCPFICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGEKGYYKICR  357

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   +N CGV SMVS+V A++T
Sbjct  358  GPHDKNKCGVDSMVSSVTAIHT  379



>emb|CAH59428.1| cysteine protease 2 [Plantago major]
Length=245

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC K LDHGVL+VGYG+ GYAP+RLK KPYWIIKNSWGESWGE GYYKICR
Sbjct  165  YIGGVSCPYICGKSLDHGVLIVGYGT-GYAPVRLKNKPYWIIKNSWGESWGESGYYKICR  223

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRN+CGV SMVS+V A +  T+
Sbjct  224  GRNVCGVESMVSSVTAAHFTTT  245



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 2/82 (2%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPY+CSK  DHGVLLVG+G +GYAPIRLKEKPYWIIKNSWG+ WGE GYYKICR
Sbjct  290  YIGGVSCPYVCSKSQDHGVLLVGFGESGYAPIRLKEKPYWIIKNSWGKMWGEHGYYKICR  349

Query  183  GR-NICGVGSMVSTVAAVN-TP  242
            GR NICG+ +MVSTVAAV  TP
Sbjct  350  GRHNICGMDTMVSTVAAVQITP  371



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICR
Sbjct  282  YVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICR  341

Query  183  GRNICGVGSMVSTVAAVNT  239
            G NICGV +MVSTV A +T
Sbjct  342  GHNICGVDAMVSTVTAAHT  360



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICR
Sbjct  280  YVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICR  339

Query  183  GRNICGVGSMVSTVAAVNT  239
            G NICGV +MVSTV A +T
Sbjct  340  GHNICGVDAMVSTVTAAHT  358



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICR
Sbjct  282  YVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICR  341

Query  183  GRNICGVGSMVSTVAAVNT  239
            G NICGV +MVSTV A +T
Sbjct  342  GHNICGVDAMVSTVTAAHT  360



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICR
Sbjct  291  YIGGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICR  350

Query  183  G-RNICGVGSMVSTVAAVNT  239
            G  N+CG+ +MVSTVAAV+T
Sbjct  351  GPHNMCGMDTMVSTVAAVHT  370



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPY+CSK  DHGVLLVG+GS+GYAPIRLKEKPYWIIKNSWG  WGE GYYKICR
Sbjct  291  YIGGVSCPYVCSKSQDHGVLLVGFGSSGYAPIRLKEKPYWIIKNSWGAMWGEHGYYKICR  350

Query  183  G-RNICGVGSMVSTVAAVNT  239
            G  N+CG+ +MVSTVAAV+T
Sbjct  351  GPHNMCGMDTMVSTVAAVHT  370



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE GY +ICR
Sbjct  238  YVGGVSCPYICGKHLDHGVLLVGYGEGAYAPIRFKNKPYWIIKNSWGESWGENGYDEICR  297

Query  183  GRNICGVGSMVSTVAAV  233
            GRN+CGV SMVSTVAA+
Sbjct  298  GRNVCGVDSMVSTVAAI  314



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score =   140 bits (352),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            YIGGVSCPY+C KR LDHGVLLVGYG+AGY+ IRLK KPYWI+KNSWGESWGE+GYYKIC
Sbjct  291  YIGGVSCPYVCGKRNLDHGVLLVGYGAAGYSTIRLKNKPYWIVKNSWGESWGEEGYYKIC  350

Query  180  RGRNICGVGSMVSTVAAVNTPTS  248
            +G N+CGV SMVS+V A++T ++
Sbjct  351  KGHNVCGVESMVSSVNAIHTTSA  373



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score =   140 bits (352),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 71/81 (88%), Gaps = 3/81 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYGSAGYAPIR KEKPYWIIKNSWGE+WGE GYYK+CR
Sbjct  303  YIGGVSCPYICGRHLDHGVLLVGYGSAGYAPIRFKEKPYWIIKNSWGENWGENGYYKLCR  362

Query  183  G---RNICGVGSMVSTVAAVN  236
            G   +N CGV SMVSTV A++
Sbjct  363  GPFVKNKCGVDSMVSTVTAIH  383



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score =   139 bits (351),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  287  YIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICR  346

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   RN CGV SMVSTV+AV+ 
Sbjct  347  GSNVRNKCGVDSMVSTVSAVHA  368



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score =   139 bits (351),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+KPYWIIKNSWGE+WGE GYYKICR
Sbjct  287  YIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICR  346

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   RN CGV SMVSTV+AV+ 
Sbjct  347  GSNVRNKCGVDSMVSTVSAVHA  368



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GG+SCPYIC++RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYKICR
Sbjct  250  YVGGISCPYICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYKICR  309

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAA +T T 
Sbjct  310  GRNICGVDSMVSTVAAAHTTTQ  331



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYG++G+AP RLK KPYW+IKNSWGE+WGEKGYYKICR
Sbjct  292  YIGGVSCPYICGRSLDHGVLLVGYGASGFAPSRLKNKPYWVIKNSWGENWGEKGYYKICR  351

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   RN CGV SMVSTVAA +T
Sbjct  352  GSNVRNKCGVDSMVSTVAAAHT  373



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+ GVSCPYIC K L+HGVLLVGYGSAGYAP R KEK YWIIKNSWGE+WGE GYYKICR
Sbjct  288  YVHGVSCPYICGKHLNHGVLLVGYGSAGYAPARFKEKSYWIIKNSWGENWGENGYYKICR  347

Query  183  GRNICGVGSMVSTVAAV  233
            GRNICGV SMVS+V A+
Sbjct  348  GRNICGVDSMVSSVTAI  364



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GG+SCPYIC++RLD GVLLVGYGS   A ++ KEKPYWI+KNSWGE+WGE GYYKICR
Sbjct  249  YVGGISCPYICTRRLDLGVLLVGYGSGAGADMKEKEKPYWIVKNSWGETWGENGYYKICR  308

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            GRNICGV SMVSTVAA +T T 
Sbjct  309  GRNICGVDSMVSTVAAAHTNTQ  330



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            Y+ G+SCPYICSKR LDHGVLLVGYG+AG+APIRLKEKPYWIIKNSWGE+WGE GYY IC
Sbjct  292  YMKGISCPYICSKRNLDHGVLLVGYGAAGFAPIRLKEKPYWIIKNSWGENWGENGYYFIC  351

Query  180  RGRNICGVGSMVSTVAAV  233
            +G+NICG  SMVS+VAA+
Sbjct  352  KGKNICGSESMVSSVAAI  369



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            Y+GGVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+C
Sbjct  289  YVGGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLC  348

Query  180  RGRNICGVGSMVSTVAAV  233
            RG N+CG+ +MVSTVAA+
Sbjct  349  RGHNVCGINNMVSTVAAI  366



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            Y+GGVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+C
Sbjct  289  YVGGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLC  348

Query  180  RGRNICGVGSMVSTVAAV  233
            RG N+CG+ +MVSTVAA+
Sbjct  349  RGHNVCGINNMVSTVAAI  366



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+ GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICR
Sbjct  280  YVRGVSCPLICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICR  339

Query  183  GRNICGVGSMVSTVAAVNT  239
            G NICGV +MVSTV A +T
Sbjct  340  GHNICGVDAMVSTVTATHT  358



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 72/78 (92%), Gaps = 1/78 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            Y+GGVSCPY+CSKR LDHGVLLVGYG+A +APIR+K+KPYW+IKNSWG +WGE GYYK+C
Sbjct  289  YVGGVSCPYVCSKRNLDHGVLLVGYGAAAFAPIRMKDKPYWVIKNSWGPNWGENGYYKLC  348

Query  180  RGRNICGVGSMVSTVAAV  233
            RG N+CG+ +MVSTVAA+
Sbjct  349  RGHNVCGINNMVSTVAAI  366



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 73/82 (89%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYG++G+APIRLK+K YWIIKNSWGE+WGE GYYKICR
Sbjct  289  YIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKAYWIIKNSWGENWGEHGYYKICR  348

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   RN CGV SMVSTV+A++T
Sbjct  349  GSNVRNKCGVDSMVSTVSAIHT  370



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+ GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICR
Sbjct  293  YVRGVSCPLICLKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICR  352

Query  183  GRNICGVGSMVSTVAAVNT  239
            G NICGV +MVSTV A +T
Sbjct  353  GHNICGVDAMVSTVTATHT  371



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCP +C K  DHGVLLVGYGSAG+APIRLK KPYWIIKNSWGE WGE GYYKICR
Sbjct  283  YIGGVSCPLVCFKHQDHGVLLVGYGSAGFAPIRLKAKPYWIIKNSWGEHWGEHGYYKICR  342

Query  183  GR-NICGVGSMVSTVAAVNT  239
            G+ NICGV +MVSTV A +T
Sbjct  343  GQHNICGVDAMVSTVTAAHT  362



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 3/86 (3%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICR
Sbjct  217  YIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICR  276

Query  183  G---RNICGVGSMVSTVAAVNTPTSD  251
            G   RN CGV SMVSTV+A +    +
Sbjct  277  GSNVRNKCGVDSMVSTVSATHASKDE  302



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   137 bits (345),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 72/82 (88%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICR
Sbjct  292  YIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICR  351

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   RN CGV SMVSTV+A ++
Sbjct  352  GSNVRNKCGVDSMVSTVSATHS  373



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 71/82 (87%), Gaps = 3/82 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICR
Sbjct  284  YIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICR  343

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   RN CGV SMVSTV+A + 
Sbjct  344  GSNVRNKCGVDSMVSTVSATHA  365



>gb|ADY04293.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04297.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+RLKEKPYWIIKNSWG+ WGE+G+YKICR
Sbjct  79   YMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRLKEKPYWIIKNSWGDKWGEEGFYKICR  138

Query  183  GRNICG  200
            GRNICG
Sbjct  139  GRNICG  144



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+ GVSCP IC KR DHGVLLVGYGS G+APIRLK KPYWIIKNSWG++WGE GYYKICR
Sbjct  278  YVRGVSCPLICFKRQDHGVLLVGYGSEGFAPIRLKNKPYWIIKNSWGKTWGEHGYYKICR  337

Query  183  GRNICGVGSMVSTVAAVNT  239
            G +ICGV +MVSTV A +T
Sbjct  338  GHHICGVDAMVSTVTATHT  356



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 3/81 (4%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDHGVLLVGYG++G+AP R KEKPYWIIKNSWGE+WG+KGYYKICR
Sbjct  292  YIGGVSCPYICGRHLDHGVLLVGYGASGFAPSRFKEKPYWIIKNSWGENWGDKGYYKICR  351

Query  183  G---RNICGVGSMVSTVAAVN  236
            G   RN CGV SMVSTV+A +
Sbjct  352  GSNVRNKCGVDSMVSTVSATH  372



>gb|ADY04361.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICR
Sbjct  79   YMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICR  138

Query  183  GRNICG  200
            GRNICG
Sbjct  139  GRNICG  144



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 68/81 (84%), Gaps = 4/81 (5%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPY C++RLDHGVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYKICR
Sbjct  249  YVGGVSCPYTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYKICR  304

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            GRNICGV SMVSTVAA  T T
Sbjct  305  GRNICGVDSMVSTVAAAQTTT  325



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 68/81 (84%), Gaps = 4/81 (5%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPY C++RLDHGVLLVGYGS  Y     KEKPYWI+K+SWGE+WGE GYYKICR
Sbjct  250  YVGGVSCPYTCTRRLDHGVLLVGYGSGAYT----KEKPYWIVKSSWGETWGENGYYKICR  305

Query  183  GRNICGVGSMVSTVAAVNTPT  245
            GRNICGV SMVSTVAA  T T
Sbjct  306  GRNICGVDSMVSTVAAAQTTT  326



>gb|ADY04342.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICR
Sbjct  79   YMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICR  138

Query  183  GRNICG  200
            GRNICG
Sbjct  139  GRNICG  144



>gb|ADY04336.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04343.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICR
Sbjct  79   YMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICR  138

Query  183  GRNICG  200
            GRNICG
Sbjct  139  GRNICG  144



>gb|ADY04262.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04263.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04264.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04265.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04266.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04267.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04269.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04270.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04271.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04272.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04273.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04274.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04275.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04276.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04277.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04278.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04279.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04280.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04281.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04282.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04283.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04284.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04285.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04286.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04287.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04288.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04289.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04290.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04291.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04292.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04294.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04296.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04298.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04299.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04300.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04301.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04302.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04303.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04304.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04305.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04306.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04307.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04308.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04309.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04310.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04311.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04312.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04313.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04314.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04315.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04316.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04317.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04318.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04319.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04320.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04321.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04322.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04323.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04324.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04325.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04326.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04327.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04328.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04329.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04330.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04331.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04332.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04333.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04334.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04335.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04337.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04338.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04339.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04340.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04341.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04344.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04345.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04346.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04347.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04348.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04349.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04350.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04351.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04352.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04353.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04354.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04355.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04356.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04357.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04360.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04362.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04363.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04364.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04365.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04366.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04367.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04369.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04370.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04371.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04372.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04373.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04374.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04377.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04378.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04379.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04380.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04381.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04382.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04383.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04384.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04385.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04386.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04387.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04388.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04389.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04391.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04392.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04393.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04394.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04395.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04396.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04397.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04398.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04399.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04400.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04401.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04402.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04403.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04404.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04405.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04406.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04407.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04408.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04409.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04410.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04411.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04412.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04413.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04415.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04416.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04417.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04418.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04419.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04420.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04421.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04422.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04423.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04424.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04425.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04426.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04427.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04428.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04429.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04430.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04431.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04432.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04433.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04434.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04435.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04436.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04437.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04438.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04439.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04440.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04441.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04442.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04443.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04444.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04445.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04446.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04447.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04448.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04449.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04450.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04451.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04452.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04453.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04454.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04455.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04456.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04458.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04459.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04460.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04461.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04462.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04463.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04464.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04465.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04466.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04467.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04468.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04469.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04470.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04471.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04472.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04473.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04474.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04475.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04476.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04478.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04481.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04483.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04484.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04485.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04486.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04487.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04488.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04489.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04491.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04493.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04501.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04502.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04503.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04504.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04505.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04506.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04507.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04508.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04509.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04510.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04511.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04512.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04513.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04514.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04515.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04516.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04517.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04518.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICR
Sbjct  79   YMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICR  138

Query  183  GRNICG  200
            GRNICG
Sbjct  139  GRNICG  144



>gb|ADY04414.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICR
Sbjct  79   YMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICR  138

Query  183  GRNICG  200
            GRNICG
Sbjct  139  GRNICG  144



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCP IC KR DHGVLLVGYGS G+APIRLKEK YWIIKNSWGE+WGE GYYKICR
Sbjct  282  YVGGVSCPLICFKRQDHGVLLVGYGSHGFAPIRLKEKAYWIIKNSWGENWGEHGYYKICR  341

Query  183  GRNICGVGSMVSTV  224
            G NICGV +MVSTV
Sbjct  342  GHNICGVDAMVSTV  355



>gb|ADY04457.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICR
Sbjct  79   YMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICR  138

Query  183  GRNICG  200
            GRNICG
Sbjct  139  GRNICG  144



>gb|ADY04359.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   130 bits (326),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICR
Sbjct  79   YMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGDRWGEEGFYKICR  138

Query  183  GRNICG  200
            GRNICG
Sbjct  139  GRNICG  144



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            YIG VSCPYICSK ++DHGVLLVGYGSAGYAP+R KEKPYWIIKNSWGE WGE GYYK+C
Sbjct  284  YIGQVSCPYICSKTKMDHGVLLVGYGSAGYAPLRFKEKPYWIIKNSWGEDWGEDGYYKLC  343

Query  180  RGRNICGVGSMVSTVAAVNT  239
             G N CG+ +MVS V + NT
Sbjct  344  SGYNACGMDTMVSAVVSTNT  363



>gb|ADY04482.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   129 bits (325),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICR
Sbjct  79   YMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRVKEKPYWIIKNSWGDKWGEEGFYKICR  138

Query  183  GRNICG  200
            GRNICG
Sbjct  139  GRNICG  144



>gb|ADY04358.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   129 bits (325),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYG++GY+P+R+KEKPYWIIKNSWG+ WGE+G+YKICR
Sbjct  79   YMGGVSCPYICSKRLDHGVLLVGYGTSGYSPVRMKEKPYWIIKNSWGDKWGEEGFYKICR  138

Query  183  GRNICG  200
            GRNICG
Sbjct  139  GRNICG  144



>gb|ADY04368.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04375.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04376.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04390.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04477.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
 gb|ADY04479.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   129 bits (325),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKPYWIIKNSWG  WGE+G+YKICR
Sbjct  79   YMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPYWIIKNSWGNKWGEEGFYKICR  138

Query  183  GRNICG  200
            GRNICG
Sbjct  139  GRNICG  144



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            YI GVSCP +C K  LDHGVL+VGYGS+GYAPIRLK KPYWI+KNSWG++WGEKGYYKIC
Sbjct  276  YIRGVSCPLVCGKSNLDHGVLMVGYGSSGYAPIRLKNKPYWIVKNSWGKNWGEKGYYKIC  335

Query  180  RGRNICGVGSMVSTVAAVNT  239
            RG NICGV SMVSTV A+++
Sbjct  336  RGSNICGVESMVSTVTAIHS  355



>gb|ADY04480.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   129 bits (324),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+++KEKPYWIIKNSWG+ WGE+G+YKICR
Sbjct  79   YMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVKMKEKPYWIIKNSWGDKWGEEGFYKICR  138

Query  183  GRNICG  200
            GRNICG
Sbjct  139  GRNICG  144



>gb|ADY04268.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   129 bits (324),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+R+KEKP+WIIKNSWG+ WGE+G+YKICR
Sbjct  79   YMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVRMKEKPHWIIKNSWGDKWGEEGFYKICR  138

Query  183  GRNICG  200
            GRNICG
Sbjct  139  GRNICG  144



>gb|AAB16997.1| thiol protease isoform A, partial [Glycine max]
Length=318

 Score =   133 bits (335),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 67/78 (86%), Gaps = 1/78 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGE-KGYYKIC  179
            Y+GGVSCPYIC K LDHGVLLVGYG   YAPIR K KPYWIIKNSWGESWGE  GY +IC
Sbjct  236  YVGGVSCPYICGKHLDHGVLLVGYGEGRYAPIRFKNKPYWIIKNSWGESWGENDGYDEIC  295

Query  180  RGRNICGVGSMVSTVAAV  233
            RGRN+CGV +MVSTVAA+
Sbjct  296  RGRNVCGVDAMVSTVAAI  313



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 66/70 (94%), Gaps = 1/70 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSK+LDHGVLLVGYG+ G++PIR+KEKPYWIIKNSWGE WGE GYYKICR
Sbjct  290  YVGGVSCPYICSKKLDHGVLLVGYGT-GFSPIRMKEKPYWIIKNSWGEKWGENGYYKICR  348

Query  183  GRNICGVGSM  212
            GRN+CGV SM
Sbjct  349  GRNVCGVDSM  358



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 4/82 (5%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            YIGGVSCPYIC + LDH V LVGYGSAGYAP+R KEKPYWIIKNSWGE+WGE GYYKICR
Sbjct  297  YIGGVSCPYICGRHLDH-VFLVGYGSAGYAPLRFKEKPYWIIKNSWGENWGESGYYKICR  355

Query  183  G---RNICGVGSMVSTVAAVNT  239
            G   +N CGV SMVSTV A++T
Sbjct  356  GPHVKNKCGVDSMVSTVTAIHT  377



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y  GVSCP++CS  LDHGVLLVGYGSAGY+PIR KEKPYWI+KNSW + WGE GYY+ICR
Sbjct  286  YTAGVSCPFLCSGELDHGVLLVGYGSAGYSPIRFKEKPYWILKNSWSKYWGEHGYYRICR  345

Query  183  GRNICGVGSMVSTVAAVNTPTS  248
            G+N+CGV SMVS+V A    TS
Sbjct  346  GQNMCGVDSMVSSVVAAIQTTS  367



>gb|ADY04295.1| cysteine protease, partial [Clarkia xantiana subsp. xantiana]
Length=144

 Score =   128 bits (321),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  3    YIGGVSCPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKICR  182
            Y+GGVSCPYICSKRLDHGVLLVGYGS+GY+P+ +KEKPYWIIKNSWG+ WGE+G+YKICR
Sbjct  79   YMGGVSCPYICSKRLDHGVLLVGYGSSGYSPVSMKEKPYWIIKNSWGDKWGEEGFYKICR  138

Query  183  GRNICG  200
            GRNICG
Sbjct  139  GRNICG  144



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 70/77 (91%), Gaps = 1/77 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSK-RLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            Y+ GVSCP IC K RLDHG+L+VGYG++GYAPIRLKEKPYWI+KNSWGE+WGE+GYYKIC
Sbjct  259  YVHGVSCPLICMKTRLDHGILIVGYGASGYAPIRLKEKPYWIVKNSWGENWGEQGYYKIC  318

Query  180  RGRNICGVGSMVSTVAA  230
            +G N+CGV S+VSTV A
Sbjct  319  KGHNVCGVESLVSTVTA  335



>dbj|BAC57957.1| thiol protease [Aster tripolium]
Length=188

 Score =   128 bits (322),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = +3

Query  3    YIGGVSCPYICSKR-LDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            YIG VSCPY+CSK+ LDHGVLLVGYGSAGYAP RLKEKPYWIIKNSWG  WGE GYYKIC
Sbjct  109  YIGKVSCPYVCSKKPLDHGVLLVGYGSAGYAPSRLKEKPYWIIKNSWGPDWGEDGYYKIC  168

Query  180  RGRNICGVGSMVSTVAAVNT  239
             G N+CG+ +MVS V + + 
Sbjct  169  SGHNLCGMDTMVSAVVSTSA  188



>gb|AAB53103.1| cysteine protease, partial [Brassica napus]
Length=85

 Score =   123 bits (308),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 64/72 (89%), Gaps = 1/72 (1%)
 Frame = +3

Query  3    YIGGVS-CPYICSKRLDHGVLLVGYGSAGYAPIRLKEKPYWIIKNSWGESWGEKGYYKIC  179
            YIGGVS CPYIC +RL+HGVLLVGYGSAGYAP R KEKPYWIIKNSWGE+WGE G+YKIC
Sbjct  14   YIGGVSACPYICMRRLNHGVLLVGYGSAGYAPARFKEKPYWIIKNSWGETWGENGFYKIC  73

Query  180  RGRNICGVGSMV  215
            RGRN+CGV   V
Sbjct  74   RGRNVCGVDMSV  85



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559124820270