BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig999

Length=633
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFA35955.1|  ent-kaurenoic acid oxidase                              298   6e-98   Nicotiana attenuata
ref|XP_009804565.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       296   2e-95   Nicotiana sylvestris
ref|XP_009589784.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    294   9e-94   Nicotiana tomentosiformis
ref|XP_010097724.1|  Ent-kaurenoic acid oxidase 1                       283   4e-89   Morus notabilis
ref|XP_006354607.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       282   6e-89   Solanum tuberosum [potatoes]
ref|XP_007039942.1|  Cytochrome P450, family 88, subfamily A, pol...    272   2e-86   
ref|XP_007039943.1|  Cytochrome P450, family 88, subfamily A, pol...    271   3e-86   
ref|XP_004229509.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    275   3e-86   Solanum lycopersicum
ref|XP_012083782.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    267   3e-84   
ref|XP_007039941.1|  Cytochrome P450, family 88, subfamily A, pol...    270   3e-84   
gb|KDO85363.1|  hypothetical protein CISIN_1g010697mg                   268   7e-84   Citrus sinensis [apfelsine]
ref|XP_006445516.1|  hypothetical protein CICLE_v10019986mg             267   2e-83   
emb|CDP09340.1|  unnamed protein product                                267   4e-83   Coffea canephora [robusta coffee]
gb|KDO85362.1|  hypothetical protein CISIN_1g010697mg                   267   5e-83   Citrus sinensis [apfelsine]
ref|XP_006464339.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       266   9e-83   Citrus sinensis [apfelsine]
ref|XP_002265630.1|  PREDICTED: ent-kaurenoic acid oxidase 2            265   2e-82   Vitis vinifera
gb|KCW76778.1|  hypothetical protein EUGRSUZ_D01134                     265   2e-82   Eucalyptus grandis [rose gum]
dbj|BAG71199.1|  ent-kaurenoic acid oxidase                             265   2e-82   Lactuca sativa [cultivated lettuce]
ref|XP_010052709.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       265   3e-82   
emb|CDP21969.1|  unnamed protein product                                263   3e-82   Coffea canephora [robusta coffee]
ref|XP_012083781.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    264   4e-82   Jatropha curcas
ref|XP_002526524.1|  Ent-kaurenoic acid oxidase, putative               264   5e-82   Ricinus communis
emb|CDP09338.1|  unnamed protein product                                263   1e-81   Coffea canephora [robusta coffee]
emb|CDP09336.1|  unnamed protein product                                263   1e-81   Coffea canephora [robusta coffee]
emb|CDP09339.1|  unnamed protein product                                263   2e-81   Coffea canephora [robusta coffee]
gb|KJB67442.1|  hypothetical protein B456_010G190900                    263   2e-81   Gossypium raimondii
gb|KDP30573.1|  hypothetical protein JCGZ_16952                         254   7e-81   Jatropha curcas
ref|XP_002321248.2|  ent-kaurenoic acid oxidase family protein          262   8e-81   
ref|XP_004307312.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       261   1e-80   Fragaria vesca subsp. vesca
emb|CDY12205.1|  BnaC04g12350D                                          259   3e-80   Brassica napus [oilseed rape]
ref|XP_012084984.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       259   3e-80   Jatropha curcas
ref|XP_008232239.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       259   3e-80   Prunus mume [ume]
ref|XP_011085042.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       259   3e-80   Sesamum indicum [beniseed]
ref|XP_011013095.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       259   4e-80   Populus euphratica
emb|CDY48265.1|  BnaA05g10890D                                          258   8e-80   Brassica napus [oilseed rape]
ref|XP_006418058.1|  hypothetical protein EUTSA_v10009356mg             258   9e-80   Eutrema salsugineum [saltwater cress]
ref|XP_009143990.1|  PREDICTED: ent-kaurenoic acid oxidase 2            258   1e-79   
ref|XP_007217930.1|  hypothetical protein PRUPE_ppa004910mg             257   2e-79   
ref|XP_002319447.1|  ent-kaurenoic acid oxidase family protein          256   5e-79   
ref|XP_008232238.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       256   6e-79   Prunus mume [ume]
ref|XP_006410376.1|  hypothetical protein EUTSA_v10016575mg             256   7e-79   Eutrema salsugineum [saltwater cress]
ref|XP_007217929.1|  hypothetical protein PRUPE_ppa004901mg             256   8e-79   
ref|XP_011010024.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    255   1e-78   Populus euphratica
ref|XP_002892270.1|  ent-kaurenoic acid hydroxylase 1                   255   2e-78   
ref|XP_011010022.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    256   2e-78   Populus euphratica
ref|XP_009376861.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       255   2e-78   Pyrus x bretschneideri [bai li]
gb|AGF25266.1|  ent-kaurenoic acid oxidase                              255   2e-78   Pyrus communis
ref|XP_010691953.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       254   2e-78   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK31124.1|  hypothetical protein AALP_AA6G071000                    254   2e-78   Arabis alpina [alpine rockcress]
ref|XP_007008706.1|  Cytochrome P450, family 88, subfamily A, pol...    254   3e-78   
ref|XP_009347589.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       254   3e-78   
emb|CDY49505.1|  BnaC05g03170D                                          254   3e-78   Brassica napus [oilseed rape]
ref|XP_007008707.1|  Ent-kaurenoic acid oxidase 1 isoform 2             255   4e-78   
gb|AGI65630.1|  ent-kaurenoic acid oxidase                              254   5e-78   Malus domestica [apple tree]
gb|AGZ93669.1|  ent-kaurene acid oxidase                                254   5e-78   Malus domestica [apple tree]
ref|XP_009119194.1|  PREDICTED: ent-kaurenoic acid oxidase 1            253   6e-78   Brassica rapa
emb|CBV36749.1|  ent-kaurenoic acid oxidase                             253   7e-78   Helianthus annuus
ref|XP_008232229.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       253   7e-78   Prunus mume [ume]
ref|XP_007219847.1|  hypothetical protein PRUPE_ppa027023mg             253   8e-78   Prunus persica
dbj|BAD93885.1|  putative cytochrome P450                               250   1e-77   Arabidopsis thaliana [mouse-ear cress]
gb|AJD25209.1|  cytochrome P450 CYP88A52                                253   1e-77   Salvia miltiorrhiza [Chinese salvia]
emb|CBV36747.1|  ent-kaurenoic acid oxidase                             253   1e-77   Helianthus annuus
ref|XP_008354800.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       253   1e-77   
gb|AAK11564.1|AF318500_1  ent-kaurenoic acid hydroxylase                251   3e-77   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172008.1|  ent-kaurenoic acid oxidase 1                          251   3e-77   Arabidopsis thaliana [mouse-ear cress]
emb|CBV36748.1|  ent-kaurenoic acid oxidase                             251   5e-77   Helianthus annuus
ref|XP_006294074.1|  hypothetical protein CARUB_v10023069mg             251   8e-77   Capsella rubella
ref|XP_011093453.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       250   1e-76   Sesamum indicum [beniseed]
ref|XP_006307341.1|  hypothetical protein CARUB_v10008960mg             250   2e-76   Capsella rubella
ref|XP_010475187.1|  PREDICTED: ent-kaurenoic acid oxidase 1            249   2e-76   
ref|XP_010457591.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    249   2e-76   
ref|XP_010457593.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    249   3e-76   
ref|XP_010269971.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       249   3e-76   Nelumbo nucifera [Indian lotus]
gb|AEF32085.1|  ent-kaurenoic acid oxidase                              249   3e-76   Castanea mollissima
gb|EYU42301.1|  hypothetical protein MIMGU_mgv1a005890mg                248   3e-76   Erythranthe guttata [common monkey flower]
gb|AAK11565.1|AF318501_1  ent-kaurenoic acid hydroxylase                249   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180803.1|  Ent-kaurenoic acid oxidase 2                          249   4e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879389.1|  ent-kaurenoic acid hydroxylase                     248   6e-76   
gb|KEH37117.1|  cytochrome P450 family ent-kaurenoic acid oxidase       247   7e-76   Medicago truncatula
ref|XP_010413993.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       248   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_004308741.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       247   2e-75   Fragaria vesca subsp. vesca
gb|KEH37116.1|  cytochrome P450 family ent-kaurenoic acid oxidase       247   2e-75   Medicago truncatula
ref|XP_010691952.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       246   3e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010469584.1|  PREDICTED: ent-kaurenoic acid oxidase 2            246   5e-75   
ref|XP_010275286.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       246   7e-75   Nelumbo nucifera [Indian lotus]
ref|XP_010510015.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    245   7e-75   Camelina sativa [gold-of-pleasure]
ref|XP_011469589.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       247   1e-74   Fragaria vesca subsp. vesca
ref|XP_010556999.1|  PREDICTED: ent-kaurenoic acid oxidase 1            245   1e-74   Tarenaya hassleriana [spider flower]
ref|XP_007219798.1|  hypothetical protein PRUPE_ppa026558mg             245   1e-74   
ref|XP_003533093.1|  PREDICTED: ent-kaurenoic acid oxidase 2            244   2e-74   Glycine max [soybeans]
ref|XP_002264215.1|  PREDICTED: ent-kaurenoic acid oxidase 1            244   4e-74   Vitis vinifera
gb|KGN46277.1|  hypothetical protein Csa_6G079220                       243   4e-74   Cucumis sativus [cucumbers]
gb|KHN14287.1|  Ent-kaurenoic acid oxidase 2                            243   4e-74   Glycine soja [wild soybean]
ref|XP_003546291.1|  PREDICTED: ent-kaurenoic acid oxidase 2            243   4e-74   Glycine max [soybeans]
gb|AAO23063.1|  ent-kaurenoic acid oxidase                              243   1e-73   Pisum sativum [garden pea]
ref|XP_011656712.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       241   3e-73   Cucumis sativus [cucumbers]
ref|XP_004486502.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       238   5e-72   Cicer arietinum [garbanzo]
gb|AAG41777.1|AF212991_1  ent-kaurenoic acid oxidase                    236   4e-71   Cucurbita maxima [Boston marrow]
gb|KGN56650.1|  hypothetical protein Csa_3G127130                       235   4e-71   Cucumis sativus [cucumbers]
gb|AAO23064.1|  ent-kaurenoic acid oxidase                              234   2e-70   Pisum sativum [garden pea]
ref|XP_004133946.1|  PREDICTED: ent-kaurenoic acid oxidase 1            234   3e-70   Cucumis sativus [cucumbers]
gb|EPS65596.1|  hypothetical protein M569_09175                         232   8e-70   Genlisea aurea
ref|XP_007147426.1|  hypothetical protein PHAVU_006G123600g             232   9e-70   Phaseolus vulgaris [French bean]
ref|XP_004486504.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    232   1e-69   Cicer arietinum [garbanzo]
ref|XP_004486505.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    232   1e-69   
ref|XP_008438234.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       231   2e-69   Cucumis melo [Oriental melon]
gb|KEH37115.1|  cytochrome P450 family ent-kaurenoic acid oxidase       229   1e-68   Medicago truncatula
ref|XP_007147425.1|  hypothetical protein PHAVU_006G123500g             227   1e-67   Phaseolus vulgaris [French bean]
ref|XP_009420467.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       223   3e-66   
ref|XP_009392783.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       219   8e-65   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI16745.3|  unnamed protein product                                216   4e-64   Vitis vinifera
ref|XP_007218023.1|  hypothetical protein PRUPE_ppa005937mg             215   7e-64   
ref|XP_006847688.1|  PREDICTED: ent-kaurenoic acid oxidase 2            216   1e-63   Amborella trichopoda
gb|EYU40296.1|  hypothetical protein MIMGU_mgv1a006460mg                214   2e-63   Erythranthe guttata [common monkey flower]
gb|AHW42467.1|  KAO2                                                    214   7e-63   Pinus tabuliformis [southern Chinese pine]
ref|XP_010934998.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       211   8e-62   Elaeis guineensis
ref|XP_010941218.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       211   1e-61   Elaeis guineensis
gb|KCW77919.1|  hypothetical protein EUGRSUZ_D021732                    208   7e-61   Eucalyptus grandis [rose gum]
ref|XP_010053587.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    208   2e-60   Eucalyptus grandis [rose gum]
gb|KCW77911.1|  hypothetical protein EUGRSUZ_D02168                     207   3e-60   Eucalyptus grandis [rose gum]
gb|KCW77918.1|  hypothetical protein EUGRSUZ_D02172                     203   3e-60   Eucalyptus grandis [rose gum]
ref|XP_010053586.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       207   3e-60   Eucalyptus grandis [rose gum]
gb|KCW77910.1|  hypothetical protein EUGRSUZ_D02168                     206   7e-60   Eucalyptus grandis [rose gum]
ref|XP_010053585.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       206   1e-59   Eucalyptus grandis [rose gum]
gb|KJB25350.1|  hypothetical protein B456_004G187300                    206   1e-59   Gossypium raimondii
gb|KHG22736.1|  Cytochrome P450                                         205   2e-59   Gossypium arboreum [tree cotton]
gb|KJB25351.1|  hypothetical protein B456_004G187300                    205   2e-59   Gossypium raimondii
ref|XP_010677318.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       202   2e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007039557.1|  Ent-kaurenoic acid hydroxylase 2                   202   3e-58   
ref|XP_008660301.1|  PREDICTED: cytochrome P450 88A1-like               200   1e-57   
gb|AAT28221.1|  putative ent-Kaurenoic acid hydroxylase-like cyto...    200   2e-57   Ginkgo biloba [ginkgo]
gb|EEC73049.1|  hypothetical protein OsI_07000                          199   5e-57   Oryza sativa Indica Group [Indian rice]
ref|NP_001056579.1|  Os06g0110000                                       199   5e-57   
ref|XP_009373441.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    197   2e-56   
emb|CBY78885.1|  KAO protein                                            196   4e-56   Triticum urartu
ref|XP_009373442.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    196   4e-56   
gb|EEE64964.1|  hypothetical protein OsJ_19857                          199   2e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007209946.1|  hypothetical protein PRUPE_ppa004753mg             194   2e-55   Prunus persica
emb|CBY78889.1|  KAO protein                                            194   3e-55   Aegilops tauschii
ref|XP_010104358.1|  Ent-kaurenoic acid oxidase 2                       194   3e-55   
ref|XP_008238293.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       193   6e-55   Prunus mume [ume]
gb|ADK62526.1|  ent-kaurenoic acid oxidase                              193   7e-55   Triticum aestivum [Canadian hard winter wheat]
gb|ADZ55287.1|  ent-kaurene acid oxidase                                193   8e-55   Triticum aestivum [Canadian hard winter wheat]
gb|AAL50602.1|  DWARF3                                                  191   1e-54   Zea mays [maize]
ref|XP_002436354.1|  hypothetical protein SORBIDRAFT_10g000920          193   1e-54   Sorghum bicolor [broomcorn]
gb|AAL50620.1|  DWARF3                                                  190   1e-54   Zea mays [maize]
ref|XP_008238332.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       192   1e-54   Prunus mume [ume]
gb|AAL50601.1|  DWARF3                                                  190   1e-54   Zea mays [maize]
ref|XP_003580920.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       192   1e-54   Brachypodium distachyon [annual false brome]
gb|ACV91868.1|  KAO1                                                    192   1e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAL50594.1|  DWARF3                                                  190   1e-54   Zea mays [maize]
sp|Q9AXH9.1|KAO1_HORVU  RecName: Full=Ent-kaurenoic acid oxidase ...    192   2e-54   Hordeum vulgare [barley]
gb|AAL50591.1|  DWARF3                                                  190   2e-54   Zea mays [maize]
gb|AAL50611.1|  DWARF3                                                  190   2e-54   Zea mays [maize]
gb|AAL50608.1|  DWARF3                                                  190   2e-54   Zea mays [maize]
gb|AAL50581.1|  DWARF3                                                  190   2e-54   Zea mays [maize]
emb|CBY78887.1|  KAO protein                                            192   2e-54   Aegilops speltoides
ref|XP_004301697.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       192   2e-54   Fragaria vesca subsp. vesca
gb|AAL50579.1|  DWARF3                                                  189   3e-54   Zea mays [maize]
gb|AAL50587.1|  DWARF3                                                  189   4e-54   Zea mays [maize]
gb|AAL50589.1|  DWARF3                                                  189   4e-54   Zea mays [maize]
gb|AAL50621.1|  DWARF3                                                  189   5e-54   Zea mays [maize]
gb|AAL50605.1|  DWARF3                                                  189   5e-54   Zea mays [maize]
gb|AAL50606.1|  DWARF3                                                  189   5e-54   Zea mays [maize]
gb|AAL50609.1|  DWARF3                                                  189   5e-54   Zea mays [maize]
gb|AAL50600.1|  DWARF3                                                  189   5e-54   Zea mays [maize]
gb|AAL50574.1|  DWARF3                                                  189   5e-54   Zea mays [maize]
gb|AAL50584.1|  DWARF3                                                  189   5e-54   Zea mays [maize]
gb|AAL50580.1|  DWARF3                                                  189   5e-54   Zea mays [maize]
gb|ADZ55288.1|  ent-kaurene acid oxidase                                191   5e-54   Triticum aestivum [Canadian hard winter wheat]
gb|AAL50582.1|  DWARF3                                                  189   5e-54   Zea mays [maize]
gb|AAL50575.1|  DWARF3                                                  189   5e-54   Zea mays [maize]
gb|AAL50578.1|  DWARF3                                                  189   6e-54   Zea mays [maize]
gb|AAL50595.1|  DWARF3                                                  189   6e-54   Zea mays [maize]
gb|AAL50586.1|  DWARF3                                                  188   6e-54   Zea mays [maize]
gb|AAL50592.1|  DWARF3                                                  188   6e-54   Zea mays [maize]
ref|XP_008356451.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       191   7e-54   Malus domestica [apple tree]
gb|AAL50576.1|  DWARF3                                                  188   7e-54   Zea mays [maize]
gb|AAL50597.1|  DWARF3                                                  188   9e-54   Zea mays [maize]
gb|AAL50585.1|  DWARF3                                                  188   9e-54   Zea mays [maize]
gb|AAL50599.1|  DWARF3                                                  188   1e-53   Zea mays [maize]
gb|AAL50573.1|  DWARF3                                                  188   1e-53   Zea mays [maize]
gb|AAL50610.1|  DWARF3                                                  186   3e-53   Zea mays [maize]
gb|AAL50577.1|  DWARF3                                                  186   3e-53   Zea mays [maize]
gb|AAL50604.1|  DWARF3                                                  186   3e-53   Zea mays [maize]
gb|AAL50607.1|  DWARF3                                                  186   3e-53   Zea mays [maize]
gb|AAL50615.1|  DWARF3                                                  186   6e-53   Zea mays [maize]
ref|XP_003611463.1|  Cytochrome P450 ent-kaurenoic acid oxidase         187   8e-53   
ref|XP_004973029.1|  PREDICTED: cytochrome P450 88A1-like               188   8e-53   Setaria italica
ref|XP_003516638.1|  PREDICTED: beta-amyrin 11-oxidase-like             187   2e-52   
gb|AAL50619.1|  DWARF3                                                  184   3e-52   Zea mays [maize]
gb|AAL50593.1|  DWARF3                                                  184   3e-52   Zea mays [maize]
gb|AAL50616.1|  DWARF3                                                  184   4e-52   Zea mays [maize]
gb|AAL50596.1|  DWARF3                                                  183   6e-52   Zea mays [maize]
gb|AAL50583.1|  DWARF3                                                  183   7e-52   Zea mays [maize]
ref|XP_003561220.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    185   8e-52   Brachypodium distachyon [annual false brome]
ref|XP_004512204.1|  PREDICTED: beta-amyrin 11-oxidase-like             184   1e-51   
emb|CDP12987.1|  unnamed protein product                                183   4e-51   Coffea canephora [robusta coffee]
gb|AAL50612.1|  DWARF3                                                  181   6e-51   Zea mays [maize]
ref|XP_004980663.1|  PREDICTED: cytochrome P450 88A1-like               182   8e-51   
ref|XP_007039555.1|  Cytochrome P450 88D6, putative                     184   1e-50   
ref|NP_001105586.1|  cytochrome P450 88A1                               182   1e-50   Zea mays [maize]
ref|XP_006655700.1|  PREDICTED: cytochrome P450 88A1-like               180   2e-50   
ref|XP_008375674.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       179   4e-50   
gb|KCW77922.1|  hypothetical protein EUGRSUZ_D02177                     181   4e-50   Eucalyptus grandis [rose gum]
ref|XP_003581683.2|  PREDICTED: ent-kaurenoic acid oxidase 1-like       180   6e-50   
ref|XP_009788182.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       172   1e-49   Nicotiana sylvestris
ref|XP_010053588.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    179   1e-49   Eucalyptus grandis [rose gum]
ref|XP_009624148.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    177   2e-49   
ref|XP_009589785.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    177   2e-49   Nicotiana tomentosiformis
ref|XP_009624147.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...    177   5e-49   
gb|KJB25348.1|  hypothetical protein B456_004G187100                    175   7e-49   Gossypium raimondii
ref|XP_008460072.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       174   3e-48   
ref|XP_006436760.1|  hypothetical protein CICLE_v10031862mg             170   4e-47   
ref|XP_007209137.1|  hypothetical protein PRUPE_ppa005745mg             171   8e-47   
gb|KDO42213.1|  hypothetical protein CISIN_1g012524mg                   170   8e-47   Citrus sinensis [apfelsine]
gb|KDO42214.1|  hypothetical protein CISIN_1g012524mg                   170   1e-46   Citrus sinensis [apfelsine]
ref|XP_007156654.1|  hypothetical protein PHAVU_002G005900g             171   1e-46   Phaseolus vulgaris [French bean]
gb|KDO42212.1|  hypothetical protein CISIN_1g012524mg                   167   2e-46   Citrus sinensis [apfelsine]
ref|XP_006436761.1|  hypothetical protein CICLE_v10031341mg             170   3e-46   Citrus clementina [clementine]
gb|KDO42211.1|  hypothetical protein CISIN_1g012524mg                   169   7e-46   Citrus sinensis [apfelsine]
gb|KDO42210.1|  hypothetical protein CISIN_1g012524mg                   169   8e-46   Citrus sinensis [apfelsine]
gb|KDO44740.1|  hypothetical protein CISIN_1g011210mg                   169   1e-45   Citrus sinensis [apfelsine]
gb|KDO44742.1|  hypothetical protein CISIN_1g011343mg                   166   1e-45   Citrus sinensis [apfelsine]
ref|XP_008788752.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       167   1e-45   
ref|XP_006485429.1|  PREDICTED: beta-amyrin 11-oxidase-like             168   2e-45   Citrus sinensis [apfelsine]
gb|KGN55788.1|  hypothetical protein Csa_3G014360                       162   2e-45   Cucumis sativus [cucumbers]
ref|XP_008799425.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       167   3e-45   
gb|KGN55784.1|  hypothetical protein Csa_3G011850                       166   5e-45   Cucumis sativus [cucumbers]
gb|KJB25349.1|  hypothetical protein B456_004G187200                    166   6e-45   Gossypium raimondii
ref|XP_006375612.1|  hypothetical protein POPTR_0014s17720g             164   2e-44   
gb|KDO44741.1|  hypothetical protein CISIN_1g011343mg                   164   5e-44   Citrus sinensis [apfelsine]
ref|XP_006485427.1|  PREDICTED: beta-amyrin 11-oxidase-like             164   6e-44   Citrus sinensis [apfelsine]
ref|XP_008448713.1|  PREDICTED: beta-amyrin 11-oxidase-like isofo...    162   2e-43   Cucumis melo [Oriental melon]
gb|KGN60411.1|  hypothetical protein Csa_3G903510                       160   3e-43   Cucumis sativus [cucumbers]
ref|XP_003611462.1|  Cytochrome P450 ent-kaurenoic acid oxidase         162   4e-43   
ref|XP_010323137.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    160   6e-43   Solanum lycopersicum
ref|XP_008448712.1|  PREDICTED: beta-amyrin 11-oxidase-like isofo...    161   8e-43   Cucumis melo [Oriental melon]
ref|XP_004148754.2|  PREDICTED: beta-amyrin 11-oxidase-like isofo...    159   2e-42   Cucumis sativus [cucumbers]
ref|XP_002975682.1|  ent-Kaurenoic acid hydroxylase                     160   2e-42   Selaginella moellendorffii
ref|XP_002993510.1|  hypothetical protein SELMODRAFT_1840               159   2e-42   
ref|XP_011652889.1|  PREDICTED: beta-amyrin 11-oxidase-like             159   4e-42   Cucumis sativus [cucumbers]
ref|XP_008465946.1|  PREDICTED: beta-amyrin 11-oxidase-like             159   6e-42   Cucumis melo [Oriental melon]
ref|XP_011650352.1|  PREDICTED: beta-amyrin 11-oxidase-like isofo...    158   7e-42   Cucumis sativus [cucumbers]
ref|XP_002988455.1|  kaurenoic acid oxidase                             157   1e-41   
gb|KEH40663.1|  cytochrome P450 family 88 protein                       157   2e-41   Medicago truncatula
ref|XP_008448717.1|  PREDICTED: beta-amyrin 11-oxidase-like isofo...    157   2e-41   Cucumis melo [Oriental melon]
ref|XP_008448721.1|  PREDICTED: beta-amyrin 11-oxidase-like isofo...    155   3e-41   
dbj|BAQ20602.1|  ent-kaurenoic acid oxidase 1                           157   4e-41   Lygodium japonicum
ref|XP_008448720.1|  PREDICTED: beta-amyrin 11-oxidase-like isofo...    155   1e-40   Cucumis melo [Oriental melon]
dbj|BAN15043.1|  putative cytochrome P450 monooxygenase CYP88D7         155   1e-40   Astragalus sinicus
sp|B5BSX1.1|BAMO_GLYUR  RecName: Full=Beta-amyrin 11-oxidase; Alt...    154   3e-40   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_008448714.1|  PREDICTED: beta-amyrin 11-oxidase-like             152   1e-39   Cucumis melo [Oriental melon]
ref|XP_004510262.1|  PREDICTED: beta-amyrin 11-oxidase-like             152   2e-39   Cicer arietinum [garbanzo]
gb|AAZ39647.1|  cytochrome P450 monooxygenase                           148   2e-38   Petunia x hybrida [garden petunia]
gb|KGN60417.1|  hypothetical protein Csa_3G904060                       141   2e-37   Cucumis sativus [cucumbers]
ref|XP_002979887.1|  hypothetical protein SELMODRAFT_419505             141   3e-37   
ref|XP_004510263.1|  PREDICTED: beta-amyrin 11-oxidase-like             145   3e-37   Cicer arietinum [garbanzo]
gb|KGN60413.1|  hypothetical protein Csa_3G903530                       145   3e-37   Cucumis sativus [cucumbers]
gb|KEH40665.1|  cytochrome P450 family 88 protein                       144   3e-37   Medicago truncatula
gb|KJB37700.1|  hypothetical protein B456_006G216200                    145   4e-37   Gossypium raimondii
dbj|BAN15044.1|  putative cytochrome P450 monooxygenase CYP88D8         145   6e-37   Astragalus sinicus
dbj|BAG68926.1|  cytochrome P450 88D3                                   144   8e-37   Medicago truncatula
gb|AIT72035.1|  cytochrome P450                                         144   1e-36   Cucumis sativus [cucumbers]
ref|XP_011652660.1|  PREDICTED: beta-amyrin 11-oxidase-like             144   1e-36   Cucumis sativus [cucumbers]
ref|XP_004148514.2|  PREDICTED: beta-amyrin 11-oxidase-like             143   2e-36   Cucumis sativus [cucumbers]
dbj|BAG68928.1|  cytochrome P450 88D5                                   143   3e-36   Lotus japonicus
gb|KEH20767.1|  cytochrome P450 family 88 protein                       143   3e-36   Medicago truncatula
ref|XP_011652661.1|  PREDICTED: beta-amyrin 11-oxidase-like             142   5e-36   Cucumis sativus [cucumbers]
dbj|BAG68927.1|  cytochrome P450 88D4                                   142   5e-36   Lotus japonicus
ref|XP_004510260.1|  PREDICTED: beta-amyrin 11-oxidase-like             140   2e-35   Cicer arietinum [garbanzo]
ref|XP_003604124.1|  Ent-kaurenoic acid oxidase                         140   3e-35   
gb|KJB25353.1|  hypothetical protein B456_004G187300                    138   9e-35   Gossypium raimondii
ref|XP_010324673.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       132   1e-34   Solanum lycopersicum
gb|KEH28510.1|  beta-amyrin 11-oxidase-like protein                     132   4e-34   Medicago truncatula
gb|KJB78703.1|  hypothetical protein B456_013G013700                    135   5e-34   Gossypium raimondii
ref|XP_008467067.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       131   6e-34   Cucumis melo [Oriental melon]
ref|XP_006366924.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       134   1e-33   
gb|KCW77914.1|  hypothetical protein EUGRSUZ_D021703                    131   6e-33   Eucalyptus grandis [rose gum]
gb|EMT30414.1|  Ent-kaurenoic acid oxidase 1                            132   1e-32   
gb|KCW77917.1|  hypothetical protein EUGRSUZ_D021711                    129   2e-32   
dbj|BAG68925.1|  cytochrome P450 88D2                                   132   2e-32   
gb|KEH18187.1|  cytochrome P450 family 88 protein                       132   2e-32   
ref|XP_004510261.1|  PREDICTED: beta-amyrin 11-oxidase-like             132   2e-32   
ref|XP_006351981.1|  PREDICTED: beta-amyrin 11-oxidase-like             131   4e-32   
gb|EMS55313.1|  Ent-kaurenoic acid oxidase 1                            131   4e-32   
ref|XP_010313690.1|  PREDICTED: ent-kaurenoic acid oxidase 2            131   5e-32   
gb|KJB25352.1|  hypothetical protein B456_004G187300                    130   5e-32   
gb|KEH29236.1|  cytochrome P450 family 88 protein                       129   7e-32   
ref|XP_010228115.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...    129   1e-31   
ref|XP_006364112.1|  PREDICTED: beta-amyrin 11-oxidase-like             128   2e-31   
ref|XP_004148515.2|  PREDICTED: beta-amyrin 11-oxidase-like             129   2e-31   
ref|XP_008659025.1|  PREDICTED: cytochrome P450 88A1 isoform X1         125   5e-30   
ref|XP_010054829.1|  PREDICTED: beta-amyrin 11-oxidase-like             123   9e-30   
ref|XP_002982048.1|  hypothetical protein SELMODRAFT_115926             124   9e-30   
ref|XP_002966472.1|  kaurenoic acid oxidase                             124   1e-29   
gb|ACE76898.1|  ent-kaurenoic acid oxidase                              123   2e-29   
gb|ACE76904.1|  ent-kaurenoic acid oxidase                              121   7e-29   
gb|ACE76901.1|  ent-kaurenoic acid oxidase                              121   7e-29   
ref|XP_008466645.1|  PREDICTED: beta-amyrin 11-oxidase-like             120   2e-28   
gb|ACE76903.1|  ent-kaurenoic acid oxidase                              119   3e-28   
gb|ACE76902.1|  ent-kaurenoic acid oxidase                              119   7e-28   
ref|XP_007039554.1|  Ent-kaurenoic acid oxidase, putative               110   9e-26   
gb|KGN55785.1|  hypothetical protein Csa_3G011860                       110   8e-25   
ref|XP_004148755.2|  PREDICTED: beta-amyrin 11-oxidase-like             109   1e-24   
gb|ACE76899.1|  ent-kaurenoic acid oxidase                              108   3e-24   
gb|KGN55789.1|  Cytochrome P450 88D6                                    107   5e-24   
gb|KEH17084.1|  cytochrome P450 family 90 protein                       108   6e-24   
gb|ACE76900.1|  ent-kaurenoic acid oxidase                              107   7e-24   
gb|KCW77912.1|  hypothetical protein EUGRSUZ_D02169                     107   2e-23   
gb|ERN01355.1|  hypothetical protein AMTR_s00002p00259110               100   2e-22   
gb|ERN01354.1|  hypothetical protein AMTR_s00002p00259030               103   2e-22   
ref|XP_011621727.1|  PREDICTED: ent-kaurenoic acid oxidase 1            103   4e-22   
ref|XP_004499923.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       102   5e-22   
gb|KDP31198.1|  hypothetical protein JCGZ_11574                         100   2e-21   
ref|XP_012080537.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like       100   2e-21   
gb|KEH17088.1|  cytochrome P450 family 90 protein                       100   2e-21   
ref|XP_010510017.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like...  99.8    3e-21   
ref|XP_010926147.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       100   4e-21   
ref|XP_008797526.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like       100   4e-21   
ref|XP_007210937.1|  hypothetical protein PRUPE_ppa025181mg           99.4    1e-20   
gb|ERM94634.1|  hypothetical protein AMTR_s00011p00192370             98.6    2e-20   
gb|KEH17087.1|  cytochrome P450 family 90 protein                     98.2    2e-20   
gb|KEH17086.1|  cytochrome P450 family 90 protein                     98.2    3e-20   
ref|XP_006878489.2|  PREDICTED: ent-kaurenoic acid oxidase 2          98.6    3e-20   
ref|XP_011465715.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like     97.8    3e-20   
gb|EMT01609.1|  Ent-kaurenoic acid oxidase 1                          97.8    3e-20   
ref|XP_011071758.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like     98.2    5e-20   
ref|XP_011464390.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like     95.9    6e-20   
gb|ABY49058.1|  ent-kaurenoic acid oxidase                            95.5    8e-20   
ref|XP_010933628.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like     97.1    9e-20   
gb|ABY49059.1|  ent-kaurenoic acid oxidase                            95.1    1e-19   
gb|EMT22159.1|  Ent-kaurenoic acid oxidase 1                          92.4    3e-19   
gb|EMT14981.1|  Ent-kaurenoic acid oxidase 1                          94.0    7e-19   
gb|EMT03540.1|  Ent-kaurenoic acid oxidase 1                          94.0    9e-19   
ref|XP_009343459.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like     93.6    1e-18   
ref|XP_010677091.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...  93.2    1e-18   
ref|XP_010677090.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...  93.6    1e-18   
ref|XP_008369248.1|  PREDICTED: cytochrome P450 90A1                  93.2    2e-18   
ref|XP_010423443.1|  PREDICTED: cytochrome P450 90A1-like             92.8    2e-18   
ref|XP_010677093.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like     92.8    3e-18   
ref|XP_008373929.1|  PREDICTED: cytochrome P450 90A1-like isoform X1  92.4    3e-18   
ref|XP_008373932.1|  PREDICTED: cytochrome P450 90A1-like isoform X2  92.4    3e-18   
ref|XP_009344816.1|  PREDICTED: cytochrome P450 90A1-like isoform X2  92.4    3e-18   
ref|XP_009344808.1|  PREDICTED: cytochrome P450 90A1-like isoform X1  92.4    3e-18   
ref|XP_010935390.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like     92.0    5e-18   
emb|CDP17342.1|  unnamed protein product                              92.0    5e-18   
dbj|BAJ95047.1|  predicted protein                                    92.0    5e-18   
dbj|BAJ98009.1|  predicted protein                                    92.0    5e-18   
dbj|BAF56237.1|  cytochrome P450 enzyme                               91.7    6e-18   
ref|XP_009369157.1|  PREDICTED: cytochrome P450 90A1-like             91.7    6e-18   
ref|XP_010491100.1|  PREDICTED: cytochrome P450 90A1-like             91.3    7e-18   
gb|KCW49382.1|  hypothetical protein EUGRSUZ_K02924                   90.9    8e-18   
ref|XP_010452477.1|  PREDICTED: cytochrome P450 90A1                  91.3    8e-18   
emb|CDY04962.1|  BnaAnng01440D                                        88.6    9e-18   
ref|XP_008807889.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like     91.3    9e-18   
ref|XP_010935406.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like     90.9    1e-17   
ref|XP_010037639.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like     90.9    1e-17   
gb|ABK25038.1|  unknown                                               90.1    2e-17   
ref|XP_008239868.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like     90.1    2e-17   
gb|EYU35888.1|  hypothetical protein MIMGU_mgv1a023958mg              89.7    3e-17   
ref|XP_010037638.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like     89.4    4e-17   
ref|XP_010253861.1|  PREDICTED: cytochrome P450 90A1-like             89.0    5e-17   
gb|AAZ39038.1|  cytochrome P450 90A2                                  89.0    5e-17   
ref|XP_009358120.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like     89.0    6e-17   
emb|CDY14104.1|  BnaC02g02210D                                        88.2    8e-17   
ref|XP_012080198.1|  PREDICTED: ent-kaurenoic acid oxidase 2-like     88.2    9e-17   
ref|XP_009125613.1|  PREDICTED: cytochrome P450 90A1-like             87.8    1e-16   
ref|XP_006376822.1|  hypothetical protein POPTR_0012s07310g           88.2    1e-16   
ref|XP_002318613.2|  hypothetical protein POPTR_0012s07300g           87.8    1e-16   
ref|XP_004307639.1|  PREDICTED: cytochrome P450 90A1                  87.8    1e-16   
gb|ABY49055.1|  ent-kaurenoic acid oxidase                            86.3    1e-16   
gb|ABY49048.1|  ent-kaurenoic acid oxidase                            86.3    1e-16   
gb|ABY49053.1|  ent-kaurenoic acid oxidase                            86.3    1e-16   
ref|XP_002540303.1|  cytochrome P450, putative                        84.0    2e-16   
ref|XP_011076685.1|  PREDICTED: cytochrome P450 90A1                  87.4    2e-16   
gb|ABY49056.1|  ent-kaurenoic acid oxidase                            85.5    2e-16   
ref|XP_007220390.1|  hypothetical protein PRUPE_ppa005060mg           86.7    3e-16   
emb|CDP06243.1|  unnamed protein product                              85.1    3e-16   
ref|XP_008233747.1|  PREDICTED: cytochrome P450 90A1                  86.7    3e-16   
ref|XP_007009210.1|  Uncharacterized protein TCM_042691               80.9    4e-16   
ref|NP_001031838.1|  cytochrome P450 90A1                             85.5    4e-16   
ref|XP_002976042.1|  hypothetical protein SELMODRAFT_104575           85.9    5e-16   
ref|XP_002968330.1|  hypothetical protein SELMODRAFT_89026            85.9    5e-16   
ref|XP_010262836.1|  PREDICTED: cytochrome P450 90A1                  85.9    7e-16   
ref|XP_006399027.1|  hypothetical protein EUTSA_v10013418mg           85.5    8e-16   
ref|NP_196188.1|  cytochrome P450 90A1                                85.1    1e-15   
ref|XP_003578492.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like     85.5    1e-15   
gb|AJD25211.1|  cytochrome P450 CYP90A39                              85.1    1e-15   
ref|XP_007009008.1|  Cytochrome P450 superfamily protein isoform 2    84.3    1e-15   
ref|XP_002873219.1|  hypothetical protein ARALYDRAFT_908485           84.7    1e-15   
ref|XP_004240946.1|  PREDICTED: cytochrome P450 90A1                  84.7    1e-15   
ref|XP_003616626.1|  Cytochrome P450                                  84.3    2e-15   
ref|XP_006287674.1|  hypothetical protein CARUB_v10000884mg           84.3    2e-15   
gb|AES99584.2|  cytochrome P450 family monooxygenase                  84.3    2e-15   
gb|ABY49060.1|  ent-kaurenoic acid oxidase                            82.8    2e-15   
ref|XP_006338854.1|  PREDICTED: cytochrome P450 90A1-like             84.0    2e-15   
gb|EYU20018.1|  hypothetical protein MIMGU_mgv1a005728mg              84.0    3e-15   
ref|XP_003581044.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like     84.0    3e-15   
ref|XP_007009007.1|  Cytochrome P450 superfamily protein isoform 1    84.0    3e-15   
gb|KCW77913.1|  hypothetical protein EUGRSUZ_D021702                  78.2    3e-15   
gb|KCW77916.1|  hypothetical protein EUGRSUZ_D021712                  78.2    3e-15   
ref|XP_003600878.1|  Cytochrome P450                                  83.6    3e-15   
ref|XP_009601885.1|  PREDICTED: cytochrome P450 90A1                  83.6    3e-15   
ref|XP_004510368.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  83.6    4e-15   
ref|XP_003607975.1|  Abscisic acid 8'-hydroxylase                     83.6    4e-15   
emb|CDY11332.1|  BnaA03g01680D                                        83.2    4e-15   
gb|ABY49057.1|  ent-kaurenoic acid oxidase                            82.0    4e-15   
ref|XP_012087583.1|  PREDICTED: cytochrome P450 90A1                  83.2    5e-15   
emb|CDX98856.1|  BnaC09g49790D                                        83.2    6e-15   
emb|CDX70137.1|  BnaA10g24860D                                        83.2    6e-15   
ref|XP_009122168.1|  PREDICTED: cytochrome P450 90A1                  82.8    6e-15   
gb|KFK24971.1|  hypothetical protein AALP_AA8G049800                  82.8    6e-15   
ref|XP_004505218.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-li...  82.4    8e-15   
ref|XP_009130893.1|  PREDICTED: cytochrome P450 90A1-like             82.4    8e-15   
ref|XP_011042615.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like     82.0    9e-15   
gb|AGJ98214.1|  CPD                                                   82.4    9e-15   
emb|CAD27417.1|  cytochrome P450                                      82.4    1e-14   
ref|XP_009789229.1|  PREDICTED: cytochrome P450 90A1                  82.4    1e-14   
gb|AAW28930.1|  cytochrome P450                                       80.5    1e-14   
ref|XP_002991753.1|  hypothetical protein SELMODRAFT_161932           82.0    1e-14   
gb|KCW50497.1|  hypothetical protein EUGRSUZ_J00224                   80.5    1e-14   
ref|XP_004297603.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  82.0    1e-14   
ref|XP_004490985.1|  PREDICTED: cytochrome P450 90A1-like isoform X1  82.0    1e-14   
gb|AAM08547.1|AC079935_19  Putative Cytochrome P450                   80.9    1e-14   
ref|XP_004490986.1|  PREDICTED: cytochrome P450 90A1-like isoform X2  82.0    1e-14   
ref|XP_011463328.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  82.0    1e-14   
ref|XP_010543733.1|  PREDICTED: cytochrome P450 90A1                  81.6    1e-14   
ref|XP_006466873.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  81.6    2e-14   
emb|CDX80969.1|  BnaC03g02230D                                        81.6    2e-14   
ref|XP_002989743.1|  hypothetical protein SELMODRAFT_130337           81.6    2e-14   
ref|XP_006425595.1|  hypothetical protein CICLE_v10025479mg           81.6    2e-14   
dbj|BAF56238.1|  cytochrome P450 enzyme                               81.6    2e-14   
ref|NP_001176125.1|  Os10g0378050                                     80.5    2e-14   
gb|KCW50496.1|  hypothetical protein EUGRSUZ_J00224                   80.5    2e-14   
gb|KJB37699.1|  hypothetical protein B456_006G216100                  79.0    2e-14   
gb|KDO71050.1|  hypothetical protein CISIN_1g011403mg                 81.3    2e-14   
ref|XP_002311214.1|  hypothetical protein POPTR_0008s06740g           81.3    2e-14   
gb|EAY78272.1|  hypothetical protein OsI_33319                        81.3    2e-14   
gb|ABA55734.1|  ABA 8'-hydroxylase CYP707A3                           76.6    2e-14   
gb|KEH18339.1|  cytochrome P450 family 90 protein                     80.9    2e-14   
ref|XP_007163533.1|  hypothetical protein PHAVU_001G242200g           81.3    2e-14   
ref|XP_007046800.1|  Cytochrome P450 superfamily protein              81.3    2e-14   
ref|XP_003519393.1|  PREDICTED: cytochrome P450 90A1                  80.9    3e-14   
ref|XP_002963154.1|  hypothetical protein SELMODRAFT_404783           79.0    3e-14   
ref|XP_006378665.1|  hypothetical protein POPTR_0010s19710g           79.7    3e-14   
ref|XP_011044517.1|  PREDICTED: cytochrome P450 90A1-like             80.9    3e-14   
gb|EYU25425.1|  hypothetical protein MIMGU_mgv1a005650mg              80.9    3e-14   
emb|CDP14872.1|  unnamed protein product                              78.6    3e-14   
ref|XP_003518838.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like   80.5    4e-14   
gb|ABC68415.1|  cytochrome P450 monooxygenase CYP707A16               79.0    4e-14   
gb|KEH18338.1|  cytochrome P450 family 90 protein                     80.5    4e-14   
ref|XP_010266622.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like   80.5    4e-14   
dbj|BAN81750.1|  ABA 8'-hydroxylase                                   80.5    4e-14   
dbj|BAD38475.1|  putative cytochrome P450                             80.1    5e-14   
dbj|BAI44032.1|  ABA 8-hydroxylase                                    80.5    5e-14   
gb|EAZ15890.1|  hypothetical protein OsJ_31312                        80.5    5e-14   
ref|XP_004976419.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like     80.1    5e-14   
dbj|BAI44031.1|  ABA 8-hydroxylase                                    80.1    6e-14   
ref|XP_002270553.2|  PREDICTED: cytochrome P450 90A1                  80.1    6e-14   
ref|XP_006378663.1|  hypothetical protein POPTR_0010s19710g           79.7    6e-14   
ref|XP_010031233.1|  PREDICTED: cytochrome P450 90A1                  80.1    6e-14   
gb|AAF89209.1|AF279252_1  cytochrome P450                             80.1    6e-14   
ref|XP_006848201.1|  PREDICTED: cytochrome P450 90A1                  79.7    6e-14   
ref|XP_011083840.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like   79.7    7e-14   
ref|XP_006660696.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like   79.7    7e-14   
dbj|BAE16978.1|  steroid 23-alpha-hydroxylase                         79.7    7e-14   
ref|NP_001063366.1|  Os09g0457100                                     79.7    7e-14   
sp|A2Z212.1|ABAH3_ORYSI  RecName: Full=Abscisic acid 8'-hydroxyla...  79.7    7e-14   
ref|XP_006378664.1|  hypothetical protein POPTR_0010s19710g           79.7    8e-14   
ref|NP_001291222.1|  cytochrome P450 90A1                             79.7    8e-14   
gb|KGN45533.1|  hypothetical protein Csa_7G451390                     79.7    8e-14   
ref|XP_002316218.2|  hypothetical protein POPTR_0010s19710g           79.7    8e-14   
gb|AFK45957.1|  unknown                                               75.9    8e-14   
ref|XP_007156342.1|  hypothetical protein PHAVU_003G278400g           79.3    9e-14   
ref|XP_012089588.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like   79.3    9e-14   
ref|XP_008665991.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like     79.3    9e-14   
ref|XP_008458843.1|  PREDICTED: cytochrome P450 724B1                 79.3    9e-14   
dbj|BAN81752.1|  ABA 8'-hydroxylase                                   79.3    1e-13   
emb|CDY58211.1|  BnaCnng32820D                                        76.6    1e-13   
gb|ADR78283.1|  CYP720B9                                              79.3    1e-13   
gb|KCW65676.1|  hypothetical protein EUGRSUZ_G03059                   78.6    1e-13   
ref|XP_007158078.1|  hypothetical protein PHAVU_002G122200g           79.3    1e-13   
gb|ABC86558.1|  abscisic acid 8'-hydroxylase                          79.0    1e-13   
ref|XP_011074435.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like   79.3    1e-13   
ref|XP_008462360.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  79.0    1e-13   
gb|ABC59109.1|  cytochrome P450 monooxygenase CYP707A17               78.6    1e-13   
ref|XP_011659645.1|  PREDICTED: LOW QUALITY PROTEIN: 3-epi-6-deox...  79.7    1e-13   
gb|AJO53634.1|  ABA 8'-hydroxylase 4                                  79.0    1e-13   
gb|KHN41770.1|  Abscisic acid 8'-hydroxylase 1                        79.0    1e-13   
ref|XP_010519301.1|  PREDICTED: abscisic acid 8'-hydroxylase 4        79.0    1e-13   
ref|NP_001237490.1|  abscisic acid 8'-hydroxylase                     79.0    1e-13   
ref|XP_010033449.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  79.0    1e-13   
gb|KEH27649.1|  cytochrome P450 family ABA 8'-hydroxylase             78.6    1e-13   
gb|EPS61772.1|  hypothetical protein M569_13021                       74.7    1e-13   
gb|KHN48562.1|  Cytochrome P450 90A1                                  79.0    1e-13   
gb|ADN34104.1|  cytochrome p450                                       79.3    2e-13   
gb|AAX59903.1|  13-alpha-hydroxylase                                  78.6    2e-13   
ref|XP_011082182.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like   78.6    2e-13   
gb|KCW65675.1|  hypothetical protein EUGRSUZ_G03059                   78.6    2e-13   



>gb|AFA35955.1| ent-kaurenoic acid oxidase, partial [Nicotiana attenuata]
Length=277

 Score =   298 bits (762),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+LG VN WYYE++KLGDKK LSLPPGD GWPFIG MWSFLRAFKSSNPDSFISSFVSR+
Sbjct  19   WLLGSVNVWYYEKLKLGDKKSLSLPPGDFGWPFIGTMWSFLRAFKSSNPDSFISSFVSRF  78

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TGMYK  MFGSPS+IVTTP+ACRRVLSDDEAF+PGWP STM+LIG+KSFIGIS+EEHK
Sbjct  79   GRTGMYKTLMFGSPSVIVTTPEACRRVLSDDEAFKPGWPTSTMKLIGKKSFIGISYEEHK  138

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
             LRKLTAAPVNGHEALS YI YIE+NV  AL+KWASMG+IEFLTQL
Sbjct  139  WLRKLTAAPVNGHEALSMYIKYIEENVISALDKWASMGQIEFLTQL  184



>ref|XP_009804565.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Nicotiana sylvestris]
Length=420

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+LG VN WYYE++KLGDKK LSLPPGDLGWPFIG MWSFLRAFKSSNPDSFISSFVSR+
Sbjct  20   WLLGSVNVWYYEKLKLGDKKSLSLPPGDLGWPFIGTMWSFLRAFKSSNPDSFISSFVSRF  79

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TGMYK  MFGSPS+IVTTP+ACRRVL+DDEAF+PGWP STM+LIG+KSFIGIS+EEHK
Sbjct  80   GRTGMYKTLMFGSPSVIVTTPEACRRVLTDDEAFKPGWPTSTMKLIGKKSFIGISYEEHK  139

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
             LRKLTAAPVNGHEALS YI YIE+NV  AL+KWASMG+IEFLTQL
Sbjct  140  WLRKLTAAPVNGHEALSMYIKYIEENVISALDKWASMGQIEFLTQL  185



>ref|XP_009589784.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=492

 Score =   294 bits (753),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVLG VN WY+E++KL DKKRLSLPPGDLGWPFIG MWSFLRAFKSSNPDSFISSFVSR+
Sbjct  19   WVLGSVNVWYFEKLKLSDKKRLSLPPGDLGWPFIGTMWSFLRAFKSSNPDSFISSFVSRF  78

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TGMYK  MFGSPS+IVTT +ACRRVL+DDEAF+PGWP STM+LIG+KSFIGIS+EEHK
Sbjct  79   GRTGMYKTLMFGSPSVIVTTAEACRRVLTDDEAFKPGWPTSTMKLIGKKSFIGISYEEHK  138

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
             LRKLTAAPVNGHEALS YI YIE+NV  ALEKWA+MG+IEFLTQL
Sbjct  139  WLRKLTAAPVNGHEALSMYIKYIEENVISALEKWATMGQIEFLTQL  184



>ref|XP_010097724.1| Ent-kaurenoic acid oxidase 1 [Morus notabilis]
 gb|EXB70679.1| Ent-kaurenoic acid oxidase 1 [Morus notabilis]
Length=493

 Score =   283 bits (723),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L  VN W YE  KLG+KK  SLPPGDLGWPFIGNMWSFL+AFKSSNPDSFISSFVSRY
Sbjct  24   WLLRNVNWWLYE-TKLGEKK-YSLPPGDLGWPFIGNMWSFLKAFKSSNPDSFISSFVSRY  81

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TGMYKAF+FG+PSIIVTTP+ CRRVL+DDE+F+PGWP ST+ELIG+KSFIGISFEEHK
Sbjct  82   GHTGMYKAFLFGNPSIIVTTPETCRRVLTDDESFKPGWPRSTVELIGKKSFIGISFEEHK  141

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLRKLTAAPVNGHEALS YI YIE+NV  +LEKWA+MGEIEFLTQ+
Sbjct  142  RLRKLTAAPVNGHEALSMYIKYIEENVVASLEKWATMGEIEFLTQV  187



>ref|XP_006354607.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Solanum tuberosum]
Length=497

 Score =   282 bits (722),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 152/168 (90%), Gaps = 2/168 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKL-GDKK-RLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVS  309
            W+L  VN WYYE+VKL GDKK RLSLPPGDLGWPFIG MWSFLRAFKS+NPDSFISSFVS
Sbjct  21   WLLLSVNVWYYEKVKLSGDKKLRLSLPPGDLGWPFIGTMWSFLRAFKSNNPDSFISSFVS  80

Query  310  RYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEE  489
            R+G TG+YKAFMFGSP +I+TTP+ACR+VL+DDEAF+PGWP STMELIG+KSFIGIS+EE
Sbjct  81   RFGRTGIYKAFMFGSPCVIITTPEACRKVLNDDEAFKPGWPTSTMELIGKKSFIGISYEE  140

Query  490  HKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            HK LRKLTAAPVNGHEALS YI YIE+ V  AL+KW+SMGEIEFLT L
Sbjct  141  HKWLRKLTAAPVNGHEALSMYIQYIEERVISALDKWSSMGEIEFLTHL  188



>ref|XP_007039942.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
2 [Theobroma cacao]
 gb|EOY24443.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
2 [Theobroma cacao]
Length=396

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 150/170 (88%), Gaps = 2/170 (1%)
 Frame = +1

Query  124  SSFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSF  303
            +S  WVL RVN W YE  +LGDK+  SLPPGDLGWPFIGNMWSFLRAFKS +PDSFI SF
Sbjct  18   ASVKWVLERVNWWLYES-QLGDKQ-FSLPPGDLGWPFIGNMWSFLRAFKSDDPDSFIRSF  75

Query  304  VSRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISF  483
            VSR+G  G+YKAFMFG+PS+IVT P+ C+RVL+DD+AF+PGWP +T+ELIG+KSFIGIS+
Sbjct  76   VSRFGHIGIYKAFMFGNPSVIVTMPETCKRVLNDDDAFKPGWPTATVELIGKKSFIGISY  135

Query  484  EEHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EEHKRLR+LTAAPVNGHEALS YI YIE+NV  AL+KW++MGEIEFLT+L
Sbjct  136  EEHKRLRRLTAAPVNGHEALSLYIQYIEENVISALDKWSNMGEIEFLTEL  185



>ref|XP_007039943.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
3 [Theobroma cacao]
 ref|XP_007039944.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
3 [Theobroma cacao]
 gb|EOY24444.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
3 [Theobroma cacao]
 gb|EOY24445.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
3 [Theobroma cacao]
Length=361

 Score =   271 bits (692),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 150/170 (88%), Gaps = 2/170 (1%)
 Frame = +1

Query  124  SSFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSF  303
            +S  WVL RVN W YE  +LGDK+  SLPPGDLGWPFIGNMWSFLRAFKS +PDSFI SF
Sbjct  18   ASVKWVLERVNWWLYES-QLGDKQ-FSLPPGDLGWPFIGNMWSFLRAFKSDDPDSFIRSF  75

Query  304  VSRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISF  483
            VSR+G  G+YKAFMFG+PS+IVT P+ C+RVL+DD+AF+PGWP +T+ELIG+KSFIGIS+
Sbjct  76   VSRFGHIGIYKAFMFGNPSVIVTMPETCKRVLNDDDAFKPGWPTATVELIGKKSFIGISY  135

Query  484  EEHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EEHKRLR+LTAAPVNGHEALS YI YIE+NV  AL+KW++MGEIEFLT+L
Sbjct  136  EEHKRLRRLTAAPVNGHEALSLYIQYIEENVISALDKWSNMGEIEFLTEL  185



>ref|XP_004229509.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Solanum 
lycopersicum]
Length=497

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 150/168 (89%), Gaps = 2/168 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKL-GDKK-RLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVS  309
            W+L  VN WYYE+VKL GDKK RLSLPPGDLGWPFIG MWSFLRAFKS+NPDSFI+SF+S
Sbjct  21   WLLSSVNVWYYEKVKLSGDKKKRLSLPPGDLGWPFIGTMWSFLRAFKSNNPDSFINSFIS  80

Query  310  RYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEE  489
            R+G TG+YKAFMFGSP +I+TTP+ CR+VL+DDEAF+PGWP STMELIG+KSFIGIS+EE
Sbjct  81   RFGRTGIYKAFMFGSPCVIITTPEGCRKVLNDDEAFKPGWPKSTMELIGKKSFIGISYEE  140

Query  490  HKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            HK LRKLTAAPVNGHEALS YI YIE+ V  AL+KW+SM E+EFLT +
Sbjct  141  HKWLRKLTAAPVNGHEALSMYIQYIEERVISALDKWSSMEEVEFLTHM  188



>ref|XP_012083782.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X2 [Jatropha 
curcas]
Length=392

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L R N W+YE  +L + +  SLPPGDLGWPFIGNMWSFLRAFKS++PDSF+ +F +RY
Sbjct  23   WILKRANKWFYE-TQLREMQ-YSLPPGDLGWPFIGNMWSFLRAFKSADPDSFMRTFAARY  80

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  GMYKA MFG PSI VTTP+ C+RVL+DDEAF+PGWP STMELIG+KSF+GIS+EEHK
Sbjct  81   GGGGMYKALMFGKPSIFVTTPETCKRVLTDDEAFKPGWPSSTMELIGKKSFLGISYEEHK  140

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT++PVNGHEALS Y+ YIEQNV  AL+KWASMG+IEFLTQL
Sbjct  141  RLRRLTSSPVNGHEALSLYLQYIEQNVASALDKWASMGQIEFLTQL  186



>ref|XP_007039941.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
1 [Theobroma cacao]
 gb|EOY24442.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
1 [Theobroma cacao]
Length=499

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 150/170 (88%), Gaps = 2/170 (1%)
 Frame = +1

Query  124  SSFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSF  303
            +S  WVL RVN W YE  +LGDK+  SLPPGDLGWPFIGNMWSFLRAFKS +PDSFI SF
Sbjct  18   ASVKWVLERVNWWLYES-QLGDKQ-FSLPPGDLGWPFIGNMWSFLRAFKSDDPDSFIRSF  75

Query  304  VSRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISF  483
            VSR+G  G+YKAFMFG+PS+IVT P+ C+RVL+DD+AF+PGWP +T+ELIG+KSFIGIS+
Sbjct  76   VSRFGHIGIYKAFMFGNPSVIVTMPETCKRVLNDDDAFKPGWPTATVELIGKKSFIGISY  135

Query  484  EEHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EEHKRLR+LTAAPVNGHEALS YI YIE+NV  AL+KW++MGEIEFLT+L
Sbjct  136  EEHKRLRRLTAAPVNGHEALSLYIQYIEENVISALDKWSNMGEIEFLTEL  185



>gb|KDO85363.1| hypothetical protein CISIN_1g010697mg [Citrus sinensis]
Length=454

 Score =   268 bits (684),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 148/166 (89%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WV+ RVN W YER KLG+K+  SLPPGD+GWPFIGNMWSFLRAFK+++PDSF+ SFVSR+
Sbjct  33   WVMKRVNWWLYER-KLGEKQ-YSLPPGDMGWPFIGNMWSFLRAFKTTHPDSFVDSFVSRF  90

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TGMYKAFMFG+PSIIVTTP+ C+RVL+DD+AF+PGWP STMELIG+KSFIGIS+EEHK
Sbjct  91   GRTGMYKAFMFGNPSIIVTTPETCKRVLTDDDAFKPGWPASTMELIGKKSFIGISYEEHK  150

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS Y+ YIE  V  AL+KW+++  IEFLTQL
Sbjct  151  RLRRLTAAPVNGHEALSVYVHYIEDIVTSALDKWSNLERIEFLTQL  196



>ref|XP_006445516.1| hypothetical protein CICLE_v10019986mg [Citrus clementina]
 gb|ESR58756.1| hypothetical protein CICLE_v10019986mg [Citrus clementina]
Length=475

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 148/166 (89%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WV+ RVN W YER KLG+K+  SLPPGD+GWPFIGNMWSFLRAFK+++PDSF+ SFVSR+
Sbjct  5    WVMKRVNWWLYER-KLGEKQ-YSLPPGDMGWPFIGNMWSFLRAFKTTHPDSFVDSFVSRF  62

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TGMYKAFMFG+PSIIVTTP+ C+RVL+DD+AF+PGWP STMELIG+KSFIGIS+EEHK
Sbjct  63   GRTGMYKAFMFGNPSIIVTTPETCKRVLTDDDAFKPGWPASTMELIGKKSFIGISYEEHK  122

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS Y+ YIE  V  AL+KW+++  IEFLTQL
Sbjct  123  RLRRLTAAPVNGHEALSVYVHYIEDIVISALDKWSNLERIEFLTQL  168



>emb|CDP09340.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN W +E  KLGD+ R SLPPGDLGWPFIGNMW+FLRAFKSSNPDSFISSFV+R+G
Sbjct  24   LLKSVNWWRFE-AKLGDR-RFSLPPGDLGWPFIGNMWAFLRAFKSSNPDSFISSFVNRFG  81

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
              G+YK  MFG+PSIIVTTP+ACRRVL+DDEAF PGWP STM+LIGRKSFIGIS EEHKR
Sbjct  82   PVGLYKTVMFGNPSIIVTTPEACRRVLTDDEAFMPGWPSSTMKLIGRKSFIGISPEEHKR  141

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LRKLTAAPVNGHEALS Y+ YIE NV  ALEKWA MG+IEFLTQL
Sbjct  142  LRKLTAAPVNGHEALSIYLKYIEDNVIEALEKWAGMGQIEFLTQL  186



>gb|KDO85362.1| hypothetical protein CISIN_1g010697mg [Citrus sinensis]
Length=503

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 148/166 (89%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WV+ RVN W YER KLG+K+  SLPPGD+GWPFIGNMWSFLRAFK+++PDSF+ SFVSR+
Sbjct  33   WVMKRVNWWLYER-KLGEKQ-YSLPPGDMGWPFIGNMWSFLRAFKTTHPDSFVDSFVSRF  90

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TGMYKAFMFG+PSIIVTTP+ C+RVL+DD+AF+PGWP STMELIG+KSFIGIS+EEHK
Sbjct  91   GRTGMYKAFMFGNPSIIVTTPETCKRVLTDDDAFKPGWPASTMELIGKKSFIGISYEEHK  150

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS Y+ YIE  V  AL+KW+++  IEFLTQL
Sbjct  151  RLRRLTAAPVNGHEALSVYVHYIEDIVTSALDKWSNLERIEFLTQL  196



>ref|XP_006464339.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Citrus sinensis]
Length=514

 Score =   266 bits (681),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 148/166 (89%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WV+ RVN W YER KLG+K+  SLPPGD+GWPFIGNMWSFLRAFK+++PDSF+ SFVSR+
Sbjct  44   WVMKRVNWWLYER-KLGEKQ-YSLPPGDMGWPFIGNMWSFLRAFKTTHPDSFVDSFVSRF  101

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TGMYKAFMFG+PSIIVTTP+ C+RVL+DD+AF+PGWP STMELIG+KSFIGIS+EEHK
Sbjct  102  GRTGMYKAFMFGNPSIIVTTPETCKRVLTDDDAFKPGWPASTMELIGKKSFIGISYEEHK  161

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS Y+ YIE  V  AL+KW+++  IEFLTQL
Sbjct  162  RLRRLTAAPVNGHEALSVYVHYIEDIVTSALDKWSNLERIEFLTQL  207



>ref|XP_002265630.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Vitis vinifera]
Length=492

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL R N W YE VKLG+K R SLPPGDLGWP IGNMWSFLRAFKS++PDSFISSF++R+
Sbjct  22   WVLRRANSWVYE-VKLGEK-RYSLPPGDLGWPLIGNMWSFLRAFKSTDPDSFISSFITRF  79

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TGMYK  MFG+PSIIVT P+AC+RVL+DD+ F+PGWP STMELIGRKSFIGI+ EEHK
Sbjct  80   GQTGMYKVLMFGNPSIIVTIPEACKRVLTDDQNFKPGWPTSTMELIGRKSFIGITNEEHK  139

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTA PVNGHEALS Y+ YIE NV  AL KWA+MGE EFLT L
Sbjct  140  RLRRLTATPVNGHEALSIYMQYIEDNVISALNKWAAMGEFEFLTAL  185



>gb|KCW76778.1| hypothetical protein EUGRSUZ_D01134 [Eucalyptus grandis]
Length=491

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L   N WY    +L  ++R SLPPGDLGWPFIGNMWSFLRAFKS +PDSF+SSFV+R+
Sbjct  21   WLLKHAN-WYLYETQLDGERRRSLPPGDLGWPFIGNMWSFLRAFKSGDPDSFMSSFVTRF  79

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YKAFMFGSPS+IVT P+ CRRVL+DDE FQPGWP+STM+LIGRKSFIGIS+EEHK
Sbjct  80   GNTGIYKAFMFGSPSVIVTMPEPCRRVLTDDEKFQPGWPISTMKLIGRKSFIGISYEEHK  139

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTA PVNGHE+LS Y+ YIE+NV  AL+KW+ MG+IEFLT+L
Sbjct  140  RLRRLTATPVNGHESLSLYMGYIEENVISALDKWSKMGQIEFLTEL  185



>dbj|BAG71199.1| ent-kaurenoic acid oxidase [Lactuca sativa]
Length=493

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL  VN W YER  L  KKR  LPPGD+GWPFIGNMWSFLRAFKS++PD+FIS+F+ R+
Sbjct  25   WVLKSVNIWIYER-NLEKKKRKCLPPGDMGWPFIGNMWSFLRAFKSNDPDAFISNFLRRF  83

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G+ G+YK+FMFGSPSIIVT P+ACR+VL DDEAFQPGWP +T ELIG+KSFIGIS+E+HK
Sbjct  84   GSRGLYKSFMFGSPSIIVTVPEACRKVLFDDEAFQPGWPTATRELIGKKSFIGISYEDHK  143

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLRKLTAAPVNGHEALS Y+ YIE NV +ALEKW+ MG IEFLT L
Sbjct  144  RLRKLTAAPVNGHEALSTYMQYIETNVVLALEKWSKMGRIEFLTYL  189



>ref|XP_010052709.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Eucalyptus grandis]
Length=480

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L   N WY    +L  ++R SLPPGDLGWPFIGNMWSFLRAFKS +PDSF+SSFV+R+
Sbjct  10   WLLKHAN-WYLYETQLDGERRRSLPPGDLGWPFIGNMWSFLRAFKSGDPDSFMSSFVTRF  68

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YKAFMFGSPS+IVT P+ CRRVL+DDE FQPGWP+STM+LIGRKSFIGIS+EEHK
Sbjct  69   GNTGIYKAFMFGSPSVIVTMPEPCRRVLTDDEKFQPGWPISTMKLIGRKSFIGISYEEHK  128

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTA PVNGHE+LS Y+ YIE+NV  AL+KW+ MG+IEFLT+L
Sbjct  129  RLRRLTATPVNGHESLSLYMGYIEENVISALDKWSKMGQIEFLTEL  174



>emb|CDP21969.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   263 bits (672),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 142/165 (86%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN W +E  KLGD+ R SLPPGDLGWPFIG MW+FLRAFKSSNPDSFISSFV+R+G
Sbjct  24   LLKSVNRWLFE-AKLGDR-RFSLPPGDLGWPFIGTMWAFLRAFKSSNPDSFISSFVNRFG  81

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
              G+YK  MFGSPSIIVTTP+AC+RVL+DDEAF PGWP ST+ L+GRKSFIGIS +EHKR
Sbjct  82   PVGLYKTMMFGSPSIIVTTPEACKRVLTDDEAFMPGWPSSTLTLMGRKSFIGISAQEHKR  141

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LRKLTAAPVNGHEALS Y+ YIE NV  ALEKWA MG+IEFLTQL
Sbjct  142  LRKLTAAPVNGHEALSIYLKYIEDNVIEALEKWAGMGQIEFLTQL  186



>ref|XP_012083781.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X1 [Jatropha 
curcas]
 gb|KDP28926.1| hypothetical protein JCGZ_14697 [Jatropha curcas]
Length=493

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L R N W+YE  +L + +  SLPPGDLGWPFIGNMWSFLRAFKS++PDSF+ +F +RY
Sbjct  23   WILKRANKWFYE-TQLREMQ-YSLPPGDLGWPFIGNMWSFLRAFKSADPDSFMRTFAARY  80

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  GMYKA MFG PSI VTTP+ C+RVL+DDEAF+PGWP STMELIG+KSF+GIS+EEHK
Sbjct  81   GGGGMYKALMFGKPSIFVTTPETCKRVLTDDEAFKPGWPSSTMELIGKKSFLGISYEEHK  140

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT++PVNGHEALS Y+ YIEQNV  AL+KWASMG+IEFLTQL
Sbjct  141  RLRRLTSSPVNGHEALSLYLQYIEQNVASALDKWASMGQIEFLTQL  186



>ref|XP_002526524.1| Ent-kaurenoic acid oxidase, putative [Ricinus communis]
 gb|EEF35915.1| Ent-kaurenoic acid oxidase, putative [Ricinus communis]
Length=492

 Score =   264 bits (675),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 149/171 (87%), Gaps = 5/171 (3%)
 Frame = +1

Query  130  FW---WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISS  300
            FW   W+L RVNCW YE  +LG+ +  SLPPGDLGWPFIGNMWSFLRAFKS++PDSF+ +
Sbjct  17   FWCLKWILKRVNCWLYEN-QLGEMQ-YSLPPGDLGWPFIGNMWSFLRAFKSNDPDSFMRN  74

Query  301  FVSRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGIS  480
            F +RYG+ G+YKAFMFG PS++VTT +AC+RVL+DD+AF+PGWP ST ELIG+KSFIGIS
Sbjct  75   FTARYGSGGIYKAFMFGKPSVLVTTSEACKRVLTDDDAFKPGWPSSTTELIGKKSFIGIS  134

Query  481  FEEHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            +EEHKRLR+LTA+PVNGHEALS Y+ YIE  VK ALEKW++MGEI+FLTQL
Sbjct  135  YEEHKRLRRLTASPVNGHEALSVYMHYIEDKVKSALEKWSTMGEIQFLTQL  185



>emb|CDP09338.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 142/165 (86%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN W +E  KLGD+ R SLPPGDLGWPFIG MW+FLRAFKSSNPDSFISSFV+R+G
Sbjct  24   LLKSVNRWLFE-AKLGDR-RFSLPPGDLGWPFIGTMWAFLRAFKSSNPDSFISSFVNRFG  81

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
              G+YK  MFGSPSIIVTTP+AC+RVL+DDEAF PGWP ST+ L+GRKSFIGIS +EHKR
Sbjct  82   PVGLYKTMMFGSPSIIVTTPEACKRVLTDDEAFMPGWPSSTLTLMGRKSFIGISAQEHKR  141

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LRKLTAAPVNGHEALS Y+ YIE NV  ALEKWA MG+IEFLTQL
Sbjct  142  LRKLTAAPVNGHEALSIYLKYIEDNVIEALEKWAGMGQIEFLTQL  186



>emb|CDP09336.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 142/165 (86%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN W +E  KLGD+ R SLPPGDLGWPFIG MW+FLRAFKSSNPDSFISSFV+R+G
Sbjct  24   LLKSVNRWLFE-AKLGDR-RFSLPPGDLGWPFIGTMWAFLRAFKSSNPDSFISSFVNRFG  81

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
              G+YK  MFGSPSIIVTTP+AC+RVL+DDEAF PGWP ST+ L+GRKSFIGIS +EHKR
Sbjct  82   PVGLYKTMMFGSPSIIVTTPEACKRVLTDDEAFMPGWPSSTLTLMGRKSFIGISAQEHKR  141

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LRKLTAAPVNGHEALS Y+ YIE NV  ALEKWA MG+IEFLTQL
Sbjct  142  LRKLTAAPVNGHEALSIYLKYIEDNVIEALEKWAGMGQIEFLTQL  186



>emb|CDP09339.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 142/165 (86%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN W +E  KLGD+ R SLPPGDLGWPFIG MW+FLRAFKSSNPDSFISSFV+R+G
Sbjct  24   LLKSVNRWLFE-AKLGDR-RFSLPPGDLGWPFIGTMWAFLRAFKSSNPDSFISSFVNRFG  81

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
              G+YK  MFGSPSIIVTTP+AC+RVL+DDEAF PGWP ST+ L+GRKSFIGIS +EHKR
Sbjct  82   PVGLYKTMMFGSPSIIVTTPEACKRVLTDDEAFMPGWPSSTLTLMGRKSFIGISAQEHKR  141

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LRKLTAAPVNGHEALS Y+ YIE NV  ALEKWA MG+IEFLTQL
Sbjct  142  LRKLTAAPVNGHEALSIYLKYIEDNVIEALEKWAGMGQIEFLTQL  186



>gb|KJB67442.1| hypothetical protein B456_010G190900 [Gossypium raimondii]
 gb|KJB67443.1| hypothetical protein B456_010G190900 [Gossypium raimondii]
Length=499

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 145/166 (87%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL RVN W YE  +LGD+ R SLPPGDLGWPFIGNMWSFLRAF+S +PDSFI+SFVSR+
Sbjct  29   WVLERVNPWVYE-TRLGDE-RYSLPPGDLGWPFIGNMWSFLRAFRSDDPDSFIASFVSRF  86

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YKAFMFG+PS+IVT P+ C+RVL+DD+AF+PGWP ST+ELIG+KSFIGI +EEHK
Sbjct  87   GRTGIYKAFMFGNPSVIVTMPETCKRVLNDDDAFKPGWPTSTVELIGKKSFIGIPYEEHK  146

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+APVNGHEALS YI YIE  V   L+KW+ MG+IEFLTQL
Sbjct  147  RLRRLTSAPVNGHEALSIYIPYIEDIVISTLDKWSKMGKIEFLTQL  192



>gb|KDP30573.1| hypothetical protein JCGZ_16952 [Jatropha curcas]
Length=287

 Score =   254 bits (650),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 144/169 (85%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            S  W+L +VN W YE  KLG+ +  SLPPGDLGWPFIGNMWSFL+AFKS++PDSF+ +FV
Sbjct  22   SLKWILKKVNWWLYE-TKLGEIQ-YSLPPGDLGWPFIGNMWSFLKAFKSTDPDSFMRNFV  79

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
            +RYG  G+YKA MFG+PSI+VTTP+ CR+VL+DDEAFQPGWP ST ELIG+KSF+ IS E
Sbjct  80   ARYGGGGVYKALMFGNPSILVTTPETCRKVLTDDEAFQPGWPKSTEELIGKKSFVSISHE  139

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EHKRLR++T+ P+NGHEALS YI YIE+NV  AL++WASM EIEFLTQL
Sbjct  140  EHKRLRRITSTPLNGHEALSQYISYIEENVIYALDEWASMTEIEFLTQL  188



>ref|XP_002321248.2| ent-kaurenoic acid oxidase family protein [Populus trichocarpa]
 gb|EEE99563.2| ent-kaurenoic acid oxidase family protein [Populus trichocarpa]
Length=535

 Score =   262 bits (670),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 148/166 (89%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L +VN W YE  +LG+K+  SLPPGDLGWPFIGNMWSFLRAFKSS+PDSF+ +F+++Y
Sbjct  22   WILKKVNWWLYE-AQLGEKQ-YSLPPGDLGWPFIGNMWSFLRAFKSSDPDSFMRTFINKY  79

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YKAFMFG+PS+ VTTP+ACRRVLS+D+AF+PGWP+ST++LIGRKSFI IS+EEHK
Sbjct  80   GDNGIYKAFMFGNPSVFVTTPEACRRVLSNDDAFKPGWPISTLKLIGRKSFIDISYEEHK  139

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+APVNGHEALS YI YIE+NV   LEKW +MG+IEFLTQ+
Sbjct  140  RLRRLTSAPVNGHEALSVYIPYIEENVIAMLEKWTTMGKIEFLTQV  185



>ref|XP_004307312.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Fragaria vesca 
subsp. vesca]
Length=503

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL  VN W YE  KLG+K+  SLPPGDLG PFIGNMWSFLRAFKS NPDSFI+SFVSR+
Sbjct  36   WVLENVNWWLYE-TKLGEKQ-YSLPPGDLGLPFIGNMWSFLRAFKSGNPDSFINSFVSRF  93

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YKA+MFG PSII T P+ C+RVL+DD+AF+PGWPVST+ELIGRKSFIGIS+EEHK
Sbjct  94   GKMGIYKAYMFGFPSIICTVPETCKRVLTDDDAFKPGWPVSTVELIGRKSFIGISYEEHK  153

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLRKLTAAPVNGHEALS Y+ YIE  V  +LEKWA+MG++EFLTQ+
Sbjct  154  RLRKLTAAPVNGHEALSVYMKYIEDIVVTSLEKWATMGDVEFLTQV  199



>emb|CDY12205.1| BnaC04g12350D [Brassica napus]
Length=490

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 140/166 (84%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L RVN W YE  KLG+K R  LPPGDLGWPFIGNM  FLRAFK+S+PDSFI ++++RY
Sbjct  23   WLLKRVNVWIYES-KLGEK-RHYLPPGDLGWPFIGNMLPFLRAFKTSDPDSFIRTYITRY  80

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YK  MFG+PS+IVTTP+ CR+VL+DDE FQPGWP STMELIG+KSFIGISFEEHK
Sbjct  81   GHNGVYKVHMFGNPSVIVTTPETCRKVLTDDECFQPGWPKSTMELIGKKSFIGISFEEHK  140

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS YI YIE+ V  ALE W+ MGEIEFLT +
Sbjct  141  RLRRLTAAPVNGHEALSVYIKYIEETVVTALENWSKMGEIEFLTHV  186



>ref|XP_012084984.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Jatropha curcas]
 gb|KDP26990.1| hypothetical protein JCGZ_22182 [Jatropha curcas]
Length=498

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 147/169 (87%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            S  W+L +VN W YE  KLG+ +  SLPPGDLGWPFIGNMWSFL+AFKS++PDSF+ +FV
Sbjct  22   SLKWILKKVNWWLYE-TKLGEIQ-YSLPPGDLGWPFIGNMWSFLKAFKSTDPDSFMRNFV  79

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
            +RYG  G+YKA MFG+PS++VTTP+ CR+VL+DDEAFQPGWP ST +LIG+KSF+ IS+E
Sbjct  80   ARYGGGGVYKALMFGNPSVLVTTPETCRKVLTDDEAFQPGWPKSTADLIGKKSFVSISYE  139

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EHKRLR+LT+APVNGHEALS YI YIE+NV  AL++WASMGEIEFLTQL
Sbjct  140  EHKRLRRLTSAPVNGHEALSQYILYIEENVISALDEWASMGEIEFLTQL  188



>ref|XP_008232239.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Prunus mume]
Length=499

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L  VN W YE   LG+K+  SLPPGDLGWPFIGNMWSFL+AFKSSNP++F++S VSR+
Sbjct  30   WLLQNVNSWLYE-TPLGEKQ-YSLPPGDLGWPFIGNMWSFLKAFKSSNPETFVNSLVSRF  87

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YKAFMFGSPS+IVTTP++ +RVL+DD+AF+PGWP+ST+ELIG+ SFIGIS+EEHK
Sbjct  88   GRTGIYKAFMFGSPSVIVTTPESSKRVLTDDDAFKPGWPLSTLELIGKNSFIGISYEEHK  147

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS Y+ YIE  V  +LEKW+ MGEIEFLTQL
Sbjct  148  RLRRLTAAPVNGHEALSMYMKYIEDMVVTSLEKWSKMGEIEFLTQL  193



>ref|XP_011085042.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Sesamum indicum]
Length=493

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL RVNCWYYE +KLG+K R  LPPGDLGWPFIGNM SFLRAFKSSNP+SF+S+FV+R+
Sbjct  18   WVLRRVNCWYYE-MKLGEK-RYELPPGDLGWPFIGNMPSFLRAFKSSNPESFVSTFVNRF  75

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YK  MFG+PSIIVTT +ACR+VL+DDE F+PGWP +T+ LIGRKSF+GI  EEHK
Sbjct  76   GHTGLYKVHMFGNPSIIVTTAEACRKVLTDDECFKPGWPSATVNLIGRKSFVGIFDEEHK  135

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
             LRKLTAAPVNGHEAL+ Y+ YIE NV  ALEKWA MG+IEFLT+L
Sbjct  136  WLRKLTAAPVNGHEALTVYMKYIEDNVVTALEKWAGMGQIEFLTEL  181



>ref|XP_011013095.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Populus euphratica]
Length=493

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 147/166 (89%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L +VN W YE  +LG+K+  SLPPGDLGWPFIGNMWSFLRAFKSS+PDSF+ +F+++Y
Sbjct  22   WILKKVNWWLYE-AQLGEKQ-YSLPPGDLGWPFIGNMWSFLRAFKSSDPDSFMRTFINKY  79

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YKAFMFG+PS+ VTTP+ACRRVLS+D+AF+PGWP++T++LIGRKSFIGIS+EEHK
Sbjct  80   GHAGIYKAFMFGNPSVFVTTPEACRRVLSNDDAFKPGWPIATVKLIGRKSFIGISYEEHK  139

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
             LR+LT+APVNGHEALS YI YIE+NV   LEKW +MG IEFLTQ+
Sbjct  140  HLRRLTSAPVNGHEALSAYIPYIEENVIAMLEKWTTMGRIEFLTQM  185



>emb|CDY48265.1| BnaA05g10890D [Brassica napus]
Length=489

 Score =   258 bits (660),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 140/166 (84%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L RVN W YE  KLG+K R  LPPGDLGWPFIGNM  FLRAFK+S+PDSFI ++++RY
Sbjct  23   WLLKRVNVWIYES-KLGEK-RHYLPPGDLGWPFIGNMLPFLRAFKTSDPDSFIRTYITRY  80

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YK  MFG+PS+IVTTP+ CR+VL+DD+ FQPGWP STMELIG+KSFIGISFEEHK
Sbjct  81   GHNGVYKVHMFGNPSVIVTTPETCRKVLTDDDCFQPGWPKSTMELIGKKSFIGISFEEHK  140

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS YI YIE+ V  ALE W+ MGEIEFLT +
Sbjct  141  RLRRLTAAPVNGHEALSVYIKYIEETVVTALENWSKMGEIEFLTHV  186



>ref|XP_006418058.1| hypothetical protein EUTSA_v10009356mg [Eutrema salsugineum]
 gb|ESQ36411.1| hypothetical protein EUTSA_v10009356mg [Eutrema salsugineum]
Length=491

 Score =   258 bits (659),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 139/169 (82%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            S  W++ +VN W YE   LG+  R  LPPGDLGWPFIGNM SFLRAFK+S+PDSF  + V
Sbjct  21   SLKWLVKKVNVWVYES-SLGEN-RHYLPPGDLGWPFIGNMLSFLRAFKTSDPDSFTRTLV  78

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
             RYG  GMYKA MFG+PSIIVTTPD CRRVL+DD+AF+PGWP STMELIGRKSFIGISFE
Sbjct  79   KRYGPKGMYKAHMFGNPSIIVTTPDTCRRVLTDDDAFRPGWPTSTMELIGRKSFIGISFE  138

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EHKRLR+LT+APVNGHEALS YI YIE+NV  AL+KW  +GE EFLT L
Sbjct  139  EHKRLRRLTSAPVNGHEALSVYIPYIEENVITALDKWTKIGEFEFLTHL  187



>ref|XP_009143990.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Brassica rapa]
 ref|XP_009143991.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Brassica rapa]
 ref|XP_009143992.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Brassica rapa]
 ref|XP_009143993.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Brassica rapa]
 ref|XP_009143994.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Brassica rapa]
Length=489

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 140/166 (84%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L RVN W YE  KLG+K R  LPPGDLGWPFIGNM  FLRAFK+S+PDSFI ++++RY
Sbjct  23   WLLKRVNVWIYES-KLGEK-RHYLPPGDLGWPFIGNMLPFLRAFKTSDPDSFIRTYITRY  80

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YK  MFG+PS+IVTTP+ CR+VL+DD+ FQPGWP STMELIG+KSFIGISFEEHK
Sbjct  81   GHNGVYKVHMFGNPSVIVTTPETCRKVLTDDDCFQPGWPKSTMELIGKKSFIGISFEEHK  140

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS YI YIE+ V  ALE W+ MGEIEFLT +
Sbjct  141  RLRRLTAAPVNGHEALSVYIKYIEETVVTALENWSKMGEIEFLTHV  186



>ref|XP_007217930.1| hypothetical protein PRUPE_ppa004910mg [Prunus persica]
 gb|EMJ19129.1| hypothetical protein PRUPE_ppa004910mg [Prunus persica]
Length=486

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L   N WYYE   LG+KK  SLPPGDLGWPFIGNMWSFLRAFKSSNP++F++S VSR+
Sbjct  17   WLLQNANSWYYE-TPLGEKK-YSLPPGDLGWPFIGNMWSFLRAFKSSNPEAFLNSMVSRF  74

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YK FMFGSPSIIVTTP+A ++VL+DDEAF+PGWP+ST ELIG+ SF  ISFEEHK
Sbjct  75   GRTGIYKTFMFGSPSIIVTTPEASKKVLTDDEAFKPGWPISTEELIGKNSFTSISFEEHK  134

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLRKLTAAPVNG+EALS Y  YIE+ V  +LEKW+ MGEIEFLTQL
Sbjct  135  RLRKLTAAPVNGYEALSVYTTYIEERVISSLEKWSKMGEIEFLTQL  180



>ref|XP_002319447.1| ent-kaurenoic acid oxidase family protein [Populus trichocarpa]
 gb|EEE95370.1| ent-kaurenoic acid oxidase family protein [Populus trichocarpa]
Length=490

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L RVN W YE  KLG KK  SLPPGDLGWPFIGNMWSFL AFKSS+PDSFI SFV+RY
Sbjct  22   WILKRVNWWLYE-AKLGAKKD-SLPPGDLGWPFIGNMWSFLTAFKSSDPDSFIRSFVNRY  79

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YKAFMFG+PS++VTTP+ CRR+L+DD AF+PGWP++T++LIG KSFI I +EEHK
Sbjct  80   GHTGIYKAFMFGNPSVLVTTPEGCRRLLTDDNAFKPGWPLATLKLIGEKSFIDIPYEEHK  139

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+A VNGHEALS YI YIEQNV   LEKW +MG+IEFLT++
Sbjct  140  RLRRLTSASVNGHEALSTYIPYIEQNVIAELEKWTTMGQIEFLTKM  185



>ref|XP_008232238.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Prunus mume]
Length=501

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L   N WYYE   LG+KK  SLPPGDLGWPFIGNMWSFLRAFKSSNP++F++S VSR+
Sbjct  32   WLLQNANSWYYE-TPLGEKK-YSLPPGDLGWPFIGNMWSFLRAFKSSNPEAFLNSMVSRF  89

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YK FMFGSPSI+VTTP+A ++VL+DD+AF+PGWPVST ELIG+ SF  ISFEEHK
Sbjct  90   GRTGIYKTFMFGSPSIVVTTPEASKKVLTDDDAFKPGWPVSTEELIGKNSFTSISFEEHK  149

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLRKLTAAPVNG+EALS Y  YIE+ V  +LEKW+ MGEIEFLTQL
Sbjct  150  RLRKLTAAPVNGYEALSVYTTYIEERVISSLEKWSKMGEIEFLTQL  195



>ref|XP_006410376.1| hypothetical protein EUTSA_v10016575mg [Eutrema salsugineum]
 ref|XP_006410377.1| hypothetical protein EUTSA_v10016575mg [Eutrema salsugineum]
 gb|ESQ51829.1| hypothetical protein EUTSA_v10016575mg [Eutrema salsugineum]
 gb|ESQ51830.1| hypothetical protein EUTSA_v10016575mg [Eutrema salsugineum]
Length=489

 Score =   256 bits (653),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 140/166 (84%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL RVN W YE  KLG+KK L LPPGDLGWPFIGNM+SFLRAFK+S+PDSF  S+++RY
Sbjct  23   WVLKRVNVWRYES-KLGEKK-LYLPPGDLGWPFIGNMFSFLRAFKTSDPDSFTRSYITRY  80

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YK  MFG+PS+IVTTP+ CRRVL+DD+ F  GWP STM+LIGRKSFIGISFEEHK
Sbjct  81   GRTGVYKTHMFGNPSVIVTTPETCRRVLTDDDCFTTGWPKSTMKLIGRKSFIGISFEEHK  140

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+ PVNGHEALS YI +IE+ V   LE W+ MGEIEFLTQL
Sbjct  141  RLRRLTSTPVNGHEALSLYIPFIEETVITDLENWSKMGEIEFLTQL  186



>ref|XP_007217929.1| hypothetical protein PRUPE_ppa004901mg [Prunus persica]
 gb|EMJ19128.1| hypothetical protein PRUPE_ppa004901mg [Prunus persica]
Length=486

 Score =   256 bits (653),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L   N WYYE   LG+KK  SLPPGDLGWPFIGNMWSFL+AFKSSNP++F++S VSR+
Sbjct  17   WLLQNANSWYYE-TPLGEKKH-SLPPGDLGWPFIGNMWSFLKAFKSSNPEAFLNSMVSRF  74

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YK FMFGSPSIIVTTP+A ++VL+DD+AF+PGWP+ST ELIG+ SF  ISFEEHK
Sbjct  75   GRTGIYKTFMFGSPSIIVTTPEASKKVLTDDDAFKPGWPISTEELIGKNSFTSISFEEHK  134

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLRKLTAAPVNG+EALS Y  YIE+ V  +LEKW+ MGEIEFLTQL
Sbjct  135  RLRKLTAAPVNGYEALSVYTTYIEERVISSLEKWSKMGEIEFLTQL  180



>ref|XP_011010024.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X2 [Populus 
euphratica]
 ref|XP_011010025.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X2 [Populus 
euphratica]
Length=493

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 147/166 (89%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L +VN W+YE  +LG+K+  SLPPGDLGWPFIGNMWSFLRAFK S+PDSF+ +F+++Y
Sbjct  22   WILKKVNWWWYE-AELGEKQ-YSLPPGDLGWPFIGNMWSFLRAFKFSDPDSFMRTFINKY  79

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YKAFMFG+PSI VTTP+ACR+VLS+D+AF+PGWP+ST++L+GRKSFIGIS+EEHK
Sbjct  80   GHNGIYKAFMFGNPSIFVTTPEACRKVLSNDDAFKPGWPISTLKLVGRKSFIGISYEEHK  139

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
             LR+LT+APVNGHEALS YI YIE+N    LEKW +MG+IEFLTQ+
Sbjct  140  HLRRLTSAPVNGHEALSAYIPYIEENAIAMLEKWTTMGKIEFLTQV  185



>ref|XP_002892270.1| ent-kaurenoic acid hydroxylase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68529.1| ent-kaurenoic acid hydroxylase 1 [Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W++  VN W YE   LG+ ++  LPPGDLGWPFIGNM SFLR+FK+S+PDSF S+ + RY
Sbjct  24   WLVKMVNVWLYES-SLGENRQY-LPPGDLGWPFIGNMLSFLRSFKTSDPDSFTSTLIKRY  81

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YKA MFG+PSIIVTTPD CRRVL+DD+AF+PGWP STMELIGRKSFIGISFEEHK
Sbjct  82   GPKGIYKAHMFGNPSIIVTTPDTCRRVLTDDDAFKPGWPTSTMELIGRKSFIGISFEEHK  141

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS YI YIE+NV   L+KW  MGE EFLT L
Sbjct  142  RLRRLTAAPVNGHEALSTYIPYIEENVITVLDKWTKMGEFEFLTHL  187



>ref|XP_011010022.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X1 [Populus 
euphratica]
Length=532

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 147/166 (89%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L +VN W+YE  +LG+K+  SLPPGDLGWPFIGNMWSFLRAFK S+PDSF+ +F+++Y
Sbjct  22   WILKKVNWWWYE-AELGEKQ-YSLPPGDLGWPFIGNMWSFLRAFKFSDPDSFMRTFINKY  79

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YKAFMFG+PSI VTTP+ACR+VLS+D+AF+PGWP+ST++L+GRKSFIGIS+EEHK
Sbjct  80   GHNGIYKAFMFGNPSIFVTTPEACRKVLSNDDAFKPGWPISTLKLVGRKSFIGISYEEHK  139

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
             LR+LT+APVNGHEALS YI YIE+N    LEKW +MG+IEFLTQ+
Sbjct  140  HLRRLTSAPVNGHEALSAYIPYIEENAIAMLEKWTTMGKIEFLTQV  185



>ref|XP_009376861.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Pyrus x bretschneideri]
Length=503

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 146/169 (86%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            +FWW++   N   YE  +LG++ R SLPPGDLG PFIGNMWSFLRAFKS+NP+SF+  FV
Sbjct  29   AFWWLIKNANRLLYE-TQLGER-RYSLPPGDLGLPFIGNMWSFLRAFKSNNPESFLDKFV  86

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
            SR+G TG+YKAFMFG PSIIVTTP+  +RVL+DD+AF+PGWPVST+ELIG+KSFIGIS+E
Sbjct  87   SRFGKTGIYKAFMFGFPSIIVTTPETSKRVLTDDDAFKPGWPVSTVELIGKKSFIGISYE  146

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EHKRLR+LTAAPVNGHEALS Y+ YIE+ V  +LEKW+ +G+IEFLTQL
Sbjct  147  EHKRLRRLTAAPVNGHEALSVYMKYIEEIVITSLEKWSKLGQIEFLTQL  195



>gb|AGF25266.1| ent-kaurenoic acid oxidase [Pyrus communis]
Length=503

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 146/169 (86%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            +FWW++   N   YE  +LG++ R SLPPGDLG PFIGNMWSFLRAFKS+NP+SF+  FV
Sbjct  29   AFWWLIKNANRLLYE-TQLGER-RYSLPPGDLGLPFIGNMWSFLRAFKSNNPESFLDKFV  86

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
            SR+G TG+YKAFMFG PSIIVTTP+  +RVL+DD+AF+PGWPVST+ELIG+KSFIGIS+E
Sbjct  87   SRFGKTGIYKAFMFGFPSIIVTTPETSKRVLTDDDAFKPGWPVSTVELIGKKSFIGISYE  146

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EHKRLR+LTAAPVNGHEALS Y+ YIE+ V  +LEKW+ +G+IEFLTQL
Sbjct  147  EHKRLRRLTAAPVNGHEALSVYMKYIEEIVITSLEKWSKLGQIEFLTQL  195



>ref|XP_010691953.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Beta vulgaris subsp. 
vulgaris]
Length=488

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 140/165 (85%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL RVN W YE  KLG+K R SLPPGD G PF+GNMWSFLRAFKSSNPDSF++SFVSR+G
Sbjct  23   VLRRVNIWVYES-KLGEK-RHSLPPGDFGLPFVGNMWSFLRAFKSSNPDSFLNSFVSRFG  80

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             TG+YKAFMFGSPSIIVTTP+ CR+VL+DDE F+PGWP+ST ELIGRKSF+ I +EEHKR
Sbjct  81   KTGLYKAFMFGSPSIIVTTPEMCRKVLNDDEHFKPGWPLSTTELIGRKSFVAIPYEEHKR  140

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LR+LT+ P+NGHEALS YI+YIE   K  L K + MGEIEFLTQL
Sbjct  141  LRRLTSTPINGHEALSNYIEYIEDISKTTLHKMSIMGEIEFLTQL  185



>gb|KFK31124.1| hypothetical protein AALP_AA6G071000 [Arabis alpina]
Length=492

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL RVN W YE  KLG++ +  LPPGDLGWPFIGNMWSFLRAFK+S+PDSF+ ++ +RY
Sbjct  23   WVLKRVNVWIYES-KLGEEIQEYLPPGDLGWPFIGNMWSFLRAFKTSDPDSFLRTYTTRY  81

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+Y+A MFG+PS+IVTTP+ CRRVL+DD++FQ GWP STMELIGRKSFIGIS+EEHK
Sbjct  82   GHNGVYRAHMFGNPSVIVTTPETCRRVLTDDDSFQTGWPKSTMELIGRKSFIGISYEEHK  141

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+APVNG EALS YI YIE+    ALEKW+ MGEIEFL+ +
Sbjct  142  RLRRLTSAPVNGPEALSAYIPYIEEACTTALEKWSKMGEIEFLSHV  187



>ref|XP_007008706.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
1 [Theobroma cacao]
 gb|EOY17516.1| Cytochrome P450, family 88, subfamily A, polypeptide 3 isoform 
1 [Theobroma cacao]
Length=496

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 146/170 (86%), Gaps = 2/170 (1%)
 Frame = +1

Query  124  SSFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSF  303
            +S  WVL RVN W YE  +LGD +  SLPPGDLGWPF+G+MWSFLRAFKS + DSFI SF
Sbjct  18   ASVKWVLERVNWWLYES-QLGDMQ-YSLPPGDLGWPFVGDMWSFLRAFKSDDRDSFIRSF  75

Query  304  VSRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISF  483
            VSR+G  G+YKAFMFGSPS+IVTTP+ C+RVL+DD+AF+PGWP +T+ELIG+KSFIGIS+
Sbjct  76   VSRFGHIGIYKAFMFGSPSVIVTTPETCKRVLNDDDAFKPGWPTATVELIGKKSFIGISY  135

Query  484  EEHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            E+HKRLR+LTAA VNGHEALS YI YIE+NV  AL+KW+ MG+I FL++L
Sbjct  136  EQHKRLRRLTAASVNGHEALSMYIQYIEENVISALDKWSKMGDIVFLSEL  185



>ref|XP_009347589.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Pyrus x bretschneideri]
Length=503

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 145/169 (86%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            +FWW++   N   YE  +LG++ R SLPPGDLG PFIGNMWSFLRAFKS+NP+SF+  FV
Sbjct  29   AFWWLIKNANRLLYE-TQLGER-RYSLPPGDLGLPFIGNMWSFLRAFKSNNPESFLDKFV  86

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
            SR+G TG+YKAFMFG PSIIVTTP+  +RVL+DD+AF+PGWPVST+ELIG+KSFIGIS+E
Sbjct  87   SRFGKTGIYKAFMFGFPSIIVTTPETSKRVLTDDDAFKPGWPVSTVELIGKKSFIGISYE  146

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EHKRLR+LTAAPVNGHEALS Y+ YIE+ V  +LEKW+ +G IEFLTQL
Sbjct  147  EHKRLRRLTAAPVNGHEALSVYMKYIEEIVITSLEKWSKLGHIEFLTQL  195



>emb|CDY49505.1| BnaC05g03170D [Brassica napus]
Length=490

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 137/169 (81%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            S  W+  +VN W YE   LG+ K   LPPGDLGWPFIGNM SFLRAFK+S+PDSF  + V
Sbjct  21   SLKWLAKKVNVWLYES-SLGENKHY-LPPGDLGWPFIGNMPSFLRAFKTSDPDSFARTLV  78

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
             RYG  G+YK  MFG+PSIIVTTPD CRRVL+DD+AF+PGWP STMELIGRKSFIGI +E
Sbjct  79   QRYGPKGVYKTHMFGNPSIIVTTPDTCRRVLTDDDAFRPGWPTSTMELIGRKSFIGIPYE  138

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EHKRLR+LTAAPVNGHEALS YI YIE+NV  AL+KW+ MGE EFLT L
Sbjct  139  EHKRLRRLTAAPVNGHEALSLYIPYIEENVITALDKWSKMGEFEFLTHL  187



>ref|XP_007008707.1| Ent-kaurenoic acid oxidase 1 isoform 2 [Theobroma cacao]
 gb|EOY17517.1| Ent-kaurenoic acid oxidase 1 isoform 2 [Theobroma cacao]
Length=539

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 146/170 (86%), Gaps = 2/170 (1%)
 Frame = +1

Query  124  SSFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSF  303
            +S  WVL RVN W YE  +LGD +  SLPPGDLGWPF+G+MWSFLRAFKS + DSFI SF
Sbjct  61   ASVKWVLERVNWWLYES-QLGDMQ-YSLPPGDLGWPFVGDMWSFLRAFKSDDRDSFIRSF  118

Query  304  VSRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISF  483
            VSR+G  G+YKAFMFGSPS+IVTTP+ C+RVL+DD+AF+PGWP +T+ELIG+KSFIGIS+
Sbjct  119  VSRFGHIGIYKAFMFGSPSVIVTTPETCKRVLNDDDAFKPGWPTATVELIGKKSFIGISY  178

Query  484  EEHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            E+HKRLR+LTAA VNGHEALS YI YIE+NV  AL+KW+ MG+I FL++L
Sbjct  179  EQHKRLRRLTAASVNGHEALSMYIQYIEENVISALDKWSKMGDIVFLSEL  228



>gb|AGI65630.1| ent-kaurenoic acid oxidase [Malus domestica]
Length=503

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 146/169 (86%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            +FWW++   N   YE  +LG+++  SLPPGDLG PFIGNMWSFLRAFKS+NP+SF+  FV
Sbjct  29   AFWWLIKNANRLLYE-TQLGERQ-YSLPPGDLGLPFIGNMWSFLRAFKSNNPESFLDKFV  86

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
            SR+G TG+YKAFMFG PSIIVTTP+  +RVL+DD+AF+PGWPVST+ELIG+KSFIGIS+E
Sbjct  87   SRFGKTGIYKAFMFGFPSIIVTTPETSKRVLTDDDAFKPGWPVSTVELIGKKSFIGISYE  146

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EHKRLR+LTAAPVNGHEALS Y+ YIE+ V  +LEKW+ +G+IEFLTQL
Sbjct  147  EHKRLRRLTAAPVNGHEALSVYMKYIEEIVITSLEKWSKLGQIEFLTQL  195



>gb|AGZ93669.1| ent-kaurene acid oxidase [Malus domestica]
Length=503

 Score =   254 bits (648),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 146/169 (86%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            +FWW++   N   YE  +LG+++  SLPPGDLG PFIGNMWSFLRAFKS+NP+SF+  FV
Sbjct  29   AFWWLIKNANRLLYE-TQLGERQ-YSLPPGDLGLPFIGNMWSFLRAFKSNNPESFLDKFV  86

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
            SR+G TG+YKAFMFG PSIIVTTP+  +RVL+DD+AF+PGWPVST+ELIG+KSFIGIS+E
Sbjct  87   SRFGKTGIYKAFMFGFPSIIVTTPETSKRVLTDDDAFKPGWPVSTVELIGKKSFIGISYE  146

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EHKRLR+LTAAPVNGHEALS Y+ YIE+ V  +LEKW+ +G+IEFLTQL
Sbjct  147  EHKRLRRLTAAPVNGHEALSVYMKYIEEIVITSLEKWSKLGQIEFLTQL  195



>ref|XP_009119194.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Brassica rapa]
 ref|XP_009119195.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Brassica rapa]
 ref|XP_009119196.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Brassica rapa]
 emb|CDY46834.1| BnaA10g03180D [Brassica napus]
Length=490

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 137/169 (81%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            S  W+  +VN W YE   LG+ K   LPPGD+GWPFIGNM SFLRAFK+S+PDSF  + V
Sbjct  21   SLKWLAKKVNVWLYES-SLGENKHY-LPPGDMGWPFIGNMPSFLRAFKTSDPDSFARTLV  78

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
             RYG  G+YK  MFG+PSIIVTTPD CRRVL+DD+AF+PGWP STMELIGRKSFIGI +E
Sbjct  79   KRYGPKGVYKTHMFGNPSIIVTTPDTCRRVLTDDDAFRPGWPTSTMELIGRKSFIGIPYE  138

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EHKRLR+LTAAPVNGHEALS YI YIE+NV  AL+KW+ MGE EFLT L
Sbjct  139  EHKRLRRLTAAPVNGHEALSLYIPYIEENVITALDKWSKMGEFEFLTHL  187



>emb|CBV36749.1| ent-kaurenoic acid oxidase [Helianthus annuus]
 emb|CBV36751.1| ent-kaurenoic acid oxidase [Helianthus annuus]
Length=481

 Score =   253 bits (646),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 137/166 (83%), Gaps = 1/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W L  +N W  ER  L + KR  LPPGD+GWP IGNMW+FLRAFKSSNPDSFISSFV R+
Sbjct  25   WGLKCLNTWINER-DLEESKRARLPPGDMGWPLIGNMWTFLRAFKSSNPDSFISSFVDRF  83

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G+ GMYK+FMFG PSIIVT P+ACRRVL +D+AF+PGWP +T ELIGRKSF+ IS+E+HK
Sbjct  84   GSGGMYKSFMFGKPSIIVTVPEACRRVLFEDDAFKPGWPTATRELIGRKSFVSISYEDHK  143

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLRKLTAAPVNGHEALS Y+ YIE  V  ALEKW+ MG+IE LTQL
Sbjct  144  RLRKLTAAPVNGHEALSIYMQYIESKVVSALEKWSQMGQIEVLTQL  189



>ref|XP_008232229.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Prunus mume]
Length=501

 Score =   253 bits (647),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 140/166 (84%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W L   N WYYE   LG+KK  SLPPGDLGWPFIGNMWSFLRAFKSS P++F++S VSR+
Sbjct  32   WFLQNANSWYYE-TPLGEKK-FSLPPGDLGWPFIGNMWSFLRAFKSSKPEAFLNSMVSRF  89

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YK FMFGSPSIIVTTP+A ++VL+DD+AF+PGWPVST ELIG+ SF  ISFEEHK
Sbjct  90   GRTGIYKTFMFGSPSIIVTTPEASKKVLTDDDAFKPGWPVSTEELIGKNSFTSISFEEHK  149

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLRKLTAAPVNG+EALS Y  YIE+ V  +LEKW+ MGEIEFLTQL
Sbjct  150  RLRKLTAAPVNGYEALSVYTTYIEERVISSLEKWSKMGEIEFLTQL  195



>ref|XP_007219847.1| hypothetical protein PRUPE_ppa027023mg [Prunus persica]
 gb|EMJ21046.1| hypothetical protein PRUPE_ppa027023mg [Prunus persica]
Length=486

 Score =   253 bits (646),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 141/166 (85%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L   N WYYE   LG+KK  SLPPGDL WPFIGNMWSFLRAFKSSNP++F++S VSR+
Sbjct  17   WLLQSANSWYYE-TPLGEKK-YSLPPGDLSWPFIGNMWSFLRAFKSSNPEAFLNSMVSRF  74

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YK FMFGSPSI+VTTP+A ++VL+DD+AF+PGWP+ST ELIG+ SF  ISFEEHK
Sbjct  75   GRTGIYKTFMFGSPSIVVTTPEASKKVLTDDDAFKPGWPISTEELIGKNSFTSISFEEHK  134

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLRKLTAAPVNG+EALS Y  YIE+ V  +LEKW+ MGEIEFLTQL
Sbjct  135  RLRKLTAAPVNGYEALSVYTTYIEERVISSLEKWSKMGEIEFLTQL  180



>dbj|BAD93885.1| putative cytochrome P450 [Arabidopsis thaliana]
 dbj|BAF02086.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=406

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL RVN W Y   KLG+KK   LPPGDLGWP IGNMWSFLRAFK+S+P+SFI S+++RY
Sbjct  23   WVLKRVNVWIYVS-KLGEKKHY-LPPGDLGWPVIGNMWSFLRAFKTSDPESFIQSYITRY  80

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YKA MFG P ++VTTP+ CRRVL+DD+AF  GWP STM+LIGRKSF+GISFEEHK
Sbjct  81   GRTGIYKAHMFGYPCVLVTTPETCRRVLTDDDAFHIGWPKSTMKLIGRKSFVGISFEEHK  140

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+APVNG EALS YI +IE+ V   LEKW+ MGEIEFL+ L
Sbjct  141  RLRRLTSAPVNGPEALSVYIQFIEETVNTDLEKWSKMGEIEFLSHL  186



>gb|AJD25209.1| cytochrome P450 CYP88A52 [Salvia miltiorrhiza]
Length=487

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 139/166 (84%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL RVN W YER KLG++ R  LPPGDLGWPFIGNMWSFLRAFK S P+SFISSFV RY
Sbjct  18   WVLRRVNGWCYER-KLGER-RYELPPGDLGWPFIGNMWSFLRAFKCSRPESFISSFVDRY  75

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  GMYK  MFG+PSIIVTT +ACR+VL+DDEAF+PGWP STM LIG+ SF+ IS EEH+
Sbjct  76   GHGGMYKVHMFGNPSIIVTTAEACRKVLTDDEAFKPGWPSSTMNLIGKNSFVAISDEEHR  135

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
             LRKLTAAPVNGHE LS Y+ YIE NV +ALE+WA MG++EFLT+L
Sbjct  136  WLRKLTAAPVNGHEVLSLYMKYIEDNVIVALERWAGMGKMEFLTEL  181



>emb|CBV36747.1| ent-kaurenoic acid oxidase [Helianthus annuus]
 emb|CBV36750.1| ent-kaurenoic acid oxidase [Helianthus annuus]
Length=492

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 137/166 (83%), Gaps = 1/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W L  +N W  ER  L + KR  LPPGD+GWP IGNMW+FLRAFKSSNPDSFISSFV R+
Sbjct  25   WGLKCLNTWINER-DLEESKRARLPPGDMGWPLIGNMWTFLRAFKSSNPDSFISSFVDRF  83

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G+ GMYK+FMFG PSIIVT P+ACRRVL +D+AF+PGWP +T ELIGRKSF+ IS+E+HK
Sbjct  84   GSGGMYKSFMFGKPSIIVTVPEACRRVLFEDDAFKPGWPTATRELIGRKSFVSISYEDHK  143

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLRKLTAAPVNGHEALS Y+ YIE  V  ALEKW+ MG+IE LTQL
Sbjct  144  RLRKLTAAPVNGHEALSIYMQYIESKVVSALEKWSQMGQIEVLTQL  189



>ref|XP_008354800.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Malus domestica]
Length=503

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 146/169 (86%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            +FWW++   N   YE  +LG+++  SLPPGDLG PFIGNMWSFLRAFKS+NP++F+  FV
Sbjct  29   AFWWLIKNANRLLYE-TQLGERQ-YSLPPGDLGLPFIGNMWSFLRAFKSNNPEAFLDKFV  86

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
            SR+G TG+YKAFMFG PSIIVTTP+  +RVL+DD+AF+PGWPVST+ELIG+KSFIGIS+E
Sbjct  87   SRFGKTGIYKAFMFGFPSIIVTTPETSKRVLTDDDAFKPGWPVSTVELIGKKSFIGISYE  146

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EHKRLR+LTAAPVNGHEALS Y+ YIE+ V  +LEKW+ +G+IEFLTQL
Sbjct  147  EHKRLRRLTAAPVNGHEALSVYMKYIEEIVITSLEKWSKLGQIEFLTQL  195



>gb|AAK11564.1|AF318500_1 ent-kaurenoic acid hydroxylase [Arabidopsis thaliana]
Length=490

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 136/166 (82%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W++ +VN W YE   LG+  R  LPPGDLGWPFIGNM SFLRAFK+S+PDSF  + + RY
Sbjct  24   WLVRKVNVWLYES-SLGEN-RHYLPPGDLGWPFIGNMLSFLRAFKTSDPDSFTRTLIKRY  81

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YKA MFG+PSIIVTT D CRRVL+DD+AF+PGWP STMELIGRKSF+GISFEEHK
Sbjct  82   GPKGIYKAHMFGNPSIIVTTSDTCRRVLTDDDAFKPGWPTSTMELIGRKSFVGISFEEHK  141

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS YI YIE+NV   L+KW  MGE EFLT L
Sbjct  142  RLRRLTAAPVNGHEALSTYIPYIEENVITVLDKWTKMGEFEFLTHL  187



>ref|NP_172008.1| ent-kaurenoic acid oxidase 1 [Arabidopsis thaliana]
 sp|O23051.1|KAO1_ARATH RecName: Full=Ent-kaurenoic acid oxidase 1; Short=AtKAO1; AltName: 
Full=Cytochrome P450 88A3 [Arabidopsis thaliana]
 gb|AAB71462.1| Similar to Zea DWARF3 (gb|U32579) [Arabidopsis thaliana]
 dbj|BAF00896.1| cytochrome P450 like protein [Arabidopsis thaliana]
 gb|ABJ17104.1| At1g05160 [Arabidopsis thaliana]
 gb|AEE27796.1| Ent-kaurenoic acid oxidase 1 [Arabidopsis thaliana]
Length=490

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 136/166 (82%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W++ +VN W YE   LG+  R  LPPGDLGWPFIGNM SFLRAFK+S+PDSF  + + RY
Sbjct  24   WLVRKVNVWLYES-SLGEN-RHYLPPGDLGWPFIGNMLSFLRAFKTSDPDSFTRTLIKRY  81

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YKA MFG+PSIIVTT D CRRVL+DD+AF+PGWP STMELIGRKSF+GISFEEHK
Sbjct  82   GPKGIYKAHMFGNPSIIVTTSDTCRRVLTDDDAFKPGWPTSTMELIGRKSFVGISFEEHK  141

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS YI YIE+NV   L+KW  MGE EFLT L
Sbjct  142  RLRRLTAAPVNGHEALSTYIPYIEENVITVLDKWTKMGEFEFLTHL  187



>emb|CBV36748.1| ent-kaurenoic acid oxidase [Helianthus annuus]
Length=489

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 137/166 (83%), Gaps = 1/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W L  +N W YER KLG KKR SLPPGDLGWPFIGNMWSFLRAFKS +PDSFIS+F+ RY
Sbjct  21   WGLKNMNAWIYER-KLGKKKRESLPPGDLGWPFIGNMWSFLRAFKSGDPDSFISAFLHRY  79

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YK+ MFGSPSIIVT P+  R+VL DD++F+ GWP ST+E+ GRKSFIGIS+EEHK
Sbjct  80   GPNGIYKSMMFGSPSIIVTVPEVVRKVLLDDDSFKHGWPNSTIEIAGRKSFIGISYEEHK  139

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT  P+NGHEALS YI YIE NV  ALEKW+ MG IEFLT+L
Sbjct  140  RLRRLTKTPINGHEALSIYIPYIETNVVSALEKWSKMGRIEFLTEL  185



>ref|XP_006294074.1| hypothetical protein CARUB_v10023069mg [Capsella rubella]
 ref|XP_006294075.1| hypothetical protein CARUB_v10023069mg [Capsella rubella]
 gb|EOA26972.1| hypothetical protein CARUB_v10023069mg [Capsella rubella]
 gb|EOA26973.1| hypothetical protein CARUB_v10023069mg [Capsella rubella]
Length=498

 Score =   251 bits (640),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 139/166 (84%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL RVN W YE  KLG++K   LPPGDLGWP IGNMWSFLRAFK+S+P+SFI S+ +RY
Sbjct  32   WVLKRVNVWIYE-CKLGEEKHY-LPPGDLGWPVIGNMWSFLRAFKTSDPESFIRSYNTRY  89

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YKA MFG P +IVTTP+ CRRVL+DD+AFQ GWP STM+LIGRKSFIGIS+EEHK
Sbjct  90   GRTGIYKAHMFGYPCVIVTTPETCRRVLTDDDAFQIGWPKSTMKLIGRKSFIGISYEEHK  149

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+APVNG EALS YI YIE+ V   LEKW+ MGEIEFL+ L
Sbjct  150  RLRRLTSAPVNGPEALSVYIQYIEETVITDLEKWSKMGEIEFLSHL  195



>ref|XP_011093453.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Sesamum indicum]
Length=486

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 141/166 (85%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL  +NCWYYER KLG++ R  LPPGDLGWPFIGNMWSFLRAFKS   +SFISSFVSR+
Sbjct  19   WVLRSLNCWYYER-KLGER-RYDLPPGDLGWPFIGNMWSFLRAFKSRKSESFISSFVSRF  76

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YK  MFG+PSIIVTT +ACR+VLSDDE+F+PGWP ST+ LIG+KSF+GI  EEHK
Sbjct  77   GHTGLYKVHMFGNPSIIVTTAEACRKVLSDDESFKPGWPSSTVNLIGKKSFLGIFDEEHK  136

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
             LRKLTAAPVNG EALS Y+ YIE++V  ALEKWA M +IEFLT+L
Sbjct  137  WLRKLTAAPVNGQEALSIYLKYIEESVIEALEKWAGMEQIEFLTEL  182



>ref|XP_006307341.1| hypothetical protein CARUB_v10008960mg [Capsella rubella]
 gb|EOA40239.1| hypothetical protein CARUB_v10008960mg [Capsella rubella]
Length=492

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 135/166 (81%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W++  VN W +E   LG   R  LPPGDLGWPFIGNM SFLRAFK+S+PDSF  +   RY
Sbjct  24   WLVKMVNVWLHE-FSLG-VNRQYLPPGDLGWPFIGNMLSFLRAFKTSDPDSFTRTLTKRY  81

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YKA +FG+PSIIVTTPD CRRVL+DD+AF+PGWP STMELIG+KSFIGISFEEHK
Sbjct  82   GPKGIYKAHVFGNPSIIVTTPDTCRRVLTDDDAFKPGWPTSTMELIGKKSFIGISFEEHK  141

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS YI YIE+NV  ALEKW  MGE EFLT L
Sbjct  142  RLRRLTAAPVNGHEALSNYIPYIEENVITALEKWTKMGEFEFLTHL  187



>ref|XP_010475187.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Camelina sativa]
 ref|XP_010475188.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Camelina sativa]
Length=490

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 135/166 (81%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W++  VN W YE   +G+     LPPGDLGWPFIGNM SFLRAFK+S+PDSF  + + RY
Sbjct  24   WLIKMVNVWLYE-FSIGENM-YYLPPGDLGWPFIGNMLSFLRAFKTSDPDSFTRTLIKRY  81

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YK  MFG+PSIIVTTPD CRRVL+DD+AF+PGWP STMELIG+KSFIGISFEEHK
Sbjct  82   GPKGIYKVHMFGNPSIIVTTPDTCRRVLTDDDAFKPGWPTSTMELIGKKSFIGISFEEHK  141

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS YI YIE+NV  AL+KW  MGE EFLT L
Sbjct  142  RLRRLTAAPVNGHEALSNYIPYIEENVITALDKWTKMGEFEFLTHL  187



>ref|XP_010457591.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010457592.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X1 [Camelina 
sativa]
Length=490

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 136/166 (82%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W++  VN W YE   +G+     LPPG+LGWPFIGNM SFLRAFK+S+PDSF  + + RY
Sbjct  24   WLIKMVNVWLYE-FSIGENM-YYLPPGNLGWPFIGNMLSFLRAFKTSDPDSFTRTLIKRY  81

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YKA MFG+PSIIVTTPD CRRVL+DD+AF+PGWP STMELIG+KSFIGISFEEHK
Sbjct  82   GPKGIYKAHMFGNPSIIVTTPDTCRRVLTDDDAFKPGWPTSTMELIGKKSFIGISFEEHK  141

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS YI YIE+NV  AL+KW  MGE EFLT L
Sbjct  142  RLRRLTAAPVNGHEALSNYIPYIEENVITALDKWTKMGEFEFLTHL  187



>ref|XP_010457593.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X2 [Camelina 
sativa]
Length=489

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 136/166 (82%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W++  VN W YE   +G+     LPPG+LGWPFIGNM SFLRAFK+S+PDSF  + + RY
Sbjct  24   WLIKMVNVWLYE-FSIGENM-YYLPPGNLGWPFIGNMLSFLRAFKTSDPDSFTRTLIKRY  81

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YKA MFG+PSIIVTTPD CRRVL+DD+AF+PGWP STMELIG+KSFIGISFEEHK
Sbjct  82   GPKGIYKAHMFGNPSIIVTTPDTCRRVLTDDDAFKPGWPTSTMELIGKKSFIGISFEEHK  141

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS YI YIE+NV  AL+KW  MGE EFLT L
Sbjct  142  RLRRLTAAPVNGHEALSNYIPYIEENVITALDKWTKMGEFEFLTHL  187



>ref|XP_010269971.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Nelumbo nucifera]
Length=495

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 141/169 (83%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            + + +L R N W+YER +LG+K RLSLPPGDLG P IGNMWSFLRA+KS +PDSFIS+F+
Sbjct  22   ALYILLKRANAWFYER-RLGEK-RLSLPPGDLGLPLIGNMWSFLRAYKSGDPDSFISTFL  79

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
             RYG TG+YKAFMFGSPSI+VT P++CR+VL DDE F PGWP +T +LIGRKSFIGIS E
Sbjct  80   QRYGRTGVYKAFMFGSPSIMVTLPESCRQVLMDDETFGPGWPKATCDLIGRKSFIGISDE  139

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EH+RLR+LTAAPVNG EALS Y+ YIE  VK ALEKWA M  IEFLT+L
Sbjct  140  EHRRLRRLTAAPVNGQEALSVYLGYIEDCVKSALEKWAGMETIEFLTEL  188



>gb|AEF32085.1| ent-kaurenoic acid oxidase [Castanea mollissima]
Length=492

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = +1

Query  154  NCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMY  333
            N W YE  +LG+K+  SLPPGDLGWPFIGNMWSFL AFKS +PDSF+SSFVSR+G TG+Y
Sbjct  28   NWWLYE-TQLGEKQ-YSLPPGDLGWPFIGNMWSFLSAFKSKDPDSFVSSFVSRFGRTGIY  85

Query  334  KAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLT  513
            K FMFG+PS+IVT+P+ACRRVLSDD+ F+PGWP ST+ LIG+KSFIGISFEEHKRLR+LT
Sbjct  86   KVFMFGNPSVIVTSPEACRRVLSDDDCFKPGWPKSTVALIGKKSFIGISFEEHKRLRRLT  145

Query  514  AAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            AAPVNG+EALS Y  YIE+ V  +L+KW +MGEIEFLT+L
Sbjct  146  AAPVNGYEALSMYTKYIEEIVTSSLDKWTTMGEIEFLTEL  185



>gb|EYU42301.1| hypothetical protein MIMGU_mgv1a005890mg [Erythranthe guttata]
Length=466

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = +1

Query  151  VNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGM  330
            VN W+ ER KLG++ R  LPPGD GWPFIGNMWSFLRAFKS+NPDSF+S F+ R+G TGM
Sbjct  4    VNSWWCER-KLGER-RYELPPGDFGWPFIGNMWSFLRAFKSTNPDSFLSDFIHRFGHTGM  61

Query  331  YKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKL  510
            YK  MFG+PSIIVTT +ACR+VL+DDEAF+PGWP ST+ LIG+KSF+GIS EEHK LRKL
Sbjct  62   YKVHMFGNPSIIVTTAEACRKVLTDDEAFKPGWPTSTVNLIGKKSFVGISDEEHKWLRKL  121

Query  511  TAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            T+APVNG+EALS Y+ YIE NV  ALEKW+ MGEIEFLT+L
Sbjct  122  TSAPVNGNEALSVYMKYIEDNVVTALEKWSEMGEIEFLTEL  162



>gb|AAK11565.1|AF318501_1 ent-kaurenoic acid hydroxylase [Arabidopsis thaliana]
Length=489

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL RVN W Y   KLG+KK   LPPGDLGWP IGNMWSFLRAFK+S+P+SFI S+++RY
Sbjct  23   WVLKRVNVWIYVS-KLGEKKHY-LPPGDLGWPVIGNMWSFLRAFKTSDPESFIQSYITRY  80

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YKA MFG P ++VTTP+ CRRVL+DD+AF  GWP STM+LIGRKSF+GISFEEHK
Sbjct  81   GRTGIYKAHMFGYPCVLVTTPETCRRVLTDDDAFHIGWPKSTMKLIGRKSFVGISFEEHK  140

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+APVNG EALS YI +IE+ V   LEKW+ MGEIEFL+ L
Sbjct  141  RLRRLTSAPVNGPEALSVYIQFIEETVNTDLEKWSKMGEIEFLSHL  186



>ref|NP_180803.1| Ent-kaurenoic acid oxidase 2 [Arabidopsis thaliana]
 ref|NP_001189657.1| Ent-kaurenoic acid oxidase 2 [Arabidopsis thaliana]
 sp|Q9C5Y2.2|KAO2_ARATH RecName: Full=Ent-kaurenoic acid oxidase 2; Short=AtKAO2; AltName: 
Full=Cytochrome P450 88A4 [Arabidopsis thaliana]
 gb|AAC69934.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|ABJ17103.1| At2g32440 [Arabidopsis thaliana]
 gb|AEC08685.1| Ent-kaurenoic acid oxidase 2 [Arabidopsis thaliana]
 gb|AEC08686.1| Ent-kaurenoic acid oxidase 2 [Arabidopsis thaliana]
Length=489

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL RVN W Y   KLG+KK   LPPGDLGWP IGNMWSFLRAFK+S+P+SFI S+++RY
Sbjct  23   WVLKRVNVWIYVS-KLGEKKHY-LPPGDLGWPVIGNMWSFLRAFKTSDPESFIQSYITRY  80

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YKA MFG P ++VTTP+ CRRVL+DD+AF  GWP STM+LIGRKSF+GISFEEHK
Sbjct  81   GRTGIYKAHMFGYPCVLVTTPETCRRVLTDDDAFHIGWPKSTMKLIGRKSFVGISFEEHK  140

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+APVNG EALS YI +IE+ V   LEKW+ MGEIEFL+ L
Sbjct  141  RLRRLTSAPVNGPEALSVYIQFIEETVNTDLEKWSKMGEIEFLSHL  186



>ref|XP_002879389.1| ent-kaurenoic acid hydroxylase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55648.1| ent-kaurenoic acid hydroxylase [Arabidopsis lyrata subsp. lyrata]
Length=489

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL  VN W YE  KLG+KK   LPPGDLGWP IGNMWSFLRAFK+S+P+SFI S+++RY
Sbjct  23   WVLKSVNVWIYES-KLGEKKHY-LPPGDLGWPIIGNMWSFLRAFKTSDPESFIQSYITRY  80

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YKA MFG P ++VTTP+ CRRVL+DD+AF  GWP STM+LIGRKSF+GISFEEHK
Sbjct  81   GRTGIYKAHMFGYPCVLVTTPETCRRVLTDDDAFHIGWPKSTMKLIGRKSFVGISFEEHK  140

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+APVNG EALS YI +IE+ V   LEKW+ MGEIEFL+ L
Sbjct  141  RLRRLTSAPVNGPEALSVYIQFIEETVITDLEKWSKMGEIEFLSHL  186



>gb|KEH37117.1| cytochrome P450 family ent-kaurenoic acid oxidase [Medicago truncatula]
Length=455

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 143/165 (87%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN W YE  KLG  K+ SLPPGD+GWPFIGNMWSFLRAFKS +PDSFISSFVSRYG
Sbjct  21   ILKNVNWWLYES-KLG-VKQYSLPPGDMGWPFIGNMWSFLRAFKSKDPDSFISSFVSRYG  78

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
            +TG+YKA MFG+PS+IVTTP+AC+RVLSDDE F PGWP ST+ELIG+ SFI ++++EHKR
Sbjct  79   STGIYKALMFGNPSVIVTTPEACKRVLSDDEKFTPGWPRSTIELIGKNSFIAMAYDEHKR  138

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LR+LT++ +NG EALS Y+ YIE+NV  +LEKW++MG+IEFLT++
Sbjct  139  LRRLTSSSINGMEALSLYLTYIEENVISSLEKWSNMGQIEFLTEI  183



>ref|XP_010413993.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Camelina sativa]
 ref|XP_010413994.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Camelina sativa]
Length=492

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 139/166 (84%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL RVN W YE  KLG+KK   LPPGDLGWP IGNMWSFLRAFK+S+P+SFI S+ +RY
Sbjct  26   WVLKRVNVWIYES-KLGEKKHY-LPPGDLGWPVIGNMWSFLRAFKTSDPESFIRSYNTRY  83

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YKA MFG P ++VTTP+ CRRVL+DD+AF  GWP STM+LIGR+SFIGISFEEHK
Sbjct  84   GRTGIYKAHMFGYPCVLVTTPETCRRVLTDDDAFHIGWPKSTMKLIGRRSFIGISFEEHK  143

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+APVNG EALS YI +IE+ V   LEKW++MGEIEFL+ +
Sbjct  144  RLRRLTSAPVNGTEALSVYIQFIEETVITDLEKWSNMGEIEFLSHV  189



>ref|XP_004308741.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Fragaria vesca 
subsp. vesca]
Length=493

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 140/166 (84%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L  VN W YE   LG KK   LPPGDLG PFIGNMWSFL+A+KSS+P+SFI SFVSR+
Sbjct  25   WLLMNVNRWLYE-TPLGVKKH-CLPPGDLGLPFIGNMWSFLKAYKSSDPESFIDSFVSRF  82

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YKAFMFGSPS+I T P+ C+RVL+DD+AFQPGWP +T+ELIG+KSF+ I FEEHK
Sbjct  83   GKTGIYKAFMFGSPSVICTAPETCKRVLTDDDAFQPGWPAATVELIGKKSFVSIPFEEHK  142

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAP+NGHEALS YI YIE+ V  +LEK A+MG++EFLTQL
Sbjct  143  RLRRLTAAPINGHEALSMYIPYIEEIVISSLEKLATMGQMEFLTQL  188



>gb|KEH37116.1| cytochrome P450 family ent-kaurenoic acid oxidase [Medicago truncatula]
Length=491

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 143/165 (87%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN W YE  KLG  K+ SLPPGD+GWPFIGNMWSFLRAFKS +PDSFISSFVSRYG
Sbjct  25   ILKNVNWWLYES-KLG-VKQYSLPPGDMGWPFIGNMWSFLRAFKSKDPDSFISSFVSRYG  82

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
            +TG+YKA MFG+PS+IVTTP+AC+RVLSDDE F PGWP ST+ELIG+ SFI ++++EHKR
Sbjct  83   STGIYKALMFGNPSVIVTTPEACKRVLSDDEKFTPGWPRSTIELIGKNSFIAMAYDEHKR  142

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LR+LT++ +NG EALS Y+ YIE+NV  +LEKW++MG+IEFLT++
Sbjct  143  LRRLTSSSINGMEALSLYLTYIEENVISSLEKWSNMGQIEFLTEI  187



>ref|XP_010691952.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=488

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 138/165 (84%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL RVN W YE  KLG  KR +LPPGDLG P IGNMWSFLRAFKS NPDSFI+SF  R+G
Sbjct  23   VLKRVNIWLYES-KLG-VKRHNLPPGDLGLPLIGNMWSFLRAFKSDNPDSFINSFFIRFG  80

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             TG+YKAFMFGSPSIIVTT + CR+VL+DDE F+PGWP+ST ELIGRKSF+ IS+E+HKR
Sbjct  81   KTGIYKAFMFGSPSIIVTTAETCRKVLNDDEHFKPGWPLSTAELIGRKSFVSISYEDHKR  140

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LRK+T+AP+NGHEAL+ YI+YIE  V   L+KW+ MGEIEFLT L
Sbjct  141  LRKITSAPINGHEALTKYIEYIEDIVITDLDKWSRMGEIEFLTHL  185



>ref|XP_010469584.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Camelina sativa]
 ref|XP_010469585.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Camelina sativa]
Length=489

 Score =   246 bits (627),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL  VN W YE  KLG+KK   LPPGDLGWP IGNMWSFLRAFK+S+P+SFI S+ +RY
Sbjct  23   WVLKGVNVWIYES-KLGEKKHY-LPPGDLGWPVIGNMWSFLRAFKTSDPESFIRSYNTRY  80

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YKA MFG P ++VTTP+ CRRVL+DD+AF  GWP STM+LIGR+SFIGISFEEHK
Sbjct  81   GRTGIYKAHMFGYPCVLVTTPETCRRVLTDDDAFHIGWPKSTMKLIGRRSFIGISFEEHK  140

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+APVNG EALS YI YIE+ V   LEKW+ MGEIEFL+ +
Sbjct  141  RLRRLTSAPVNGPEALSVYIQYIEETVITGLEKWSKMGEIEFLSHV  186



>ref|XP_010275286.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Nelumbo nucifera]
Length=492

 Score =   246 bits (627),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 139/169 (82%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            +F+ +L R N W YER KLG+K R SLPPGDLGWP IGN WSFLRAFK  +PDSFISSFV
Sbjct  19   AFYGLLRRANGWLYER-KLGEK-RFSLPPGDLGWPLIGNTWSFLRAFKYDDPDSFISSFV  76

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
            +RYG TG+YKAFMFGSPSI++T P+ CR+ L DDEAF PGWP ST +LIGRKSF+G   +
Sbjct  77   NRYGRTGVYKAFMFGSPSIMLTLPEPCRQALMDDEAFIPGWPKSTYKLIGRKSFLGTVDD  136

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EHKRLR+LTAAPVNGHEALS YI++IE  VK  L+KW  MG+IEFLT++
Sbjct  137  EHKRLRRLTAAPVNGHEALSVYIEFIEDCVKSTLDKWVGMGQIEFLTEI  185



>ref|XP_010510015.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010510016.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Camelina 
sativa]
Length=489

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WVL RVN W YE  KLG+KK   LPPGDLGWP IGNMWSFLRAFK+S+P+SFI S+ +RY
Sbjct  23   WVLKRVNVWIYES-KLGEKKHY-LPPGDLGWPVIGNMWSFLRAFKTSDPESFIRSYNTRY  80

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YKA MFG P ++VTT + CRRVL+DD+AF  GWP STM+LIGRKSFIGISFEEHK
Sbjct  81   GRTGIYKAHMFGYPCVLVTTAETCRRVLTDDDAFHIGWPKSTMKLIGRKSFIGISFEEHK  140

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+APVNG EALS Y+ YIE+ V   LEKW+ MGEIEFL+ +
Sbjct  141  RLRRLTSAPVNGPEALSVYLQYIEETVITDLEKWSKMGEIEFLSHV  186



>ref|XP_011469589.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Fragaria vesca 
subsp. vesca]
Length=566

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 139/166 (84%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WV    N W YE  KLG  K+  LPPGD+G PFIGN+WSFLRAFKS NPDSFI+SFVSR+
Sbjct  36   WVQENANWWLYE-TKLG-AKQYCLPPGDMGLPFIGNIWSFLRAFKSGNPDSFINSFVSRF  93

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YKA+MFG+PSII T P  C+RVL+DD+AF+PGWPVST+EL+GRKSF+GIS+EEHK
Sbjct  94   GKTGIYKAYMFGNPSIICTVPKTCKRVLTDDDAFKPGWPVSTVELMGRKSFVGISYEEHK  153

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLRKLTAAP+NGHEA S Y+ YIE+ V  +LEKW++MGEIEFL  +
Sbjct  154  RLRKLTAAPINGHEAFSVYMKYIEELVVSSLEKWSTMGEIEFLIHV  199



>ref|XP_010556999.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Tarenaya hassleriana]
 ref|XP_010557000.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Tarenaya hassleriana]
Length=491

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            WV+ R+N   YE   LG+KK   LPPGDLG PFIGNM  FL+AFK S+PDSF  S +++Y
Sbjct  23   WVVRRINPLIYEST-LGEKKHY-LPPGDLGLPFIGNMRPFLKAFKGSDPDSFTRSLITKY  80

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YK  +FG+PS++VTTPD CRRVL+DDE+F PGWP STMELIG+KSFIGISFEEHK
Sbjct  81   GNTGVYKTHLFGNPSVLVTTPDTCRRVLADDESFGPGWPKSTMELIGKKSFIGISFEEHK  140

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LTAAPVNGHEALS YI+YIE+NV  ALEKW+ MGE EFLT L
Sbjct  141  RLRRLTAAPVNGHEALSVYIEYIEENVISALEKWSKMGEFEFLTHL  186



>ref|XP_007219798.1| hypothetical protein PRUPE_ppa026558mg [Prunus persica]
 gb|EMJ20997.1| hypothetical protein PRUPE_ppa026558mg [Prunus persica]
Length=492

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 134/151 (89%), Gaps = 1/151 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG+KK  SLPPGDLGWPFIGNMWSFLRAFKSSNP++F++S VSR+G TG+YK FMFGSPS
Sbjct  37   LGEKK-YSLPPGDLGWPFIGNMWSFLRAFKSSNPEAFLNSMVSRFGRTGIYKTFMFGSPS  95

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            IIVTTP+A ++VL+DDEAF+PGWP+ST ELIG+ SF  ISFEEHKRLRKLTAAPVNG+EA
Sbjct  96   IIVTTPEASKKVLTDDEAFKPGWPISTEELIGKNSFTSISFEEHKRLRKLTAAPVNGYEA  155

Query  541  LSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LS Y  YIE+ V  +LEKW+ MGEIEFLTQL
Sbjct  156  LSVYTTYIEERVISSLEKWSKMGEIEFLTQL  186



>ref|XP_003533093.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Glycine max]
 gb|KHN44669.1| Ent-kaurenoic acid oxidase 1 [Glycine soja]
Length=496

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 141/165 (85%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN W YE  KLG  K+ SLPPGD+GWPFIGNMWSFL AFKS +PDSFISSFVSR+G
Sbjct  29   ILKNVNWWLYES-KLG-VKQYSLPPGDMGWPFIGNMWSFLSAFKSKDPDSFISSFVSRFG  86

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             TGMYK  MFG+PSIIVTTP+ C+RVL+DD+ F PGWP ST+ELIG++SFI +S+EEHKR
Sbjct  87   RTGMYKTMMFGNPSIIVTTPEICKRVLTDDDKFTPGWPQSTIELIGKRSFISMSYEEHKR  146

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LR+LT++ +NG EALS Y+ YIE+NVK +LEKWA+MG+IEFLT++
Sbjct  147  LRRLTSSSINGMEALSLYLTYIEKNVKSSLEKWANMGQIEFLTEI  191



>ref|XP_002264215.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Vitis vinifera]
 emb|CBI16744.3| unnamed protein product [Vitis vinifera]
Length=488

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 135/165 (82%), Gaps = 4/165 (2%)
 Frame = +1

Query  136  WVLGRVNCWYYE-RVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSR  312
            WVL RVN W YE R+K    K   LPPGDLGWP IGNMW+FLRAFK+ NPDSFIS+ V R
Sbjct  22   WVLLRVNKWVYEGRLK---GKSYHLPPGDLGWPLIGNMWTFLRAFKTKNPDSFISNIVER  78

Query  313  YGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEH  492
            YG  G+YK FMFG+PSI+VT+P+ CR+VL+DD+ F+PGWP ST ELIG+KSF+ IS+EEH
Sbjct  79   YGKGGIYKTFMFGNPSILVTSPEGCRKVLTDDDNFKPGWPTSTEELIGKKSFVSISYEEH  138

Query  493  KRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLT  627
            KRLR+LT+APVNGHEALS YI YIE+NV   LEKW+ MG IEFLT
Sbjct  139  KRLRRLTSAPVNGHEALSLYIPYIEKNVISDLEKWSKMGNIEFLT  183



>gb|KGN46277.1| hypothetical protein Csa_6G079220 [Cucumis sativus]
Length=462

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = +1

Query  130  FWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVS  309
              W+L   N   YE  +LG K R +LPPG+LGWPFIGNMWSFLRAFKS  PDSF+ SF+S
Sbjct  13   LLWLLKNANHLLYETAQLGSK-RFALPPGNLGWPFIGNMWSFLRAFKSPYPDSFMDSFLS  71

Query  310  RYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEE  489
            RYG TGMYKAFMFGSPS+IVT+ +AC+RVL+DDEAF  GWP STM+LIG  SFIGIS +E
Sbjct  72   RYGNTGMYKAFMFGSPSVIVTSAEACKRVLNDDEAFGSGWPPSTMKLIGENSFIGISNQE  131

Query  490  HKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            HKRLR++TAAPVNG++AL+ Y+ YIE+ V  +L+KW +MGEIEFLT+L
Sbjct  132  HKRLRRITAAPVNGYDALATYLTYIEKIVVSSLDKWGNMGEIEFLTEL  179



>gb|KHN14287.1| Ent-kaurenoic acid oxidase 2 [Glycine soja]
Length=493

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 141/165 (85%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN W YE  KLG  K+ SLPPGD+GWPFIGNMWSFLRAFKS +PDSFISSFVSRYG
Sbjct  25   MLKNVNWWLYES-KLG-VKQYSLPPGDMGWPFIGNMWSFLRAFKSKDPDSFISSFVSRYG  82

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             TGMYK  MFG+PS+IVTTP+ C+RVL+DD+ F  GWP ST+ELIG++SFI +S+EEHKR
Sbjct  83   RTGMYKTLMFGNPSVIVTTPETCKRVLTDDDKFTTGWPQSTIELIGKRSFISMSYEEHKR  142

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LR+LT++ +NG E+LS Y+ YIE+NVK +LEKWA+MG+IEFLT++
Sbjct  143  LRRLTSSSINGMESLSLYLTYIEENVKNSLEKWANMGQIEFLTEI  187



>ref|XP_003546291.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Glycine max]
Length=494

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 141/165 (85%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN W YE  KLG  K+ SLPPGD+GWPFIGNMWSFLRAFKS +PDSFISSFVSRYG
Sbjct  26   MLKNVNWWLYES-KLG-VKQYSLPPGDMGWPFIGNMWSFLRAFKSKDPDSFISSFVSRYG  83

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             TGMYK  MFG+PS+IVTTP+ C+RVL+DD+ F  GWP ST+ELIG++SFI +S+EEHKR
Sbjct  84   RTGMYKTLMFGNPSVIVTTPETCKRVLTDDDKFTTGWPQSTIELIGKRSFISMSYEEHKR  143

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LR+LT++ +NG E+LS Y+ YIE+NVK +LEKWA+MG+IEFLT++
Sbjct  144  LRRLTSSSINGMESLSLYLTYIEENVKNSLEKWANMGQIEFLTEI  188



>gb|AAO23063.1| ent-kaurenoic acid oxidase [Pisum sativum]
Length=488

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 141/165 (85%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN W YE  KLG  K+ SLPPGD+GWPFIGNMWSFLRAFKS +PDSFISS VSRYG
Sbjct  25   ILKNVNWWLYES-KLG-VKQYSLPPGDMGWPFIGNMWSFLRAFKSKDPDSFISSIVSRYG  82

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
            ++G+YKA MFG+PS+IVTTP+ C+RVL+DDE F  GWP ST+ELIG+ SFI +++EEHKR
Sbjct  83   SSGIYKALMFGNPSVIVTTPEGCKRVLTDDEKFTTGWPQSTIELIGKNSFIAMTYEEHKR  142

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LR+LT++ +NG EALS Y+ YIE+NV I+LEKW++MG+IEFLT++
Sbjct  143  LRRLTSSSINGMEALSLYLKYIEENVIISLEKWSNMGQIEFLTEI  187



>ref|XP_011656712.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Cucumis sativus]
Length=484

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W+L   N   YE  +LG K R +LPPG+LGWPFIGNMWSFLRAFKS  PDSF+ SF+SRY
Sbjct  15   WLLKNANHLLYETAQLGSK-RFALPPGNLGWPFIGNMWSFLRAFKSPYPDSFMDSFLSRY  73

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TGMYKAFMFGSPS+IVT+ +AC+RVL+DDEAF  GWP STM+LIG  SFIGIS +EHK
Sbjct  74   GNTGMYKAFMFGSPSVIVTSAEACKRVLNDDEAFGSGWPPSTMKLIGENSFIGISNQEHK  133

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR++TAAPVNG++AL+ Y+ YIE+ V  +L+KW +MGEIEFLT+L
Sbjct  134  RLRRITAAPVNGYDALATYLTYIEKIVVSSLDKWGNMGEIEFLTEL  179



>ref|XP_004486502.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Cicer arietinum]
Length=486

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN   YE  KLG  KR SLPPGD+GWP IGNMWSFLRAFKS++P+SF+ SFV R+G
Sbjct  18   LLKNVNWLLYE-YKLG-LKRYSLPPGDMGWPLIGNMWSFLRAFKSNHPESFMDSFVKRFG  75

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             TG+YK FMFG+PS+IVTTP+ C+RVL+DDE F PGWP ST+ELIG KSFI +SFEEHKR
Sbjct  76   KTGIYKVFMFGNPSVIVTTPETCKRVLTDDEKFVPGWPQSTIELIGEKSFIKMSFEEHKR  135

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LR+LT++ +NG+E+LS Y+ YIE+NV  +LEKW  MGEIEFLTQ+
Sbjct  136  LRRLTSSSINGYESLSVYLKYIEENVITSLEKWTHMGEIEFLTQM  180



>gb|AAG41777.1|AF212991_1 ent-kaurenoic acid oxidase [Cucurbita maxima]
Length=496

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +1

Query  124  SSFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSF  303
            S   W    +N W YE  KLGD+ RL+LPPGDLGWP IGNM  FLRAFKS NP++FI  +
Sbjct  22   SVLKWAAKSLNEWIYE-AKLGDR-RLALPPGDLGWPLIGNMLGFLRAFKSKNPETFIDGY  79

Query  304  VSRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISF  483
            VSRYG TG+YK  +FG+PS++VTTP+ CR+VL+DDEAFQPGWP + +ELIG KSFI +  
Sbjct  80   VSRYGKTGVYKVHLFGNPSVVVTTPETCRKVLTDDEAFQPGWPRAAVELIGEKSFIQMPQ  139

Query  484  EEHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EEHKRLR+LT+APVNG EALS YI YIE+NV  +LEKW+ MG IEFLTQL
Sbjct  140  EEHKRLRRLTSAPVNGFEALSNYIPYIEKNVLESLEKWSKMGPIEFLTQL  189



>gb|KGN56650.1| hypothetical protein Csa_3G127130 [Cucumis sativus]
Length=466

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W    +N W YE  KLGD+ R++LPPGDLGWP IGNM  FLRAFKS+NP++FI S+VSR+
Sbjct  28   WAAKSLNEWIYE-AKLGDR-RMALPPGDLGWPLIGNMLGFLRAFKSNNPETFIDSYVSRF  85

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YK  +FG+PS++VTTP+ CR+VL+DDEAFQPGWP + +ELIG+KSFI +  EEHK
Sbjct  86   GKIGVYKIHLFGNPSVVVTTPETCRKVLTDDEAFQPGWPRAAVELIGKKSFIEMPVEEHK  145

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+APVNG EALS YI YIE+NV  +L+KW++MG IEFLTQL
Sbjct  146  RLRRLTSAPVNGFEALSNYIPYIEENVLKSLDKWSNMGPIEFLTQL  191



>gb|AAO23064.1| ent-kaurenoic acid oxidase [Pisum sativum]
Length=490

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 136/165 (82%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN + YE  KLGDK+  SLPPGD+GWP IGNMWSFLRAFKSS PDSF+ S V R+G
Sbjct  21   LLKNVNWFLYE-AKLGDKQ-YSLPPGDMGWPIIGNMWSFLRAFKSSKPDSFMDSIVKRFG  78

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             TG+YK FMFG PS+IVT+P+AC++VL+DDE F+PGWP ST+ELIG KSFI + FEEH+R
Sbjct  79   NTGIYKVFMFGFPSVIVTSPEACKKVLTDDENFEPGWPQSTVELIGEKSFIKMPFEEHRR  138

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LR+LT+A +NG+EALS Y+ YIE+ V  +LEKW  MGEIEFLTQ+
Sbjct  139  LRRLTSASINGYEALSVYLKYIEEIVISSLEKWTQMGEIEFLTQM  183



>ref|XP_004133946.1| PREDICTED: ent-kaurenoic acid oxidase 1 [Cucumis sativus]
Length=498

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W    +N W YE  KLGD+ R++LPPGDLGWP IGNM  FLRAFKS+NP++FI S+VSR+
Sbjct  28   WAAKSLNEWIYE-AKLGDR-RMALPPGDLGWPLIGNMLGFLRAFKSNNPETFIDSYVSRF  85

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YK  +FG+PS++VTTP+ CR+VL+DDEAFQPGWP + +ELIG+KSFI +  EEHK
Sbjct  86   GKIGVYKIHLFGNPSVVVTTPETCRKVLTDDEAFQPGWPRAAVELIGKKSFIEMPVEEHK  145

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+APVNG EALS YI YIE+NV  +L+KW++MG IEFLTQL
Sbjct  146  RLRRLTSAPVNGFEALSNYIPYIEENVLKSLDKWSNMGPIEFLTQL  191



>gb|EPS65596.1| hypothetical protein M569_09175, partial [Genlisea aurea]
Length=481

 Score =   232 bits (592),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGA  321
            L   NCWYYER  LG  +R  LPPGDLGWPFIGNM+SFLRAFKS+ PDSFI+ FV R+G 
Sbjct  12   LKSFNCWYYER-NLG-YRRYHLPPGDLGWPFIGNMFSFLRAFKSAAPDSFIAGFVHRFGQ  69

Query  322  TGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRL  501
             G+YKA MFG+PSIIVTT +ACRRVL+DD++F PGWP +T+ LIGR SF+GI  ++HKRL
Sbjct  70   GGLYKAHMFGNPSIIVTTAEACRRVLTDDDSFIPGWPTATVNLIGRNSFVGIYDDDHKRL  129

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            RKLTAAPVNGHE LS YI YIE  +  ALE W SM GEIEFLT+L
Sbjct  130  RKLTAAPVNGHELLSTYIRYIEDIMVKALEDWESMGGEIEFLTEL  174



>ref|XP_007147426.1| hypothetical protein PHAVU_006G123600g [Phaseolus vulgaris]
 gb|ESW19420.1| hypothetical protein PHAVU_006G123600g [Phaseolus vulgaris]
Length=488

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 136/165 (82%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            V  + N W YE  KLG  K+ SLPPGD+G PFIGNMWSFLRAFKS +PDSFI SFVSR+G
Sbjct  25   VFKKFNWWLYES-KLG-VKQYSLPPGDMGLPFIGNMWSFLRAFKSKDPDSFIFSFVSRFG  82

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             TGMYK  MFGSPS+IVTTP+ C+RVL+DD+ F  GWP S +ELIG++SFI +SFEEHKR
Sbjct  83   RTGMYKTLMFGSPSVIVTTPETCKRVLTDDDKFTTGWPRSAIELIGKRSFISMSFEEHKR  142

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LR+LT+  +NG EALS Y+ YIE+NV+ +LEKWA++G+IEFLT++
Sbjct  143  LRRLTSTSINGMEALSLYLTYIEKNVRSSLEKWANLGQIEFLTEI  187



>ref|XP_004486504.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Cicer 
arietinum]
Length=491

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN   YE  KLG  K+ SLPPGD+GWPFIGNMWSFLRAFKS +PDSFISSFVSRYG
Sbjct  25   ILKNVNWLLYES-KLG-LKQYSLPPGDMGWPFIGNMWSFLRAFKSRDPDSFISSFVSRYG  82

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
              G+YK  MFG+PS+IVTTP+A R+VL DDE F PGWP ST+ELIG+KSFI + ++EHKR
Sbjct  83   HGGIYKGLMFGNPSVIVTTPEASRKVLIDDERFTPGWPQSTIELIGKKSFIAMPYDEHKR  142

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LR+LT++ +NG EALS Y+ YIE+NV  +LEKW++MG+IEFLT++
Sbjct  143  LRRLTSSSINGMEALSLYLKYIEENVISSLEKWSNMGQIEFLTEI  187



>ref|XP_004486505.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X2 [Cicer 
arietinum]
Length=490

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN   YE  KLG  K+ SLPPGD+GWPFIGNMWSFLRAFKS +PDSFISSFVSRYG
Sbjct  25   ILKNVNWLLYES-KLG-LKQYSLPPGDMGWPFIGNMWSFLRAFKSRDPDSFISSFVSRYG  82

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
              G+YK  MFG+PS+IVTTP+A R+VL DDE F PGWP ST+ELIG+KSFI + ++EHKR
Sbjct  83   HGGIYKGLMFGNPSVIVTTPEASRKVLIDDERFTPGWPQSTIELIGKKSFIAMPYDEHKR  142

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LR+LT++ +NG EALS Y+ YIE+NV  +LEKW++MG+IEFLT++
Sbjct  143  LRRLTSSSINGMEALSLYLKYIEENVISSLEKWSNMGQIEFLTEI  187



>ref|XP_008438234.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Cucumis melo]
Length=498

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 135/166 (81%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            W     N W YE  KLG++ R++LPPGDLGWP IGNM  FLRAFKS NP++FI S+VSR+
Sbjct  28   WAAKSFNEWIYE-AKLGER-RMALPPGDLGWPLIGNMLGFLRAFKSKNPETFIDSYVSRF  85

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G  G+YK  +FG+PS++VTTP+ CR+VL+DDEAFQPGWP + +ELIG+KSFI +  EEHK
Sbjct  86   GKIGVYKVHLFGNPSVVVTTPETCRKVLTDDEAFQPGWPRAAVELIGKKSFIEMPVEEHK  145

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+APVNG EALS YI YIE+NV  +L+KW++MG IEFLTQL
Sbjct  146  RLRRLTSAPVNGFEALSNYIPYIEENVLKSLDKWSTMGPIEFLTQL  191



>gb|KEH37115.1| cytochrome P450 family ent-kaurenoic acid oxidase [Medicago truncatula]
Length=490

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L  VN   YE  KLG  K+ SLPPGD+GWP +GNMWSFLRAFKS++PDSF++SFV R+G
Sbjct  21   LLKSVNWLLYE-AKLG-AKQYSLPPGDMGWPIVGNMWSFLRAFKSNDPDSFMASFVKRFG  78

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             TG+YK FMFG+PS++VTTP+AC+RVL+DDE F PGWP S +ELIG KSFI + FEEHKR
Sbjct  79   KTGIYKVFMFGNPSVVVTTPEACKRVLTDDEKFVPGWPQSAVELIGEKSFIKMPFEEHKR  138

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LR+LT++ +NG+EALS Y+  IE+ V  +LEKW  MGEIEFLTQ+
Sbjct  139  LRRLTSSSINGYEALSVYLKKIEEVVISSLEKWTHMGEIEFLTQM  183



>ref|XP_007147425.1| hypothetical protein PHAVU_006G123500g [Phaseolus vulgaris]
 gb|ESW19419.1| hypothetical protein PHAVU_006G123500g [Phaseolus vulgaris]
Length=486

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 136/166 (82%), Gaps = 2/166 (1%)
 Frame = +1

Query  136  WVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRY  315
            ++L  VN + YE  KLG K+   LPPGD+GWP IGNMWSFL AFK+SNPD+FI SF +R+
Sbjct  20   YLLKNVNWFLYEH-KLGGKQYF-LPPGDMGWPLIGNMWSFLSAFKTSNPDTFIDSFYARF  77

Query  316  GATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHK  495
            G TG+YK  MFG+PS+IVTTP+AC++VL+DD+ F  GWP ST+EL+G KSFI I +EEH+
Sbjct  78   GKTGIYKVLMFGNPSVIVTTPEACKKVLTDDDNFTLGWPASTVELMGEKSFISIPYEEHR  137

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RLR+LT+A +NG+EALS YI YIE+ VK +LE+W +MG+IEFLTQ+
Sbjct  138  RLRRLTSASINGYEALSVYITYIEEVVKSSLEEWTTMGDIEFLTQM  183



>ref|XP_009420467.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=496

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 128/164 (78%), Gaps = 2/164 (1%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGA  321
            L R++ W  E V LG+K+R  LPPGD+GWP IGNMW+FLR+FKS  PDSFI+SFV R+  
Sbjct  28   LRRLHEWVQE-VGLGEKRR-HLPPGDMGWPIIGNMWAFLRSFKSGQPDSFIASFVRRFNG  85

Query  322  TGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRL  501
             GMYK +MFGSP+I++ TP+ CR VL DDE F PGWP ST  L+G KSF+GI  EEHKRL
Sbjct  86   VGMYKGYMFGSPTIMIHTPEGCRHVLMDDEHFIPGWPKSTRLLMGEKSFVGIVREEHKRL  145

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            R+LTAAP+NGHEAL+ Y+ +IE  V   LE+WA MG+IEFLT++
Sbjct  146  RRLTAAPINGHEALNDYLQFIEHTVVTTLERWAGMGQIEFLTEM  189



>ref|XP_009392783.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=496

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +1

Query  208  PPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPSIIVTTPDAC  387
            PPGD+GWP IGNMW+FLRAFKSS+PDSFI+SF+ RYG  G+YKAFMFGSP+I+VT P++C
Sbjct  45   PPGDMGWPVIGNMWAFLRAFKSSDPDSFIASFIRRYGRIGIYKAFMFGSPTIMVTVPESC  104

Query  388  RRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEALSFYIDYIE  567
            ++VL DD+ F PGWP +T ELIG+KSFIGI+  EHKRLR+LTA PVNG+EAL+ Y+ +IE
Sbjct  105  KQVLMDDDHFAPGWPKATNELIGKKSFIGITQAEHKRLRRLTANPVNGYEALNTYLQFIE  164

Query  568  QNVKIALEKWASMGEIEFLTQL  633
              V   LE+WASMG+IEFLT+L
Sbjct  165  NTVISTLERWASMGQIEFLTEL  186



>emb|CBI16745.3| unnamed protein product [Vitis vinifera]
Length=437

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  244  MWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQP  423
            MWSFLRAFKS++PDSFISSF++R+G TGMYK  MFG+PSIIVT P+AC+RVL+DD+ F+P
Sbjct  1    MWSFLRAFKSTDPDSFISSFITRFGQTGMYKVLMFGNPSIIVTIPEACKRVLTDDQNFKP  60

Query  424  GWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWAS  603
            GWP STMELIGRKSFIGI+ EEHKRLR+LTA PVNGHEALS Y+ YIE NV  AL KWA+
Sbjct  61   GWPTSTMELIGRKSFIGITNEEHKRLRRLTATPVNGHEALSIYMQYIEDNVISALNKWAA  120

Query  604  MGEIEFLTQL  633
            MGE EFLT L
Sbjct  121  MGEFEFLTAL  130



>ref|XP_007218023.1| hypothetical protein PRUPE_ppa005937mg [Prunus persica]
 gb|EMJ19222.1| hypothetical protein PRUPE_ppa005937mg [Prunus persica]
Length=436

 Score =   215 bits (548),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  244  MWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQP  423
            MWSFL+AFKSSNP++F++S VSR+G TG+YKAFMFGSPS+IVTTP++ +RVL+DD+AF+P
Sbjct  1    MWSFLKAFKSSNPETFVNSLVSRFGRTGIYKAFMFGSPSVIVTTPESSKRVLTDDDAFKP  60

Query  424  GWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWAS  603
            GWP+ST+ELIG+ SFIGIS+EEHKRLR+LTAAPVNGHEALS Y+ YIE  V  +LEKW+ 
Sbjct  61   GWPLSTLELIGKNSFIGISYEEHKRLRRLTAAPVNGHEALSMYMKYIEDMVVTSLEKWSK  120

Query  604  MGEIEFLTQL  633
            MGEIEFLTQL
Sbjct  121  MGEIEFLTQL  130



>ref|XP_006847688.1| PREDICTED: ent-kaurenoic acid oxidase 2 [Amborella trichopoda]
 gb|ERN09269.1| hypothetical protein AMTR_s00149p00053760 [Amborella trichopoda]
Length=494

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 135/169 (80%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            + + +L +VN W+ E  K+G++ R  LPPGD+GWP +GNM+ FLRAFKS NPDSF+SSFV
Sbjct  19   ALFQLLRKVNGWFCE-WKVGER-RFLLPPGDMGWPLMGNMFHFLRAFKSGNPDSFLSSFV  76

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
             R+G TG+Y+AFMFGSP+I+VT P+ C++VL DD  F PGWP +T ELIG+KSF+ I+ E
Sbjct  77   KRFGRTGIYRAFMFGSPTILVTIPETCKQVLMDDSNFVPGWPKATEELIGKKSFLLITPE  136

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EH+ LRK+TAAPVNGHE LS Y+ +IE +V  +LE WA +GEIEFLT+L
Sbjct  137  EHRWLRKVTAAPVNGHEMLSNYLKFIEASVISSLESWAQLGEIEFLTEL  185



>gb|EYU40296.1| hypothetical protein MIMGU_mgv1a006460mg [Erythranthe guttata]
Length=443

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +1

Query  220  LGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPSIIVTTPDACRRVL  399
            +GWP IGNM SFL AFKSSNPDSF SSF+ R+G TG+YK  MFG+PSII T+ +ACR++L
Sbjct  1    MGWPLIGNMLSFLSAFKSSNPDSFTSSFIHRFGRTGLYKVHMFGNPSIIATSAEACRKIL  60

Query  400  SDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEALSFYIDYIEQNVK  579
            +DDEAF+PGWP ST+ LIGRKSF+GI  EEHK LRKLTAAPVNG+EAL+ Y+ YIE+NV 
Sbjct  61   TDDEAFRPGWPSSTVNLIGRKSFVGIYDEEHKWLRKLTAAPVNGYEALTVYMKYIEENVV  120

Query  580  IALEKWASMGEIEFLTQL  633
            IALE+W+ MG+IEFLT+L
Sbjct  121  IALEEWSEMGQIEFLTEL  138



>gb|AHW42467.1| KAO2 [Pinus tabuliformis]
Length=482

 Score =   214 bits (545),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 131/169 (78%), Gaps = 2/169 (1%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            + ++V+ R N W+YE      K +  LPPGD+GWP +GNM SFLR FKS+NP++FISSFV
Sbjct  16   TLFYVVRRFNSWWYEPTL--KKGQPPLPPGDMGWPLLGNMLSFLRDFKSANPEAFISSFV  73

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
            SR+   G+YKAFMFG P+I+ TTP+ACRRVL DD  F PGWP ST++L+G KSF+GIS E
Sbjct  74   SRFNRVGVYKAFMFGKPTILATTPEACRRVLMDDVHFIPGWPKSTVKLMGSKSFVGISQE  133

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            EHKRLRKLTAAP+NG EALS Y+++IE+ V  ALE W+ M +I+ L +L
Sbjct  134  EHKRLRKLTAAPLNGPEALSKYMNWIEERVVSALENWSKMDQIDLLIEL  182



>ref|XP_010934998.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Elaeis guineensis]
Length=489

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 130/162 (80%), Gaps = 2/162 (1%)
 Frame = +1

Query  148  RVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATG  327
            RV  W YE   LG+K++  LPPGD GWP +GNM +FLRAFKS++PDSFI+S++ R+   G
Sbjct  26   RVQEWVYE-WGLGEKRK-KLPPGDFGWPLLGNMVAFLRAFKSNDPDSFINSYIQRFKRVG  83

Query  328  MYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRK  507
            +YKA MFG+P+I+VTTP+ C++VL DDE F PGWP +T EL+G++SF+ I  EEHKRLRK
Sbjct  84   IYKACMFGTPTIMVTTPENCKQVLMDDEHFVPGWPKATCELVGKRSFLFIINEEHKRLRK  143

Query  508  LTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LT+AP+NG+EAL+ Y+ +IE+ V   LEKWA MGEIEFLT+L
Sbjct  144  LTSAPINGYEALTTYLGFIEETVVSTLEKWAGMGEIEFLTEL  185



>ref|XP_010941218.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Elaeis guineensis]
Length=492

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 130/162 (80%), Gaps = 2/162 (1%)
 Frame = +1

Query  148  RVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATG  327
            RV  W +E   LG+K++  LPPGDLGWP +GNM +FL AFKS++PDSFI+S++ R+   G
Sbjct  26   RVQEWVHE-WGLGEKRK-RLPPGDLGWPLLGNMAAFLWAFKSNDPDSFINSYIRRFSRIG  83

Query  328  MYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRK  507
            +YKA+MFG+P+I+VT P+ C++VL DD+ F PGWP +T ELIG+KSF+GI  EEHKRLR+
Sbjct  84   IYKAYMFGTPTIMVTIPETCKQVLMDDDLFVPGWPKATCELIGKKSFVGIIHEEHKRLRR  143

Query  508  LTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LTAAP+NG EAL+ Y+++IE  V   LEKWA MGEIEFLT+L
Sbjct  144  LTAAPINGCEALTTYLEFIEDTVVSTLEKWAGMGEIEFLTEL  185



>gb|KCW77919.1| hypothetical protein EUGRSUZ_D021732, partial [Eucalyptus grandis]
Length=460

 Score =   208 bits (530),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL RVN W Y R +LG+K R SLPPGD+GWP +G MWSFLRAF+S +PDSF+S+F+SR+G
Sbjct  24   VLKRVNEWIYMR-RLGEK-RGSLPPGDMGWPLVGKMWSFLRAFRSDDPDSFLSTFISRFG  81

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
            ATG+YK +MFGSPSIIV  P+ CRRVL+DD+ F+ G+P +   L GR+SF  IS  EHKR
Sbjct  82   ATGIYKTYMFGSPSIIVCKPETCRRVLTDDQNFKLGYPKAVRVLSGRRSFHSISNAEHKR  141

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+LTAAP+ G EALS Y+  IE+N+  +LE+W+S  + +EFLT +
Sbjct  142  LRRLTAAPITGSEALSMYVPGIEENIVASLEEWSSSDQPVEFLTGM  187



>ref|XP_010053587.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Eucalyptus 
grandis]
Length=491

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL RVN W Y R +LG+K R SLPPGD+GWP +G MWSFLRAF+S +PDSF+S+F+SR+G
Sbjct  24   VLKRVNEWIYMR-RLGEK-RGSLPPGDMGWPLVGKMWSFLRAFRSDDPDSFLSTFISRFG  81

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
            ATG+YK +MFGSPSIIV  P+ CRRVL+DD+ F+ G+P +   L GR+SF  IS  EHKR
Sbjct  82   ATGIYKTYMFGSPSIIVCKPETCRRVLTDDQNFKLGYPKAVRVLSGRRSFHSISNAEHKR  141

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+LTAAP+ G EALS Y+  IE+N+  +LE+W+S  + +EFLT +
Sbjct  142  LRRLTAAPITGSEALSMYVPGIEENIVASLEEWSSSDQPVEFLTGM  187



>gb|KCW77911.1| hypothetical protein EUGRSUZ_D02168 [Eucalyptus grandis]
Length=464

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 128/164 (78%), Gaps = 3/164 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL RVN W Y   +LG+K R SLPPGD+GWP +G MWSFLRAF+S +PDSF+S+F+SR+G
Sbjct  24   VLKRVNEWIYVS-RLGEK-RASLPPGDMGWPLVGKMWSFLRAFRSDDPDSFLSTFISRFG  81

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
            ATG+YK +MFGSPSIIV  P+ CRRVL+DD+ F+ G+P +   L GR+SF  IS  EHKR
Sbjct  82   ATGIYKTYMFGSPSIIVCKPETCRRVLTDDQNFKLGYPKAVKVLTGRRSFHSISNAEHKR  141

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLT  627
            LR+LTAAP+ G EALS Y+  IE+N+  +LE+W++  + +EFLT
Sbjct  142  LRRLTAAPITGSEALSMYVPGIEENIVASLEEWSNSDQPVEFLT  185



>gb|KCW77918.1| hypothetical protein EUGRSUZ_D02172 [Eucalyptus grandis]
Length=337

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 128/166 (77%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL RVN W Y   +LG+K R SLPPGD+GWP +G M SFLRAF+S +PDSF+S+F+SR+G
Sbjct  24   VLKRVNEWIYVS-RLGEK-RASLPPGDMGWPLVGKMRSFLRAFRSDDPDSFLSTFISRFG  81

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
            ATG+YK +MFGSPSIIV  P+ CRRVL+DD+ F+ G+P +   L GR+SF  IS  EHKR
Sbjct  82   ATGIYKTYMFGSPSIIVCKPETCRRVLTDDQNFKLGYPKAVKVLTGRRSFHSISNAEHKR  141

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+LTAAP+ G EALS Y+  IE+N+  +LE+W+S  + +EFLT +
Sbjct  142  LRRLTAAPITGSEALSMYVPGIEENIVASLEEWSSSDQPVEFLTGM  187



>ref|XP_010053586.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Eucalyptus grandis]
Length=494

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 129/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL RVN W Y   +LG+K R SLPPGD+GWP +G MWSFLRAF+S +PDSF+S+F+SR+G
Sbjct  24   VLKRVNEWIYVS-RLGEK-RASLPPGDMGWPLVGKMWSFLRAFRSDDPDSFLSTFISRFG  81

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
            ATG+YK +MFGSPSIIV  P+ CRRVL+DD+ F+ G+P +   L GR+SF  IS  EHKR
Sbjct  82   ATGIYKTYMFGSPSIIVCKPETCRRVLTDDQNFKLGYPKAVKVLTGRRSFHSISNAEHKR  141

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+LTAAP+ G EALS Y+  IE+N+  +LE+W+S  + +EFLT +
Sbjct  142  LRRLTAAPITGSEALSMYVPGIEENIVASLEEWSSSDQPVEFLTGM  187



>gb|KCW77910.1| hypothetical protein EUGRSUZ_D02168 [Eucalyptus grandis]
Length=488

 Score =   206 bits (525),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 129/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL RVN W Y   +LG+K R SLPPGD+GWP +G MWSFLRAF+S +PDSF+S+F+SR+G
Sbjct  24   VLKRVNEWIYVS-RLGEK-RASLPPGDMGWPLVGKMWSFLRAFRSDDPDSFLSTFISRFG  81

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
            ATG+YK +MFGSPSIIV  P+ CRRVL+DD+ F+ G+P +   L GR+SF  IS  EHKR
Sbjct  82   ATGIYKTYMFGSPSIIVCKPETCRRVLTDDQNFKLGYPKAVKVLTGRRSFHSISNAEHKR  141

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+LTAAP+ G EALS Y+  IE+N+  +LE+W++  + +EFLT +
Sbjct  142  LRRLTAAPITGSEALSMYVPGIEENIVASLEEWSNSDQPVEFLTGM  187



>ref|XP_010053585.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Eucalyptus grandis]
Length=494

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 129/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL RVN W Y   +LG+K R SLPPGD+GWP +G MWSFLRAF+S +PDSF+S+F+SR+G
Sbjct  24   VLKRVNEWIYVS-RLGEK-RASLPPGDMGWPLVGKMWSFLRAFRSDDPDSFLSTFISRFG  81

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
            ATG+YK +MFGSPSIIV  P+ CRRVL+DD+ F+ G+P +   L GR+SF  IS  EHKR
Sbjct  82   ATGIYKTYMFGSPSIIVCKPETCRRVLTDDQNFKLGYPKAVKVLTGRRSFHSISNAEHKR  141

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+LTAAP+ G EALS Y+  IE+N+  +LE+W++  + +EFLT +
Sbjct  142  LRRLTAAPITGSEALSMYVPGIEENIVASLEEWSNSDQPVEFLTGM  187



>gb|KJB25350.1| hypothetical protein B456_004G187300 [Gossypium raimondii]
Length=487

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 127/165 (77%), Gaps = 3/165 (2%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGA  321
            L ++N W Y    LG+KK  SLPPGD+GWP IGNMWSFL+ F+S++PD+FI + V RYG 
Sbjct  26   LKKINEWRYVS-SLGEKKH-SLPPGDMGWPIIGNMWSFLKVFRSNDPDTFIYNLVKRYGR  83

Query  322  TGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRL  501
            TGMYK ++FGSPSIIV+ P+ CR+VL+DDE F  G+P+ST +L G+KSF  I   EHKRL
Sbjct  84   TGMYKTYLFGSPSIIVSIPETCRKVLADDEQFGLGYPLSTKQLTGKKSFHSIPNSEHKRL  143

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            R+LT AP+NGHEALS YI YIE+ V  +L++W+SM E IE L ++
Sbjct  144  RRLTTAPINGHEALSMYIGYIEEIVVNSLDEWSSMKEPIELLNEI  188



>gb|KHG22736.1| Cytochrome P450 [Gossypium arboreum]
Length=487

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 127/165 (77%), Gaps = 3/165 (2%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGA  321
            L ++N W Y    LG+KK  SLPPGD+GWP IGNMWSFL+ F+S++PD+FI + V RYG 
Sbjct  26   LKKINEWCYVS-SLGEKKH-SLPPGDMGWPIIGNMWSFLKVFRSNDPDTFIYNLVKRYGR  83

Query  322  TGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRL  501
            TGMYK ++FGSPSIIV+ P+ CR+VL+DDE F  G+P+ST +L G+KSF  I   EHKRL
Sbjct  84   TGMYKTYLFGSPSIIVSIPETCRKVLADDEQFGLGYPLSTKQLTGKKSFHSIPNSEHKRL  143

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            R+LT AP+NGHEALS YI YIE+ V  +L++W+SM E IE L ++
Sbjct  144  RRLTTAPINGHEALSMYIGYIEEIVVNSLDEWSSMKEPIELLNEI  188



>gb|KJB25351.1| hypothetical protein B456_004G187300 [Gossypium raimondii]
Length=484

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 127/165 (77%), Gaps = 3/165 (2%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGA  321
            L ++N W Y    LG+KK  SLPPGD+GWP IGNMWSFL+ F+S++PD+FI + V RYG 
Sbjct  26   LKKINEWRYVS-SLGEKKH-SLPPGDMGWPIIGNMWSFLKVFRSNDPDTFIYNLVKRYGR  83

Query  322  TGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRL  501
            TGMYK ++FGSPSIIV+ P+ CR+VL+DDE F  G+P+ST +L G+KSF  I   EHKRL
Sbjct  84   TGMYKTYLFGSPSIIVSIPETCRKVLADDEQFGLGYPLSTKQLTGKKSFHSIPNSEHKRL  143

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            R+LT AP+NGHEALS YI YIE+ V  +L++W+SM E IE L ++
Sbjct  144  RRLTTAPINGHEALSMYIGYIEEIVVNSLDEWSSMKEPIELLNEI  188



>ref|XP_010677318.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Beta vulgaris subsp. 
vulgaris]
Length=497

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 132/170 (78%), Gaps = 3/170 (2%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            +F+ +L   N  +Y R +LG  + L LPPGD+GWPFIG   SFL+AFKS +PDSFIS+F 
Sbjct  20   AFYGILKNGNELFYVR-RLGKMRHL-LPPGDMGWPFIGTQLSFLKAFKSGDPDSFISNFA  77

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
            SR+GATG+Y+A MFG P +IVTTP++C+RVLSDD  F PG+P S  +L+G+K+F GIS E
Sbjct  78   SRFGATGIYRAVMFGKPCVIVTTPESCKRVLSDDATFGPGFPESITKLMGKKAFHGISQE  137

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            EHKRLR+LT A ++G EALS Y+ +IE+ VK +LE+W+ M + I+FLT++
Sbjct  138  EHKRLRRLTTAALSGQEALSIYLKHIEEIVKTSLEEWSIMSKPIQFLTEM  187



>ref|XP_007039557.1| Ent-kaurenoic acid hydroxylase 2 [Theobroma cacao]
 gb|EOY24058.1| Ent-kaurenoic acid hydroxylase 2 [Theobroma cacao]
Length=516

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 123/165 (75%), Gaps = 3/165 (2%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGA  321
            L +VN W Y    LG+KK  SLPPGD+GWP  GNM SFLRAF+S NPD+FI   V RYG 
Sbjct  24   LKKVNEWRYVS-SLGEKKH-SLPPGDMGWPMFGNMGSFLRAFRSKNPDTFIYDLVKRYGR  81

Query  322  TGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRL  501
            TG+YK ++FGSPSIIV+ P+ CR+VL+DDE F  G+PVST +L G+KSF  I   EHKRL
Sbjct  82   TGIYKTYLFGSPSIIVSIPETCRKVLADDERFGLGYPVSTKQLTGKKSFHSIPNSEHKRL  141

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            R+LT AP+NGHEAL+ YI YIE  V  +L++WASM E IE L ++
Sbjct  142  RRLTTAPINGHEALAMYIGYIEDIVINSLDEWASMKEPIELLKEM  186



>ref|XP_008660301.1| PREDICTED: cytochrome P450 88A1-like [Zea mays]
 gb|AFW88847.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=484

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            ++ R + W +E   LG  +R  LPPGD+GWP +G MW+FL AFKS NPDSFI SF+ R+G
Sbjct  21   LVRRAHRWAWE-ASLGGSRRARLPPGDMGWPVVGAMWAFLWAFKSGNPDSFIGSFIRRFG  79

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             TG+Y  FMF  P+++V TP+AC+RVL DD++F  GWP +T+ LIGRKSF+ +  EEH+R
Sbjct  80   RTGVYMTFMFSKPTVLVATPEACKRVLMDDDSFLEGWPRATVALIGRKSFLTLPCEEHRR  139

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LRKLTAAP+NG +AL+ Y+ +I++ V   L  W+  GEIEFLT+L
Sbjct  140  LRKLTAAPINGFDALTTYLGFIDRTVVATLRGWSDAGEIEFLTEL  184



>gb|AAT28221.1| putative ent-Kaurenoic acid hydroxylase-like cytochrome P450 
[Ginkgo biloba]
Length=485

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGA  321
            L + N W YE    G   +  LPPGD+GWP +GNM SFL AFK + P+SF+S+FVSR+G 
Sbjct  20   LKKFNGWRYE---CGLSSKKPLPPGDMGWPLLGNMLSFLIAFKFNRPNSFVSAFVSRFGR  76

Query  322  TGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRL  501
            TG+YK FMFGSP+I+ TTP+ C++VL DD  F PGWPVST++L+GRKSF+ +S E+H RL
Sbjct  77   TGLYKPFMFGSPTILATTPETCKQVLMDDAHFVPGWPVSTVQLMGRKSFVALSHEDHDRL  136

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            RKLTA  +NGHEALS Y+ +IEQ V  A E WA+   I  L +L
Sbjct  137  RKLTAPSINGHEALSNYLGWIEQRVVSAYEDWANQDRIVLLNEL  180



>gb|EEC73049.1| hypothetical protein OsI_07000 [Oryza sativa Indica Group]
Length=499

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 124/153 (81%), Gaps = 2/153 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G+MW+FLRAFKS NPD+FI+SF+ R+G TG+Y+ FMF SP+
Sbjct  40   LGAERRSRLPPGEMGWPMVGSMWAFLRAFKSGNPDAFIASFIRRFGRTGVYRTFMFSSPT  99

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            I+  TP+AC++VL DDE F  GWP +T+ LIG KSF+ +S+++H+R+RKLTAAP+NG +A
Sbjct  100  ILAVTPEACKQVLMDDEGFVTGWPKATVTLIGPKSFVNMSYDDHRRIRKLTAAPINGFDA  159

Query  541  LSFYIDYIEQNVKIALEKWAS--MGEIEFLTQL  633
            L+ Y+ +I+Q V  +L +W+S   G++EFLT+L
Sbjct  160  LTTYLSFIDQTVVASLRRWSSPESGQVEFLTEL  192



>ref|NP_001056579.1| Os06g0110000 [Oryza sativa Japonica Group]
 dbj|BAD67695.1| putative cytochrome P450 DWARF3 [Oryza sativa Japonica Group]
 dbj|BAD67898.1| putative cytochrome P450 DWARF3 [Oryza sativa Japonica Group]
 dbj|BAF18493.1| Os06g0110000 [Oryza sativa Japonica Group]
Length=506

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 124/153 (81%), Gaps = 2/153 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G+MW+FLRAFKS NPD+FI+SF+ R+G TG+Y+ FMF SP+
Sbjct  47   LGAERRSRLPPGEMGWPMVGSMWAFLRAFKSGNPDAFIASFIRRFGRTGVYRTFMFSSPT  106

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            I+  TP+AC++VL DDE F  GWP +T+ LIG KSF+ +S+++H+R+RKLTAAP+NG +A
Sbjct  107  ILAVTPEACKQVLMDDEGFVTGWPKATVTLIGPKSFVNMSYDDHRRIRKLTAAPINGFDA  166

Query  541  LSFYIDYIEQNVKIALEKWAS--MGEIEFLTQL  633
            L+ Y+ +I+Q V  +L +W+S   G++EFLT+L
Sbjct  167  LTTYLSFIDQTVVASLRRWSSPESGQVEFLTEL  199



>ref|XP_009373441.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=502

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            +   +L R N W + R KLG+ K  +LPPG+LGWPFIGN  SF++A KS +P+SFIS+ V
Sbjct  29   ALLLILERANEWMFVR-KLGENKH-TLPPGELGWPFIGNTLSFIKALKSDDPESFISNHV  86

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
             R+G+TG+YKA +FG P+IIVTTP+ C++VL D   F+ GWP ST EL+GRKSF+G+S E
Sbjct  87   KRFGSTGIYKACLFGKPTIIVTTPETCKQVLMDSLQFKTGWPKSTSELMGRKSFLGLSEE  146

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            EHKRLRKLTAAP++GH+ALS Y +YIE  +  +L++ A   + +EFLT++
Sbjct  147  EHKRLRKLTAAPISGHKALSMYQEYIEDVIVSSLDELAKAKKPVEFLTEI  196



>emb|CBY78885.1| KAO protein [Triticum urartu]
Length=491

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = +1

Query  154  NCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMY  333
            + WY+    LG  +R  LPPGD+GWP +G MW+FLRAFKS  PDSFI SF  R+G  G+Y
Sbjct  29   HAWYWT-ASLGAGRRGRLPPGDMGWPLVGGMWAFLRAFKSGRPDSFIDSFARRFGRAGLY  87

Query  334  KAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLT  513
            +AFMF SP+I+VTTPDAC++VL DD+ F  GWP +T+ LIG KSFI + ++EH+RLRKLT
Sbjct  88   RAFMFSSPTIMVTTPDACKQVLMDDDTFVTGWPKATVALIGPKSFISMGYDEHRRLRKLT  147

Query  514  AAPVNGHEALSFYIDYIEQNVKIALEKWASMG-EIEFLTQL  633
            AAP+NG +AL+ Y+ +I+  V   L  W+  G + EFLT+L
Sbjct  148  AAPINGFDALTSYLAFIDHTVVTTLRGWSERGDDFEFLTEL  188



>ref|XP_009373442.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=493

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            +   +L + N W + R KLG+ K  +LPPG+LGWPFIGN  SF++A KS +P+SFIS+ V
Sbjct  20   ALLLILKKANEWLFVR-KLGENKH-TLPPGELGWPFIGNTLSFIKALKSDDPESFISNHV  77

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
             R+G+TG+YKA +FG P+IIVTTP+ C++VL D   F+ GWP ST EL+GRKSF+G+S E
Sbjct  78   KRFGSTGIYKACLFGKPTIIVTTPETCKQVLMDSLQFKTGWPKSTSELMGRKSFLGLSEE  137

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            EHKRLRKLTAAP++GH+ALS Y +YIE  +  +L++ A   + +EFLT++
Sbjct  138  EHKRLRKLTAAPISGHKALSMYQEYIEDVIVSSLDELAKAKKPVEFLTEI  187



>gb|EEE64964.1| hypothetical protein OsJ_19857 [Oryza sativa Japonica Group]
Length=813

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 124/153 (81%), Gaps = 2/153 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G+MW+FLRAFKS NPD+FI+SF+ R+G TG+Y+ FMF SP+
Sbjct  40   LGAERRSRLPPGEMGWPMVGSMWAFLRAFKSGNPDAFIASFIRRFGRTGVYRTFMFSSPT  99

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            I+  TP+AC++VL DDE F  GWP +T+ LIG KSF+ +S+++H+R+RKLTAAP+NG +A
Sbjct  100  ILAVTPEACKQVLMDDEGFVTGWPKATVTLIGPKSFVNMSYDDHRRIRKLTAAPINGFDA  159

Query  541  LSFYIDYIEQNVKIALEKWAS--MGEIEFLTQL  633
            L+ Y+ +I+Q V  +L +W+S   G++EFLT+L
Sbjct  160  LTTYLSFIDQTVVASLRRWSSPESGQVEFLTEL  192



>ref|XP_007209946.1| hypothetical protein PRUPE_ppa004753mg [Prunus persica]
 gb|EMJ11145.1| hypothetical protein PRUPE_ppa004753mg [Prunus persica]
Length=493

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 129/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L R N WY+   +LG++++ +LPPGD+GWPF+GN  SFL+A KS +PDSFIS++V RYG
Sbjct  23   ILRRANEWYFVS-RLGERQK-TLPPGDMGWPFLGNTLSFLKALKSDDPDSFISNYVKRYG  80

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
            +TG+YKA++FG P+IIVT P+ CR+VL D   F+ GWP ST +L+GRKSF+ +S  EHKR
Sbjct  81   STGIYKAYLFGKPTIIVTAPETCRQVLMDSLQFKTGWPKSTSDLMGRKSFMSLSEGEHKR  140

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+LTAAP++GH+ALS Y +YI+  +  +L++ A     IEFLT++
Sbjct  141  LRRLTAAPISGHKALSMYHEYIKDAIVSSLDELAKAERPIEFLTEI  186



>emb|CBY78889.1| KAO protein [Aegilops tauschii]
Length=493

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  154  NCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMY  333
            + WY+    LG  +R  LPPGD+GWP +G MW+FL AFKS  PDSFI SF  R+G  G+Y
Sbjct  29   HAWYWT-ASLGAGRRGRLPPGDMGWPLVGGMWAFLCAFKSGRPDSFIDSFARRFGRAGLY  87

Query  334  KAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLT  513
            +AFMF SP+I+VTTPDAC++VL DD+ F  GWP +T+ LIG KSFI + ++EH+RLRKLT
Sbjct  88   RAFMFSSPTIMVTTPDACKQVLMDDDTFVTGWPKATVALIGPKSFINMGYDEHRRLRKLT  147

Query  514  AAPVNGHEALSFYIDYIEQNVKIALEKWASMG-EIEFLTQL  633
            AAP+NG +AL+ Y+ +I+  V   L  WA  G + EFLT+L
Sbjct  148  AAPINGFDALTSYLAFIDHTVVTTLRGWADRGSDFEFLTEL  188



>ref|XP_010104358.1| Ent-kaurenoic acid oxidase 2 [Morus notabilis]
 gb|EXB99778.1| Ent-kaurenoic acid oxidase 2 [Morus notabilis]
Length=498

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 125/166 (75%), Gaps = 2/166 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L R N WY+  + LG K+  SLPPGD+GWP IGNM SFL  FK   PDSFIS+FV+R+G
Sbjct  29   ILKRANEWYHVSM-LGRKQYYSLPPGDMGWPLIGNMLSFLITFKFGYPDSFISNFVTRFG  87

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             TG+YKA++FGSP+IIVT P+ CR  L DD  F+PGWP ST EL+GRKSF+G+S EEHKR
Sbjct  88   RTGIYKAYLFGSPTIIVTAPETCRPALMDDTQFKPGWPKSTFELMGRKSFLGLSAEEHKR  147

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+LTAAP++G +ALS Y ++++  +  +L++ A     +EF T++
Sbjct  148  LRRLTAAPISGKKALSTYHEFMKDVIVSSLDELAEAERPVEFFTEV  193



>ref|XP_008238293.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Prunus mume]
Length=496

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            +   +L R N WY+   +LG++++ +LPPGD+GWPF+GN  SFL+A KS +PDSFIS++V
Sbjct  22   ALLLILRRANEWYFVS-RLGERQK-TLPPGDMGWPFLGNTLSFLKALKSDDPDSFISNYV  79

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
             RYG+TG+YKA++FG P+IIVT P+ CR+VL D   F+ GWP ST +L+GRKSF+ +S  
Sbjct  80   KRYGSTGIYKAYLFGKPTIIVTAPETCRQVLMDSLQFKTGWPKSTSDLMGRKSFMSLSEG  139

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            EHKRLR+LTAAP++GH+AL+ Y +YI+  +  +L++ A     IEFLT++
Sbjct  140  EHKRLRRLTAAPISGHKALAMYHEYIKDAIVSSLDELAKAERPIEFLTEI  189



>gb|ADK62526.1| ent-kaurenoic acid oxidase [Triticum aestivum]
Length=491

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  154  NCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMY  333
            + WY+    LG  +R  LPPGD+GWP +G MW+FL AFKS  PDSFI SF  R+G  G+Y
Sbjct  29   HAWYWT-ASLGAGRRGRLPPGDMGWPLVGGMWAFLCAFKSGRPDSFIDSFARRFGRAGLY  87

Query  334  KAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLT  513
            +AFMF SP+I+VTTPDAC++VL DD+ F  GWP +T+ LIG KSFI + ++EH+RLRKLT
Sbjct  88   RAFMFSSPTIMVTTPDACKQVLMDDDTFVTGWPKATVALIGPKSFINMGYDEHRRLRKLT  147

Query  514  AAPVNGHEALSFYIDYIEQNVKIALEKWASMG-EIEFLTQL  633
            AAP+NG +AL+ Y+ +I+  V   L  W+  G + EFLT+L
Sbjct  148  AAPINGFDALTSYLGFIDHTVVTTLRGWSDRGSDFEFLTEL  188



>gb|ADZ55287.1| ent-kaurene acid oxidase [Triticum aestivum]
Length=492

 Score =   193 bits (490),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = +1

Query  154  NCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMY  333
            + WY+    LG  +R  LPPGD+GWP +G MW+FLRAFKS  PDSFI SF  R+   G+Y
Sbjct  29   HAWYWT-ASLGAGRRGRLPPGDMGWPLVGGMWAFLRAFKSGRPDSFIDSFARRFRRAGLY  87

Query  334  KAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLT  513
            +AFMF SP+I+VTTP+AC++VL DD+ F  GWP +T+ LIG KSF+ + ++EH+RLRKLT
Sbjct  88   RAFMFSSPTILVTTPEACKQVLMDDDTFVTGWPKATVALIGPKSFVNMGYDEHRRLRKLT  147

Query  514  AAPVNGHEALSFYIDYIEQNVKIALEKWASMG-EIEFLTQL  633
            AAP+NG +AL+ Y+ +I++ V   L  WA  G + EFLT+L
Sbjct  148  AAPINGFDALTSYLGFIDETVVTTLRGWADRGSDFEFLTEL  188



>gb|AAL50602.1| DWARF3 [Zea mays]
 gb|AAL50603.1| DWARF3 [Zea mays]
Length=394

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I++ V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDRTVTSSLRAWADHGGSVEFLTEL  152



>ref|XP_002436354.1| hypothetical protein SORBIDRAFT_10g000920 [Sorghum bicolor]
 gb|EER87721.1| hypothetical protein SORBIDRAFT_10g000920 [Sorghum bicolor]
Length=505

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 123/169 (73%), Gaps = 9/169 (5%)
 Frame = +1

Query  151  VNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGM  330
             + WY E   LG  +R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+
Sbjct  32   AHGWYRE-APLGAARRARLPPGEMGWPVVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGV  90

Query  331  YKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKL  510
            Y+ FMF SP+++VTTP+AC++VL DD+AF  GWP +T+ LIG KSF+ + ++EH+RLRKL
Sbjct  91   YRGFMFSSPTVLVTTPEACKQVLMDDDAFVTGWPKATVALIGPKSFVAMPYDEHRRLRKL  150

Query  511  TAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE--------IEFLTQL  633
            TAAP+NG +AL+ Y+ +I++ V  +L  WA            +EFLT+L
Sbjct  151  TAAPINGFDALTAYLPFIDRTVTSSLRAWADESSSGAGAGTGVEFLTEL  199



>gb|AAL50620.1| DWARF3 [Zea mays]
Length=394

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I++ V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDRTVTSSLRAWADHGGSVEFLTEL  152



>ref|XP_008238332.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Prunus mume]
Length=493

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 125/166 (75%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L R N WY+   +LG+KK  +LPPGD+GWPFIGN  SFL+A KS++PDSFIS+   RYG
Sbjct  23   ILKRANEWYFVS-RLGEKKN-TLPPGDMGWPFIGNTLSFLKALKSNDPDSFISNCFKRYG  80

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
            +TG+YKA++FG P+II T P+ CR+VL D   F+ GWP +T EL+GRKSF+ +  EEHKR
Sbjct  81   STGIYKAYLFGKPTIIATAPETCRQVLMDSLQFKTGWPKATAELMGRKSFVTLPEEEHKR  140

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LRKLTAAP++GH+ALS Y +YI+     +L++ A     IEFL+++
Sbjct  141  LRKLTAAPISGHKALSMYHEYIKHVTVSSLDELAKADRPIEFLSEI  186



>gb|AAL50601.1| DWARF3 [Zea mays]
 gb|AAL50613.1| DWARF3 [Zea mays]
Length=394

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG  +R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGSARRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I++ V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDRTVTSSLRAWADHGGSVEFLTEL  152



>ref|XP_003580920.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Brachypodium distachyon]
Length=493

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 122/165 (74%), Gaps = 4/165 (2%)
 Frame = +1

Query  148  RVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATG  327
            + + WY+    LG ++R  LPPGD+GWP +G MW+FLRAFKS  PD+FI S V RYG TG
Sbjct  23   KAHAWYWVG-SLGAERRARLPPGDMGWPLVGGMWAFLRAFKSGKPDAFIDSLVGRYGRTG  81

Query  328  MYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISF--EEHKRL  501
            +Y++FM+ SPS++VTTP+AC++VL DD AF  GWP +T+ LIG +SF   +   +EH+RL
Sbjct  82   LYRSFMYSSPSVLVTTPEACKKVLMDDVAFVNGWPEATLNLIGTRSFTSPAMPRDEHRRL  141

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            RKLTAAPVNG  AL+ Y+ +I+ NV   L +W+S  E +EFLT+L
Sbjct  142  RKLTAAPVNGSTALAAYLGFIDHNVTSTLRRWSSSSEPVEFLTEL  186



>gb|ACV91868.1| KAO1 [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 118/164 (72%), Gaps = 4/164 (2%)
 Frame = +1

Query  151  VNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGM  330
             + WY+    LG  +R  LPPGD+GWP +G MW+FLRAFKS  PDSFI SF  R+G  G+
Sbjct  28   AHAWYWT-ASLGAGRRGRLPPGDMGWPLVGGMWAFLRAFKSGRPDSFIDSFARRFGRAGL  86

Query  331  YKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKL  510
            Y+AFMF SP+I+ TTP+AC++VL DD+AF  GWP +T+ LIG KSF+ + ++EH+RLRKL
Sbjct  87   YRAFMFSSPTIMATTPEACKQVLMDDDAFVTGWPKATVALIGPKSFVNMGYDEHRRLRKL  146

Query  511  TAAPVNGHEALSFYIDYIEQNVKIALEKWASM---GEIEFLTQL  633
            TAAP+NG +AL+ Y+ +I+  V   L  W+     G  EFLT+L
Sbjct  147  TAAPINGFDALTSYLGFIDDTVVTTLRGWSERGGDGHFEFLTEL  190



>gb|AAL50594.1| DWARF3 [Zea mays]
Length=394

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG  +R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++F+F SP+
Sbjct  1    LGAARRARLPPGEMGWPLVGGMWAFLRAFKSDKPDAFIASFVRRFGRTGVYRSFIFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            +++TTP+ C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +A
Sbjct  61   VLLTTPEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I++ V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDRTVTSSLRAWADHGGSVEFLTEL  152



>sp|Q9AXH9.1|KAO1_HORVU RecName: Full=Ent-kaurenoic acid oxidase 1; AltName: Full=gpr5 
[Hordeum vulgare]
 gb|AAK11616.1|AF326277_1 ent-kaurenoic acid oxidase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88914.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 118/163 (72%), Gaps = 4/163 (2%)
 Frame = +1

Query  154  NCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMY  333
            + WY+    LG  +R  LPPGD+GWP +G MW+FLRAFKS  PDSFI SF  R+G  G+Y
Sbjct  29   HAWYWT-ASLGAGRRGRLPPGDMGWPLVGGMWAFLRAFKSGRPDSFIDSFARRFGRAGLY  87

Query  334  KAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLT  513
            +AFMF SP+I+ TTP+AC++VL DD+AF  GWP +T+ LIG KSF+ + ++EH+RLRKLT
Sbjct  88   RAFMFSSPTIMATTPEACKQVLMDDDAFVTGWPKATVALIGPKSFVNMGYDEHRRLRKLT  147

Query  514  AAPVNGHEALSFYIDYIEQNVKIALEKWASM---GEIEFLTQL  633
            AAP+NG +AL+ Y+ +I+  V   L  W+     G  EFLT+L
Sbjct  148  AAPINGFDALTSYLGFIDDTVVTTLRGWSERGGDGHFEFLTEL  190



>gb|AAL50591.1| DWARF3 [Zea mays]
 gb|AAL50598.1| DWARF3 [Zea mays]
 gb|AAL50618.1| DWARF3 [Zea mays]
Length=394

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG  +R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAARRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I++ V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDRTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50611.1| DWARF3 [Zea mays]
Length=394

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG  +R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAARRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I++ V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDRTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50608.1| DWARF3 [Zea mays]
Length=394

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG  +R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAARRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I++ V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDRTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50581.1| DWARF3 [Zea mays]
Length=394

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG  +R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGSARRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I + V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFINRTVTSSLRAWADHGGSVEFLTEL  152



>emb|CBY78887.1| KAO protein [Aegilops speltoides]
Length=492

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = +1

Query  154  NCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMY  333
            + WY+    LG  +R  LPPGD+GWP +G MW+FLRAFKS  PDSFI SF  R+   G+Y
Sbjct  29   HAWYWT-ASLGAGRRDRLPPGDMGWPLVGGMWAFLRAFKSGRPDSFIDSFARRFRRAGLY  87

Query  334  KAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLT  513
            +AFMF SP+I+VTTP+AC++VL DD+ F  GWP +T+ LIG KSF+ + ++EH+RLRKLT
Sbjct  88   RAFMFSSPTILVTTPEACKQVLMDDDTFVTGWPKATVALIGPKSFVNMGYDEHRRLRKLT  147

Query  514  AAPVNGHEALSFYIDYIEQNVKIALEKWASMG-EIEFLTQL  633
            AAP+NG +AL+ Y+ +I++ +   L  WA  G + EFLT+L
Sbjct  148  AAPINGFDALTSYLGFIDETMVTTLRGWADRGDDFEFLTEL  188



>ref|XP_004301697.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Fragaria vesca 
subsp. vesca]
Length=495

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 123/166 (74%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L R N WY   V    K + S+PPGDLGWPFIGN  SFL + K  +PDSF+S++V RYG
Sbjct  24   ILKRANEWYL--VSSLGKIQSSVPPGDLGWPFIGNTLSFLYSLKYGHPDSFVSNYVKRYG  81

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
              G+ KA++FG P+II T P+ CR++L+DD  F+PGWP ST +L+GR +F+G S EEHKR
Sbjct  82   QKGICKAYLFGKPTIIATAPEICRKILTDDTQFKPGWPKSTTKLLGRLAFMGSSAEEHKR  141

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LRKLTAAP++GH+ALS Y +YI+  V  +L++W+   E IEFLT++
Sbjct  142  LRKLTAAPISGHKALSMYHEYIKDVVVTSLDEWSKSEEPIEFLTEI  187



>gb|AAL50579.1| DWARF3 [Zea mays]
Length=394

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG  +R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAARRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP  T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKXTVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I++ V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDRTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50587.1| DWARF3 [Zea mays]
Length=394

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG  +R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAARRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I + V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFINRTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50589.1| DWARF3 [Zea mays]
Length=394

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG  +R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGSARRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTGEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I + V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFINRTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50621.1| DWARF3 [Zea mays]
Length=394

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG  +R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGSARRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASMG-EIEFLTQL  633
            L+ Y+ +I++ V  +L  WA  G  +EFLT++
Sbjct  121  LTGYLPFIDRTVTSSLRAWADHGASVEFLTEI  152



>gb|AAL50605.1| DWARF3 [Zea mays]
Length=394

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50606.1| DWARF3 [Zea mays]
Length=394

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50609.1| DWARF3 [Zea mays]
Length=394

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50600.1| DWARF3 [Zea mays]
Length=394

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50574.1| DWARF3 [Zea mays]
Length=394

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50584.1| DWARF3 [Zea mays]
Length=394

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50580.1| DWARF3 [Zea mays]
Length=394

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|ADZ55288.1| ent-kaurene acid oxidase [Triticum aestivum]
Length=491

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +1

Query  154  NCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMY  333
            + WY+    LG  +R  LPPGD+GWP +G MW+FLRAFKS  PDSFI SF   +G  G+Y
Sbjct  29   HAWYWT-ASLGAGRRGRLPPGDMGWPLVGGMWAFLRAFKSGRPDSFIDSFARWFGRAGLY  87

Query  334  KAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLT  513
            +AFMF SP+I+VTTPDAC++VL DD+ F  GWP +T+ LIG KSFI + ++EH+RLRKLT
Sbjct  88   RAFMFSSPTIMVTTPDACKQVLMDDDTFVTGWPKATIALIGPKSFISMGYDEHRRLRKLT  147

Query  514  AAPVNGHEALSFYIDYIEQNVKIALEKWASMG-EIEFLTQL  633
            AAP+NG +AL+ Y+ +I   V   L  W+  G + EFLT+L
Sbjct  148  AAPINGFDALTSYLAFIGHTVVTTLRGWSERGDDFEFLTEL  188



>gb|AAL50582.1| DWARF3 [Zea mays]
 gb|AAL50617.1| DWARF3 [Zea mays]
Length=394

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50575.1| DWARF3 [Zea mays]
 gb|AAL50588.1| DWARF3 [Zea mays]
Length=394

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50578.1| DWARF3 [Zea mays]
 gb|AAL50590.1| DWARF3 [Zea mays]
 gb|AAL50614.1| DWARF3 [Zea mays]
Length=394

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50595.1| DWARF3 [Zea mays]
Length=394

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50586.1| DWARF3 [Zea mays]
Length=394

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG  +R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGSARRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50592.1| DWARF3 [Zea mays]
Length=394

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>ref|XP_008356451.1| PREDICTED: ent-kaurenoic acid oxidase 2-like [Malus domestica]
Length=493

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            +   +L + N W + R KLG+ K  +LPPGDLGWPFIGN  SF++A KS +P+SFIS+ V
Sbjct  20   ALLLILKKANEWLFVR-KLGENKH-TLPPGDLGWPFIGNTLSFIKALKSDHPESFISNHV  77

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
             R+G+TG+YKA +FG P+IIVTT + C++VL D   F+ GWP ST EL+GRKSF+ +S E
Sbjct  78   KRFGSTGIYKACLFGKPTIIVTTAETCKQVLMDSLQFKTGWPKSTSELMGRKSFMSLSGE  137

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            EHKRLRKLTAAP++GH+ALS Y +YI+  +  +L++ A   + +EFLT++
Sbjct  138  EHKRLRKLTAAPISGHKALSMYHEYIKDVIVSSLDELAEAEKPVEFLTEI  187



>gb|AAL50576.1| DWARF3 [Zea mays]
Length=394

 Score =   188 bits (478),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50597.1| DWARF3 [Zea mays]
Length=394

 Score =   188 bits (477),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG  +R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAARRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50585.1| DWARF3 [Zea mays]
Length=394

 Score =   188 bits (477),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG  +R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAARRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVWRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I++ V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDRTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50599.1| DWARF3 [Zea mays]
Length=394

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWDFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50573.1| DWARF3 [Zea mays]
Length=394

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG +GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGQMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50610.1| DWARF3 [Zea mays]
Length=394

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW FLRA KS  PD FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWDFLRAXKSGKPDXFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I++ V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDRTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50577.1| DWARF3 [Zea mays]
Length=394

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LP G++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPLGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I++ V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDRTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50604.1| DWARF3 [Zea mays]
Length=394

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW FLRA KS  PD FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWDFLRAXKSGKPDXFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I++ V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDRTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50607.1| DWARF3 [Zea mays]
Length=394

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW FLRA+KS  PD+FI SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWDFLRAYKSGKPDTFIDSFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50615.1| DWARF3 [Zea mays]
Length=394

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG  +R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++F F SP+
Sbjct  1    LGSARRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFTFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C +VL DD+AF  GWP +T+ L+G +SF+ I  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCNQVLMDDDAFVTGWPKATVALVGPRSFVPIPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I++ V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDRTVTSSLRAWADHGGSVEFLTEL  152



>ref|XP_003611463.1| Cytochrome P450 ent-kaurenoic acid oxidase [Medicago truncatula]
 gb|AES94421.1| cytochrome P450 family ent-kaurenoic acid oxidase [Medicago truncatula]
Length=491

 Score =   187 bits (476),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 121/165 (73%), Gaps = 4/165 (2%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGA  321
            L R+N WYY   +LG  K  +LPPGD+GWPF GNM +FL+AFKS++PDSFI++ VSRYG 
Sbjct  27   LRRLNEWYYVG-RLG--KSQNLPPGDMGWPFFGNMPTFLKAFKSADPDSFINNLVSRYGK  83

Query  322  TGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRL  501
            TGMY+  +FGSPSIIV TP+ CR+VL+D+E  + G+P STM L G++SF GIS  EHKRL
Sbjct  84   TGMYRTHLFGSPSIIVCTPETCRKVLTDEENLKVGYPHSTMVLTGKRSFHGISNSEHKRL  143

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            R+L  +P+NG EALS YI  IE +    LE+ + M    EFL ++
Sbjct  144  RRLITSPINGDEALSTYISLIEDSAVKHLEELSKMNTPCEFLKEM  188



>ref|XP_004973029.1| PREDICTED: cytochrome P450 88A1-like [Setaria italica]
Length=511

 Score =   188 bits (477),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 116/146 (79%), Gaps = 4/146 (3%)
 Frame = +1

Query  208  PPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPSIIVTTPDAC  387
            PPG++GWP +G MW+FLRAFKS  PD+F++SF+ R+G TG+Y+AFMF SP+I+VTTP+AC
Sbjct  59   PPGEMGWPVVGAMWAFLRAFKSGKPDAFVASFIRRFGRTGVYRAFMFSSPTILVTTPEAC  118

Query  388  RRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEALSFYIDYIE  567
            ++VL DD+ F  GWP +T+ LIG KSF+ + ++EH+RLRKLTAAP+NG +AL+ Y+ +I+
Sbjct  119  KQVLMDDDGFVTGWPKATVALIGPKSFVAMPYDEHRRLRKLTAAPINGFDALTAYLPFID  178

Query  568  QNVKIALEKW----ASMGEIEFLTQL  633
            + V  +L  W    A  GE+EFLT+L
Sbjct  179  RTVTSSLRAWSGECADGGEVEFLTEL  204



>ref|XP_003516638.1| PREDICTED: beta-amyrin 11-oxidase-like [Glycine max]
 gb|KHN42618.1| Ent-kaurenoic acid oxidase 2 [Glycine soja]
Length=493

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 117/166 (70%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            +L RVN WYY   +L  K +  LPPG LGWP +GNM +FLRAFKS NPDSFI   VSRYG
Sbjct  24   LLRRVNEWYYVS-RLQGKLQHPLPPGHLGWPLLGNMPTFLRAFKS-NPDSFIYDLVSRYG  81

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             TGMY+ ++FGSPSIIV TP+ CR+VL+DDE  + G+P ST  L G++S  GIS  EHKR
Sbjct  82   RTGMYRTYLFGSPSIIVCTPETCRKVLTDDENLKLGYPPSTTALTGKRSLHGISNAEHKR  141

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+L  +P+ GHEALS YI  IE      LE+ +SM    EFLT+L
Sbjct  142  LRRLITSPITGHEALSTYIGLIEHASVKRLEELSSMNTPCEFLTEL  187



>gb|AAL50619.1| DWARF3 [Zea mays]
Length=394

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++ WP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMWWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50593.1| DWARF3 [Zea mays]
Length=394

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 115/151 (76%), Gaps = 1/151 (1%)
 Frame = +1

Query  184  GDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPSI  363
            G  +R  LPPG++GWP +G MW FLRA KS  PD FI+SFV R+G TG+Y++FMF SP++
Sbjct  2    GAXRRARLPPGEMGWPLVGGMWDFLRAXKSGXPDXFIASFVRRFGRTGVYRSFMFSSPTV  61

Query  364  IVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEAL  543
            +VTT + C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +AL
Sbjct  62   LVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDAL  121

Query  544  SFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            + Y+ +I++ V  +L  WA   G +EFLT+L
Sbjct  122  TGYLPFIDRTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50616.1| DWARF3 [Zea mays]
Length=394

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT +  ++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGRKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50596.1| DWARF3 [Zea mays]
Length=394

 Score =   183 bits (465),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = +1

Query  184  GDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPSI  363
            G  +R  LPP ++GWP +G MW FLRA+KS  PD+FI+SFV R+G TG+Y++FMF SP++
Sbjct  2    GXARRARLPPXEMGWPLVGGMWDFLRAYKSGMPDTFIASFVRRFGRTGVYRSFMFSSPTV  61

Query  364  IVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEAL  543
            +VTT + C++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +AL
Sbjct  62   LVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDAL  121

Query  544  SFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            + Y+ +I++ V  +L  WA   G +EFLT+L
Sbjct  122  TGYLPFIDRTVTSSLRAWADHGGSVEFLTEL  152



>gb|AAL50583.1| DWARF3 [Zea mays]
Length=394

 Score =   183 bits (464),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 115/152 (76%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPP D+GWP +G MW++LRA KS  PD FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPXDMGWPLVGGMWAYLRAXKSGKPDXFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT + C++VL DD+AF  GWP +T+ L+G +SF+ +  +EH+R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGCKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDEHRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>ref|XP_003561220.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X1 [Brachypodium 
distachyon]
Length=501

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 124/170 (73%), Gaps = 6/170 (4%)
 Frame = +1

Query  136  WVLGRVNCWYYER-VKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSR  312
            W + R + W++ + +  G K RL  P GD+GWP +G MW+FLRAFKS +PD+FI+SF  R
Sbjct  27   WAVRRGHGWWWTKGMDAGRKGRL--PAGDMGWPLVGGMWAFLRAFKSGDPDAFINSFHHR  84

Query  313  YGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEH  492
            +G  G+Y+AFMF SP+I+VT+PDAC++VL DD  F  GWP +T+ LIG +SFI +  EEH
Sbjct  85   FGRAGLYRAFMFSSPTILVTSPDACKQVLMDDATFCTGWPKATVTLIGARSFISMPEEEH  144

Query  493  KRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE---IEFLTQL  633
            +RLRKLTAAP+NG +ALS Y+ +I+  V   L +W+S  +   IEFLT+L
Sbjct  145  RRLRKLTAAPINGFDALSAYLAFIDATVVSTLRRWSSETKTKPIEFLTEL  194



>ref|XP_004512204.1| PREDICTED: beta-amyrin 11-oxidase-like [Cicer arietinum]
Length=493

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 122/166 (73%), Gaps = 4/166 (2%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKK-RLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            L ++N WYY   +LG+ + +  LPPGD+GWPF+GNM +FL+AFKS +PDSFI  FVSRYG
Sbjct  27   LRKLNEWYYVS-RLGNMQMQYPLPPGDMGWPFLGNMPTFLKAFKS-DPDSFIYHFVSRYG  84

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             TGMYK  +FGSPSIIV TP+ CR+VL+D+E  + G+P STM L G++SF GIS  EHKR
Sbjct  85   RTGMYKTHLFGSPSIIVCTPETCRKVLTDEENLKLGYPPSTMALTGKRSFHGISNTEHKR  144

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMG-EIEFLTQL  633
            LR+L  +P+NGHEALS YI  IE      LE+ ++M    EFL ++
Sbjct  145  LRRLITSPINGHEALSSYIGLIENIAVKHLEELSTMDMPCEFLKEM  190



>emb|CDP12987.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 118/171 (69%), Gaps = 4/171 (2%)
 Frame = +1

Query  124  SSFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSF  303
            S  + +L + N W Y     G +K  +LPPGDLG+P IGNM+SF RAFK  NPDSFISSF
Sbjct  18   SIVYSLLRKTNDWIYVSPLGGLQK--TLPPGDLGFPLIGNMFSFFRAFKFGNPDSFISSF  75

Query  304  VSRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISF  483
             +RYG   MY+  +FG PSIIVTT +ACR+VL+ DE F PGWP S  +L+G++   G+S 
Sbjct  76   TTRYGQAPMYRTLLFGKPSIIVTTAEACRKVLT-DERFGPGWPRSVSDLVGKRGLHGVSN  134

Query  484  EEHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            +EHKRLR+L AAPV G EALS +I YIE   +   + WAS  E I+ LT++
Sbjct  135  QEHKRLRQLIAAPVAGQEALSLFIGYIEDIARTTFDTWASKDEPIQLLTEM  185



>gb|AAL50612.1| DWARF3 [Zea mays]
Length=394

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 116/152 (76%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  LGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPS  360
            LG ++R  LPPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+
Sbjct  1    LGAERRARLPPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPT  60

Query  361  IIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEA  540
            ++VTT +  ++VL DD+AF  GWP +T+ L+G +SF+ +  +E +R+RKLTAAP+NG +A
Sbjct  61   VLVTTAEGYKQVLMDDDAFVTGWPKATVALVGPRSFVAMPHDERRRIRKLTAAPINGFDA  120

Query  541  LSFYIDYIEQNVKIALEKWASM-GEIEFLTQL  633
            L+ Y+ +I+  V  +L  WA   G +EFLT+L
Sbjct  121  LTGYLPFIDSTVTSSLRAWADHGGSVEFLTEL  152



>ref|XP_004980663.1| PREDICTED: cytochrome P450 88A1-like [Setaria italica]
Length=510

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 115/146 (79%), Gaps = 4/146 (3%)
 Frame = +1

Query  208  PPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPSIIVTTPDAC  387
            PPG++GWP +G MW+FLRAFKS  PD+F++SF+ R+G TG+Y+AFMF +P+I+VTTP+AC
Sbjct  58   PPGEMGWPVVGAMWAFLRAFKSGKPDAFVASFIRRFGRTGVYRAFMFSNPTILVTTPEAC  117

Query  388  RRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEALSFYIDYIE  567
            ++VL DD+ F  GW  +T+ LIG KSF+ + ++EH+RLRKLTAAP+NG +AL+ Y+ +I+
Sbjct  118  KQVLMDDDGFVNGWLKATVALIGPKSFVAMPYDEHRRLRKLTAAPINGFDALTAYLPFID  177

Query  568  QNVKIALEKW----ASMGEIEFLTQL  633
            + V  +L  W    A  GE+EFLT+L
Sbjct  178  RTVTSSLRAWSGECADGGEVEFLTEL  203



>ref|XP_007039555.1| Cytochrome P450 88D6, putative [Theobroma cacao]
 gb|EOY24056.1| Cytochrome P450 88D6, putative [Theobroma cacao]
Length=597

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 113/153 (74%), Gaps = 2/153 (1%)
 Frame = +1

Query  178  KLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSP  357
            KLG KK+  LPPGD+GWPFIGNMWSFLRAFKS +PDSFI++ + R+G T +YK  +FGSP
Sbjct  144  KLG-KKQNPLPPGDMGWPFIGNMWSFLRAFKSQDPDSFINNLIKRHGRTSIYKTHLFGSP  202

Query  358  SIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHE  537
            S+IV +P+ CR+VL+DDE F  G+P S  +L G+KS  GIS  EH+RLR+LT  P+NGHE
Sbjct  203  SVIVCSPELCRKVLTDDEHFLFGYPSSATQLGGKKSLYGISNSEHRRLRRLTTDPINGHE  262

Query  538  ALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            AL+ YI +IE  V  +LE    M   I+F  ++
Sbjct  263  ALALYIGHIEDIVITSLEDLGGMNRPIKFFNEM  295



>ref|NP_001105586.1| cytochrome P450 88A1 [Zea mays]
 sp|Q43246.1|C88A1_MAIZE RecName: Full=Cytochrome P450 88A1; AltName: Full=Dwarf3 protein 
[Zea mays]
 gb|AAC49067.1| DWARF3 [Zea mays]
 gb|ACF86671.1| unknown [Zea mays]
 gb|AFW86170.1| dwarf plant3 [Zea mays]
Length=519

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = +1

Query  208  PPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPSIIVTTPDAC  387
            PPG++GWP +G MW+FLRAFKS  PD+FI+SFV R+G TG+Y++FMF SP+++VTT + C
Sbjct  73   PPGEMGWPLVGGMWAFLRAFKSGKPDAFIASFVRRFGRTGVYRSFMFSSPTVLVTTAEGC  132

Query  388  RRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEALSFYIDYIE  567
            ++VL DD+AF  GWP +T+ L+G +SF+ + ++EH+R+RKLTAAP+NG +AL+ Y+ +I+
Sbjct  133  KQVLMDDDAFVTGWPKATVALVGPRSFVAMPYDEHRRIRKLTAAPINGFDALTGYLPFID  192

Query  568  QNVKIALEKWASM-GEIEFLTQL  633
            + V  +L  WA   G +EFLT+L
Sbjct  193  RTVTSSLRAWADHGGSVEFLTEL  215



>ref|XP_006655700.1| PREDICTED: cytochrome P450 88A1-like [Oryza brachyantha]
Length=447

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 111/140 (79%), Gaps = 2/140 (1%)
 Frame = +1

Query  220  LGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPSIIVTTPDACRRVL  399
            +GWP +G MW+FLRAFKS NPD+FISSF+ R+G TG+Y+A+MF SP+I+  TP+ C++VL
Sbjct  1    MGWPVVGGMWAFLRAFKSGNPDAFISSFIRRFGRTGVYRAYMFSSPTILAVTPETCKQVL  60

Query  400  SDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEALSFYIDYIEQNVK  579
             DDEAF  GWP +T+ LIG KSF+ + +++H+RLRKLTAAP+NG +AL+ Y+ +I++ V 
Sbjct  61   MDDEAFVTGWPKATITLIGPKSFVNMPYDDHRRLRKLTAAPINGFDALTTYLGFIDRTVV  120

Query  580  IALEKWAS--MGEIEFLTQL  633
              L +W+S    E+EFLT+L
Sbjct  121  DTLRRWSSEPAAEVEFLTEL  140



>ref|XP_008375674.1| PREDICTED: ent-kaurenoic acid oxidase 1-like, partial [Malus 
domestica]
Length=422

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +1

Query  310  RYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEE  489
            R+G TG+YKAFMFG PS+IVTTP+  +RVL+DD+AF+PGWPVST+ELIG+KSFIGIS+EE
Sbjct  7    RFGKTGIYKAFMFGFPSVIVTTPETSKRVLTDDDAFKPGWPVSTVELIGKKSFIGISYEE  66

Query  490  HKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            HKRLRKLTAAPVNGHEALS Y+ YIE+ V  +LEKW+ MG+IEFLTQL
Sbjct  67   HKRLRKLTAAPVNGHEALSVYMKYIEEIVVRSLEKWSKMGQIEFLTQL  114



>gb|KCW77922.1| hypothetical protein EUGRSUZ_D02177 [Eucalyptus grandis]
Length=496

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGA  321
            L ++N W Y R KLG+K+  SLPPGD+GWPF+G M SF RAF+  +PDSFISSFV+RYG 
Sbjct  24   LRKINEWLYVR-KLGEKQ-YSLPPGDMGWPFLGKMLSFWRAFQFGDPDSFISSFVTRYGG  81

Query  322  TGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRL  501
             GMY+  MFG PSIIV+ P+ CRRVL+D+  F+  +P +T ELIG+KSF  +S   HK  
Sbjct  82   MGMYRTVMFGKPSIIVSMPETCRRVLADEVNFKLNYPKTTQELIGKKSFHDMSNTAHKHF  141

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            R+LTAA +NG E+LS YI +IE+ +  +L++WA M   IEF  ++
Sbjct  142  RRLTAAKINGSESLSMYIKHIEEIMIGSLDEWAKMERPIEFYEEM  186



>ref|XP_003581683.2| PREDICTED: ent-kaurenoic acid oxidase 1-like [Brachypodium distachyon]
Length=495

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 110/147 (75%), Gaps = 4/147 (3%)
 Frame = +1

Query  205  LPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPSIIVTTPDA  384
            LPPGD+GWP +G MW+FLRAFKS +PD+FI SF  R+G TGMY+AFMF SP+I+VT P+ 
Sbjct  29   LPPGDMGWPLVGGMWAFLRAFKSGDPDAFIESFHRRFGRTGMYRAFMFSSPTILVTLPEV  88

Query  385  CRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEALSFYIDYI  564
            C+RVL D+  F  GWP +T+ LIG KSF+ +  ++H+RLRKLTAAP+NG +ALS Y+ +I
Sbjct  89   CKRVLMDEVTFTNGWPKATVTLIGAKSFLNMPDDDHRRLRKLTAAPINGFDALSAYLTFI  148

Query  565  EQNVKIALEKWASMGE----IEFLTQL  633
            +  V   L +W+S       IEFLT+L
Sbjct  149  DSTVVSTLRRWSSETTASRPIEFLTEL  175



>ref|XP_009788182.1| PREDICTED: ent-kaurenoic acid oxidase 1-like, partial [Nicotiana 
sylvestris]
Length=219

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +1

Query  343  MFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAP  522
            MFGSPS+IVTTP+ACRRVL+DDEAF+PGWP +TM+LIG+KSFIGIS+EEHK LRKLTA P
Sbjct  1    MFGSPSVIVTTPEACRRVLTDDEAFKPGWPTATMKLIGKKSFIGISYEEHKWLRKLTATP  60

Query  523  VNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            VNGHEALS YI YIE+NV  AL+KWASMG+IEFLTQL
Sbjct  61   VNGHEALSMYIKYIEENVISALDKWASMGQIEFLTQL  97



>ref|XP_010053588.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X2 [Eucalyptus 
grandis]
Length=477

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 117/166 (70%), Gaps = 17/166 (10%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL RVN W Y R +LG+K R SLPPGD+GWP +G MWSFLRAF              R+G
Sbjct  24   VLKRVNEWIYMR-RLGEK-RGSLPPGDMGWPLVGKMWSFLRAF--------------RFG  67

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
            ATG+YK +MFGSPSIIV  P+ CRRVL+DD+ F+ G+P +   L GR+SF  IS  EHKR
Sbjct  68   ATGIYKTYMFGSPSIIVCKPETCRRVLTDDQNFKLGYPKAVRVLSGRRSFHSISNAEHKR  127

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+LTAAP+ G EALS Y+  IE+N+  +LE+W+S  + +EFLT +
Sbjct  128  LRRLTAAPITGSEALSMYVPGIEENIVASLEEWSSSDQPVEFLTGM  173



>ref|XP_009624148.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=407

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 106/140 (76%), Gaps = 2/140 (1%)
 Frame = +1

Query  220  LGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPSIIVTTPDACRRVL  399
            + WPFIGNM++F   FK  +PDSFIS F SRYG  GMYKAFMFG PSIIVT P+ CR++L
Sbjct  1    MSWPFIGNMFTFFTTFKYGDPDSFISYFTSRYGQGGMYKAFMFGMPSIIVTKPELCRKIL  60

Query  400  SDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEALSFYIDYIEQNVK  579
             DDE F+ GWP S + LIG+K+  GI+ +EHKRLR++T AP+ G +ALS Y+  IE+ VK
Sbjct  61   MDDENFELGWPESVLNLIGKKALHGITNQEHKRLRRITTAPIKGQQALSLYLGLIEEVVK  120

Query  580  IALEKWASMGE--IEFLTQL  633
             + EKWA +GE  +EF++++
Sbjct  121  SSYEKWAEIGENPVEFVSKM  140



>ref|XP_009589785.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=410

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +1

Query  328  MYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRK  507
            MYK  MFGSPS+IVTT +ACRRVL+DDEAF+PGWP STM+LIG+KSFIGIS+EEHK LRK
Sbjct  1    MYKTLMFGSPSVIVTTAEACRRVLTDDEAFKPGWPTSTMKLIGKKSFIGISYEEHKWLRK  60

Query  508  LTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            LTAAPVNGHEALS YI YIE+NV  ALEKWA+MG+IEFLTQL
Sbjct  61   LTAAPVNGHEALSMYIKYIEENVISALEKWATMGQIEFLTQL  102



>ref|XP_009624147.1| PREDICTED: ent-kaurenoic acid oxidase 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=449

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 106/140 (76%), Gaps = 2/140 (1%)
 Frame = +1

Query  220  LGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPSIIVTTPDACRRVL  399
            + WPFIGNM++F   FK  +PDSFIS F SRYG  GMYKAFMFG PSIIVT P+ CR++L
Sbjct  1    MSWPFIGNMFTFFTTFKYGDPDSFISYFTSRYGQGGMYKAFMFGMPSIIVTKPELCRKIL  60

Query  400  SDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEALSFYIDYIEQNVK  579
             DDE F+ GWP S + LIG+K+  GI+ +EHKRLR++T AP+ G +ALS Y+  IE+ VK
Sbjct  61   MDDENFELGWPESVLNLIGKKALHGITNQEHKRLRRITTAPIKGQQALSLYLGLIEEVVK  120

Query  580  IALEKWASMGE--IEFLTQL  633
             + EKWA +GE  +EF++++
Sbjct  121  SSYEKWAEIGENPVEFVSKM  140



>gb|KJB25348.1| hypothetical protein B456_004G187100 [Gossypium raimondii]
Length=402

 Score =   175 bits (444),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 116/165 (70%), Gaps = 6/165 (4%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGA  321
            L ++N WYY  V + +KK+  LPPG +GWPFIGNMWSF +A  S +PDSFI + V RYG 
Sbjct  24   LKKINEWYY--VTMSEKKQNPLPPGHMGWPFIGNMWSFFKASNSQDPDSFIDNLVKRYGR  81

Query  322  TGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRL  501
            T +Y+  +FGSPS+IV + + CR+VL+DDE F  G+P S ++L G+KS  GIS  EH+RL
Sbjct  82   TSIYRTHLFGSPSVIVCSQELCRKVLTDDEHFSYGYPSSAIQLGGKKSLYGISNSEHRRL  141

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            R+L A P+NGH+AL+    +IE  V  +LE+ A+M   I+F  ++
Sbjct  142  RRLRADPINGHQALAL---HIEDVVITSLEELATMNRPIKFFNEM  183



>ref|XP_008460072.1| PREDICTED: ent-kaurenoic acid oxidase 1-like, partial [Cucumis 
melo]
Length=418

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +1

Query  301  FVSRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGIS  480
            F  RYG TG+YKAFMFGSPS+IVT+P+ C+RVL+DDEAF PGWP+ST++LIG  SF+GIS
Sbjct  2    FCYRYGNTGVYKAFMFGSPSVIVTSPETCKRVLNDDEAFGPGWPLSTLKLIGENSFVGIS  61

Query  481  FEEHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            ++EHKRLR++TAAPVNG+EALS Y+ YIE+ V  +LEKWA MGEIEFLT+L
Sbjct  62   YQEHKRLRRITAAPVNGYEALSTYLTYIEKIVVSSLEKWAYMGEIEFLTEL  112



>ref|XP_006436760.1| hypothetical protein CICLE_v10031862mg [Citrus clementina]
 gb|ESR50000.1| hypothetical protein CICLE_v10031862mg [Citrus clementina]
Length=374

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  148  RVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATG  327
            RVN WY+   KLG+K+   LPPGD+GWPF+GNM SFLRA++S+NP++FI S V RYG TG
Sbjct  26   RVNEWYHVS-KLGEKRHF-LPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTG  83

Query  328  MYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRK  507
            +YK  +FG+PSIIV++P  CRRVL DDE F  G+  S   L G+ +F+ I+  EH+RLRK
Sbjct  84   VYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLAGKNTFVNIAKSEHRRLRK  143

Query  508  LTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE---IEFLTQ  630
            +  + +  HEAL  YI   E     +LE+WA+  +   IEF  +
Sbjct  144  MMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCE  187



>ref|XP_007209137.1| hypothetical protein PRUPE_ppa005745mg [Prunus persica]
 gb|EMJ10336.1| hypothetical protein PRUPE_ppa005745mg [Prunus persica]
Length=446

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 106/139 (76%), Gaps = 1/139 (1%)
 Frame = +1

Query  220  LGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKAFMFGSPSIIVTTPDACRRVL  399
            +GWPFIGN  SFL+A KS +PDSFIS+ V RYG+TG+YKA++FG P+II T P+ CR+VL
Sbjct  1    MGWPFIGNTLSFLKALKSDDPDSFISNCVKRYGSTGIYKAYLFGKPTIIATAPETCRQVL  60

Query  400  SDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAPVNGHEALSFYIDYIEQNVK  579
             D   F+ GWP +T EL+GRKSF+ +  EEHKRLR+LTAAP++GH+ALS Y +YI+    
Sbjct  61   MDSLQFKTGWPKATAELMGRKSFVTLPEEEHKRLRRLTAAPISGHKALSMYHEYIKHVTV  120

Query  580  IALEKWASMGE-IEFLTQL  633
             +L++ A     IEFL+++
Sbjct  121  SSLDELAKADRPIEFLSEI  139



>gb|KDO42213.1| hypothetical protein CISIN_1g012524mg [Citrus sinensis]
Length=415

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  148  RVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATG  327
            RVN WY+   KLG+K+   LPPGD+GWPF+GNM SFLRA++S+NP++FI S V RYG TG
Sbjct  26   RVNEWYHVS-KLGEKRHF-LPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTG  83

Query  328  MYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRK  507
            +YK  +FG+PSIIV++P  CRRVL DDE F  G+  S   L G+ +F+ I+  EH+RLRK
Sbjct  84   VYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLAGKNTFVNIAKSEHRRLRK  143

Query  508  LTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE---IEFLTQ  630
            +  + +  HEAL  YI   E     +LE+WA+  +   IEF  +
Sbjct  144  MMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCE  187



>gb|KDO42214.1| hypothetical protein CISIN_1g012524mg [Citrus sinensis]
Length=412

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  148  RVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATG  327
            RVN WY+   KLG+K+   LPPGD+GWPF+GNM SFLRA++S+NP++FI S V RYG TG
Sbjct  26   RVNEWYHVS-KLGEKRHF-LPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTG  83

Query  328  MYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRK  507
            +YK  +FG+PSIIV++P  CRRVL DDE F  G+  S   L G+ +F+ I+  EH+RLRK
Sbjct  84   VYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLAGKNTFVNIAKSEHRRLRK  143

Query  508  LTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE---IEFLTQ  630
            +  + +  HEAL  YI   E     +LE+WA+  +   IEF  +
Sbjct  144  MMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCE  187



>ref|XP_007156654.1| hypothetical protein PHAVU_002G005900g [Phaseolus vulgaris]
 gb|ESW28648.1| hypothetical protein PHAVU_002G005900g [Phaseolus vulgaris]
Length=492

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 117/169 (69%), Gaps = 9/169 (5%)
 Frame = +1

Query  130  FWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVS  309
            F W   RVN WYY   +LG K + +LPPG LGWPF+GNM +F RAFKS +PDSFI+  VS
Sbjct  29   FLW---RVNEWYYVS-RLGRKIQHTLPPGHLGWPFLGNMLTFFRAFKS-DPDSFINDLVS  83

Query  310  RYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEE  489
            RYG TG+Y+ F+F SPSIIV TP+ CR+VLSDDE  + G+P   + L G++SF GIS EE
Sbjct  84   RYGRTGIYRTFLFWSPSIIVCTPEICRKVLSDDEQLKLGYPA--LSLFGKRSFHGISNEE  141

Query  490  HKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            HKRLR+LT  P+ G +ALS YI   E      LE+ +SM    E LT+L
Sbjct  142  HKRLRRLTTPPITG-QALSTYIGLTEDASVKVLEELSSMTTPSELLTEL  189



>gb|KDO42212.1| hypothetical protein CISIN_1g012524mg [Citrus sinensis]
Length=343

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  148  RVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATG  327
            RVN WY+   KLG+K+   LPPGD+GWPF+GNM SFLRA++S+NP++FI S V RYG TG
Sbjct  26   RVNEWYHVS-KLGEKRHF-LPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTG  83

Query  328  MYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRK  507
            +YK  +FG+PSIIV++P  CRRVL DDE F  G+  S   L G+ +F+ I+  EH+RLRK
Sbjct  84   VYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLAGKNTFVNIAKSEHRRLRK  143

Query  508  LTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE---IEFLTQ  630
            +  + +  HEAL  YI   E     +LE+WA+  +   IEF  +
Sbjct  144  MMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCE  187



>ref|XP_006436761.1| hypothetical protein CICLE_v10031341mg [Citrus clementina]
 ref|XP_006485428.1| PREDICTED: beta-amyrin 11-oxidase-like [Citrus sinensis]
 gb|ESR50001.1| hypothetical protein CICLE_v10031341mg [Citrus clementina]
Length=491

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 114/166 (69%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL RVN WYY   KLG+ K  SLPPGD+GWP +GNM S  +AFKSS P SFI +   RYG
Sbjct  25   VLRRVNEWYYCG-KLGEMKH-SLPPGDMGWPLVGNMLSHQKAFKSSEPQSFIYNLFERYG  82

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
              G+Y+  +FGSP +IV  P+AC++V  DDE F+ G+P ST +L  R SFI  S E  KR
Sbjct  83   RKGIYRNHIFGSPCVIVVAPEACKQVFLDDENFKMGYPTSTNKLTFRGSFITASKEGQKR  142

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            +RKL  +P+ GH+A+  YID IE+ V  +L+ WAS+   IEFLT++
Sbjct  143  IRKLATSPLKGHKAIVVYIDNIEEIVIKSLKGWASLDTPIEFLTEM  188



>gb|KDO42211.1| hypothetical protein CISIN_1g012524mg [Citrus sinensis]
Length=455

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  148  RVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATG  327
            RVN WY+   KLG+K+   LPPGD+GWPF+GNM SFLRA++S+NP++FI S V RYG TG
Sbjct  26   RVNEWYHVS-KLGEKRHF-LPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTG  83

Query  328  MYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRK  507
            +YK  +FG+PSIIV++P  CRRVL DDE F  G+  S   L G+ +F+ I+  EH+RLRK
Sbjct  84   VYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLAGKNTFVNIAKSEHRRLRK  143

Query  508  LTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE---IEFLTQ  630
            +  + +  HEAL  YI   E     +LE+WA+  +   IEF  +
Sbjct  144  MMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCE  187



>gb|KDO42210.1| hypothetical protein CISIN_1g012524mg [Citrus sinensis]
Length=461

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  148  RVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATG  327
            RVN WY+   KLG+K+   LPPGD+GWPF+GNM SFLRA++S+NP++FI S V RYG TG
Sbjct  26   RVNEWYHVS-KLGEKRHF-LPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTG  83

Query  328  MYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRK  507
            +YK  +FG+PSIIV++P  CRRVL DDE F  G+  S   L G+ +F+ I+  EH+RLRK
Sbjct  84   VYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLAGKNTFVNIAKSEHRRLRK  143

Query  508  LTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE---IEFLTQ  630
            +  + +  HEAL  YI   E     +LE+WA+  +   IEF  +
Sbjct  144  MMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCE  187



>gb|KDO44740.1| hypothetical protein CISIN_1g011210mg [Citrus sinensis]
Length=491

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 114/166 (69%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL RVN WY+   KLG+ K  SLPPGD+GWP +GNM S  +AFKSS P SFI +   RYG
Sbjct  25   VLRRVNEWYHCG-KLGEMKH-SLPPGDMGWPLVGNMLSHQKAFKSSEPQSFIYNLFERYG  82

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
              G+Y+  +FGSP +IV  P+AC++V  DDE F+ G+P ST +L  R SFI  S E  KR
Sbjct  83   RKGIYRNHIFGSPCVIVVAPEACKQVFLDDENFKMGYPTSTNKLTFRGSFITASKEGQKR  142

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            +RKL  +P+ GH+A+  YID IE+ V  +L+ WAS+   IEFLT++
Sbjct  143  IRKLATSPLKGHKAIVVYIDNIEEIVIKSLKGWASLDTPIEFLTEM  188



>gb|KDO44742.1| hypothetical protein CISIN_1g011343mg [Citrus sinensis]
Length=356

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 112/157 (71%), Gaps = 3/157 (2%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGA  321
            L ++N WYY   +LG+KK  SLPPG++GWP +GNM S ++AF+SS+PDSFI   V RYG 
Sbjct  24   LKKINEWYYVG-RLGEKKN-SLPPGEMGWPLLGNMLSLIKAFRSSDPDSFIHCLVDRYGR  81

Query  322  TGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRL  501
            TG+YK+ +F SPSI+V TP+ C+ VL D+E F  G P ST EL+G+++ + +S EEHKRL
Sbjct  82   TGVYKSHLFWSPSIVVCTPETCKHVLMDNEKFGRGNPESTKELLGKQT-VSLSTEEHKRL  140

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE  612
            RKLT  P  G +AL+ Y+ YIE  V   L++  S+ +
Sbjct  141  RKLTTNPFRGDKALTMYVGYIEDIVIDMLDELGSINK  177



>ref|XP_008788752.1| PREDICTED: ent-kaurenoic acid oxidase 1-like, partial [Phoenix 
dactylifera]
Length=423

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +1

Query  280  PDSFISSFVSRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGR  459
            PDSFI+S++ R+   G+YKA+MFG+P+I+VTTP+ C++VL DDE F PGWP +T EL+G+
Sbjct  1    PDSFINSYIRRFSRVGIYKAYMFGTPTIMVTTPENCKQVLMDDEHFVPGWPKATCELVGK  60

Query  460  KSFIGISFEEHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            KSF+ I  EEHKRLR+LT+AP+NG EALS YI++IE  V   LEKWA MGEIEFLT+L
Sbjct  61   KSFLFIVHEEHKRLRRLTSAPINGFEALSTYIEFIEDTVVSTLEKWAGMGEIEFLTEL  118



>ref|XP_006485429.1| PREDICTED: beta-amyrin 11-oxidase-like [Citrus sinensis]
Length=491

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +1

Query  148  RVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATG  327
            RVN WY+   KLG+K+   LPPGD+GWPF+GNM SFLRA++S+NP++FI S V RYG TG
Sbjct  26   RVNEWYHVS-KLGEKRHF-LPPGDMGWPFLGNMPSFLRAYRSNNPETFIDSIVERYGRTG  83

Query  328  MYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRK  507
            +YK  +FG+PSIIV++P  CRRVL DDE F  G+  S   L G+ +F+ I+  EH+RLRK
Sbjct  84   VYKTHLFGNPSIIVSSPQTCRRVLMDDEKFGLGYGKSMTRLAGKNTFVNIAKSEHRRLRK  143

Query  508  LTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE---IEFLTQ  630
            +  + +  HEAL  YI   E     +LE+WA+  +   IEF  +
Sbjct  144  MMTSLMISHEALVMYIGNTEDVAIASLEEWAAASKDEPIEFFCE  187



>gb|KGN55788.1| hypothetical protein Csa_3G014360 [Cucumis sativus]
Length=255

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 108/166 (65%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL R+N  YY  +KLG KK   LPPGDL WP IG+  SFL+ F    PD FI  F  RYG
Sbjct  23   VLKRLNNLYYA-LKLG-KKWDELPPGDLSWPLIGSTLSFLKYFTFGPPDGFIRDFSRRYG  80

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
               MYK  +FG P++IV  P+ CR+VL+D+  F P +P S   + G+KS + +  EEH++
Sbjct  81   KIDMYKTHIFGKPTLIVCKPEICRQVLTDETKFIPSYPTSITAVFGKKSLLQVPKEEHRK  140

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+LT AP++GH AL  YID+IE  V   LE+W+SM + +E LT +
Sbjct  141  LRRLTMAPISGHAALEMYIDHIEHTVISGLEEWSSMKKPLELLTTI  186



>ref|XP_008799425.1| PREDICTED: ent-kaurenoic acid oxidase 1-like [Phoenix dactylifera]
Length=455

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  280  PDSFISSFVSRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGR  459
            PDSFI+S+V R+   G+YKA+MFG P+I+VT P+ C++VL DDE F PGWP +T ELIG+
Sbjct  31   PDSFINSYVRRFSRIGIYKAYMFGKPTIMVTIPETCKQVLMDDERFVPGWPKATCELIGK  90

Query  460  KSFIGISFEEHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            KSF+GI  EEHKRLR+LTAAP+NG EAL+ Y+++IE  V   L+KWA MGEIEFLT+L
Sbjct  91   KSFVGIIHEEHKRLRRLTAAPINGFEALTTYLEFIEGTVVSTLKKWAGMGEIEFLTEL  148



>gb|KGN55784.1| hypothetical protein Csa_3G011850 [Cucumis sativus]
Length=439

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 111/166 (67%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL R+N WYYE VKLG K    LPPG +GWPF+G+  SF++ + S  P +F+ +   RYG
Sbjct  23   VLKRLNDWYYE-VKLG-KLWPKLPPGHMGWPFVGSTLSFIKDYTSGQPQNFVKALQIRYG  80

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
               MYK  + G PSIIV TP+ CR+VL+++E F P  P + + L GRKS + ++  EH+R
Sbjct  81   KADMYKTHLLGRPSIIVYTPEICRQVLTNEEIFTPSLPKNIVILSGRKSLMQVTKAEHRR  140

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+LT AP++ H AL  YI+ IEQ V   LE+WASM   IE LT++
Sbjct  141  LRRLTTAPISSHTALEIYINDIEQTVMNGLEEWASMKSPIELLTEM  186



>gb|KJB25349.1| hypothetical protein B456_004G187200 [Gossypium raimondii]
Length=486

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 111/156 (71%), Gaps = 3/156 (2%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGA  321
            L ++N WYY   +LG KK+ +LPPGD+GWPFIGN+WSF +AF S +PD+F+ + + RYG 
Sbjct  24   LKKINEWYY-VTRLG-KKQNTLPPGDMGWPFIGNLWSFFKAFNSQDPDTFVENLIKRYGK  81

Query  322  TGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRL  501
            TG+Y+  +FG P IIV +P+ CR+ L+D+     G+P S  ++ G+KS  GIS  EH+RL
Sbjct  82   TGIYRTHLFGGPGIIVCSPELCRKALADEHVLF-GYPSSAKQIAGKKSLYGISTSEHRRL  140

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMG  609
            RK+   P++G EAL+ +I+ IE+ V  +LE+ A+M 
Sbjct  141  RKIATNPIHGDEALTSHIEDIERIVTTSLEELATMN  176



>ref|XP_006375612.1| hypothetical protein POPTR_0014s17720g [Populus trichocarpa]
 gb|ERP53409.1| hypothetical protein POPTR_0014s17720g [Populus trichocarpa]
Length=405

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +1

Query  343  MFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAP  522
            MFG+PS+ VTTP+ACRRVLS+D+AF+PGWP+ST++LIGRKSFI IS+EEHKRLR+LT+AP
Sbjct  1    MFGNPSVFVTTPEACRRVLSNDDAFKPGWPISTLKLIGRKSFIDISYEEHKRLRRLTSAP  60

Query  523  VNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            VNGHEALS YI YIE+NV   LEKW +MG+IEFLTQ+
Sbjct  61   VNGHEALSVYIPYIEENVIAMLEKWTTMGKIEFLTQV  97



>gb|KDO44741.1| hypothetical protein CISIN_1g011343mg [Citrus sinensis]
Length=488

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 112/157 (71%), Gaps = 3/157 (2%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGA  321
            L ++N WYY   +LG+KK  SLPPG++GWP +GNM S ++AF+SS+PDSFI   V RYG 
Sbjct  24   LKKINEWYYVG-RLGEKKN-SLPPGEMGWPLLGNMLSLIKAFRSSDPDSFIHCLVDRYGR  81

Query  322  TGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRL  501
            TG+YK+ +F SPSI+V TP+ C+ VL D+E F  G P ST EL+G+++ + +S EEHKRL
Sbjct  82   TGVYKSHLFWSPSIVVCTPETCKHVLMDNEKFGRGNPESTKELLGKQT-VSLSTEEHKRL  140

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE  612
            RKLT  P  G +AL+ Y+ YIE  V   L++  S+ +
Sbjct  141  RKLTTNPFRGDKALTMYVGYIEDIVIDMLDELGSINK  177



>ref|XP_006485427.1| PREDICTED: beta-amyrin 11-oxidase-like [Citrus sinensis]
Length=488

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 111/157 (71%), Gaps = 3/157 (2%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGA  321
            L ++N WYY   +LG+KK  SLPPG++GWP +GNM S ++AF+SS+PDSFI   V RYG 
Sbjct  24   LKKINEWYYVG-RLGEKKN-SLPPGEMGWPLLGNMLSLIKAFRSSDPDSFIHCLVDRYGR  81

Query  322  TGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRL  501
            TG+YK  +F SPSI+V TP+ C+ VL D+E F  G P ST EL+G+++ + +S EEHKRL
Sbjct  82   TGVYKGHLFWSPSIVVCTPETCKHVLMDNEKFGRGNPESTKELLGKQT-VSLSTEEHKRL  140

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE  612
            RKLT  P  G +AL+ Y+ YIE  V   L++  S+ +
Sbjct  141  RKLTTNPFRGDKALTMYVGYIEDIVIDMLDELGSINK  177



>ref|XP_008448713.1| PREDICTED: beta-amyrin 11-oxidase-like isoform X2 [Cucumis melo]
Length=427

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 108/166 (65%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            V+ R+N WYYE  KLG K    LPPGD+GWP +G+  SFL+ F S  P   + +   RYG
Sbjct  20   VMKRLNGWYYE-AKLG-KLWPKLPPGDMGWPILGSTLSFLKNFNSGQPRILLHNLSIRYG  77

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             + MYK  + G  SIIV T + CR+VL D+E F+P  P S   L GRKS + +   EH+R
Sbjct  78   KSDMYKTHLLGRASIIVCTSEVCRQVLCDEEKFKPSLPRSITLLSGRKSLMQVFKAEHRR  137

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+LT AP++GH AL  YI++IEQ V   LE+WASM + IE LT++
Sbjct  138  LRRLTMAPISGHSALEMYINHIEQTVISGLEEWASMKKPIELLTEI  183



>gb|KGN60411.1| hypothetical protein Csa_3G903510 [Cucumis sativus]
Length=392

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 114/168 (68%), Gaps = 4/168 (2%)
 Frame = +1

Query  133  WWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSR  312
            + +L  +N W++   + G  +R +LPPGD+GWP IG + SFL+AF+S  PD FI  F  +
Sbjct  20   FLILKNLNQWWF-ITRHG--RRYNLPPGDMGWPLIGTLLSFLQAFRSGRPDLFIHQFAYK  76

Query  313  YGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEH  492
            YG  GMYK ++FGSPS+IVT P+ CR VL +DE F  G+  +T  L G K+   +   EH
Sbjct  77   YGKIGMYKTYLFGSPSVIVTAPEVCRHVLMNDEQFGFGYSKATRILTGGKALNTVPRPEH  136

Query  493  KRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            +RLR+L A+ ++G+EALS YI ++E  V   LE+WASM + +EFL+++
Sbjct  137  RRLRRLIASLISGNEALSLYIGHVEGIVVTCLEEWASMKKPVEFLSEM  184



>ref|XP_003611462.1| Cytochrome P450 ent-kaurenoic acid oxidase [Medicago truncatula]
 gb|AES94420.1| cytochrome P450 family ent-kaurenoic acid oxidase [Medicago truncatula]
Length=490

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 110/164 (67%), Gaps = 6/164 (4%)
 Frame = +1

Query  142  LGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGA  321
            L R+N WYY   +LG  K  +LPPGD+GWPF GNM +F + +  S+PDS I + +SRYG 
Sbjct  27   LRRLNEWYYVG-RLG--KSQNLPPGDMGWPFFGNMPTFAK-YAKSDPDSLIYNLISRYGR  82

Query  322  TGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRL  501
            TGMY+  +FG P++IV +P+ CR VL D+E  +PG+P S M L G+KSF GIS  EHKRL
Sbjct  83   TGMYRTHLFGYPTVIVCSPETCRNVLKDEEHLKPGYPASAMALAGKKSFHGISSAEHKRL  142

Query  502  RKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQ  630
            RK+T +P+NGHE L  YI  IE  V   LE  +     +EFL +
Sbjct  143  RKVTTSPINGHE-LYNYIGLIEDIVVKNLEDSSKTNTPVEFLKE  185



>ref|XP_010323137.1| PREDICTED: ent-kaurenoic acid oxidase 1-like isoform X2 [Solanum 
lycopersicum]
Length=406

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +1

Query  343  MFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAAP  522
            MFGSP +I+TTP+ CR+VL+DDEAF+PGWP STMELIG+KSFIGIS+EEHK LRKLTAAP
Sbjct  1    MFGSPCVIITTPEGCRKVLNDDEAFKPGWPKSTMELIGKKSFIGISYEEHKWLRKLTAAP  60

Query  523  VNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            VNGHEALS YI YIE+ V  AL+KW+SM E+EFLT +
Sbjct  61   VNGHEALSMYIQYIEERVISALDKWSSMEEVEFLTHM  97



>ref|XP_008448712.1| PREDICTED: beta-amyrin 11-oxidase-like isoform X1 [Cucumis melo]
Length=488

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 108/166 (65%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            V+ R+N WYYE  KLG K    LPPGD+GWP +G+  SFL+ F S  P   + +   RYG
Sbjct  20   VMKRLNGWYYE-AKLG-KLWPKLPPGDMGWPILGSTLSFLKNFNSGQPRILLHNLSIRYG  77

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             + MYK  + G  SIIV T + CR+VL D+E F+P  P S   L GRKS + +   EH+R
Sbjct  78   KSDMYKTHLLGRASIIVCTSEVCRQVLCDEEKFKPSLPRSITLLSGRKSLMQVFKAEHRR  137

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+LT AP++GH AL  YI++IEQ V   LE+WASM + IE LT++
Sbjct  138  LRRLTMAPISGHSALEMYINHIEQTVISGLEEWASMKKPIELLTEI  183



>ref|XP_004148754.2| PREDICTED: beta-amyrin 11-oxidase-like isoform X2 [Cucumis sativus]
Length=427

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 106/166 (64%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            V+ R+N WYYE  KLG K    LPPGD+GWP +G   S+L+ F S  P   + +   RYG
Sbjct  20   VMKRLNGWYYE-AKLG-KLWPKLPPGDMGWPILGVTLSYLKNFSSGQPRILLHNLSIRYG  77

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             + MYK  + G  SIIV T + CR+VL D+E F+P  P S   L GRKS + +   EH+R
Sbjct  78   KSDMYKTHLLGRASIIVCTSEVCRQVLCDEEKFKPSLPRSITLLSGRKSLMQVFKAEHRR  137

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+LT AP++GH AL  YI++IEQ V   LE+WASM   IE LT++
Sbjct  138  LRRLTTAPISGHSALEMYINHIEQTVISGLEEWASMKRPIELLTEI  183



>ref|XP_002975682.1| ent-Kaurenoic acid hydroxylase [Selaginella moellendorffii]
 gb|EFJ23311.1| ent-Kaurenoic acid hydroxylase [Selaginella moellendorffii]
Length=480

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = +1

Query  160  WYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKA  339
            WY  ++K G   +  LPPG LGWP  GNM SFLRAFKS NPDSFI++++ +Y  TG+YKA
Sbjct  28   WYEPKLKPG---QAPLPPGSLGWPIFGNMASFLRAFKSHNPDSFITNYLHKYDRTGVYKA  84

Query  340  FMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAA  519
            F+F  P+++ TTP+ C+ VLS D  F+ GWP ST  LIG +SF G++ EEH +LR+LT  
Sbjct  85   FLFWQPTVLATTPETCKVVLSRDSLFETGWPSSTRRLIGTRSFAGVTGEEHLKLRRLTEP  144

Query  520  PVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
             ++  +AL  YI  +  N+K  LE+W+       L ++
Sbjct  145  ALSNPKALEDYIPRMSSNIKSCLEEWSCQERTLLLKEM  182



>ref|XP_002993510.1| hypothetical protein SELMODRAFT_1840, partial [Selaginella moellendorffii]
 gb|EFJ05402.1| hypothetical protein SELMODRAFT_1840, partial [Selaginella moellendorffii]
Length=458

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = +1

Query  160  WYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGMYKA  339
            WY  ++K G   +  LPPG LGWP  GNM SFLRAFKS NPDSFI+ ++ +Y  TG+YKA
Sbjct  8    WYEPKLKPG---QAPLPPGSLGWPIFGNMASFLRAFKSHNPDSFITKYLHKYDRTGVYKA  64

Query  340  FMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKLTAA  519
            F+F  P+++ TTP+ C+ VLS D  F+ GWP ST  LIG +SF G++ EEH +LR+LT  
Sbjct  65   FLFWQPTVLATTPETCKVVLSRDSLFETGWPSSTRRLIGTRSFAGVTGEEHLKLRRLTEP  124

Query  520  PVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
             ++  +AL  YI  +  N+K  LE+W+       L ++
Sbjct  125  ALSNPKALEDYIPRMSSNIKSCLEEWSCQERTLLLREM  162



>ref|XP_011652889.1| PREDICTED: beta-amyrin 11-oxidase-like [Cucumis sativus]
Length=491

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 114/168 (68%), Gaps = 4/168 (2%)
 Frame = +1

Query  133  WWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSR  312
            + +L  +N W++   + G  +R +LPPGD+GWP IG + SFL+AF+S  PD FI  F  +
Sbjct  20   FLILKNLNQWWF-ITRHG--RRYNLPPGDMGWPLIGTLLSFLQAFRSGRPDLFIHQFAYK  76

Query  313  YGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEH  492
            YG  GMYK ++FGSPS+IVT P+ CR VL +DE F  G+  +T  L G K+   +   EH
Sbjct  77   YGKIGMYKTYLFGSPSVIVTAPEVCRHVLMNDEQFGFGYSKATRILTGGKALNTVPRPEH  136

Query  493  KRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            +RLR+L A+ ++G+EALS YI ++E  V   LE+WASM + +EFL+++
Sbjct  137  RRLRRLIASLISGNEALSLYIGHVEGIVVTCLEEWASMKKPVEFLSEM  184



>ref|XP_008465946.1| PREDICTED: beta-amyrin 11-oxidase-like [Cucumis melo]
Length=491

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 114/168 (68%), Gaps = 4/168 (2%)
 Frame = +1

Query  133  WWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSR  312
            + +L  +N W++   + G  +R +LPPGD+GWP IG +  FL+AF+S  PDSFI  F  +
Sbjct  20   FLILRNLNQWWFV-TRHG--RRYNLPPGDMGWPLIGTLLPFLQAFRSGRPDSFIHLFAYK  76

Query  313  YGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEH  492
            YG  GMYK ++FGSPS+IVT P+ CR VL +DE F  G+  +T  L G K+   +   EH
Sbjct  77   YGKIGMYKTYLFGSPSVIVTVPEVCRHVLMNDEQFGFGYSKATRILTGSKALNTVPKPEH  136

Query  493  KRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            +RLR+L A+ ++G+EALS YI ++E  V   LE+WASM + +EFL+++
Sbjct  137  RRLRRLIASLISGNEALSLYIGHVEGIVVTCLEEWASMKKPVEFLSEM  184



>ref|XP_011650352.1| PREDICTED: beta-amyrin 11-oxidase-like isoform X1 [Cucumis sativus]
Length=488

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 106/166 (64%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            V+ R+N WYYE  KLG K    LPPGD+GWP +G   S+L+ F S  P   + +   RYG
Sbjct  20   VMKRLNGWYYE-AKLG-KLWPKLPPGDMGWPILGVTLSYLKNFSSGQPRILLHNLSIRYG  77

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
             + MYK  + G  SIIV T + CR+VL D+E F+P  P S   L GRKS + +   EH+R
Sbjct  78   KSDMYKTHLLGRASIIVCTSEVCRQVLCDEEKFKPSLPRSITLLSGRKSLMQVFKAEHRR  137

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+LT AP++GH AL  YI++IEQ V   LE+WASM   IE LT++
Sbjct  138  LRRLTTAPISGHSALEMYINHIEQTVISGLEEWASMKRPIELLTEI  183



>ref|XP_002988455.1| kaurenoic acid oxidase [Selaginella moellendorffii]
 gb|EFJ10545.1| kaurenoic acid oxidase [Selaginella moellendorffii]
Length=475

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 107/161 (66%), Gaps = 5/161 (3%)
 Frame = +1

Query  154  NCWYYERV-KLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYGATGM  330
            N WYYE V K G      LPPG LGWP  GNM +FLRAFKS  PD+F++ +V++Y   G 
Sbjct  21   NKWYYEPVLKPGQP---PLPPGSLGWPVFGNMAAFLRAFKSGRPDTFMAHYVAKYNRVGF  77

Query  331  YKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKRLRKL  510
            YKAF+F  P+++  TP+AC+ VLS D +F+ GWP S +EL+GR SF G++ E H +LRKL
Sbjct  78   YKAFLFWQPTVLAATPEACKFVLSKD-SFETGWPESAVELMGRNSFAGLTGESHFKLRKL  136

Query  511  TAAPVNGHEALSFYIDYIEQNVKIALEKWASMGEIEFLTQL  633
            T   VN  +AL  Y+  I  N+K  L +W++  +I  LT++
Sbjct  137  TEPAVNSPKALEQYVPLIVNNIKACLARWSAQDKIVLLTEM  177



>gb|KEH40663.1| cytochrome P450 family 88 protein [Medicago truncatula]
Length=477

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 113/170 (66%), Gaps = 6/170 (4%)
 Frame = +1

Query  127  SFWWVLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFV  306
            +F W   R+N WYY  +KL  KK+  LPPG LGWP IGNM +F++ F S +PDSFI++ V
Sbjct  22   NFMW---RLNEWYY-NMKL-KKKQYPLPPGHLGWPLIGNMLAFVKDFSSGHPDSFITNLV  76

Query  307  SRYGATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFE  486
            S+ G TG+YK  +FGSPSII+   D CRRVL D E F+ G+P STME+IG KSF     +
Sbjct  77   SKNGRTGIYKTHLFGSPSIIICEADMCRRVLLDYETFKIGYPKSTMEVIGFKSFWSSVEK  136

Query  487  EHKRLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            EHK L++L +A   GH  L  Y+  IE  V  ++E+ +SM   +EFL ++
Sbjct  137  EHKGLKRLVSALTMGHNTLEMYLPRIEDIVINSMEEISSMNHPVEFLKEM  186



>ref|XP_008448717.1| PREDICTED: beta-amyrin 11-oxidase-like isoform X1 [Cucumis melo]
Length=497

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 109/167 (65%), Gaps = 4/167 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL R+N  YY  +KLG KK   LPPGDL WP +G+  SFL+ F    P+SFI+ F  RYG
Sbjct  23   VLKRLNNLYYA-LKLG-KKWDELPPGDLSWPLVGSTLSFLKYFTFGPPESFIADFSRRYG  80

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEA-FQPGWPVSTMELIGRKSFIGISFEEHK  495
               MYK  +FG P+IIV  P+ CR+VL  +EA F PG+P++   + GRKS   +  EEH+
Sbjct  81   KLDMYKTHIFGKPTIIVCKPEICRQVLLTEEAKFIPGYPITMTTIFGRKSLHQVPKEEHR  140

Query  496  RLRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            +LR+LT AP++GH AL  YID+IE  V   LE+W+   + +E LT +
Sbjct  141  KLRRLTTAPISGHAALEMYIDHIEHTVISGLEEWSRTEKPLELLTTI  187



>ref|XP_008448721.1| PREDICTED: beta-amyrin 11-oxidase-like isoform X2 [Cucumis melo]
Length=423

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 108/166 (65%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL R+N  YY  +KLG KK   LPPGDL WPFIG+  SFL+ F    P+SFI+ F  RYG
Sbjct  23   VLKRLNNLYYA-LKLG-KKWDELPPGDLSWPFIGSTLSFLKYFTFGPPESFIADFSRRYG  80

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
              GMYK  +FG+ +IIV  P+ CR+VL+D+  F P +  +   L G++S   +S EEH++
Sbjct  81   KVGMYKTHIFGNLTIIVCKPEICRQVLTDESKFIPAYHTTMKTLFGKRSLHQVSKEEHQK  140

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+L   P++GH +L  YID+IEQ      E+W+SM + +E LT +
Sbjct  141  LRRLITIPISGHASLEMYIDHIEQTAISGFEEWSSMEKPLELLTSI  186



>dbj|BAQ20602.1| ent-kaurenoic acid oxidase 1 [Lygodium japonicum]
Length=524

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 100/155 (65%), Gaps = 2/155 (1%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL R N WYYE        +  LPPGD+GWP  GNM  FL AFK  +P SFI +++ RY 
Sbjct  49   VLCRFNSWYYEPSL--RPSQAPLPPGDMGWPIFGNMLQFLFAFKWGDPQSFIGNYIKRYK  106

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
              G+YKA+MFG P+++ TTP+AC+ VL  DE F  GWP ST  L+GRKSF  I   EH+R
Sbjct  107  RIGVYKAYMFGQPTVLATTPEACKFVLMGDEVFASGWPKSTEALMGRKSFTSIPPHEHRR  166

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWAS  603
            LR+LT+A VNG  ALS ++  ++      + +WA+
Sbjct  167  LRRLTSATVNGPAALSKFMPRLQALATATMAQWAA  201



>ref|XP_008448720.1| PREDICTED: beta-amyrin 11-oxidase-like isoform X1 [Cucumis melo]
Length=496

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 108/166 (65%), Gaps = 3/166 (2%)
 Frame = +1

Query  139  VLGRVNCWYYERVKLGDKKRLSLPPGDLGWPFIGNMWSFLRAFKSSNPDSFISSFVSRYG  318
            VL R+N  YY  +KLG KK   LPPGDL WPFIG+  SFL+ F    P+SFI+ F  RYG
Sbjct  23   VLKRLNNLYYA-LKLG-KKWDELPPGDLSWPFIGSTLSFLKYFTFGPPESFIADFSRRYG  80

Query  319  ATGMYKAFMFGSPSIIVTTPDACRRVLSDDEAFQPGWPVSTMELIGRKSFIGISFEEHKR  498
              GMYK  +FG+ +IIV  P+ CR+VL+D+  F P +  +   L G++S   +S EEH++
Sbjct  81   KVGMYKTHIFGNLTIIVCKPEICRQVLTDESKFIPAYHTTMKTLFGKRSLHQVSKEEHQK  140

Query  499  LRKLTAAPVNGHEALSFYIDYIEQNVKIALEKWASMGE-IEFLTQL  633
            LR+L   P++GH +L  YID+IEQ      E+W+SM + +E LT +
Sbjct  141  LRRLITIPISGHASLEMYIDHIEQTAISGFEEWSSMEKPLELLTSI  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 955946848384