BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9866

Length=1084
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629702.1|  PREDICTED: polyadenylate-binding protein RBP...    385   5e-127   Nicotiana tomentosiformis
ref|XP_009765294.1|  PREDICTED: polyadenylate-binding protein RBP...    384   6e-127   Nicotiana sylvestris
ref|XP_006354957.1|  PREDICTED: polyadenylate-binding protein RBP...    383   2e-126   Solanum tuberosum [potatoes]
ref|XP_004238180.1|  PREDICTED: polyadenylate-binding protein RBP...    381   1e-125   Solanum lycopersicum
ref|XP_007222286.1|  hypothetical protein PRUPE_ppa005903mg             370   1e-121   Prunus persica
ref|XP_008220171.1|  PREDICTED: polyadenylate-binding protein RBP...    367   3e-120   Prunus mume [ume]
emb|CBI19566.3|  unnamed protein product                                362   8e-120   Vitis vinifera
ref|XP_009605325.1|  PREDICTED: polyadenylate-binding protein RBP...    363   4e-119   Nicotiana tomentosiformis
ref|XP_006374988.1|  RNA-binding protein 47                             363   5e-119   
ref|XP_012071696.1|  PREDICTED: polyadenylate-binding protein RBP...    363   5e-119   Jatropha curcas
ref|XP_008220170.1|  PREDICTED: polyadenylate-binding protein RBP...    363   7e-119   Prunus mume [ume]
ref|XP_003634360.1|  PREDICTED: polyadenylate-binding protein RBP...    361   3e-118   Vitis vinifera
ref|XP_006434827.1|  hypothetical protein CICLE_v10001214mg             361   5e-118   Citrus clementina [clementine]
emb|CAC69852.1|  nucleic acid binding protein                           361   8e-118   Nicotiana tabacum [American tobacco]
ref|XP_007017329.1|  RNA-binding protein 47C isoform 1                  360   1e-117   
ref|XP_007017331.1|  RNA-binding protein 47C isoform 3                  360   1e-117   
ref|XP_006473363.1|  PREDICTED: polyadenylate-binding protein RBP...    359   3e-117   Citrus sinensis [apfelsine]
ref|XP_002510266.1|  nuclear acid binding protein, putative             359   4e-117   Ricinus communis
ref|XP_010098709.1|  Polyadenylate-binding protein RBP47C               358   7e-117   Morus notabilis
emb|CDP01376.1|  unnamed protein product                                357   1e-116   Coffea canephora [robusta coffee]
ref|XP_011030480.1|  PREDICTED: polyadenylate-binding protein RBP...    357   2e-116   Populus euphratica
ref|XP_011030472.1|  PREDICTED: polyadenylate-binding protein RBP...    357   2e-116   Populus euphratica
ref|XP_011030463.1|  PREDICTED: polyadenylate-binding protein RBP...    357   2e-116   Populus euphratica
ref|XP_004291135.1|  PREDICTED: polyadenylate-binding protein RBP...    357   2e-116   Fragaria vesca subsp. vesca
ref|XP_004141245.1|  PREDICTED: polyadenylate-binding protein RBP...    357   2e-116   Cucumis sativus [cucumbers]
ref|XP_008361011.1|  PREDICTED: polyadenylate-binding protein RBP...    356   6e-116   
ref|XP_009370172.1|  PREDICTED: polyadenylate-binding protein RBP...    355   9e-116   Pyrus x bretschneideri [bai li]
gb|KJB58432.1|  hypothetical protein B456_009G209600                    355   9e-116   Gossypium raimondii
ref|XP_002302445.2|  RNA-binding protein 47                             354   1e-115   
ref|XP_008452518.1|  PREDICTED: polyadenylate-binding protein RBP...    354   2e-115   Cucumis melo [Oriental melon]
ref|XP_008357395.1|  PREDICTED: polyadenylate-binding protein RBP...    353   1e-114   
ref|XP_009367486.1|  PREDICTED: polyadenylate-binding protein RBP...    351   1e-114   Pyrus x bretschneideri [bai li]
ref|XP_008393835.1|  PREDICTED: polyadenylate-binding protein RBP...    352   2e-114   
ref|XP_009370171.1|  PREDICTED: polyadenylate-binding protein RBP...    352   3e-114   Pyrus x bretschneideri [bai li]
ref|XP_008357394.1|  PREDICTED: polyadenylate-binding protein RBP...    349   5e-114   
ref|XP_011013053.1|  PREDICTED: polyadenylate-binding protein RBP...    350   8e-114   Populus euphratica
ref|XP_011017227.1|  PREDICTED: polyadenylate-binding protein RBP...    349   1e-113   Populus euphratica
emb|CAN81343.1|  hypothetical protein VITISV_008697                     353   2e-113   Vitis vinifera
gb|KJB59840.1|  hypothetical protein B456_009G275200                    348   4e-113   Gossypium raimondii
gb|KJB63805.1|  hypothetical protein B456_010G017300                    347   9e-113   Gossypium raimondii
ref|XP_010268853.1|  PREDICTED: polyadenylate-binding protein RBP...    346   1e-112   Nelumbo nucifera [Indian lotus]
ref|XP_010268845.1|  PREDICTED: polyadenylate-binding protein RBP...    345   5e-112   Nelumbo nucifera [Indian lotus]
ref|XP_011083821.1|  PREDICTED: polyadenylate-binding protein RBP...    345   6e-112   Sesamum indicum [beniseed]
gb|KHN04518.1|  Polyadenylate-binding protein RBP47C                    343   6e-112   Glycine soja [wild soybean]
ref|XP_003523906.1|  PREDICTED: polyadenylate-binding protein RBP...    344   8e-112   Glycine max [soybeans]
gb|EYU25396.1|  hypothetical protein MIMGU_mgv1a006186mg                345   2e-111   Erythranthe guttata [common monkey flower]
gb|KHN12758.1|  Polyadenylate-binding protein RBP47C                    338   1e-110   Glycine soja [wild soybean]
ref|XP_010275610.1|  PREDICTED: polyadenylate-binding protein RBP...    341   1e-110   Nelumbo nucifera [Indian lotus]
ref|XP_010275609.1|  PREDICTED: polyadenylate-binding protein RBP...    340   5e-110   Nelumbo nucifera [Indian lotus]
ref|XP_010668311.1|  PREDICTED: polyadenylate-binding protein RBP...    342   6e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009764865.1|  PREDICTED: polyadenylate-binding protein RBP...    340   6e-110   Nicotiana sylvestris
gb|KCW68770.1|  hypothetical protein EUGRSUZ_F02369                     338   1e-109   Eucalyptus grandis [rose gum]
ref|XP_007160823.1|  hypothetical protein PHAVU_001G019600g             338   2e-109   Phaseolus vulgaris [French bean]
gb|KHN46301.1|  Polyadenylate-binding protein RBP47C                    335   2e-109   Glycine soja [wild soybean]
ref|XP_007136663.1|  hypothetical protein PHAVU_009G063200g             338   3e-109   Phaseolus vulgaris [French bean]
ref|XP_003549410.2|  PREDICTED: polyadenylate-binding protein RBP...    337   4e-109   Glycine max [soybeans]
ref|XP_010061775.1|  PREDICTED: polyadenylate-binding protein RBP...    338   6e-109   Eucalyptus grandis [rose gum]
gb|KHN22302.1|  Polyadenylate-binding protein RBP47C                    336   1e-108   Glycine soja [wild soybean]
ref|XP_004501589.1|  PREDICTED: polyadenylate-binding protein RBP...    334   7e-108   Cicer arietinum [garbanzo]
ref|XP_003544447.1|  PREDICTED: polyadenylate-binding protein RBP...    334   1e-107   Glycine max [soybeans]
gb|AGV54251.1|  RNA binding post-transcriptional regulator csx1 l...    329   9e-106   Phaseolus vulgaris [French bean]
ref|XP_004499084.1|  PREDICTED: polyadenylate-binding protein RBP...    322   5e-103   Cicer arietinum [garbanzo]
ref|XP_008444645.1|  PREDICTED: polyadenylate-binding protein RBP...    322   8e-103   Cucumis melo [Oriental melon]
ref|XP_004152729.1|  PREDICTED: polyadenylate-binding protein RBP47     321   2e-102   Cucumis sativus [cucumbers]
ref|XP_003528246.1|  PREDICTED: polyadenylate-binding protein RBP...    319   6e-102   
ref|XP_003603009.1|  RNA-binding protein                                319   7e-102   Medicago truncatula
gb|EPS64859.1|  nucleic acid binding protein                            317   2e-101   Genlisea aurea
ref|XP_006393576.1|  hypothetical protein EUTSA_v10011476mg             318   4e-101   
gb|AFK35123.1|  unknown                                                 315   3e-100   Medicago truncatula
gb|KEH40058.1|  polyadenylate-binding protein RBP47C                    315   3e-100   Medicago truncatula
ref|XP_006480131.1|  PREDICTED: polyadenylate-binding protein RBP...    312   6e-99    Citrus sinensis [apfelsine]
ref|XP_006423054.1|  hypothetical protein CICLE_v10028454mg             312   6e-99    Citrus clementina [clementine]
ref|XP_009391347.1|  PREDICTED: polyadenylate-binding protein RBP...    311   6e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007017333.1|  RNA-binding protein 47C isoform 5                  309   1e-98    
ref|XP_009417617.1|  PREDICTED: polyadenylate-binding protein RBP...    310   1e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007017330.1|  RNA-binding protein 47C isoform 2                  307   1e-97    
ref|XP_010500273.1|  PREDICTED: polyadenylate-binding protein RBP...    308   3e-97    Camelina sativa [gold-of-pleasure]
gb|KDO49116.1|  hypothetical protein CISIN_1g013061mg                   308   4e-97    Citrus sinensis [apfelsine]
ref|XP_007017332.1|  RNA-binding protein 47C isoform 4                  305   7e-97    
gb|KJB58433.1|  hypothetical protein B456_009G209600                    305   8e-97    Gossypium raimondii
ref|NP_175181.1|  RNA-binding protein 47C'                              306   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008813036.1|  PREDICTED: polyadenylate-binding protein RBP...    304   3e-96    Phoenix dactylifera
ref|XP_008782204.1|  PREDICTED: polyadenylate-binding protein RBP...    303   8e-96    Phoenix dactylifera
ref|XP_010461546.1|  PREDICTED: polyadenylate-binding protein RBP...    303   2e-95    Camelina sativa [gold-of-pleasure]
ref|NP_175180.1|  RNA-binding protein 47C                               302   3e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011623994.1|  PREDICTED: polyadenylate-binding protein RBP47     301   3e-95    Amborella trichopoda
gb|KCW68769.1|  hypothetical protein EUGRSUZ_F02369                     302   3e-95    Eucalyptus grandis [rose gum]
ref|XP_010479152.1|  PREDICTED: polyadenylate-binding protein RBP...    301   8e-95    Camelina sativa [gold-of-pleasure]
emb|CBI32444.3|  unnamed protein product                                297   3e-94    Vitis vinifera
ref|XP_010907889.1|  PREDICTED: polyadenylate-binding protein RBP47     298   8e-94    Elaeis guineensis
ref|XP_009794615.1|  PREDICTED: polyadenylate-binding protein RBP...    298   8e-94    Nicotiana sylvestris
ref|XP_009380242.1|  PREDICTED: polyadenylate-binding protein RBP...    297   1e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009794616.1|  PREDICTED: polyadenylate-binding protein RBP...    298   2e-93    Nicotiana sylvestris
ref|XP_002285031.1|  PREDICTED: polyadenylate-binding protein RBP...    297   2e-93    Vitis vinifera
ref|XP_010647773.1|  PREDICTED: polyadenylate-binding protein RBP...    297   2e-93    Vitis vinifera
sp|Q9LEB3.1|RBP47_NICPL  RecName: Full=Polyadenylate-binding prot...    297   2e-93    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_008797245.1|  PREDICTED: polyadenylate-binding protein RBP...    296   3e-93    Phoenix dactylifera
ref|XP_004230808.1|  PREDICTED: polyadenylate-binding protein RBP47     296   3e-93    Solanum lycopersicum
gb|EEE69858.1|  hypothetical protein OsJ_29658                          293   4e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009590296.1|  PREDICTED: polyadenylate-binding protein RBP47     297   4e-93    Nicotiana tomentosiformis
ref|XP_006346456.1|  PREDICTED: polyadenylate-binding protein RBP47     296   5e-93    Solanum tuberosum [potatoes]
ref|XP_009404023.1|  PREDICTED: polyadenylate-binding protein RBP...    295   9e-93    
dbj|BAD33940.1|  putative nucleic acid binding protein                  292   9e-93    Oryza sativa Japonica Group [Japonica rice]
emb|CAN74486.1|  hypothetical protein VITISV_029928                     296   1e-92    Vitis vinifera
gb|AAB92518.1|  putative RNA binding protein                            296   2e-92    Nicotiana tabacum [American tobacco]
dbj|BAG87507.1|  unnamed protein product                                291   4e-92    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001275480.1|  DNA binding protein ACBF-like                      292   5e-92    Solanum tuberosum [potatoes]
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...    303   9e-92    Elaeis guineensis
ref|XP_009390905.1|  PREDICTED: polyadenylate-binding protein RBP...    292   9e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006660711.1|  PREDICTED: polyadenylate-binding protein RBP...    290   2e-91    Oryza brachyantha
gb|EEC84714.1|  hypothetical protein OsI_31675                          290   3e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_010525621.1|  PREDICTED: polyadenylate-binding protein RBP...    292   4e-91    Tarenaya hassleriana [spider flower]
ref|XP_012089580.1|  PREDICTED: polyadenylate-binding protein RBP...    291   6e-91    Jatropha curcas
ref|XP_011088289.1|  PREDICTED: polyadenylate-binding protein RBP47     291   7e-91    Sesamum indicum [beniseed]
gb|KHN31058.1|  Polyadenylate-binding protein RBP47                     285   9e-91    Glycine soja [wild soybean]
ref|XP_010539063.1|  PREDICTED: polyadenylate-binding protein RBP...    290   9e-91    Tarenaya hassleriana [spider flower]
ref|NP_001063403.1|  Os09g0462700                                       291   1e-90    
ref|XP_008236618.1|  PREDICTED: polyadenylate-binding protein RBP...    291   2e-90    Prunus mume [ume]
gb|KFK36144.1|  hypothetical protein AALP_AA4G083000                    290   2e-90    Arabis alpina [alpine rockcress]
ref|NP_001275430.1|  DNA-binding protein-like                           290   2e-90    Solanum tuberosum [potatoes]
gb|AAC49850.1|  DNA binding protein ACBF                                289   3e-90    Nicotiana tabacum [American tobacco]
gb|ACF83065.1|  unknown                                                 285   4e-90    Zea mays [maize]
ref|XP_008236617.1|  PREDICTED: polyadenylate-binding protein RBP...    289   7e-90    Prunus mume [ume]
ref|XP_010540323.1|  PREDICTED: polyadenylate-binding protein RBP47B    288   7e-90    Tarenaya hassleriana [spider flower]
ref|XP_007199852.1|  hypothetical protein PRUPE_ppa005661mg             288   1e-89    Prunus persica
ref|XP_010327390.1|  PREDICTED: DNA-binding protein isoform X2          287   2e-89    Solanum lycopersicum
ref|XP_006349628.1|  PREDICTED: polyadenylate-binding protein RBP...    287   2e-89    Solanum tuberosum [potatoes]
ref|XP_002518798.1|  nuclear acid binding protein, putative             287   3e-89    Ricinus communis
gb|EMS62393.1|  Uncharacterized RNA-binding protein C23E6.01c           285   4e-89    Triticum urartu
ref|XP_002313840.2|  RNA-binding protein 47                             286   5e-89    Populus trichocarpa [western balsam poplar]
ref|XP_006307520.1|  hypothetical protein CARUB_v10009143mg             286   5e-89    Capsella rubella
ref|XP_004957051.1|  PREDICTED: polyadenylate-binding protein RBP...    286   6e-89    Setaria italica
ref|XP_006406535.1|  hypothetical protein EUTSA_v10020763mg             286   7e-89    Eutrema salsugineum [saltwater cress]
ref|XP_006384437.1|  hypothetical protein POPTR_0004s15080g             286   8e-89    Populus trichocarpa [western balsam poplar]
gb|EEE61093.1|  hypothetical protein OsJ_14988                          283   1e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011000065.1|  PREDICTED: polyadenylate-binding protein RBP47     285   1e-88    Populus euphratica
ref|XP_002446570.1|  hypothetical protein SORBIDRAFT_06g018280          285   1e-88    Sorghum bicolor [broomcorn]
ref|XP_003579863.1|  PREDICTED: polyadenylate-binding protein RBP...    285   1e-88    Brachypodium distachyon [annual false brome]
ref|XP_006349627.1|  PREDICTED: polyadenylate-binding protein RBP...    285   1e-88    Solanum tuberosum [potatoes]
ref|NP_001052934.2|  Os04g0449900                                       283   2e-88    
ref|XP_003578248.1|  PREDICTED: polyadenylate-binding protein RBP...    285   2e-88    Brachypodium distachyon [annual false brome]
ref|XP_003529385.1|  PREDICTED: polyadenylate-binding protein RBP...    285   2e-88    Glycine max [soybeans]
gb|EMT27298.1|  Putative RNA-binding protein                            280   3e-88    
gb|EMS68577.1|  Uncharacterized RNA-binding protein C23E6.01c           280   3e-88    Triticum urartu
gb|EAY94326.1|  hypothetical protein OsI_16094                          284   3e-88    Oryza sativa Indica Group [Indian rice]
emb|CAH67097.1|  H0818E04.14                                            284   3e-88    Oryza sativa [red rice]
gb|ACF87959.1|  unknown                                                 284   3e-88    Zea mays [maize]
ref|XP_006653468.1|  PREDICTED: polyadenylate-binding protein RBP...    283   4e-88    
gb|EMT16295.1|  Putative RNA-binding protein                            285   5e-88    
ref|XP_010327389.1|  PREDICTED: DNA-binding protein isoform X1          283   5e-88    
ref|NP_001144988.1|  uncharacterized protein LOC100278143               284   5e-88    Zea mays [maize]
ref|XP_008782206.1|  PREDICTED: polyadenylate-binding protein RBP...    281   8e-88    
dbj|BAJ85879.1|  predicted protein                                      284   1e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007156541.1|  hypothetical protein PHAVU_003G294800g             280   2e-87    Phaseolus vulgaris [French bean]
gb|KHN37491.1|  Polyadenylate-binding protein RBP47                     278   2e-87    Glycine soja [wild soybean]
ref|XP_004975779.1|  PREDICTED: polyadenylate-binding protein RBP...    282   2e-87    Setaria italica
ref|XP_011461514.1|  PREDICTED: polyadenylate-binding protein RBP...    282   3e-87    Fragaria vesca subsp. vesca
gb|KCW63816.1|  hypothetical protein EUGRSUZ_G01492                     282   3e-87    Eucalyptus grandis [rose gum]
ref|NP_001234487.1|  DNA-binding protein                                281   3e-87    
ref|XP_010066047.1|  PREDICTED: polyadenylate-binding protein RBP47     282   4e-87    
ref|XP_011004995.1|  PREDICTED: polyadenylate-binding protein RBP...    281   5e-87    Populus euphratica
ref|XP_007156542.1|  hypothetical protein PHAVU_003G294800g             279   6e-87    Phaseolus vulgaris [French bean]
ref|XP_003575198.1|  PREDICTED: polyadenylate-binding protein RBP...    280   9e-87    Brachypodium distachyon [annual false brome]
ref|XP_009628458.1|  PREDICTED: polyadenylate-binding protein RBP...    280   1e-86    Nicotiana tomentosiformis
ref|XP_006297697.1|  hypothetical protein CARUB_v10013726mg             280   2e-86    Capsella rubella
ref|XP_002885294.1|  RNA-binding protein 47B                            280   2e-86    
ref|XP_009783555.1|  PREDICTED: polyadenylate-binding protein RBP...    280   2e-86    Nicotiana sylvestris
gb|ACN40970.1|  unknown                                                 280   2e-86    Picea sitchensis
gb|KFK39248.1|  hypothetical protein AALP_AA3G219800                    280   2e-86    Arabis alpina [alpine rockcress]
gb|ACN39849.1|  unknown                                                 280   2e-86    Picea sitchensis
emb|CDY52067.1|  BnaA09g53390D                                          279   2e-86    Brassica napus [oilseed rape]
ref|XP_010519119.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    279   2e-86    Tarenaya hassleriana [spider flower]
ref|XP_009114049.1|  PREDICTED: polyadenylate-binding protein RBP...    279   3e-86    Brassica rapa
ref|XP_006297696.1|  hypothetical protein CARUB_v10013726mg             279   3e-86    Capsella rubella
ref|NP_001047180.1|  Os02g0567900                                       273   3e-86    
ref|XP_002891364.1|  ATRBP47C                                           279   4e-86    
emb|CDX95176.1|  BnaC09g16940D                                          278   4e-86    
ref|XP_009358068.1|  PREDICTED: polyadenylate-binding protein RBP...    277   6e-86    Pyrus x bretschneideri [bai li]
ref|XP_011092726.1|  PREDICTED: polyadenylate-binding protein RBP...    277   8e-86    Sesamum indicum [beniseed]
gb|ACG32072.1|  nucleic acid binding protein                            276   8e-86    Zea mays [maize]
ref|XP_004952707.1|  PREDICTED: polyadenylate-binding protein RBP...    278   9e-86    Setaria italica
ref|XP_003518846.1|  PREDICTED: polyadenylate-binding protein RBP...    278   9e-86    Glycine max [soybeans]
gb|EEC73442.1|  hypothetical protein OsI_07730                          274   1e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_009356988.1|  PREDICTED: polyadenylate-binding protein RBP...    278   1e-85    Pyrus x bretschneideri [bai li]
ref|XP_010442131.1|  PREDICTED: polyadenylate-binding protein RBP...    277   2e-85    Camelina sativa [gold-of-pleasure]
ref|XP_008813039.1|  PREDICTED: polyadenylate-binding protein RBP...    274   3e-85    Phoenix dactylifera
gb|ACF85767.1|  unknown                                                 276   3e-85    Zea mays [maize]
ref|XP_008813037.1|  PREDICTED: polyadenylate-binding protein RBP...    274   3e-85    
gb|KFK39249.1|  hypothetical protein AALP_AA3G219800                    276   3e-85    Arabis alpina [alpine rockcress]
ref|NP_001150649.1|  nucleic acid binding protein                       276   3e-85    Zea mays [maize]
ref|XP_010481964.1|  PREDICTED: polyadenylate-binding protein RBP...    276   4e-85    Camelina sativa [gold-of-pleasure]
gb|AAM67293.1|  nuclear acid binding protein, putative                  275   4e-85    Arabidopsis thaliana [mouse-ear cress]
ref|NP_188544.1|  RNA-binding protein 47B                               276   7e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008392304.1|  PREDICTED: polyadenylate-binding protein RBP47     275   2e-84    Malus domestica [apple tree]
ref|XP_011092727.1|  PREDICTED: polyadenylate-binding protein RBP...    273   2e-84    Sesamum indicum [beniseed]
ref|XP_004145357.2|  PREDICTED: polyadenylate-binding protein RBP47     274   3e-84    Cucumis sativus [cucumbers]
ref|XP_010494212.1|  PREDICTED: polyadenylate-binding protein RBP...    274   3e-84    Camelina sativa [gold-of-pleasure]
gb|ACL54800.1|  unknown                                                 270   3e-84    Zea mays [maize]
ref|XP_006279885.1|  hypothetical protein CARUB_v100264670mg            270   4e-84    
ref|XP_004294842.1|  PREDICTED: polyadenylate-binding protein RBP...    274   5e-84    Fragaria vesca subsp. vesca
ref|XP_002894197.1|  hypothetical protein ARALYDRAFT_474095             273   7e-84    
gb|EMT05029.1|  Putative RNA-binding protein                            269   8e-84    
ref|XP_006648763.1|  PREDICTED: polyadenylate-binding protein RBP...    271   1e-83    
ref|XP_010500505.1|  PREDICTED: polyadenylate-binding protein RBP...    273   1e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010523211.1|  PREDICTED: polyadenylate-binding protein RBP...    273   1e-83    Tarenaya hassleriana [spider flower]
ref|XP_010479396.1|  PREDICTED: polyadenylate-binding protein RBP...    273   1e-83    Camelina sativa [gold-of-pleasure]
emb|CDY22988.1|  BnaC03g40810D                                          272   1e-83    Brassica napus [oilseed rape]
ref|XP_010461802.1|  PREDICTED: polyadenylate-binding protein RBP...    273   1e-83    Camelina sativa [gold-of-pleasure]
dbj|BAD17764.1|  putative nucleic acid binding protein                  270   2e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010487839.1|  PREDICTED: polyadenylate-binding protein RBP...    272   2e-83    Camelina sativa [gold-of-pleasure]
gb|EEE57226.1|  hypothetical protein OsJ_07197                          272   3e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006393234.1|  hypothetical protein EUTSA_v10011485mg             271   3e-83    Eutrema salsugineum [saltwater cress]
ref|NP_175383.1|  RNA-binding protein 47A                               271   5e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010507446.1|  PREDICTED: polyadenylate-binding protein RBP...    271   5e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010487840.1|  PREDICTED: polyadenylate-binding protein RBP...    271   6e-83    Camelina sativa [gold-of-pleasure]
ref|XP_008667171.1|  PREDICTED: uncharacterized protein LOC100193...    270   6e-83    Zea mays [maize]
ref|XP_002452313.1|  hypothetical protein SORBIDRAFT_04g023540          270   7e-83    Sorghum bicolor [broomcorn]
emb|CDY18570.1|  BnaA01g26250D                                          270   7e-83    Brassica napus [oilseed rape]
ref|XP_010507452.1|  PREDICTED: polyadenylate-binding protein RBP...    270   1e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010466046.1|  PREDICTED: polyadenylate-binding protein RBP...    270   1e-82    Camelina sativa [gold-of-pleasure]
ref|XP_008459212.1|  PREDICTED: polyadenylate-binding protein RBP47     270   2e-82    Cucumis melo [Oriental melon]
ref|XP_003608019.1|  RNA Binding Protein                                270   2e-82    Medicago truncatula
emb|CDX95462.1|  BnaC01g33540D                                          269   3e-82    
ref|XP_009112131.1|  PREDICTED: polyadenylate-binding protein RBP...    269   3e-82    Brassica rapa
ref|XP_006307519.1|  hypothetical protein CARUB_v10009142mg             269   3e-82    Capsella rubella
gb|AFK40720.1|  unknown                                                 269   5e-82    Medicago truncatula
emb|CDO97156.1|  unnamed protein product                                267   1e-81    Coffea canephora [robusta coffee]
ref|XP_004505196.1|  PREDICTED: polyadenylate-binding protein RBP...    267   2e-81    Cicer arietinum [garbanzo]
dbj|BAB02953.1|  DNA/RNA binding protein-like                           268   4e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147873.1|  PREDICTED: polyadenylate-binding protein RBP47A    265   6e-81    Brassica rapa
ref|XP_009112124.1|  PREDICTED: polyadenylate-binding protein RBP...    266   7e-81    
ref|NP_001130489.1|  uncharacterized protein LOC100191587               265   8e-81    Zea mays [maize]
ref|XP_006434824.1|  hypothetical protein CICLE_v10001214mg             262   1e-80    
gb|KDO35910.1|  hypothetical protein CISIN_1g029152mg                   256   1e-80    Citrus sinensis [apfelsine]
ref|XP_008678713.1|  PREDICTED: polyadenylate-binding protein RBP...    264   1e-80    Zea mays [maize]
emb|CDY50959.1|  BnaA06g37550D                                          263   4e-80    Brassica napus [oilseed rape]
gb|ABK24911.1|  unknown                                                 262   4e-80    Picea sitchensis
ref|XP_009145825.1|  PREDICTED: polyadenylate-binding protein RBP...    263   4e-80    Brassica rapa
emb|CDY68866.1|  BnaCnng60840D                                          262   5e-80    Brassica napus [oilseed rape]
emb|CDX92304.1|  BnaA05g21030D                                          263   6e-80    
emb|CDY29341.1|  BnaA05g16080D                                          261   1e-79    Brassica napus [oilseed rape]
ref|XP_009135617.1|  PREDICTED: polyadenylate-binding protein RBP...    261   1e-79    Brassica rapa
emb|CDY28101.1|  BnaC06g02820D                                          261   2e-79    Brassica napus [oilseed rape]
gb|AAG13046.1|AC011807_5  Putative RNA binding protein                  262   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001132004.1|  uncharacterized protein LOC100193409               261   2e-79    Zea mays [maize]
gb|KFK31830.1|  hypothetical protein AALP_AA6G163800                    260   3e-79    Arabis alpina [alpine rockcress]
gb|KFK31829.1|  hypothetical protein AALP_AA6G163800                    260   3e-79    Arabis alpina [alpine rockcress]
emb|CDY16528.1|  BnaA08g02390D                                          260   4e-79    Brassica napus [oilseed rape]
ref|XP_009107272.1|  PREDICTED: polyadenylate-binding protein RBP...    259   8e-79    Brassica rapa
emb|CDX99265.1|  BnaC05g33800D                                          259   9e-79    
gb|EMS47480.1|  Uncharacterized RNA-binding protein C23E6.01c           254   9e-79    Triticum urartu
ref|XP_009783557.1|  PREDICTED: polyadenylate-binding protein RBP...    258   2e-78    Nicotiana sylvestris
ref|XP_009145104.1|  PREDICTED: polyadenylate-binding protein RBP...    258   3e-78    Brassica rapa
gb|EPS57677.1|  hypothetical protein M569_17140                         257   6e-78    Genlisea aurea
gb|KJB63806.1|  hypothetical protein B456_010G017300                    255   6e-78    Gossypium raimondii
gb|KJB79289.1|  hypothetical protein B456_013G042300                    258   6e-78    Gossypium raimondii
emb|CDY32840.1|  BnaC08g02620D                                          256   1e-77    Brassica napus [oilseed rape]
ref|XP_007042377.1|  RNA-binding protein 47A                            256   2e-77    
gb|EYU42664.1|  hypothetical protein MIMGU_mgv1a008163mg                254   3e-77    Erythranthe guttata [common monkey flower]
gb|KJB32435.1|  hypothetical protein B456_005G240800                    256   3e-77    Gossypium raimondii
gb|EYU36286.1|  hypothetical protein MIMGU_mgv1a005576mg                255   2e-76    Erythranthe guttata [common monkey flower]
gb|KJB47423.1|  hypothetical protein B456_008G025400                    252   2e-76    Gossypium raimondii
ref|XP_006487135.1|  PREDICTED: uncharacterized protein LOC102626638    255   5e-76    
gb|EYU37704.1|  hypothetical protein MIMGU_mgv1a006826mg                252   6e-76    Erythranthe guttata [common monkey flower]
gb|KFK35996.1|  hypothetical protein AALP_AA4G064500                    253   6e-76    Arabis alpina [alpine rockcress]
gb|KJB47422.1|  hypothetical protein B456_008G025400                    251   1e-75    Gossypium raimondii
gb|AEW68341.1|  putative nuclear acid binding protein                   251   1e-75    Medicago sativa [alfalfa]
ref|XP_001784132.1|  predicted protein                                  251   2e-75    
gb|KJB79291.1|  hypothetical protein B456_013G042300                    249   5e-75    Gossypium raimondii
ref|XP_009420609.1|  PREDICTED: polyadenylate-binding protein RBP45     249   1e-74    
ref|XP_003610417.1|  RNA-binding protein                                248   2e-74    Medicago truncatula
gb|AFK41944.1|  unknown                                                 248   2e-74    Medicago truncatula
gb|KJB32438.1|  hypothetical protein B456_005G240800                    246   7e-74    Gossypium raimondii
ref|XP_001777334.1|  predicted protein                                  246   9e-74    
ref|XP_010265753.1|  PREDICTED: polyadenylate-binding protein RBP...    246   2e-73    Nelumbo nucifera [Indian lotus]
ref|XP_002863750.1|  hypothetical protein ARALYDRAFT_331131             244   3e-73    
ref|XP_002513488.1|  nuclear acid binding protein, putative             244   3e-73    
ref|XP_009418782.1|  PREDICTED: polyadenylate-binding protein RBP...    245   5e-73    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406503.1|  PREDICTED: polyadenylate-binding protein RBP...    244   6e-73    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406502.1|  PREDICTED: polyadenylate-binding protein RBP...    244   7e-73    
ref|XP_010923889.1|  PREDICTED: polyadenylate-binding protein RBP...    244   7e-73    
ref|XP_011628461.1|  PREDICTED: polyadenylate-binding protein RBP...    243   1e-72    
ref|XP_004982540.1|  PREDICTED: polyadenylate-binding protein RBP...    243   2e-72    
ref|XP_008792645.1|  PREDICTED: polyadenylate-binding protein RBP...    243   2e-72    
ref|XP_011025522.1|  PREDICTED: polyadenylate-binding protein RBP...    243   2e-72    
ref|XP_008437079.1|  PREDICTED: polyadenylate-binding protein RBP...    243   3e-72    
ref|XP_004152401.1|  PREDICTED: polyadenylate-binding protein RBP...    242   4e-72    
ref|XP_011654806.1|  PREDICTED: polyadenylate-binding protein RBP...    240   6e-72    
ref|XP_010930147.1|  PREDICTED: polyadenylate-binding protein RBP45     241   7e-72    
ref|XP_010265752.1|  PREDICTED: polyadenylate-binding protein RBP...    242   7e-72    
gb|ABK25253.1|  unknown                                                 243   9e-72    
emb|CBI16387.3|  unnamed protein product                                242   1e-71    
ref|XP_011654805.1|  PREDICTED: polyadenylate-binding protein RBP...    241   1e-71    
ref|XP_002285479.1|  PREDICTED: polyadenylate-binding protein RBP...    241   1e-71    
gb|ABR18422.1|  unknown                                                 241   1e-71    
ref|XP_002313332.2|  hypothetical protein POPTR_0009s05920g             241   1e-71    
ref|XP_011654802.1|  PREDICTED: polyadenylate-binding protein RBP...    241   2e-71    
ref|XP_008437078.1|  PREDICTED: polyadenylate-binding protein RBP...    240   2e-71    
ref|XP_008437076.1|  PREDICTED: polyadenylate-binding protein RBP...    240   4e-71    
gb|KHG09232.1|  Polyadenylate-binding RBP47B' -like protein             239   6e-71    
ref|XP_004288602.1|  PREDICTED: polyadenylate-binding protein RBP...    238   1e-70    
ref|XP_007153936.1|  hypothetical protein PHAVU_003G077700g             238   1e-70    
ref|XP_012089988.1|  PREDICTED: polyadenylate-binding protein RBP...    238   1e-70    
ref|XP_009412453.1|  PREDICTED: polyadenylate-binding protein RBP45     239   2e-70    
gb|EMS68789.1|  Uncharacterized RNA-binding protein C23E6.01c           236   2e-70    
ref|XP_010276065.1|  PREDICTED: polyadenylate-binding protein RBP...    237   3e-70    
dbj|BAJ93453.1|  predicted protein                                      237   4e-70    
ref|XP_011628460.1|  PREDICTED: polyadenylate-binding protein RBP...    237   4e-70    
emb|CAC85246.1|  salt tolerance protein 6                               233   5e-70    
ref|XP_006449039.1|  hypothetical protein CICLE_v10015407mg             236   5e-70    
ref|XP_008796097.1|  PREDICTED: polyadenylate-binding protein RBP45     236   6e-70    
ref|XP_006468022.1|  PREDICTED: polyadenylate-binding protein RBP...    236   6e-70    
ref|XP_010108648.1|  Polyadenylate-binding protein RBP47B'              238   6e-70    
ref|XP_006468021.1|  PREDICTED: polyadenylate-binding protein RBP...    236   8e-70    
ref|XP_006449038.1|  hypothetical protein CICLE_v10015407mg             236   9e-70    
gb|AFA36523.1|  nucleic acid binding protein                            228   9e-70    
ref|XP_011625480.1|  PREDICTED: polyadenylate-binding protein RBP...    237   9e-70    
ref|XP_010278711.1|  PREDICTED: polyadenylate-binding protein RBP...    236   1e-69    
ref|XP_007015035.1|  RNA-binding family protein isoform 3               236   1e-69    
emb|CDP05748.1|  unnamed protein product                                233   1e-69    
ref|XP_007209154.1|  hypothetical protein PRUPE_ppa005940mg             236   1e-69    
gb|EEC75600.1|  hypothetical protein OsI_12307                          235   1e-69    
ref|XP_008377253.1|  PREDICTED: polyadenylate-binding protein RBP...    236   1e-69    
ref|XP_007015034.1|  RNA-binding family protein isoform 2               236   1e-69    
ref|XP_009376881.1|  PREDICTED: polyadenylate-binding protein RBP...    236   2e-69    
gb|KHG24367.1|  Polyadenylate-binding RBP47                             234   2e-69    
ref|XP_007015033.1|  RNA-binding family protein isoform 1               236   2e-69    
gb|KHG01821.1|  Polyadenylate-binding RBP47C -like protein              234   3e-69    
ref|XP_002468416.1|  hypothetical protein SORBIDRAFT_01g045570          234   3e-69    
gb|KJB09397.1|  hypothetical protein B456_001G139100                    234   3e-69    
gb|KJB09398.1|  hypothetical protein B456_001G139100                    233   3e-69    
emb|CDY06734.1|  BnaA10g05130D                                          231   5e-69    
gb|ABF97193.1|  RNA recognition motif family protein, expressed         234   5e-69    
gb|AAG59664.1|AC084319_22  putative RNA binding protein                 233   5e-69    
emb|CDP18029.1|  unnamed protein product                                235   5e-69    
ref|XP_011097972.1|  PREDICTED: polyadenylate-binding protein RBP...    233   5e-69    
ref|XP_007020874.1|  RNA-binding family protein                         234   6e-69    
gb|KJB09396.1|  hypothetical protein B456_001G139100                    234   7e-69    
ref|XP_002973844.1|  hypothetical protein SELMODRAFT_100454             231   1e-68    
ref|XP_004232721.1|  PREDICTED: polyadenylate-binding protein RBP45     233   1e-68    
ref|XP_010665562.1|  PREDICTED: polyadenylate-binding protein RBP...    233   1e-68    
ref|XP_006348103.1|  PREDICTED: polyadenylate-binding protein RBP...    233   2e-68    
ref|NP_001050516.1|  Os03g0569900                                       233   2e-68    
gb|KDO61276.1|  hypothetical protein CISIN_1g014513mg                   231   2e-68    
ref|XP_008238181.1|  PREDICTED: polyadenylate-binding protein RBP...    233   3e-68    
ref|XP_002979510.1|  hypothetical protein SELMODRAFT_111082             232   3e-68    
ref|XP_006446110.1|  hypothetical protein CICLE_v10015576mg             231   3e-68    
gb|KDO61275.1|  hypothetical protein CISIN_1g014513mg                   232   4e-68    
ref|XP_009414748.1|  PREDICTED: polyadenylate-binding protein RBP...    232   4e-68    
ref|XP_004985527.1|  PREDICTED: polyadenylate-binding protein RBP...    231   4e-68    
ref|XP_010031800.1|  PREDICTED: polyadenylate-binding protein RBP...    231   5e-68    
ref|XP_008345010.1|  PREDICTED: polyadenylate-binding protein RBP...    232   5e-68    
ref|XP_006850190.1|  PREDICTED: polyadenylate-binding protein RBP...    232   6e-68    
ref|XP_007150369.1|  hypothetical protein PHAVU_005G147800g             231   6e-68    
ref|XP_009375056.1|  PREDICTED: polyadenylate-binding protein RBP...    232   7e-68    
ref|XP_010911059.1|  PREDICTED: polyadenylate-binding protein RBP...    226   9e-68    
gb|KDO49119.1|  hypothetical protein CISIN_1g013061mg                   229   9e-68    
gb|KDO35911.1|  hypothetical protein CISIN_1g029152mg                   223   1e-67    
ref|XP_010276064.1|  PREDICTED: polyadenylate-binding protein RBP...    231   1e-67    
ref|XP_004507695.1|  PREDICTED: polyadenylate-binding protein RBP...    230   1e-67    
ref|XP_006423053.1|  hypothetical protein CICLE_v10028454mg             229   1e-67    
ref|XP_006470600.1|  PREDICTED: polyadenylate-binding protein RBP...    230   1e-67    
ref|NP_001152183.1|  LOC100285821                                       230   1e-67    
gb|ACR34003.1|  unknown                                                 230   1e-67    
ref|XP_010278708.1|  PREDICTED: polyadenylate-binding protein RBP...    230   2e-67    
gb|KHG27259.1|  Polyadenylate-binding RBP47                             229   2e-67    
ref|XP_009768585.1|  PREDICTED: polyadenylate-binding protein RBP...    230   2e-67    
gb|EYU46265.1|  hypothetical protein MIMGU_mgv1a007107mg                229   3e-67    
ref|XP_011080284.1|  PREDICTED: polyadenylate-binding protein RBP...    229   3e-67    
ref|XP_007147735.1|  hypothetical protein PHAVU_006G150400g             229   3e-67    
ref|XP_003558701.1|  PREDICTED: polyadenylate-binding protein RBP...    229   5e-67    
gb|AGV54881.1|  RNA-binding post-transcriptional regulator csx1-l...    228   6e-67    
gb|KJB22074.1|  hypothetical protein B456_004G028000                    228   7e-67    
gb|KJB13666.1|  hypothetical protein B456_002G088100                    228   7e-67    
ref|XP_006452313.1|  hypothetical protein CICLE_v10008440mg             228   8e-67    
ref|XP_009615947.1|  PREDICTED: polyadenylate-binding protein RBP...    228   8e-67    
gb|KJB13664.1|  hypothetical protein B456_002G088100                    228   9e-67    
gb|KJB13665.1|  hypothetical protein B456_002G088100                    228   9e-67    
ref|XP_004294372.1|  PREDICTED: polyadenylate-binding protein RBP45C    228   1e-66    
ref|XP_006452314.1|  hypothetical protein CICLE_v10008440mg             228   1e-66    
ref|XP_002464324.1|  hypothetical protein SORBIDRAFT_01g016170          228   1e-66    
ref|XP_003549897.1|  PREDICTED: polyadenylate-binding protein RBP...    227   1e-66    
ref|XP_006361747.1|  PREDICTED: polyadenylate-binding protein RBP...    228   1e-66    
gb|KHN37596.1|  Polyadenylate-binding protein RBP45B                    226   2e-66    
gb|KHN33037.1|  Polyadenylate-binding protein RBP45                     225   2e-66    
ref|XP_009772575.1|  PREDICTED: polyadenylate-binding protein RBP...    227   2e-66    
ref|XP_003529629.1|  PREDICTED: polyadenylate-binding protein RBP45     226   2e-66    
gb|KDO36653.1|  hypothetical protein CISIN_1g037126mg                   219   2e-66    
ref|XP_010938882.1|  PREDICTED: polyadenylate-binding protein RBP...    228   3e-66    
ref|XP_002977811.1|  hypothetical protein SELMODRAFT_232989             228   3e-66    
ref|XP_002280601.1|  PREDICTED: polyadenylate-binding protein RBP...    226   4e-66    
ref|XP_006361746.1|  PREDICTED: polyadenylate-binding protein RBP...    226   4e-66    
ref|XP_010545222.1|  PREDICTED: polyadenylate-binding protein RBP...    226   4e-66    
emb|CAN83958.1|  hypothetical protein VITISV_039907                     226   4e-66    
ref|XP_003542872.1|  PREDICTED: polyadenylate-binding protein RBP...    226   5e-66    
ref|XP_009772574.1|  PREDICTED: polyadenylate-binding protein RBP...    226   5e-66    
ref|XP_008812246.1|  PREDICTED: polyadenylate-binding protein RBP...    227   5e-66    
ref|XP_010313279.1|  PREDICTED: polyadenylate-binding protein RBP...    226   6e-66    
ref|XP_002988285.1|  hypothetical protein SELMODRAFT_447249             224   8e-66    
gb|KHN35750.1|  Polyadenylate-binding protein RBP45                     225   8e-66    
ref|XP_004145109.1|  PREDICTED: polyadenylate-binding protein RBP...    224   1e-65    
ref|XP_003546146.1|  PREDICTED: polyadenylate-binding protein RBP...    225   1e-65    
gb|KHG01774.1|  Polyadenylate-binding RBP45C -like protein              224   2e-65    
ref|XP_003543537.1|  PREDICTED: polyadenylate-binding protein RBP...    224   2e-65    
ref|XP_004250947.1|  PREDICTED: polyadenylate-binding protein RBP...    224   3e-65    
ref|XP_006649483.1|  PREDICTED: polyadenylate-binding protein RBP...    224   4e-65    
gb|KDO35914.1|  hypothetical protein CISIN_1g029152mg                   216   4e-65    
dbj|BAE71244.1|  putative DNA binding protein                           223   5e-65    
gb|EEE68172.1|  hypothetical protein OsJ_26296                          221   6e-65    
ref|XP_010062999.1|  PREDICTED: polyadenylate-binding protein RBP45C    223   6e-65    
ref|XP_011652705.1|  PREDICTED: polyadenylate-binding protein RBP...    223   6e-65    
ref|XP_008441139.1|  PREDICTED: polyadenylate-binding protein RBP...    223   7e-65    
gb|ABF94248.1|  RNA recognition motif family protein, expressed         223   7e-65    
gb|EEC74608.1|  hypothetical protein OsI_10216                          223   7e-65    
ref|NP_001049124.1|  Os03g0174100                                       223   1e-64    
ref|XP_002518499.1|  nuclear acid binding protein, putative             223   1e-64    
ref|NP_001168324.1|  hypothetical protein                               222   1e-64    
ref|XP_008806741.1|  PREDICTED: polyadenylate-binding protein RBP45     222   2e-64    
ref|XP_008226922.1|  PREDICTED: polyadenylate-binding protein RBP45C    221   2e-64    
ref|XP_011652720.1|  PREDICTED: polyadenylate-binding protein RBP...    221   3e-64    
ref|XP_008441138.1|  PREDICTED: polyadenylate-binding protein RBP...    221   3e-64    
ref|XP_004295261.2|  PREDICTED: polyadenylate-binding protein RBP45B    221   4e-64    
gb|AGV54456.1|  RNA-binding post-transcriptional regulator csx1-l...    221   4e-64    
ref|NP_001141359.1|  uncharacterized protein LOC100273450               222   5e-64    
gb|KGN55171.1|  hypothetical protein Csa_4G639100                       219   5e-64    
ref|XP_003543536.1|  PREDICTED: polyadenylate-binding protein RBP...    221   5e-64    
ref|XP_004486120.1|  PREDICTED: polyadenylate-binding protein RBP...    220   6e-64    
ref|XP_011652716.1|  PREDICTED: polyadenylate-binding protein RBP...    220   6e-64    
ref|XP_011030800.1|  PREDICTED: polyadenylate-binding protein RBP...    220   6e-64    
ref|XP_008224810.1|  PREDICTED: polyadenylate-binding protein RBP...    220   7e-64    
ref|XP_008365193.1|  PREDICTED: polyadenylate-binding protein RBP...    220   7e-64    
ref|XP_009372712.1|  PREDICTED: polyadenylate-binding protein RBP...    220   9e-64    
gb|EPS67039.1|  hypothetical protein M569_07737                         220   1e-63    
gb|AFW61056.1|  hypothetical protein ZEAMMB73_234884                    221   1e-63    
ref|XP_008676816.1|  PREDICTED: uncharacterized protein LOC100273...    221   1e-63    
ref|XP_007213954.1|  hypothetical protein PRUPE_ppa006577mg             219   1e-63    
ref|XP_008441150.1|  PREDICTED: polyadenylate-binding protein RBP...    219   1e-63    
ref|XP_002963882.1|  hypothetical protein SELMODRAFT_80061              217   1e-63    
gb|EMS60206.1|  RNA-binding post-transcriptional regulator csx1         217   2e-63    
gb|KHG22988.1|  Polyadenylate-binding RBP45C -like protein              219   2e-63    
gb|KDO35913.1|  hypothetical protein CISIN_1g029152mg                   211   2e-63    
dbj|BAD05744.1|  putative RNA Binding Protein 45                        219   2e-63    
ref|XP_002522953.1|  nuclear acid binding protein, putative             219   2e-63    
ref|XP_004486967.1|  PREDICTED: polyadenylate-binding protein RBP...    219   3e-63    
ref|XP_009352469.1|  PREDICTED: polyadenylate-binding protein RBP...    219   3e-63    
ref|XP_007211969.1|  hypothetical protein PRUPE_ppa006617mg             218   3e-63    
ref|XP_004507696.1|  PREDICTED: polyadenylate-binding protein RBP...    217   3e-63    
ref|XP_006659900.1|  PREDICTED: polyadenylate-binding protein RBP...    219   3e-63    
ref|XP_008441163.1|  PREDICTED: polyadenylate-binding protein RBP...    218   3e-63    
ref|XP_002316998.2|  RNA-binding protein 45                             218   3e-63    
ref|XP_012091367.1|  PREDICTED: polyadenylate-binding protein RBP...    219   3e-63    
ref|XP_008441142.1|  PREDICTED: polyadenylate-binding protein RBP...    218   3e-63    
ref|XP_009631416.1|  PREDICTED: polyadenylate-binding protein RBP...    218   3e-63    
ref|XP_004486966.1|  PREDICTED: polyadenylate-binding protein RBP...    219   4e-63    
ref|XP_008385660.1|  PREDICTED: polyadenylate-binding protein RBP...    218   4e-63    
dbj|BAK03410.1|  predicted protein                                      219   4e-63    
ref|XP_009614215.1|  PREDICTED: polyadenylate-binding protein RBP...    218   4e-63    
ref|XP_004957865.1|  PREDICTED: polyadenylate-binding protein RBP...    220   6e-63    
gb|KJB21879.1|  hypothetical protein B456_004G019500                    218   6e-63    
ref|XP_012070803.1|  PREDICTED: polyadenylate-binding protein RBP45C    217   6e-63    
ref|XP_009631415.1|  PREDICTED: polyadenylate-binding protein RBP...    218   7e-63    
gb|KDP39118.1|  hypothetical protein JCGZ_00875                         218   7e-63    
ref|XP_004145107.1|  PREDICTED: polyadenylate-binding protein RBP...    218   7e-63    
gb|KEH36836.1|  polyadenylate-binding protein RBP47B                    218   7e-63    
ref|XP_008349306.1|  PREDICTED: polyadenylate-binding protein RBP...    217   7e-63    
gb|KHG00069.1|  Polyadenylate-binding RBP47B' -like protein             218   9e-63    
ref|XP_006352618.1|  PREDICTED: polyadenylate-binding protein RBP...    218   9e-63    
ref|XP_004248403.1|  PREDICTED: polyadenylate-binding protein RBP...    217   9e-63    
ref|XP_004957864.1|  PREDICTED: polyadenylate-binding protein RBP...    220   1e-62    
gb|KJB81764.1|  hypothetical protein B456_013G160200                    217   2e-62    
gb|KJB81761.1|  hypothetical protein B456_013G160200                    217   2e-62    
ref|NP_172630.1|  polyadenylate-binding protein RBP45B                  216   2e-62    
ref|XP_002979028.1|  hypothetical protein SELMODRAFT_418663             216   2e-62    
ref|XP_003573391.1|  PREDICTED: polyadenylate-binding protein RBP...    216   3e-62    
ref|XP_011010322.1|  PREDICTED: polyadenylate-binding protein RBP...    216   3e-62    
ref|XP_004234481.1|  PREDICTED: polyadenylate-binding protein RBP...    216   3e-62    
ref|XP_011010320.1|  PREDICTED: polyadenylate-binding protein RBP...    216   3e-62    
gb|KCW76953.1|  hypothetical protein EUGRSUZ_D01313                     211   3e-62    
ref|XP_006352617.1|  PREDICTED: polyadenylate-binding protein RBP...    216   4e-62    
ref|XP_009776437.1|  PREDICTED: polyadenylate-binding protein RBP...    216   4e-62    
ref|XP_010327241.1|  PREDICTED: polyadenylate-binding protein RBP...    216   4e-62    
ref|XP_006307499.1|  hypothetical protein CARUB_v10009124mg             216   5e-62    
ref|XP_006417333.1|  hypothetical protein EUTSA_v10007819mg             215   5e-62    
ref|XP_009776429.1|  PREDICTED: polyadenylate-binding protein RBP...    215   6e-62    
ref|XP_009631417.1|  PREDICTED: polyadenylate-binding protein RBP...    215   6e-62    
ref|XP_006370698.1|  hypothetical protein POPTR_0001s45000g             215   8e-62    
ref|XP_004972674.1|  PREDICTED: polyadenylate-binding protein RBP...    216   9e-62    
ref|XP_007026047.1|  RNA-binding family protein                         215   9e-62    
gb|KJB21880.1|  hypothetical protein B456_004G019500                    215   1e-61    
ref|XP_004972673.1|  PREDICTED: polyadenylate-binding protein RBP...    216   1e-61    
ref|XP_010476096.1|  PREDICTED: polyadenylate-binding protein RBP...    214   1e-61    
ref|XP_010240455.1|  PREDICTED: polyadenylate-binding protein RBP...    214   1e-61    
ref|XP_002889883.1|  ATRBP45B                                           214   1e-61    
ref|XP_011096084.1|  PREDICTED: polyadenylate-binding protein RBP...    214   2e-61    
ref|XP_010493089.1|  PREDICTED: polyadenylate-binding protein RBP...    214   2e-61    
ref|XP_002305583.2|  RNA-binding protein 45                             213   3e-61    
ref|XP_003580589.1|  PREDICTED: polyadenylate-binding protein RBP...    214   3e-61    
ref|XP_010458570.1|  PREDICTED: polyadenylate-binding protein RBP45B    213   3e-61    
ref|XP_011037670.1|  PREDICTED: polyadenylate-binding protein RBP...    213   3e-61    
ref|XP_010052832.1|  PREDICTED: polyadenylate-binding protein RBP...    213   4e-61    



>ref|XP_009629702.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
tomentosiformis]
Length=456

 Score =   385 bits (988),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 221/269 (82%), Positives = 236/269 (88%), Gaps = 2/269 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFSMG+KR+NN SDLSIFVGDLAADVTDTLL +TF +KYPSVKAAKVV DAN
Sbjct  188   QPFRLNWATFSMGDKRANNGSDLSIFVGDLAADVTDTLLHETFATKYPSVKAAKVVFDAN  247

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++QGGYSN
Sbjct  248   TGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSQGGYSN  307

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G PA GSQ D DS+NTTIFVGGLDPNVSDEDLRQPF+QYGEIVSVKIPVGKGCGFVQFAN
Sbjct  308   GGPAQGSQPDADSTNTTIFVGGLDPNVSDEDLRQPFAQYGEIVSVKIPVGKGCGFVQFAN  367

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R DAEEALQKL G  IGKQTVRLSWGRNPA++QSR DF NQW G YYGGHFYDGY YAFP
Sbjct  368   RNDAEEALQKLNGTAIGKQTVRLSWGRNPANKQSRGDFGNQWTGPYYGGHFYDGYGYAFP  427

Query  330   APHNPNmyapaaygaypmyG--THQQQVS  250
              PH+P MYA AA          THQQQVS
Sbjct  428   PPHDPGMYAAAAAAYGAYPMYGTHQQQVS  456



>ref|XP_009765294.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
sylvestris]
Length=456

 Score =   384 bits (987),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 220/269 (82%), Positives = 235/269 (87%), Gaps = 2/269 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFSMG+KR+NN SDLSIFVGDLAADVTDTLL +TF +KYPSVKAAKVV DAN
Sbjct  188   QPFRLNWATFSMGDKRANNGSDLSIFVGDLAADVTDTLLHETFATKYPSVKAAKVVFDAN  247

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++QGGYSN
Sbjct  248   TGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSQGGYSN  307

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G PA GSQ D DS+NTTIFVGGLDPNVSDEDLRQPF+QYGEIVSVKIPVGKGCGFVQFAN
Sbjct  308   GGPAQGSQPDADSTNTTIFVGGLDPNVSDEDLRQPFAQYGEIVSVKIPVGKGCGFVQFAN  367

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R DAEEALQKL G  IGKQTVRLSWGRNPA++QSR DF NQW G YYGGHFYDGY YAFP
Sbjct  368   RNDAEEALQKLNGTAIGKQTVRLSWGRNPANKQSRGDFGNQWTGPYYGGHFYDGYGYAFP  427

Query  330   APHNPNmyapaaygaypmyG--THQQQVS  250
               H+P MYA AA          THQQQVS
Sbjct  428   PQHDPGMYAAAAAAYGAYPIYGTHQQQVS  456



>ref|XP_006354957.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Solanum 
tuberosum]
Length=438

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 223/267 (84%), Positives = 237/267 (89%), Gaps = 1/267 (0%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFSMG+KR NN SDLSIFVGDLAADVTDTLL +TF  KYPSVKAAKVVIDAN
Sbjct  173   QPFRLNWATFSMGDKRVNNGSDLSIFVGDLAADVTDTLLHETFSQKYPSVKAAKVVIDAN  232

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNERS A+ EMNGVYCSSRPMRIGAATPRKSSGY QQ+++QGGYSN
Sbjct  233   TGRSKGYGFVRFGDDNERSSAMNEMNGVYCSSRPMRIGAATPRKSSGYPQQYSSQGGYSN  292

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G P  GSQ D DS+NTTIFVGGLDPNVSDEDLRQPF+QYGEIVSVKIPVGKGCGFVQFAN
Sbjct  293   GGPVQGSQPDADSTNTTIFVGGLDPNVSDEDLRQPFAQYGEIVSVKIPVGKGCGFVQFAN  352

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R DAEEALQKL G  IGKQTVRLSWGRNPA++QSRSDF NQW G YYGGHFYDGY YAFP
Sbjct  353   RNDAEEALQKLNGTAIGKQTVRLSWGRNPANKQSRSDFGNQWTGPYYGGHFYDGYGYAFP  412

Query  330   APHNPNmyapaaygaypmyGTHQQQVS  250
              PH+P     AAYGAYP+YGTHQQQVS
Sbjct  413   PPHDPG-MYAAAYGAYPVYGTHQQQVS  438


 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG S+GYGFV F       + L   + +    + +P R+  AT      
Sbjct  128  VASIKVIRNKQTGFSEGYGFVEFFTHASAEKVLQTYSCMTMPNAEQPFRLNWAT------  181

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVK  553
                            + G +   + S+ +IFVG L  +V+D  L + FSQ Y  + + K
Sbjct  182  ---------------FSMGDKRVNNGSDLSIFVGDLAADVTDTLLHETFSQKYPSVKAAK  226

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  227  VVIDANTGRSKGYGFVRFGDDNERSSAMNEMNGVYCSSRPMRI  269



>ref|XP_004238180.1| PREDICTED: polyadenylate-binding protein RBP47-like [Solanum 
lycopersicum]
Length=451

 Score =   381 bits (978),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 224/267 (84%), Positives = 238/267 (89%), Gaps = 1/267 (0%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFSMG+KR+NN SDLSIFVGDLAADVTDTLLLDTF  KYPSVKAAKVVIDAN
Sbjct  186   QPFRLNWATFSMGDKRANNGSDLSIFVGDLAADVTDTLLLDTFSLKYPSVKAAKVVIDAN  245

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNERS A+ EMNGVYCSSRPMRIGAATPRKSSGY QQ+++QGGYSN
Sbjct  246   TGRSKGYGFVRFGDDNERSSAMNEMNGVYCSSRPMRIGAATPRKSSGYPQQYSSQGGYSN  305

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G PA GSQ D DS+NTTIFVGGLDPNVSDEDLRQPF+QYGEIVSVKIPVGKGCGFVQFA 
Sbjct  306   GGPAQGSQPDADSTNTTIFVGGLDPNVSDEDLRQPFAQYGEIVSVKIPVGKGCGFVQFAK  365

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R DAEEALQKL G  IGKQTVRLSWGRNPA++Q RSDF NQW G YYGGHFYDGY YAFP
Sbjct  366   RNDAEEALQKLNGTAIGKQTVRLSWGRNPANKQPRSDFGNQWTGPYYGGHFYDGYGYAFP  425

Query  330   APHNPNmyapaaygaypmyGTHQQQVS  250
              PH+P     AAYGAYP+YGTHQQQVS
Sbjct  426   QPHDPG-MYAAAYGAYPVYGTHQQQVS  451



>ref|XP_007222286.1| hypothetical protein PRUPE_ppa005903mg [Prunus persica]
 gb|EMJ23485.1| hypothetical protein PRUPE_ppa005903mg [Prunus persica]
Length=438

 Score =   370 bits (951),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 219/268 (82%), Positives = 240/268 (90%), Gaps = 1/268 (0%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+NA DLSIFVGDLAADVTD+LL +TF SKYPSVKAAKVV DAN
Sbjct  171   QPFRLNWATFSTGDKRSDNAPDLSIFVGDLAADVTDSLLHETFSSKYPSVKAAKVVFDAN  230

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gyS  694
             TGRSKGYGFVRFGD+NERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++QG   S
Sbjct  231   TGRSKGYGFVRFGDENERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSQGGYVS  290

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLR PFSQYGEIVSVKIPVGKGCGFVQFA
Sbjct  291   NGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRHPFSQYGEIVSVKIPVGKGCGFVQFA  350

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR +AEEAL KL G VIGKQTVRLSWGRNPA++Q R+DF NQWAGAYYGG  YDGY YA 
Sbjct  351   NRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQFRTDFGNQWAGAYYGGPVYDGYGYAL  410

Query  333   PAPHNPNmyapaaygaypmyGTHQQQVS  250
             P  H+P+MYA AAYGAYP+YGTHQQQVS
Sbjct  411   PPHHDPSMYAAAAYGAYPVYGTHQQQVS  438



>ref|XP_008220171.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Prunus mume]
Length=441

 Score =   367 bits (941),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 213/270 (79%), Positives = 233/270 (86%), Gaps = 3/270 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+NA DLSIFVGDLAADVTD+LL +TF SKYPSVKAAKVV DAN
Sbjct  172   QPFRLNWATFSTGDKRSDNAPDLSIFVGDLAADVTDSLLHETFSSKYPSVKAAKVVFDAN  231

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gyS  694
             TGRSKGYGFVRFGD+NERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++QG   S
Sbjct  232   TGRSKGYGFVRFGDENERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSQGGYVS  291

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA
Sbjct  292   NGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  351

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR +AEEAL KL G VIGKQTVRLSWGRNPA++Q R+DF NQWAGAYYGG  YDGY YA 
Sbjct  352   NRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQFRTDFGNQWAGAYYGGPVYDGYGYAL  411

Query  333   PAPHNPNmyapaaygaypmyG--THQQQVS  250
             P  H+P+MYA AA          THQQQVS
Sbjct  412   PPHHDPSMYAAAAAAYGAYPVYGTHQQQVS  441



>emb|CBI19566.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   362 bits (928),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 211/268 (79%), Positives = 233/268 (87%), Gaps = 5/268 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFSMG+KRS+N  DLSIFVGDLA+DV+D+LL +TF  KYPSVKAAKVV DAN
Sbjct  61    QPFRLNWATFSMGDKRSDNGPDLSIFVGDLASDVSDSLLHETFAGKYPSVKAAKVVFDAN  120

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gyS  694
             TGRSKGYGFVRFGD+NERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++ G   S
Sbjct  121   TGRSKGYGFVRFGDENERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSHGGYAS  180

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+     QSDGDS NTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA
Sbjct  181   NGASV---QSDGDSMNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  237

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR +AE+ALQKL G VIGKQTVRLSWGRNPA++Q R+DF NQW+GAYYGG  YDGY YA 
Sbjct  238   NRNNAEDALQKLNGTVIGKQTVRLSWGRNPANKQMRADFGNQWSGAYYGGQVYDGYGYAL  297

Query  333   PAPHNPNmyapaaygaypmyGTHQQQVS  250
             P PH+P     AAYGAYP+YG HQQQVS
Sbjct  298   PPPHDPT-MYAAAYGAYPVYGNHQQQVS  324



>ref|XP_009605325.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Nicotiana 
tomentosiformis]
Length=422

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 210/267 (79%), Positives = 231/267 (87%), Gaps = 0/267 (0%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FS G+KRSNN S LSIFVGDLAADVTDTLL  TF  KYPSVKAAKVV+DAN
Sbjct  156   QPFRLNWASFSTGDKRSNNGSGLSIFVGDLAADVTDTLLHKTFAKKYPSVKAAKVVVDAN  215

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRS+GYGFVRFGDDNERSQA+TEMNGVYCSSRPMRIGAATPRKSSGY Q +++ GGYSN
Sbjct  216   TGRSRGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYLQYYSSLGGYSN  275

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
              +   GSQ D DS+NTTIFVGGLDP VSDEDLR PF+QYGEI SVKIPVGKGCGFVQFA 
Sbjct  276   SASPQGSQPDVDSTNTTIFVGGLDPIVSDEDLRHPFAQYGEIASVKIPVGKGCGFVQFAK  335

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R DAE+ALQKL G  IGKQTVRLSWGRNPA++QSR+DF  QW G YYGGHFY+ Y YAFP
Sbjct  336   RNDAEKALQKLNGTAIGKQTVRLSWGRNPANKQSRADFMKQWTGPYYGGHFYNAYGYAFP  395

Query  330   APHNPNmyapaaygaypmyGTHQQQVS  250
              PH+P+MYA AAYG YP+YGTHQQQVS
Sbjct  396   PPHDPSMYAAAAYGTYPIYGTHQQQVS  422



>ref|XP_006374988.1| RNA-binding protein 47 [Populus trichocarpa]
 gb|ERP52785.1| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score =   363 bits (932),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 209/269 (78%), Positives = 230/269 (86%), Gaps = 5/269 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+NA DLSIFVGDLAADVTD+LL +TFVSKYPSVKAAKVV DAN
Sbjct  164   QPFRLNWATFSTGDKRSDNAPDLSIFVGDLAADVTDSLLQETFVSKYPSVKAAKVVFDAN  223

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+ER+QA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ        N
Sbjct  224   TGRSKGYGFVRFGDDSERTQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQGGYGS---N  280

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+ A G QSDGDS+NTTIFVGGLDPNV+DEDL+QPFSQYGEIVSVKIPVGKGCGFVQFAN
Sbjct  281   GASAQGFQSDGDSNNTTIFVGGLDPNVTDEDLKQPFSQYGEIVSVKIPVGKGCGFVQFAN  340

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQKL G VIGKQTVRLSWGRNPA++Q R+DF + W GAYYGG  YDGY YA P
Sbjct  341   RDNAEEALQKLNGTVIGKQTVRLSWGRNPANKQFRADFGSPWNGAYYGGQVYDGYGYALP  400

Query  330   APHNPNmyapaaygaypm--yGTHQQQVS  250
              PH+P+MYA AA        YG+HQQQVS
Sbjct  401   PPHDPSMYAAAAAAYGAYPIYGSHQQQVS  429


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 93/199 (47%), Gaps = 31/199 (16%)
 Frame = -2

Query  1011  EKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYGFVRFG  832
             ++R  +  + +I++GDL   + +  L   FVS    + + KV+ +  TG S+GYGFV F 
Sbjct  84    QQREGSGENKTIWIGDLHHWMDENYLHSCFVST-GEIASIKVIRNKQTGLSEGYGFVEFL  142

Query  831   DDNERSQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHGSQSDG  658
                   + L    G+    + +P R+  AT                      + G +   
Sbjct  143   THATAEKVLQNYGGILMPNTEQPFRLNWAT---------------------FSTGDKRSD  181

Query  657   DSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVKIPV------GKGCGFVQFANRTDA  499
             ++ + +IFVG L  +V+D  L++ F S+Y  + + K+         KG GFV+F + ++ 
Sbjct  182   NAPDLSIFVGDLAADVTDSLLQETFVSKYPSVKAAKVVFDANTGRSKGYGFVRFGDDSER  241

Query  498   EEALQKLKGLVIGKQTVRL  442
              +A+ ++ G+    + +R+
Sbjct  242   TQAMTEMNGVYCSSRPMRI  260



>ref|XP_012071696.1| PREDICTED: polyadenylate-binding protein RBP47-like [Jatropha 
curcas]
 gb|KDP38389.1| hypothetical protein JCGZ_04314 [Jatropha curcas]
Length=437

 Score =   363 bits (933),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 205/269 (76%), Positives = 231/269 (86%), Gaps = 5/269 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+NA DLSIFVGDLAADVTD++L +TF S+YPSVKAAKVV DAN
Sbjct  172   QPFRLNWATFSTGDKRSDNAPDLSIFVGDLAADVTDSILHETFASRYPSVKAAKVVFDAN  231

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRF DD+ER+QA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ        N
Sbjct  232   TGRSKGYGFVRFADDSERTQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQGGYAS---N  288

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+   G QSDGDS+NTTIFVGGLDPNV+DEDL+QPFSQYGEIVSVKIP+GKGCGFVQFAN
Sbjct  289   GATGQGFQSDGDSTNTTIFVGGLDPNVTDEDLKQPFSQYGEIVSVKIPLGKGCGFVQFAN  348

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R++AEEALQKL G VIGKQTVRLSWGRNPA++Q R+DF NQW+GAYYGG  YDGY YA P
Sbjct  349   RSNAEEALQKLNGTVIGKQTVRLSWGRNPANKQFRADFGNQWSGAYYGGQVYDGYGYALP  408

Query  330   APHNPNmyapaaygayp--myGTHQQQVS  250
              PH+P+MYA AA       +YG+HQQQVS
Sbjct  409   PPHDPSMYAAAAAAYGAYPVYGSHQQQVS  437


 Score = 54.7 bits (130),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 76/163 (47%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            + + KV+ +  TG S+GYGFV F       + L   +G+    + +P R+  AT      
Sbjct  127  IASLKVIRNKQTGLSEGYGFVEFFTHATAEKVLQNYSGILMPNTEQPFRLNWAT------  180

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +   ++ + +IFVG L  +V+D  L + F S+Y  + + K
Sbjct  181  ---------------FSTGDKRSDNAPDLSIFVGDLAADVTDSILHETFASRYPSVKAAK  225

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            +         KG GFV+FA+ ++  +A+ ++ G+    + +R+
Sbjct  226  VVFDANTGRSKGYGFVRFADDSERTQAMTEMNGVYCSSRPMRI  268



>ref|XP_008220170.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Prunus mume]
Length=442

 Score =   363 bits (932),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 213/271 (79%), Positives = 233/271 (86%), Gaps = 4/271 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+NA DLSIFVGDLAADVTD+LL +TF SKYPSVKAAKVV DAN
Sbjct  172   QPFRLNWATFSTGDKRSDNAPDLSIFVGDLAADVTDSLLHETFSSKYPSVKAAKVVFDAN  231

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gyS  694
             TGRSKGYGFVRFGD+NERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++QG   S
Sbjct  232   TGRSKGYGFVRFGDENERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSQGGYVS  291

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA
Sbjct  292   NGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  351

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-RSDFTNQWAGAYYGGHFYDGYTYA  337
             NR +AEEAL KL G VIGKQTVRLSWGRNPA++Q  R+DF NQWAGAYYGG  YDGY YA
Sbjct  352   NRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQQFRTDFGNQWAGAYYGGPVYDGYGYA  411

Query  336   FPAPHNPNmyapaaygaypmyG--THQQQVS  250
              P  H+P+MYA AA          THQQQVS
Sbjct  412   LPPHHDPSMYAAAAAAYGAYPVYGTHQQQVS  442



>ref|XP_003634360.1| PREDICTED: polyadenylate-binding protein RBP47-like [Vitis vinifera]
Length=418

 Score =   361 bits (926),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 211/268 (79%), Positives = 233/268 (87%), Gaps = 5/268 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFSMG+KRS+N  DLSIFVGDLA+DV+D+LL +TF  KYPSVKAAKVV DAN
Sbjct  155   QPFRLNWATFSMGDKRSDNGPDLSIFVGDLASDVSDSLLHETFAGKYPSVKAAKVVFDAN  214

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gyS  694
             TGRSKGYGFVRFGD+NERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++ G   S
Sbjct  215   TGRSKGYGFVRFGDENERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSHGGYAS  274

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+     QSDGDS NTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA
Sbjct  275   NGASV---QSDGDSMNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  331

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR +AE+ALQKL G VIGKQTVRLSWGRNPA++Q R+DF NQW+GAYYGG  YDGY YA 
Sbjct  332   NRNNAEDALQKLNGTVIGKQTVRLSWGRNPANKQMRADFGNQWSGAYYGGQVYDGYGYAL  391

Query  333   PAPHNPNmyapaaygaypmyGTHQQQVS  250
             P PH+P     AAYGAYP+YG HQQQVS
Sbjct  392   PPPHDPT-MYAAAYGAYPVYGNHQQQVS  418


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 88/195 (45%), Gaps = 31/195 (16%)
 Frame = -2

Query  999  NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYGFVRFGDDNE  820
            +NA + +I+VGDL   + +  L   F +    + + KV+ +  TG S+GYGFV F     
Sbjct  79   SNADNRTIWVGDLHNWMDENYLHSCFAAT-GELASMKVIRNKQTGSSEGYGFVEFFSHAA  137

Query  819  RSQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHGSQSDGDSSN  646
              + L    GV    + +P R+  AT                      + G +   +  +
Sbjct  138  AEKVLQGYAGVLMPNTDQPFRLNWAT---------------------FSMGDKRSDNGPD  176

Query  645  TTIFVGGLDPNVSDEDLRQPFS-QYGEIVSVKIPV------GKGCGFVQFANRTDAEEAL  487
             +IFVG L  +VSD  L + F+ +Y  + + K+         KG GFV+F +  +  +A+
Sbjct  177  LSIFVGDLASDVSDSLLHETFAGKYPSVKAAKVVFDANTGRSKGYGFVRFGDENERSQAM  236

Query  486  QKLKGLVIGKQTVRL  442
             ++ G+    + +R+
Sbjct  237  TEMNGVYCSSRPMRI  251



>ref|XP_006434827.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48067.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
Length=432

 Score =   361 bits (926),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 207/270 (77%), Positives = 232/270 (86%), Gaps = 3/270 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+N  DLSIFVGDLAADVTD+LL +TF S+YPSVKAAKVV DAN
Sbjct  163   QPFRLNWATFSTGDKRSDNGPDLSIFVGDLAADVTDSLLHETFASRYPSVKAAKVVFDAN  222

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gyS  694
             TGRSKGYGFVRFGDDNERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++QG   S
Sbjct  223   TGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSQGGYAS  282

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+P  G QS+GDSSNTTIFVGGLDPNV+DEDLRQPFSQYGEI SVKIPVGKGCGFVQFA
Sbjct  283   NGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFA  342

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR +AEEAL KL G VIGKQ+VRLSWGRNPA++Q R+D+ NQW+GAYYGG  YDGY YA 
Sbjct  343   NRENAEEALHKLNGTVIGKQSVRLSWGRNPANKQFRADYGNQWSGAYYGGQVYDGYGYAI  402

Query  333   PAPHNPNmyapaaygaypmyG--THQQQVS  250
             P P++P+MYA AA          +HQQQVS
Sbjct  403   PPPNDPSMYAAAAAAYGAYPVYGSHQQQVS  432



>emb|CAC69852.1| nucleic acid binding protein [Nicotiana tabacum]
Length=456

 Score =   361 bits (927),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 212/269 (79%), Positives = 227/269 (84%), Gaps = 2/269 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFSMG+KR+NN SDLSIFVGDLAADVTDTLL +TF +KYPSVKAAKVV DAN
Sbjct  188   QPFRLNWATFSMGDKRANNGSDLSIFVGDLAADVTDTLLHETFATKYPSVKAAKVVFDAN  247

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++QGGYSN
Sbjct  248   TGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSQGGYSN  307

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G PA GSQ D DS+NTTIFVGGLDPNVSDEDLRQPF QYGEIVSVKIPV +     QFAN
Sbjct  308   GGPAQGSQPDADSTNTTIFVGGLDPNVSDEDLRQPFVQYGEIVSVKIPVEERVWVWQFAN  367

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R DAEEALQKL G  IGKQTVRL WGRNPA++QSR DF NQW G YYGGHFYDGY YAFP
Sbjct  368   RNDAEEALQKLNGTFIGKQTVRLFWGRNPANKQSRGDFGNQWTGPYYGGHFYDGYGYAFP  427

Query  330   APHNPNmyapaaygaypmyG--THQQQVS  250
               H+P MYA AA          THQQQVS
Sbjct  428   PQHDPGMYAAAAAAYGAYPIYGTHQQQVS  456



>ref|XP_007017329.1| RNA-binding protein 47C isoform 1 [Theobroma cacao]
 gb|EOY14554.1| RNA-binding protein 47C isoform 1 [Theobroma cacao]
Length=435

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 213/272 (78%), Positives = 234/272 (86%), Gaps = 6/272 (2%)
 Frame = -2

Query  1056  LFKPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVID  877
             + +P   NW+TFS GEKRS N  DLSIFVGDLAADVTD+LL +TF SKY SVKAAKVVID
Sbjct  167   MEQPFRLNWATFSTGEKRSENGPDLSIFVGDLAADVTDSLLHETFASKYSSVKAAKVVID  226

Query  876   ANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-g  700
             ANTGRSKGYGFVRFGDD ERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++QG  
Sbjct  227   ANTGRSKGYGFVRFGDDTERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSQGGY  286

Query  699   ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  520
              SNG+    +QSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGEIVSVKIPVGKGCGFVQ
Sbjct  287   ASNGA---SNQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  343

Query  519   FANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
             FANR +AEEALQKL G VIGKQTVRLSWGRNPA++Q R+D+ NQW+GAYYGG  YDGY Y
Sbjct  344   FANRNNAEEALQKLNGTVIGKQTVRLSWGRNPANKQFRADYGNQWSGAYYGGQVYDGYGY  403

Query  339   AFPAPHNPNmyapaaygaypm--yGTHQQQVS  250
             AFP PH+P MYA AA        YG+HQQQVS
Sbjct  404   AFPPPHDPGMYAAAAATYGAYPIYGSHQQQVS  435


 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 74/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSS--RPMRIGAATPRKssg  730
            + + KV+ +  TG S+GYGFV F       + L    G+   +  +P R+  AT      
Sbjct  124  IASIKVIRNKQTGLSEGYGFVEFFSHATAEKVLQNYGGILMPNMEQPFRLNWAT------  177

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +   +  + +IFVG L  +V+D  L + F S+Y  + + K
Sbjct  178  ---------------FSTGEKRSENGPDLSIFVGDLAADVTDSLLHETFASKYSSVKAAK  222

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + T+  +A+ ++ G+    + +R+
Sbjct  223  VVIDANTGRSKGYGFVRFGDDTERSQAMTEMNGVYCSSRPMRI  265



>ref|XP_007017331.1| RNA-binding protein 47C isoform 3 [Theobroma cacao]
 gb|EOY14556.1| RNA-binding protein 47C isoform 3 [Theobroma cacao]
Length=436

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 211/271 (78%), Positives = 232/271 (86%), Gaps = 3/271 (1%)
 Frame = -2

Query  1056  LFKPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVID  877
             + +P   NW+TFS GEKRS N  DLSIFVGDLAADVTD+LL +TF SKY SVKAAKVVID
Sbjct  167   MEQPFRLNWATFSTGEKRSENGPDLSIFVGDLAADVTDSLLHETFASKYSSVKAAKVVID  226

Query  876   ANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy  697
             ANTGRSKGYGFVRFGDD ERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++Q G 
Sbjct  227   ANTGRSKGYGFVRFGDDTERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSQEGG  286

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
                + A  +QSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGEIVSVKIPVGKGCGFVQF
Sbjct  287   YASNGA-SNQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  345

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
             ANR +AEEALQKL G VIGKQTVRLSWGRNPA++Q R+D+ NQW+GAYYGG  YDGY YA
Sbjct  346   ANRNNAEEALQKLNGTVIGKQTVRLSWGRNPANKQFRADYGNQWSGAYYGGQVYDGYGYA  405

Query  336   FPAPHNPNmyapaaygaypm--yGTHQQQVS  250
             FP PH+P MYA AA        YG+HQQQVS
Sbjct  406   FPPPHDPGMYAAAAATYGAYPIYGSHQQQVS  436


 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 74/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSS--RPMRIGAATPRKssg  730
            + + KV+ +  TG S+GYGFV F       + L    G+   +  +P R+  AT      
Sbjct  124  IASIKVIRNKQTGLSEGYGFVEFFSHATAEKVLQNYGGILMPNMEQPFRLNWAT------  177

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +   +  + +IFVG L  +V+D  L + F S+Y  + + K
Sbjct  178  ---------------FSTGEKRSENGPDLSIFVGDLAADVTDSLLHETFASKYSSVKAAK  222

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + T+  +A+ ++ G+    + +R+
Sbjct  223  VVIDANTGRSKGYGFVRFGDDTERSQAMTEMNGVYCSSRPMRI  265



>ref|XP_006473363.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Citrus 
sinensis]
Length=433

 Score =   359 bits (921),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 207/270 (77%), Positives = 232/270 (86%), Gaps = 3/270 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+N  DLSIFVGDLAADVTD+LL +TF S+YPSVKAAKVV DAN
Sbjct  164   QPFRLNWATFSTGDKRSDNGPDLSIFVGDLAADVTDSLLHETFASRYPSVKAAKVVFDAN  223

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg-yS  694
             TGRSKGYGFVRFGDDNERSQA+TEMNG YCSSRPMRIGAATPRKSSGYQQQ+++QGG  S
Sbjct  224   TGRSKGYGFVRFGDDNERSQAMTEMNGAYCSSRPMRIGAATPRKSSGYQQQYSSQGGYAS  283

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+P  G QS+GDSSNTTIFVGGLDPNV+DEDLRQPFSQYGEI SVKIPVGKGCGFVQFA
Sbjct  284   NGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFA  343

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR +AEEAL KL G VIGKQ+VRLSWGRNPA++Q R+D+ NQW+GAYYGG  YDGY YA 
Sbjct  344   NRENAEEALHKLNGTVIGKQSVRLSWGRNPANKQFRADYGNQWSGAYYGGQVYDGYGYAI  403

Query  333   PAPHNPNmyapaaygaypmyG--THQQQVS  250
             P P++P+MYA AA          +HQQQVS
Sbjct  404   PPPNDPSMYAAAAAAYGAYPVYGSHQQQVS  433



>ref|XP_002510266.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF52453.1| nuclear acid binding protein, putative [Ricinus communis]
Length=443

 Score =   359 bits (921),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 206/268 (77%), Positives = 230/268 (86%), Gaps = 5/268 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+NA DLSIFVGDLAADVTD+LL +TFVS+YPSVKAAKVV DAN
Sbjct  180   QPFRLNWATFSTGDKRSDNAPDLSIFVGDLAADVTDSLLHETFVSRYPSVKAAKVVFDAN  239

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNER+QA+TEMNGVYCSSR MRIGAATPRKS+GYQ Q        N
Sbjct  240   TGRSKGYGFVRFGDDNERTQAMTEMNGVYCSSRAMRIGAATPRKSTGYQHQGGYVS---N  296

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+     Q+DGDS+NTTIFVGGLDPNV+DEDL+QPFSQYGEIVSVKIPVGKGCGFVQFA+
Sbjct  297   GASGQAFQADGDSTNTTIFVGGLDPNVTDEDLKQPFSQYGEIVSVKIPVGKGCGFVQFAS  356

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-RSDFTNQWAGAYYGGHFYDGYTYAF  334
             R++AEEALQKL G VIGKQTVRLSWGRNPA++Q  RSDF NQW GAYYGG  YDGY YA 
Sbjct  357   RSNAEEALQKLNGTVIGKQTVRLSWGRNPANKQQLRSDFGNQWGGAYYGGQIYDGYGYAL  416

Query  333   PAPHNPNmyapaaygaypmyGTHQQQVS  250
             P PH+P+    A YGAYP+YG+HQQQVS
Sbjct  417   PPPHDPS-MYAAPYGAYPVYGSHQQQVS  443


 Score = 51.6 bits (122),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/163 (24%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            + + KV+ +  TG S+GYGFV F       + L    G+    + +P R+  AT      
Sbjct  135  IVSIKVIRNKQTGLSEGYGFVEFYTHATAEKVLQNYAGILMPNTEQPFRLNWAT------  188

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +   ++ + +IFVG L  +V+D  L + F S+Y  + + K
Sbjct  189  ---------------FSTGDKRSDNAPDLSIFVGDLAADVTDSLLHETFVSRYPSVKAAK  233

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            +         KG GFV+F +  +  +A+ ++ G+    + +R+
Sbjct  234  VVFDANTGRSKGYGFVRFGDDNERTQAMTEMNGVYCSSRAMRI  276



>ref|XP_010098709.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
 gb|EXB75612.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
Length=423

 Score =   358 bits (918),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 209/268 (78%), Positives = 229/268 (85%), Gaps = 6/268 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKRS NNASDLSIFVGDLAADVTD+LLL+TF SK+PSVKAAKVV DA
Sbjct  161   QPFRLNWASFSTGEKRSDNNASDLSIFVGDLAADVTDSLLLETFSSKFPSVKAAKVVFDA  220

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS  694
             +TGRSKGYGFVRFGDDNERSQA++EMNGVYCSSRPMRIGAATPRKSSGY     A     
Sbjct  221   STGRSKGYGFVRFGDDNERSQAMSEMNGVYCSSRPMRIGAATPRKSSGYHNGGYAS----  276

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+   G QSDGDSSNTTIFVGGLDP+V DEDLRQPFSQYGEIVSVKIP GKGCGFVQFA
Sbjct  277   NGASTQGFQSDGDSSNTTIFVGGLDPSVIDEDLRQPFSQYGEIVSVKIPTGKGCGFVQFA  336

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR +AEEALQKL G VIGKQTVRLSWGRNPA++Q R DF NQW GAYYGG  YDGY YA 
Sbjct  337   NRNNAEEALQKLNGTVIGKQTVRLSWGRNPANKQYRGDFGNQWGGAYYGGQVYDGYGYAL  396

Query  333   PAPHNPNmyapaaygaypmyGTHQQQVS  250
             P PH+P+    A+YGAYP+YG+HQQQV+
Sbjct  397   PPPHDPS-MYAASYGAYPLYGSHQQQVN  423



>emb|CDP01376.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   357 bits (915),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 233/269 (87%), Gaps = 2/269 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRSNN SDLSIFVGDLAADVTD+LL DTF S+YPSVKAAKVVIDAN
Sbjct  134   QPFRLNWATFSTGDKRSNNGSDLSIFVGDLAADVTDSLLHDTFASRYPSVKAAKVVIDAN  193

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNERSQA+TEMNG+YCSSRPMRIGAATPRKSSGYQQQ+++QGGY N
Sbjct  194   TGRSKGYGFVRFGDDNERSQAMTEMNGIYCSSRPMRIGAATPRKSSGYQQQYSSQGGYIN  253

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
              S   GSQSDGDS NTTIFVGGLDPNVSDEDLRQPF QYGEIVSVKIPVGKGCGFVQFAN
Sbjct  254   SSSGQGSQSDGDSPNTTIFVGGLDPNVSDEDLRQPFLQYGEIVSVKIPVGKGCGFVQFAN  313

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R DAEEALQKL G  IGKQTVRLSWGRNPA++Q R++F NQW GAYYGGHFYDGY YA P
Sbjct  314   RNDAEEALQKLNGTTIGKQTVRLSWGRNPANKQLRAEFGNQWTGAYYGGHFYDGYGYAMP  373

Query  330   APHNPNmyapaaygaypmyG--THQQQVS  250
              PH+P MYA AA          THQQQVS
Sbjct  374   PPHDPGMYAAAAAAYGAYPMYGTHQQQVS  402



>ref|XP_011030480.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X3 
[Populus euphratica]
Length=427

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 207/269 (77%), Positives = 229/269 (85%), Gaps = 6/269 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+NA DLSIFVGDLAADVTD+LL +TFVSKYPSVKAAKVV DAN
Sbjct  163   QPFRLNWATFSTGDKRSDNAPDLSIFVGDLAADVTDSLLQETFVSKYPSVKAAKVVFDAN  222

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+ER+QA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ        N
Sbjct  223   TGRSKGYGFVRFGDDSERTQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQGGYAS---N  279

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+ A G QSDGDS+NTTIFVGGLDPNV+DEDL+QPFSQYGEIVSVKIPVGKGCGFVQFA 
Sbjct  280   GASAQGFQSDGDSNNTTIFVGGLDPNVTDEDLKQPFSQYGEIVSVKIPVGKGCGFVQFAK  339

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQ+L G VIGKQTVRLSWGRNPA++Q R+DF + W GAYYGG  YDGY YA P
Sbjct  340   RDNAEEALQRLNGTVIGKQTVRLSWGRNPANKQFRADFGSPWNGAYYGGQVYDGYGYALP  399

Query  330   APHNPNmyapaaygaypm--yGTHQQQVS  250
              PH+P+MYA AA        YG+HQQQVS
Sbjct  400   -PHDPSMYAAAAAAYGAYPIYGSHQQQVS  427


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/199 (24%), Positives = 92/199 (46%), Gaps = 31/199 (16%)
 Frame = -2

Query  1011  EKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYGFVRFG  832
             ++R  +  + +I++GDL   + +  L   F S    + + KV+ +  TG S+GYGFV F 
Sbjct  83    QQREGSGENKTIWIGDLHHWMDENYLHSCFAST-GEIASIKVIRNKQTGLSEGYGFVEFL  141

Query  831   DDNERSQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHGSQSDG  658
                   + L    G+    + +P R+  AT                      + G +   
Sbjct  142   THATAEKVLQNYGGILMPNTEQPFRLNWAT---------------------FSTGDKRSD  180

Query  657   DSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVKIPV------GKGCGFVQFANRTDA  499
             ++ + +IFVG L  +V+D  L++ F S+Y  + + K+         KG GFV+F + ++ 
Sbjct  181   NAPDLSIFVGDLAADVTDSLLQETFVSKYPSVKAAKVVFDANTGRSKGYGFVRFGDDSER  240

Query  498   EEALQKLKGLVIGKQTVRL  442
              +A+ ++ G+    + +R+
Sbjct  241   TQAMTEMNGVYCSSRPMRI  259



>ref|XP_011030472.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Populus euphratica]
Length=428

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 207/269 (77%), Positives = 229/269 (85%), Gaps = 6/269 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+NA DLSIFVGDLAADVTD+LL +TFVSKYPSVKAAKVV DAN
Sbjct  164   QPFRLNWATFSTGDKRSDNAPDLSIFVGDLAADVTDSLLQETFVSKYPSVKAAKVVFDAN  223

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+ER+QA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ        N
Sbjct  224   TGRSKGYGFVRFGDDSERTQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQGGYAS---N  280

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+ A G QSDGDS+NTTIFVGGLDPNV+DEDL+QPFSQYGEIVSVKIPVGKGCGFVQFA 
Sbjct  281   GASAQGFQSDGDSNNTTIFVGGLDPNVTDEDLKQPFSQYGEIVSVKIPVGKGCGFVQFAK  340

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQ+L G VIGKQTVRLSWGRNPA++Q R+DF + W GAYYGG  YDGY YA P
Sbjct  341   RDNAEEALQRLNGTVIGKQTVRLSWGRNPANKQFRADFGSPWNGAYYGGQVYDGYGYALP  400

Query  330   APHNPNmyapaaygaypm--yGTHQQQVS  250
              PH+P+MYA AA        YG+HQQQVS
Sbjct  401   -PHDPSMYAAAAAAYGAYPIYGSHQQQVS  428


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/199 (24%), Positives = 92/199 (46%), Gaps = 31/199 (16%)
 Frame = -2

Query  1011  EKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYGFVRFG  832
             ++R  +  + +I++GDL   + +  L   F S    + + KV+ +  TG S+GYGFV F 
Sbjct  84    QQREGSGENKTIWIGDLHHWMDENYLHSCFAST-GEIASIKVIRNKQTGLSEGYGFVEFL  142

Query  831   DDNERSQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHGSQSDG  658
                   + L    G+    + +P R+  AT                      + G +   
Sbjct  143   THATAEKVLQNYGGILMPNTEQPFRLNWAT---------------------FSTGDKRSD  181

Query  657   DSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVKIPV------GKGCGFVQFANRTDA  499
             ++ + +IFVG L  +V+D  L++ F S+Y  + + K+         KG GFV+F + ++ 
Sbjct  182   NAPDLSIFVGDLAADVTDSLLQETFVSKYPSVKAAKVVFDANTGRSKGYGFVRFGDDSER  241

Query  498   EEALQKLKGLVIGKQTVRL  442
              +A+ ++ G+    + +R+
Sbjct  242   TQAMTEMNGVYCSSRPMRI  260



>ref|XP_011030463.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Populus euphratica]
Length=428

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 207/269 (77%), Positives = 229/269 (85%), Gaps = 6/269 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+NA DLSIFVGDLAADVTD+LL +TFVSKYPSVKAAKVV DAN
Sbjct  164   QPFRLNWATFSTGDKRSDNAPDLSIFVGDLAADVTDSLLQETFVSKYPSVKAAKVVFDAN  223

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+ER+QA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ        N
Sbjct  224   TGRSKGYGFVRFGDDSERTQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQGGYAS---N  280

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+ A G QSDGDS+NTTIFVGGLDPNV+DEDL+QPFSQYGEIVSVKIPVGKGCGFVQFA 
Sbjct  281   GASAQGFQSDGDSNNTTIFVGGLDPNVTDEDLKQPFSQYGEIVSVKIPVGKGCGFVQFAK  340

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQ+L G VIGKQTVRLSWGRNPA++Q R+DF + W GAYYGG  YDGY YA P
Sbjct  341   RDNAEEALQRLNGTVIGKQTVRLSWGRNPANKQFRADFGSPWNGAYYGGQVYDGYGYALP  400

Query  330   APHNPNmyapaaygaypm--yGTHQQQVS  250
              PH+P+MYA AA        YG+HQQQVS
Sbjct  401   -PHDPSMYAAAAAAYGAYPIYGSHQQQVS  428


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/199 (24%), Positives = 92/199 (46%), Gaps = 31/199 (16%)
 Frame = -2

Query  1011  EKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYGFVRFG  832
             ++R  +  + +I++GDL   + +  L   F S    + + KV+ +  TG S+GYGFV F 
Sbjct  84    QQREGSGENKTIWIGDLHHWMDENYLHSCFAST-GEIASIKVIRNKQTGLSEGYGFVEFL  142

Query  831   DDNERSQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHGSQSDG  658
                   + L    G+    + +P R+  AT                      + G +   
Sbjct  143   THATAEKVLQNYGGILMPNTEQPFRLNWAT---------------------FSTGDKRSD  181

Query  657   DSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVKIPV------GKGCGFVQFANRTDA  499
             ++ + +IFVG L  +V+D  L++ F S+Y  + + K+         KG GFV+F + ++ 
Sbjct  182   NAPDLSIFVGDLAADVTDSLLQETFVSKYPSVKAAKVVFDANTGRSKGYGFVRFGDDSER  241

Query  498   EEALQKLKGLVIGKQTVRL  442
              +A+ ++ G+    + +R+
Sbjct  242   TQAMTEMNGVYCSSRPMRI  260



>ref|XP_004291135.1| PREDICTED: polyadenylate-binding protein RBP47-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   357 bits (917),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 211/270 (78%), Positives = 229/270 (85%), Gaps = 6/270 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+NA DLSIFVGDLAADVTD+LL +TF SKYPSVKAAKVV DAN
Sbjct  178   QPFRLNWATFSTGDKRSDNAPDLSIFVGDLAADVTDSLLHETFSSKYPSVKAAKVVFDAN  237

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGD+NERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ        N
Sbjct  238   TGRSKGYGFVRFGDENERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQGGYAL---N  294

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+P  G QSDGD++NTTIFVGGLDPNV+DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN
Sbjct  295   GTPTQGFQSDGDATNTTIFVGGLDPNVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  354

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-RSDFTNQWAG-AYYGGHFYDGYTYA  337
             R +AEEAL KL G VIGKQTVRLSWGRNPA++Q  R DF NQWAG AYYGG  YDGY YA
Sbjct  355   RNNAEEALPKLNGSVIGKQTVRLSWGRNPANKQQFRMDFGNQWAGAAYYGGPVYDGYGYA  414

Query  336   FPAPHNPNmyapaaygayp-myGTHQQQVS  250
              P  H+P+MYA AA      +YGTHQQQVS
Sbjct  415   LPPQHDPSMYAAAAAYGAYPVYGTHQQQVS  444



>ref|XP_004141245.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
sativus]
Length=426

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 211/266 (79%), Positives = 232/266 (87%), Gaps = 4/266 (2%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+TFS G+KRS+N  DLSIFVGDLAADVTD+LL +TF SK+PSVKAAKVVIDANTGRSK
Sbjct  160   NWATFSTGDKRSDNDPDLSIFVGDLAADVTDSLLYETFSSKFPSVKAAKVVIDANTGRSK  219

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg--gySNGSP  682
             GYGFVRFGDDNERSQA+TEMNG+YCSSRPMRIGAATPRKSSGYQQQ ++QG    +NG  
Sbjct  220   GYGFVRFGDDNERSQAMTEMNGIYCSSRPMRIGAATPRKSSGYQQQHSSQGGGYSTNGYF  279

Query  681   AHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTD  502
             + G QS+GDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR D
Sbjct  280   SQGLQSEGDSANTTIFVGGLDPNVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRND  339

Query  501   AEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPH  322
             AEEALQKL G VIGKQTVRLSWGRNPA++Q R DF NQW GAYYGGH YDGY Y   +PH
Sbjct  340   AEEALQKLNGTVIGKQTVRLSWGRNPANKQFR-DFGNQWNGAYYGGHIYDGYGYGLASPH  398

Query  321   NPNmyapaaygaypmyGTHQQQVS*M  244
             +P+    AAYGAY +YG HQQQV  M
Sbjct  399   DPS-MYHAAYGAYTVYGNHQQQVEQM  423



>ref|XP_008361011.1| PREDICTED: polyadenylate-binding protein RBP47-like [Malus domestica]
Length=443

 Score =   356 bits (913),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 209/271 (77%), Positives = 230/271 (85%), Gaps = 4/271 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+NA DLSIFVGDLAADVTD+LL +TF SKYPSVKAAKVV DAN
Sbjct  173   QPFRLNWATFSTGDKRSDNAPDLSIFVGDLAADVTDSLLXETFSSKYPSVKAAKVVFDAN  232

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gyS  694
             TGRSKGYGFVRFGD+NERSQA+TEMNG +CSSRPMRIGAATPRKSS YQQQ+++QG   S
Sbjct  233   TGRSKGYGFVRFGDENERSQAMTEMNGSFCSSRPMRIGAATPRKSSAYQQQYSSQGGYVS  292

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA
Sbjct  293   NGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  352

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGA-YYGGHFYDGYTYA  337
             NR +AEEAL KL G VIGKQTVRLSWGRNPA++Q RSDF NQW GA YYGG  Y+GY YA
Sbjct  353   NRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQFRSDFGNQWGGAXYYGGPVYEGYGYA  412

Query  336   FPAPHNPNmyapaaygaypmyG--THQQQVS  250
              P  H+P+MYA AA          THQQQVS
Sbjct  413   LPPHHDPSMYAAAAAAYGAYPVYGTHQQQVS  443



>ref|XP_009370172.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Pyrus x bretschneideri]
Length=440

 Score =   355 bits (912),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 208/271 (77%), Positives = 231/271 (85%), Gaps = 4/271 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS G+KRS+NA DLSIFVGDLAADVTD+LL +TF SKYPSVKAAKVV DAN
Sbjct  170   QPFRLNWAAFSTGDKRSDNAPDLSIFVGDLAADVTDSLLHETFSSKYPSVKAAKVVFDAN  229

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gyS  694
             TGRSKGYGFVRFGD+NERSQA+TEMNG++CSSRPMRIGAATPRKSSGYQQQ+++QG   S
Sbjct  230   TGRSKGYGFVRFGDENERSQAMTEMNGIFCSSRPMRIGAATPRKSSGYQQQYSSQGGYVS  289

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA
Sbjct  290   NGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  349

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG-AYYGGHFYDGYTYA  337
             NR +AEEAL KL G VIGKQTVRLSWGRNPA++Q RSDF NQW G AYYGG  Y+GY YA
Sbjct  350   NRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQFRSDFGNQWGGAAYYGGPVYEGYGYA  409

Query  336   FPAPHNPNmyapaaygaypmyG--THQQQVS  250
              P  H+P+MYA A+          THQQQVS
Sbjct  410   LPPHHDPSMYAAASAAYGAYPVYGTHQQQVS  440



>gb|KJB58432.1| hypothetical protein B456_009G209600 [Gossypium raimondii]
Length=432

 Score =   355 bits (911),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 196/247 (79%), Positives = 216/247 (87%), Gaps = 2/247 (1%)
 Frame = -2

Query  1056  LFKPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVID  877
             + +P   NW+TFSMG+K S N  DLSIFVGDLAADVTD+LL +TF SKYPSVKA KVVID
Sbjct  167   MEQPFRLNWATFSMGDKHSENGPDLSIFVGDLAADVTDSLLHETFASKYPSVKAVKVVID  226

Query  876   ANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy  697
             ANTGRSKGYGFVRFGDD ERS A+TEMNGVYCSSRPMRIGAATPRKSS YQQQ++ QGGY
Sbjct  227   ANTGRSKGYGFVRFGDDTERSLAMTEMNGVYCSSRPMRIGAATPRKSSSYQQQYSLQGGY  286

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             ++ S +  SQSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGEIVSVKIPVGKGCGFVQF
Sbjct  287   ASNSAS--SQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  344

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
             A R +AEEALQKL G +IGKQTVRLSWGRNP ++Q R+D+ NQW GAYYGG  YDGY YA
Sbjct  345   AGRNNAEEALQKLNGTIIGKQTVRLSWGRNPTNKQFRADYGNQWGGAYYGGAVYDGYGYA  404

Query  336   FPAPHNP  316
             FP PHNP
Sbjct  405   FPPPHNP  411


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 75/163 (46%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSS--RPMRIGAATPRKssg  730
            + + KV+ +  TG S+GYGFV F       + L   +G+   +  +P R+  AT      
Sbjct  124  ISSIKVIRNKQTGLSEGYGFVEFFSHATAEKVLQNYSGILMPNMEQPFRLNWAT------  177

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +   +  + +IFVG L  +V+D  L + F S+Y  + +VK
Sbjct  178  ---------------FSMGDKHSENGPDLSIFVGDLAADVTDSLLHETFASKYPSVKAVK  222

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + T+   A+ ++ G+    + +R+
Sbjct  223  VVIDANTGRSKGYGFVRFGDDTERSLAMTEMNGVYCSSRPMRI  265



>ref|XP_002302445.2| RNA-binding protein 47 [Populus trichocarpa]
 gb|EEE81718.2| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 206/267 (77%), Positives = 226/267 (85%), Gaps = 4/267 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+N  DLSIFVGDLAADVTD+LL +TF SKY SVK+AKVV DAN
Sbjct  167   QPFRLNWATFSTGDKRSDNTPDLSIFVGDLAADVTDSLLQETFASKYQSVKSAKVVFDAN  226

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD ER+QA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ        N
Sbjct  227   TGRSKGYGFVRFGDDTERTQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQGGYGS---N  283

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+ + G QSDGDSSN TIFVGGLDPNV+DEDL+QPFSQYGEIVSVKIPV KGCGFVQFAN
Sbjct  284   GASSQGFQSDGDSSNATIFVGGLDPNVTDEDLKQPFSQYGEIVSVKIPVSKGCGFVQFAN  343

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQKL G VIGKQTVRLSWGRNP H+Q R+DF++ W GAYYGG  YDGY YA P
Sbjct  344   RNNAEEALQKLNGTVIGKQTVRLSWGRNPGHKQHRADFSSPWNGAYYGGQVYDGYGYALP  403

Query  330   APHNPNmyapaaygaypmyGTHQQQVS  250
              PH+P+    AAYGAYPMYG HQQQVS
Sbjct  404   PPHDPS-TYAAAYGAYPMYGNHQQQVS  429


 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 74/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            + + KV+    TG S+GYGFV F       + L    G+    + +P R+  AT      
Sbjct  122  IASIKVIRSKQTGLSEGYGFVEFFTHATAEKVLQNYGGILMPNTEQPFRLNWAT------  175

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +   ++ + +IFVG L  +V+D  L++ F S+Y  + S K
Sbjct  176  ---------------FSTGDKRSDNTPDLSIFVGDLAADVTDSLLQETFASKYQSVKSAK  220

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            +         KG GFV+F + T+  +A+ ++ G+    + +R+
Sbjct  221  VVFDANTGRSKGYGFVRFGDDTERTQAMTEMNGVYCSSRPMRI  263



>ref|XP_008452518.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
melo]
Length=426

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 209/266 (79%), Positives = 232/266 (87%), Gaps = 4/266 (2%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+TFS G+KRS+N  DLSIFVGDLAADVTD+LL +TF SK+PSVKAAKVVIDANTGRSK
Sbjct  160   NWATFSTGDKRSDNDPDLSIFVGDLAADVTDSLLYETFSSKFPSVKAAKVVIDANTGRSK  219

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg--gySNGSP  682
             GYGFVRFGDDNERSQA+TEMNG+YCSSRPMRIGAATPRKSSGYQQQ ++QG    +NG  
Sbjct  220   GYGFVRFGDDNERSQAMTEMNGIYCSSRPMRIGAATPRKSSGYQQQHSSQGGGYSTNGYF  279

Query  681   AHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTD  502
             + G QS+GDS+NTTIFVGGLDPNV+DEDLRQPFSQ+GEIVSVKIPVGKGCGFVQFANR D
Sbjct  280   SQGLQSEGDSANTTIFVGGLDPNVTDEDLRQPFSQHGEIVSVKIPVGKGCGFVQFANRND  339

Query  501   AEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPH  322
             AEEALQKL G VIGKQTVRLSWGRNPA++Q R +F NQW GAYYGGH YDGY Y   +PH
Sbjct  340   AEEALQKLNGTVIGKQTVRLSWGRNPANKQFR-EFGNQWNGAYYGGHIYDGYGYGLASPH  398

Query  321   NPNmyapaaygaypmyGTHQQQVS*M  244
             +P+    AAYGAY +YG HQQQV  M
Sbjct  399   DPS-MYHAAYGAYTVYGNHQQQVEQM  423



>ref|XP_008357395.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Malus domestica]
Length=444

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 207/271 (76%), Positives = 229/271 (85%), Gaps = 4/271 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+NA DLSIFVGDLAADV D+LL +TF SKYPSVKAAKVV DAN
Sbjct  174   QPFRLNWATFSTGDKRSDNAPDLSIFVGDLAADVXDSLLHETFSSKYPSVKAAKVVFDAN  233

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gyS  694
             TGRSKGYGFVRFGD+NERSQA+TEMNG +CSSRPMRIGAATPRKSSGYQQQ+++QG   S
Sbjct  234   TGRSKGYGFVRFGDENERSQAMTEMNGXFCSSRPMRIGAATPRKSSGYQQQYSSQGGYVS  293

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+P  G Q DGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA
Sbjct  294   NGTPTQGFQFDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  353

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG-AYYGGHFYDGYTYA  337
             NR +AEEAL KL G VIGKQTVRLSWGRNPA++Q RSDF NQW G AYYGG  Y+GY YA
Sbjct  354   NRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQFRSDFGNQWGGAAYYGGPVYEGYGYA  413

Query  336   FPAPHNPNmyapaaygaypmyG--THQQQVS  250
              P  H+P+MYA A+          THQQQVS
Sbjct  414   LPPHHDPSMYAAASAAYGAYPVYGTHQQQVS  444



>ref|XP_009367486.1| PREDICTED: polyadenylate-binding protein RBP47-like, partial 
[Pyrus x bretschneideri]
Length=410

 Score =   351 bits (901),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 209/272 (77%), Positives = 229/272 (84%), Gaps = 5/272 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+NA DLSIFVGDLAADVTD LL +TF SKYPSVKAAKVV DAN
Sbjct  139   QPFRLNWATFSTGDKRSDNAPDLSIFVGDLAADVTDGLLHETFSSKYPSVKAAKVVFDAN  198

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gyS  694
             TGRSKGYGFVRFGD+NERSQA+TEMNG +CSSRPMRIGAATPRKSS YQQQ+++QG   S
Sbjct  199   TGRSKGYGFVRFGDENERSQAMTEMNGSFCSSRPMRIGAATPRKSSAYQQQYSSQGGYVS  258

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA
Sbjct  259   NGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  318

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-RSDFTNQWAG-AYYGGHFYDGYTY  340
             NR +AEEAL KL G VIGKQTVRLSWGRNPA++Q  RSDF NQW G AYYGG  Y+GY Y
Sbjct  319   NRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQQFRSDFGNQWGGAAYYGGPVYEGYGY  378

Query  339   AFPAPHNPNmyapaaygaypmyG--THQQQVS  250
             A P  H+P+MYA AA          THQQQVS
Sbjct  379   ALPPHHDPSMYAAAAAAYGAYPMYGTHQQQVS  410



>ref|XP_008393835.1| PREDICTED: polyadenylate-binding protein RBP47-like [Malus domestica]
Length=444

 Score =   352 bits (903),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 209/272 (77%), Positives = 230/272 (85%), Gaps = 5/272 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+NA DLSIFVGDLAADVTD+LL +TF SKYPSVKAAKVV DAN
Sbjct  173   QPFRLNWATFSTGDKRSDNAPDLSIFVGDLAADVTDSLLXETFSSKYPSVKAAKVVFDAN  232

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gyS  694
             TGRSKGYGFVRFGD+NERSQA+TEMNG +CSSRPMRIGAATPRKSS YQQQ+++QG   S
Sbjct  233   TGRSKGYGFVRFGDENERSQAMTEMNGSFCSSRPMRIGAATPRKSSAYQQQYSSQGGYVS  292

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA
Sbjct  293   NGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  352

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-RSDFTNQWAGA-YYGGHFYDGYTY  340
             NR +AEEAL KL G VIGKQTVRLSWGRNPA++Q  RSDF NQW GA YYGG  Y+GY Y
Sbjct  353   NRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQQFRSDFGNQWGGAXYYGGPVYEGYGY  412

Query  339   AFPAPHNPNmyapaaygaypmyG--THQQQVS  250
             A P  H+P+MYA AA          THQQQVS
Sbjct  413   ALPPHHDPSMYAAAAAAYGAYPVYGTHQQQVS  444



>ref|XP_009370171.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Pyrus x bretschneideri]
Length=441

 Score =   352 bits (902),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 208/272 (76%), Positives = 231/272 (85%), Gaps = 5/272 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS G+KRS+NA DLSIFVGDLAADVTD+LL +TF SKYPSVKAAKVV DAN
Sbjct  170   QPFRLNWAAFSTGDKRSDNAPDLSIFVGDLAADVTDSLLHETFSSKYPSVKAAKVVFDAN  229

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gyS  694
             TGRSKGYGFVRFGD+NERSQA+TEMNG++CSSRPMRIGAATPRKSSGYQQQ+++QG   S
Sbjct  230   TGRSKGYGFVRFGDENERSQAMTEMNGIFCSSRPMRIGAATPRKSSGYQQQYSSQGGYVS  289

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+P  G QSDGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA
Sbjct  290   NGTPTQGFQSDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  349

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-RSDFTNQWAG-AYYGGHFYDGYTY  340
             NR +AEEAL KL G VIGKQTVRLSWGRNPA++Q  RSDF NQW G AYYGG  Y+GY Y
Sbjct  350   NRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQQFRSDFGNQWGGAAYYGGPVYEGYGY  409

Query  339   AFPAPHNPNmyapaaygaypmyG--THQQQVS  250
             A P  H+P+MYA A+          THQQQVS
Sbjct  410   ALPPHHDPSMYAAASAAYGAYPVYGTHQQQVS  441



>ref|XP_008357394.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X1 [Malus domestica]
Length=382

 Score =   349 bits (895),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 207/272 (76%), Positives = 229/272 (84%), Gaps = 5/272 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+NA DLSIFVGDLAADV D+LL +TF SKYPSVKAAKVV DAN
Sbjct  111   QPFRLNWATFSTGDKRSDNAPDLSIFVGDLAADVXDSLLHETFSSKYPSVKAAKVVFDAN  170

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gyS  694
             TGRSKGYGFVRFGD+NERSQA+TEMNG +CSSRPMRIGAATPRKSSGYQQQ+++QG   S
Sbjct  171   TGRSKGYGFVRFGDENERSQAMTEMNGXFCSSRPMRIGAATPRKSSGYQQQYSSQGGYVS  230

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+P  G Q DGDS+NTTIFVGGLDPNV+DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA
Sbjct  231   NGTPTQGFQFDGDSTNTTIFVGGLDPNVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  290

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-RSDFTNQWAG-AYYGGHFYDGYTY  340
             NR +AEEAL KL G VIGKQTVRLSWGRNPA++Q  RSDF NQW G AYYGG  Y+GY Y
Sbjct  291   NRNNAEEALPKLNGTVIGKQTVRLSWGRNPANKQQFRSDFGNQWGGAAYYGGPVYEGYGY  350

Query  339   AFPAPHNPNmyapaaygaypmyG--THQQQVS  250
             A P  H+P+MYA A+          THQQQVS
Sbjct  351   ALPPHHDPSMYAAASAAYGAYPVYGTHQQQVS  382



>ref|XP_011013053.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score =   350 bits (898),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 203/267 (76%), Positives = 226/267 (85%), Gaps = 4/267 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+N  DLSIFVGDLAADVTD+LL +TF +KY SVK+AKVV DAN
Sbjct  165   QPFRLNWATFSTGDKRSDNTPDLSIFVGDLAADVTDSLLQETFATKYQSVKSAKVVFDAN  224

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD ER+QA+TEMNG+YCSSRPMRIGAATPRKSSGYQQQ        N
Sbjct  225   TGRSKGYGFVRFGDDTERTQAMTEMNGIYCSSRPMRIGAATPRKSSGYQQQGGYGS---N  281

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+ + G QSDGDSSN TIFVGGLDPNV+DEDL+QPFSQYGEIVSVKIPV KGCGFVQFAN
Sbjct  282   GASSQGFQSDGDSSNATIFVGGLDPNVTDEDLKQPFSQYGEIVSVKIPVSKGCGFVQFAN  341

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQKL G VIGKQTVRLSWGRNP ++Q R+DF++ W GAYYGG  YDGY YA P
Sbjct  342   RNNAEEALQKLNGTVIGKQTVRLSWGRNPGNKQHRADFSSPWNGAYYGGQVYDGYGYALP  401

Query  330   APHNPNmyapaaygaypmyGTHQQQVS  250
              PH+P+    AAYGAYPMYG HQQQVS
Sbjct  402   PPHDPS-TYAAAYGAYPMYGNHQQQVS  427


 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 74/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            + + KV+    TG S+GYGFV F       + L    G+    + +P R+  AT      
Sbjct  120  IASIKVIRSKQTGLSEGYGFVEFFTHATAEKVLQNYGGILMPNTEQPFRLNWAT------  173

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +   ++ + +IFVG L  +V+D  L++ F ++Y  + S K
Sbjct  174  ---------------FSTGDKRSDNTPDLSIFVGDLAADVTDSLLQETFATKYQSVKSAK  218

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            +         KG GFV+F + T+  +A+ ++ G+    + +R+
Sbjct  219  VVFDANTGRSKGYGFVRFGDDTERTQAMTEMNGIYCSSRPMRI  261



>ref|XP_011017227.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score =   349 bits (896),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 203/267 (76%), Positives = 226/267 (85%), Gaps = 4/267 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+N  DLSIFVGDLAADVTD+LL +TF +KY SVK+AKVV DAN
Sbjct  165   QPFRLNWATFSTGDKRSDNTPDLSIFVGDLAADVTDSLLQETFATKYQSVKSAKVVFDAN  224

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD ER+QA+TEMNG+YCSSRPMRIGAATPRKSSGYQQQ        N
Sbjct  225   TGRSKGYGFVRFGDDTERTQAMTEMNGIYCSSRPMRIGAATPRKSSGYQQQGGYGS---N  281

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+ + G QSDGDSSN TIFVGGLDPNV+DEDL+QPFSQYGEIVSVKIPV KGCGFVQFAN
Sbjct  282   GASSQGFQSDGDSSNATIFVGGLDPNVNDEDLKQPFSQYGEIVSVKIPVSKGCGFVQFAN  341

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQKL G VIGKQTVRLSWGRNP ++Q R+DF++ W GAYYGG  YDGY YA P
Sbjct  342   RNNAEEALQKLNGTVIGKQTVRLSWGRNPGNKQHRADFSSPWNGAYYGGQVYDGYGYALP  401

Query  330   APHNPNmyapaaygaypmyGTHQQQVS  250
              PH+P+    AAYGAYPMYG HQQQVS
Sbjct  402   PPHDPS-TYAAAYGAYPMYGNHQQQVS  427


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 74/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            + + KV+    TG S+GYGFV F       + L    G+    + +P R+  AT      
Sbjct  120  IASIKVIRSKQTGLSEGYGFVEFFTHATAEKVLQNYGGILMPNTEQPFRLNWAT------  173

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +   ++ + +IFVG L  +V+D  L++ F ++Y  + S K
Sbjct  174  ---------------FSTGDKRSDNTPDLSIFVGDLAADVTDSLLQETFATKYQSVKSAK  218

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            +         KG GFV+F + T+  +A+ ++ G+    + +R+
Sbjct  219  VVFDANTGRSKGYGFVRFGDDTERTQAMTEMNGIYCSSRPMRI  261



>emb|CAN81343.1| hypothetical protein VITISV_008697 [Vitis vinifera]
Length=536

 Score =   353 bits (905),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 207/289 (72%), Positives = 232/289 (80%), Gaps = 9/289 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFSMG+KRS+N  DLSIFVGDLA+DV+D+LL +TF  KYPSVKAAKVV DAN
Sbjct  43    QPFRLNWATFSMGDKRSDNGPDLSIFVGDLASDVSDSLLHETFAGKYPSVKAAKVVFDAN  102

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg-yS  694
             TGRSKGYGFVRFGD+NERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++ GG  S
Sbjct  103   TGRSKGYGFVRFGDENERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSHGGYAS  162

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+     QSDGDS NTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA
Sbjct  163   NGASV---QSDGDSMNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  219

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS-----RSDFTNQWAGAYYGGHFYDG  349
             NR +AE+ALQKL G VIGKQTVRLSWGRNPA++Q+     R+DF NQW+GAYYGG  YDG
Sbjct  220   NRNNAEDALQKLNGTVIGKQTVRLSWGRNPANKQANSLFMRADFGNQWSGAYYGGQVYDG  279

Query  348   YTYAFPAPHNPNmyapaaygaypmyGTHQQQVS*MSAQEDYLQLRWHFW  202
             Y YA P PH+P MYA A           QQ++   S  +    L W  W
Sbjct  280   YGYALPPPHDPTMYAAAYGAYPVYGNHQQQKMFSGSIHDSNGFLMWLIW  328



>gb|KJB59840.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
 gb|KJB59841.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
Length=419

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 206/267 (77%), Positives = 228/267 (85%), Gaps = 3/267 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+T S GEKRS N  DLSIFVGDL ADVTD+LL +TF SKYPSVKAA+VVI AN
Sbjct  156   QPFRLNWATLSTGEKRSENGPDLSIFVGDLGADVTDSLLHETFASKYPSVKAARVVIVAN  215

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGD+ ERSQA+ EMNGVYCSSRPMRIGAATPRKSSGYQQQ++ QGGY  
Sbjct  216   TGRSKGYGFVRFGDETERSQAMNEMNGVYCSSRPMRIGAATPRKSSGYQQQYSLQGGY--  273

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
              S  + +QSDGDSSNTTIFVGGLDPNV++EDLRQ FSQYGEIVSVKIPVGKGCGFVQ+AN
Sbjct  274   ASNGNSTQSDGDSSNTTIFVGGLDPNVTEEDLRQSFSQYGEIVSVKIPVGKGCGFVQYAN  333

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQKL G+VIGKQTVRLSWGRNPA++Q R D+ NQW GAYYGG  YDGY YA P
Sbjct  334   RKNAEEALQKLNGMVIGKQTVRLSWGRNPANKQFRGDYGNQWGGAYYGGQVYDGYRYAVP  393

Query  330   APHNPNmyapaaygaypmyGTHQQQVS  250
              PH+P     AAYG YP+YG+HQQQVS
Sbjct  394   PPHDPG-MYAAAYGTYPIYGSHQQQVS  419


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 74/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            + + KV+ +  TG S+GYGFV F       + L   + +    + +P R+  AT      
Sbjct  111  IASIKVIRNKQTGLSEGYGFVEFFSHATAEKVLQSYSSILMPNTDQPFRLNWAT------  164

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +   +  + +IFVG L  +V+D  L + F S+Y  + + +
Sbjct  165  ---------------LSTGEKRSENGPDLSIFVGDLGADVTDSLLHETFASKYPSVKAAR  209

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + T+  +A+ ++ G+    + +R+
Sbjct  210  VVIVANTGRSKGYGFVRFGDETERSQAMNEMNGVYCSSRPMRI  252



>gb|KJB63805.1| hypothetical protein B456_010G017300 [Gossypium raimondii]
Length=431

 Score =   347 bits (891),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 207/270 (77%), Positives = 229/270 (85%), Gaps = 6/270 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS GEKRS N  DLSIFVGDLAADVTD+LL +TF SKYPSVKAAKVVIDAN
Sbjct  165   QPFRLNWATFSTGEKRSENGPDLSIFVGDLAADVTDSLLHETFASKYPSVKAAKVVIDAN  224

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gyS  694
             TGRSKGYGFVRFGDD ERSQA+TEMNG YCSSRPMRIGAATPRKSSGYQQQ+++QG   S
Sbjct  225   TGRSKGYGFVRFGDDTERSQAMTEMNGAYCSSRPMRIGAATPRKSSGYQQQYSSQGGYAS  284

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NGS    +QSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGE+VSVKIPVGKGCGFV+FA
Sbjct  285   NGS---STQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGELVSVKIPVGKGCGFVRFA  341

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR +AEEALQKL    IGKQTVRLSWGRNPA++Q R+D++NQW GAYYGG  YDGY YA 
Sbjct  342   NRNNAEEALQKLNETNIGKQTVRLSWGRNPANKQFRADYSNQWGGAYYGGQVYDGYGYAL  401

Query  333   PAPHNPNmyapaaygaypm--yGTHQQQVS  250
             P P++  MYA AA        YG+HQQQVS
Sbjct  402   PPPNSLGMYAAAATAYGAYPIYGSHQQQVS  431


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 74/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            + + KV+ +  TG S+GYGFV F       + L   +G+    + +P R+  AT      
Sbjct  120  IVSIKVIRNKQTGLSEGYGFVEFFSHAMAEKVLQNYSGMLMPNTEQPFRLNWAT------  173

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +   +  + +IFVG L  +V+D  L + F S+Y  + + K
Sbjct  174  ---------------FSTGEKRSENGPDLSIFVGDLAADVTDSLLHETFASKYPSVKAAK  218

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + T+  +A+ ++ G     + +R+
Sbjct  219  VVIDANTGRSKGYGFVRFGDDTERSQAMTEMNGAYCSSRPMRI  261



>ref|XP_010268853.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Nelumbo 
nucifera]
Length=408

 Score =   346 bits (888),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 205/268 (76%), Positives = 229/268 (85%), Gaps = 3/268 (1%)
 Frame = -2

Query  1047  PAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANT  868
             P   NW++FSMGE+RS+  SD SIFVGDLAADVTDTLL +TF S+YPSVK AKVVIDANT
Sbjct  142   PFRLNWASFSMGERRSDAGSDHSIFVGDLAADVTDTLLHETFASRYPSVKGAKVVIDANT  201

Query  867   GRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gySN  691
             GRSKGYGFVRFGD+NE+S+A+TEMNGVYCSSRPMRIG ATPRKSS YQQQ+++QG   SN
Sbjct  202   GRSKGYGFVRFGDENEKSRAMTEMNGVYCSSRPMRIGVATPRKSSAYQQQYSSQGGYASN  261

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+ A G QSDGDS+NTTIFVGGLDP+V+DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN
Sbjct  262   GASALGGQSDGDSTNTTIFVGGLDPSVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  321

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             RT+AEEALQKL G VIGKQTVRLSWGRNPA++  R+D  NQW GAYYGG  YDGY YA P
Sbjct  322   RTNAEEALQKLNGTVIGKQTVRLSWGRNPANKL-RADPVNQWNGAYYGGQVYDGYGYAVP  380

Query  330   APHNPNmyapaaygayp-myGTHQQQVS  250
              P +P+MYA A       +YG HQQQVS
Sbjct  381   PPQDPSMYAAATAYGAYPIYGNHQQQVS  408


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 71/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+GYGFV F       + L   NG     +  P R+  A       
Sbjct  96   VVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKVLHNYNGTAMPNTEHPFRLNWA-------  148

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +     S+ +IFVG L  +V+D  L + F S+Y  +   K
Sbjct  149  --------------SFSMGERRSDAGSDHSIFVGDLAADVTDTLLHETFASRYPSVKGAK  194

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  195  VVIDANTGRSKGYGFVRFGDENEKSRAMTEMNGVYCSSRPMRI  237



>ref|XP_010268845.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Nelumbo 
nucifera]
Length=413

 Score =   345 bits (884),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 204/273 (75%), Positives = 228/273 (84%), Gaps = 8/273 (3%)
 Frame = -2

Query  1047  PAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANT  868
             P   NW++FSMGE+RS+  SD SIFVGDLAADVTDTLL +TF S+YPSVK AKVVIDANT
Sbjct  142   PFRLNWASFSMGERRSDAGSDHSIFVGDLAADVTDTLLHETFASRYPSVKGAKVVIDANT  201

Query  867   GRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg----  700
             GRSKGYGFVRFGD+NE+S+A+TEMNGVYCSSRPMRIG ATPRKSS YQQQ+++Q      
Sbjct  202   GRSKGYGFVRFGDENEKSRAMTEMNGVYCSSRPMRIGVATPRKSSAYQQQYSSQALVLVG  261

Query  699   --ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGF  526
                SNG+ A G QSDGDS+NTTIFVGGLDP+V+DEDLRQPFSQYGEIVSVKIPVGKGCGF
Sbjct  262   GYASNGASALGGQSDGDSTNTTIFVGGLDPSVTDEDLRQPFSQYGEIVSVKIPVGKGCGF  321

Query  525   VQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGY  346
             VQFANRT+AEEALQKL G VIGKQTVRLSWGRNPA++  R+D  NQW GAYYGG  YDGY
Sbjct  322   VQFANRTNAEEALQKLNGTVIGKQTVRLSWGRNPANKL-RADPVNQWNGAYYGGQVYDGY  380

Query  345   TYAFPAPHNPNmyapaaygayp-myGTHQQQVS  250
              YA P P +P+MYA A       +YG HQQQVS
Sbjct  381   GYAVPPPQDPSMYAAATAYGAYPIYGNHQQQVS  413


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 71/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+GYGFV F       + L   NG     +  P R+  A       
Sbjct  96   VVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKVLHNYNGTAMPNTEHPFRLNWA-------  148

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +     S+ +IFVG L  +V+D  L + F S+Y  +   K
Sbjct  149  --------------SFSMGERRSDAGSDHSIFVGDLAADVTDTLLHETFASRYPSVKGAK  194

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  195  VVIDANTGRSKGYGFVRFGDENEKSRAMTEMNGVYCSSRPMRI  237



>ref|XP_011083821.1| PREDICTED: polyadenylate-binding protein RBP47-like [Sesamum 
indicum]
Length=432

 Score =   345 bits (886),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 204/263 (78%), Positives = 225/263 (86%), Gaps = 2/263 (1%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+TFSMG+KRSN  SDLSIFVGDLAADVTD LL  TF SKYPSVKAAKVVIDANTGRSK
Sbjct  171   NWATFSMGDKRSNTGSDLSIFVGDLAADVTDILLHQTFASKYPSVKAAKVVIDANTGRSK  230

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gySNGSPA  679
             GYGFVRF DDNERSQA+ EMNGVYCSSRPMRIGAATPRK SGYQQQ+++ G  YSN   +
Sbjct  231   GYGFVRFEDDNERSQAMAEMNGVYCSSRPMRIGAATPRKLSGYQQQYSSPGGRYSNNVSS  290

Query  678   HGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDA  499
              GS  DGDS NTTIFVGGLDPNV+DEDLRQPFSQYGEI+SVKIPVGKGCGFVQFANR +A
Sbjct  291   QGSWLDGDSLNTTIFVGGLDPNVTDEDLRQPFSQYGEILSVKIPVGKGCGFVQFANRNNA  350

Query  498   EEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHN  319
             E ALQ+L G  IGKQ VRLSWGR+ A++Q R+D+ +QW+GAYYGG F+DGY YA P  H+
Sbjct  351   EAALQRLSGTTIGKQIVRLSWGRSLANKQLRADYGHQWSGAYYGGTFFDGYGYALPPLHS  410

Query  318   PNmyapaaygaypmyGTHQQQVS  250
             PN   PAAYGAY +Y THQQQVS
Sbjct  411   PN-MYPAAYGAYSIYSTHQQQVS  432



>gb|KHN04518.1| Polyadenylate-binding protein RBP47C, partial [Glycine soja]
Length=376

 Score =   343 bits (880),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 200/269 (74%), Positives = 229/269 (85%), Gaps = 12/269 (4%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+N  DLSIFVGDLAADVTD++L +TF ++YPSVKAAKVV DAN
Sbjct  118   QPFRLNWATFSTGDKRSDNVPDLSIFVGDLAADVTDSMLHETFTNRYPSVKAAKVVFDAN  177

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNERSQA+TEMNGVYCSSRPMRIGAATPRK+SGYQ           
Sbjct  178   TGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPRKTSGYQ----------Q  227

Query  690   GSPAHG--SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             GS ++G  SQS+ DS+NTTIFVGGLDPNV+ EDL+QPFSQYGEIVSVKIPVGKGCGFVQF
Sbjct  228   GSQSNGTSSQSEADSTNTTIFVGGLDPNVTAEDLKQPFSQYGEIVSVKIPVGKGCGFVQF  287

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
             ANR +AEEALQKL G  IGKQ VRLSWGR+PA++Q R+DF N W+GAYYGG  YDGY YA
Sbjct  288   ANRNNAEEALQKLNGTTIGKQMVRLSWGRSPANKQFRADFGNAWSGAYYGGPVYDGYGYA  347

Query  336   FPAPHNPNmyapaaygaypmyGTHQQQVS  250
              P P++P++YA AAYGAYP+YG +QQQVS
Sbjct  348   LPPPYDPSIYAAAAYGAYPIYGGYQQQVS  376



>ref|XP_003523906.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=409

 Score =   344 bits (882),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 200/269 (74%), Positives = 229/269 (85%), Gaps = 12/269 (4%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+N  DLSIFVGDLAADVTD++L +TF ++YPSVKAAKVV DAN
Sbjct  151   QPFRLNWATFSTGDKRSDNVPDLSIFVGDLAADVTDSMLHETFTNRYPSVKAAKVVFDAN  210

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNERSQA+TEMNGVYCSSRPMRIGAATPRK+SGYQ           
Sbjct  211   TGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPRKTSGYQ----------Q  260

Query  690   GSPAHG--SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             GS ++G  SQS+ DS+NTTIFVGGLDPNV+ EDL+QPFSQYGEIVSVKIPVGKGCGFVQF
Sbjct  261   GSQSNGTSSQSEADSTNTTIFVGGLDPNVTAEDLKQPFSQYGEIVSVKIPVGKGCGFVQF  320

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
             ANR +AEEALQKL G  IGKQ VRLSWGR+PA++Q R+DF N W+GAYYGG  YDGY YA
Sbjct  321   ANRNNAEEALQKLNGTTIGKQMVRLSWGRSPANKQFRADFGNAWSGAYYGGPVYDGYGYA  380

Query  336   FPAPHNPNmyapaaygaypmyGTHQQQVS  250
              P P++P++YA AAYGAYP+YG +QQQVS
Sbjct  381   LPPPYDPSIYAAAAYGAYPIYGGYQQQVS  409



>gb|EYU25396.1| hypothetical protein MIMGU_mgv1a006186mg [Erythranthe guttata]
Length=454

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 212/265 (80%), Positives = 233/265 (88%), Gaps = 4/265 (2%)
 Frame = -2

Query  1035  NWSTFSMGEKRSN-NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW+TFSMG+KRSN N SD SIFVGDLAADVTDTLL +TF +KYPSVKAAKVVIDA TGRS
Sbjct  191   NWATFSMGDKRSNMNGSDRSIFVGDLAADVTDTLLHETFSTKYPSVKAAKVVIDAITGRS  250

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPA  679
             KGYGFVRF DD+ERSQA+TEMNGVYCSSRPMRIG ATPRKSSGYQQQ++ QGGYSNG  A
Sbjct  251   KGYGFVRFEDDSERSQAMTEMNGVYCSSRPMRIGPATPRKSSGYQQQYSPQGGYSNGFSA  310

Query  678   HGSQ-SDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTD  502
             HGSQ SDGDS NTTIFVGGLDP+V+DE+LRQPFS+YGEIVSVKIPVGKGCGFVQF NR D
Sbjct  311   HGSQLSDGDSVNTTIFVGGLDPSVTDEELRQPFSEYGEIVSVKIPVGKGCGFVQFVNRND  370

Query  501   AEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG-AYYGGHFYDGYTYAFPAP  325
             AEEALQ+L G  IGKQTVRLSWG +PA++QSR D+ +QW G AYYGG ++DGY YA P P
Sbjct  371   AEEALQQLSGKTIGKQTVRLSWGHSPANKQSRVDYAHQWTGAAYYGGPYFDGYGYALPPP  430

Query  324   HNPNmyapaaygaypmyGTHQQQVS  250
             H+PN    AAYGAYP YGTHQQQVS
Sbjct  431   HDPN-MYAAAYGAYPFYGTHQQQVS  454



>gb|KHN12758.1| Polyadenylate-binding protein RBP47C [Glycine soja]
Length=318

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 195/267 (73%), Positives = 217/267 (81%), Gaps = 9/267 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+K S+N  DLSIFVGDLAADVTD+LL +TF S YPSVKAAKVV DAN
Sbjct  61    QPFRLNWATFSTGDKGSDNVPDLSIFVGDLAADVTDSLLHETFASVYPSVKAAKVVFDAN  120

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNER+QA+T+MNGVYCSSRPMRIGAATPRKSSG+QQ   +     N
Sbjct  121   TGRSKGYGFVRFGDDNERTQAMTQMNGVYCSSRPMRIGAATPRKSSGHQQGGLS-----N  175

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+    +QS+ DS+NTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN
Sbjct  176   GT---ANQSEADSTNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  232

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQKL G  IGKQTVRLSWGRNPA++Q R DF + W GAYYG   YDGY YA P
Sbjct  233   RNNAEEALQKLNGTTIGKQTVRLSWGRNPANKQFRMDFGSPWTGAYYGAPMYDGYGYALP  292

Query  330   APHNPNmyapaaygaypmyGTHQQQVS  250
               H+P++YA A        G HQQQVS
Sbjct  293   PRHDPSIYAAAYGAYPLYGG-HQQQVS  318



>ref|XP_010275610.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Nelumbo nucifera]
Length=413

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 200/268 (75%), Positives = 220/268 (82%), Gaps = 4/268 (1%)
 Frame = -2

Query  1047  PAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANT  868
             P   NW++FS GE+RS+  SD SIFVGDLAADVTDTLL +TF S+YPSVK AKVVIDANT
Sbjct  148   PFRLNWASFSTGERRSDAGSDRSIFVGDLAADVTDTLLQETFASRYPSVKGAKVVIDANT  207

Query  867   GRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS--  694
             GRSKGYGFVRFGDDNERS+A+TEMNGVYCS+RPMRIG ATPRKSSGYQQQ  +  G    
Sbjct  208   GRSKGYGFVRFGDDNERSRAMTEMNGVYCSTRPMRIGVATPRKSSGYQQQQYSSQGGYAP  267

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             N +   G QSDGDS+NTTIFVGGLDP+V+DEDLRQPFSQYGEI+SVKIPVGKGCGFVQFA
Sbjct  268   NNASGLGGQSDGDSTNTTIFVGGLDPSVTDEDLRQPFSQYGEIISVKIPVGKGCGFVQFA  327

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NRT+AEEALQKL G VIGKQTVRLSWGRNPA++  R D  NQW GAYYGG  YDGY Y  
Sbjct  328   NRTNAEEALQKLNGTVIGKQTVRLSWGRNPANKM-RIDPVNQWNGAYYGGQVYDGYGYVI  386

Query  333   PAPHNPNmyapaaygaypmyGTHQQQVS  250
             P PH+P+MYA A        G HQQQVS
Sbjct  387   PPPHDPSMYAAAYGAYPIYGG-HQQQVS  413


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 72/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+GYGFV F       + L   NG     +  P R+  A       
Sbjct  102  VVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKVLQNYNGTAMPNTDHPFRLNWA-------  154

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +     S+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  155  --------------SFSTGERRSDAGSDRSIFVGDLAADVTDTLLQETFASRYPSVKGAK  200

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  201  VVIDANTGRSKGYGFVRFGDDNERSRAMTEMNGVYCSTRPMRI  243



>ref|XP_010275609.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Nelumbo nucifera]
Length=418

 Score =   340 bits (871),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 199/273 (73%), Positives = 219/273 (80%), Gaps = 9/273 (3%)
 Frame = -2

Query  1047  PAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANT  868
             P   NW++FS GE+RS+  SD SIFVGDLAADVTDTLL +TF S+YPSVK AKVVIDANT
Sbjct  148   PFRLNWASFSTGERRSDAGSDRSIFVGDLAADVTDTLLQETFASRYPSVKGAKVVIDANT  207

Query  867   GRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS--  694
             GRSKGYGFVRFGDDNERS+A+TEMNGVYCS+RPMRIG ATPRKSSGYQQQ  +       
Sbjct  208   GRSKGYGFVRFGDDNERSRAMTEMNGVYCSTRPMRIGVATPRKSSGYQQQQYSSQALVLV  267

Query  693   -----NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
                  N +   G QSDGDS+NTTIFVGGLDP+V+DEDLRQPFSQYGEI+SVKIPVGKGCG
Sbjct  268   GGYAPNNASGLGGQSDGDSTNTTIFVGGLDPSVTDEDLRQPFSQYGEIISVKIPVGKGCG  327

Query  528   FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  349
             FVQFANRT+AEEALQKL G VIGKQTVRLSWGRNPA++  R D  NQW GAYYGG  YDG
Sbjct  328   FVQFANRTNAEEALQKLNGTVIGKQTVRLSWGRNPANKM-RIDPVNQWNGAYYGGQVYDG  386

Query  348   YTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  250
             Y Y  P PH+P+MYA A        G HQQQVS
Sbjct  387   YGYVIPPPHDPSMYAAAYGAYPIYGG-HQQQVS  418


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 72/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+GYGFV F       + L   NG     +  P R+  A       
Sbjct  102  VVSIKVIRNKQTGQSEGYGFVEFFSHAAAEKVLQNYNGTAMPNTDHPFRLNWA-------  154

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +     S+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  155  --------------SFSTGERRSDAGSDRSIFVGDLAADVTDTLLQETFASRYPSVKGAK  200

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  201  VVIDANTGRSKGYGFVRFGDDNERSRAMTEMNGVYCSTRPMRI  243



>ref|XP_010668311.1| PREDICTED: polyadenylate-binding protein RBP47-like [Beta vulgaris 
subsp. vulgaris]
Length=476

 Score =   342 bits (876),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 184/246 (75%), Positives = 210/246 (85%), Gaps = 4/246 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFSMG+KR++N SDLSIFVGDLAADVTDT+L + F +K+PSVKAAKVVIDAN
Sbjct  213   QPFRLNWATFSMGDKRTDNGSDLSIFVGDLAADVTDTMLHELFATKFPSVKAAKVVIDAN  272

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+ER+QA++EMNGVYCS+RPMRIG ATPRKS GYQQ         N
Sbjct  273   TGRSKGYGFVRFGDDSERTQAMSEMNGVYCSTRPMRIGPATPRKSLGYQQGGYGS----N  328

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+ A GSQS+ +SSNTTIFVGGLDP+V+DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN
Sbjct  329   GNAAQGSQSEDNSSNTTIFVGGLDPSVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  388

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R++AEEAL KL G VIGKQTVRLSWGRNPA++QSR D+ NQW G YYGG  YDG     P
Sbjct  389   RSNAEEALNKLNGTVIGKQTVRLSWGRNPANKQSRGDYGNQWNGGYYGGPMYDGGYGYVP  448

Query  330   APHNPN  313
              PH+P+
Sbjct  449   HPHDPS  454



>ref|XP_009764865.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Nicotiana 
sylvestris]
Length=423

 Score =   340 bits (871),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 209/267 (78%), Positives = 232/267 (87%), Gaps = 0/267 (0%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FS G+KRSNN S LSIFVGDLAADVTDTLL +TF  KYPSVKAAKVV+D N
Sbjct  157   QPFRLNWASFSTGDKRSNNGSGLSIFVGDLAADVTDTLLHETFAKKYPSVKAAKVVVDVN  216

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRS+GYGFVRF DDNERSQA+TEMNGVYCSSRPMRIGAATPRKSSGY Q +++ GGYSN
Sbjct  217   TGRSRGYGFVRFADDNERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYLQHYSSLGGYSN  276

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
              +   GSQ D DS+NTTIFVGGLDP+VSDEDLRQ F+QYGEI SVKIPVGKGCGFVQFA 
Sbjct  277   SASPQGSQPDVDSTNTTIFVGGLDPHVSDEDLRQLFAQYGEIASVKIPVGKGCGFVQFAK  336

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R DAE+ALQKL G  IGKQTVRLSWGRNPA++QSR+DF  QW G YYGGHFY+ Y YAFP
Sbjct  337   RNDAEKALQKLNGTAIGKQTVRLSWGRNPANKQSRADFMKQWTGPYYGGHFYNAYGYAFP  396

Query  330   APHNPNmyapaaygaypmyGTHQQQVS  250
              PH+P+MYA AAYGAYP+YGTHQQQVS
Sbjct  397   PPHDPSMYAAAAYGAYPIYGTHQQQVS  423



>gb|KCW68770.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=399

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 202/269 (75%), Positives = 229/269 (85%), Gaps = 2/269 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS NA DLSIFVGDLAADVTD LL +TF +KYPSVKAAKVV D N
Sbjct  131   QPFRLNWATFSTGDKRSENAPDLSIFVGDLAADVTDNLLHETFANKYPSVKAAKVVFDVN  190

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS-  694
             TGRSKGYGFVRFGD+NERSQA++EMNGVYCSSRPMRIGAATPRKSSGYQ Q+++QGGYS 
Sbjct  191   TGRSKGYGFVRFGDENERSQAMSEMNGVYCSSRPMRIGAATPRKSSGYQSQYSSQGGYSS  250

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+ +   QSDGDS+NTTIFVGGLDP+V+DEDLRQ FSQYGEIVSVKIP GKGCGFVQFA
Sbjct  251   NGASSQSFQSDGDSANTTIFVGGLDPSVNDEDLRQQFSQYGEIVSVKIPSGKGCGFVQFA  310

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR++AEEALQKL G VIGKQTVRLSWGRNPA++Q R+DF NQW   YYGG  YDGY Y  
Sbjct  311   NRSNAEEALQKLNGTVIGKQTVRLSWGRNPANKQFRADFGNQWGPVYYGGQVYDGYGYGV  370

Query  333   PAPHNPNmyapaaygayp-myGTHQQQVS  250
             P  ++P+MYA A   A   +YG+HQQQV+
Sbjct  371   PPHYDPSMYATATAYAAYPVYGSHQQQVN  399


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 89/194 (46%), Gaps = 31/194 (16%)
 Frame = -2

Query  996  NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYGFVRFGDDNER  817
            N  + +++VGDL   + +  L   FVS    + + KV+ +  TG S+GYGFV F      
Sbjct  56   NGENRTVWVGDLHHWMDENYLHSCFVST-GEIASIKVIRNKQTGLSEGYGFVEFFTHGTA  114

Query  816  SQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHGSQSDGDSSNT  643
             + L   +G+    + +P R+  AT                      + G +   ++ + 
Sbjct  115  EKVLQNYSGIMMPNTEQPFRLNWAT---------------------FSTGDKRSENAPDL  153

Query  642  TIFVGGLDPNVSDEDLRQPFS-QYGEIVSVKIPV------GKGCGFVQFANRTDAEEALQ  484
            +IFVG L  +V+D  L + F+ +Y  + + K+         KG GFV+F +  +  +A+ 
Sbjct  154  SIFVGDLAADVTDNLLHETFANKYPSVKAAKVVFDVNTGRSKGYGFVRFGDENERSQAMS  213

Query  483  KLKGLVIGKQTVRL  442
            ++ G+    + +R+
Sbjct  214  EMNGVYCSSRPMRI  227



>ref|XP_007160823.1| hypothetical protein PHAVU_001G019600g [Phaseolus vulgaris]
 gb|ESW32817.1| hypothetical protein PHAVU_001G019600g [Phaseolus vulgaris]
Length=415

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 200/262 (76%), Positives = 220/262 (84%), Gaps = 9/262 (3%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW++FS G+K S+N  DLSIFVGDLAADVTD+LL +TF S +PSVKAAKVV DANTGRSK
Sbjct  163   NWASFSTGDKGSDNVPDLSIFVGDLAADVTDSLLHETFASVFPSVKAAKVVFDANTGRSK  222

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDNERSQA+T+MNGVYCSSRPMRIGAATPRKSSG+QQ   +     NG+   
Sbjct  223   GYGFVRFGDDNERSQAMTQMNGVYCSSRPMRIGAATPRKSSGHQQGGQS-----NGT---  274

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
              SQS+ DS+NTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR +AE
Sbjct  275   SSQSEADSTNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAE  334

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EALQKL G  IGKQTVRLSWGRNPA++Q R DF N W GAYYG   YDGY YA P  H+P
Sbjct  335   EALQKLNGTTIGKQTVRLSWGRNPANKQFRMDFGNPWTGAYYGAPIYDGYGYALPPRHDP  394

Query  315   NmyapaaygaypmyGTHQQQVS  250
             +    AAYGAYP+YG HQQQVS
Sbjct  395   S-IYAAAYGAYPLYGAHQQQVS  415



>gb|KHN46301.1| Polyadenylate-binding protein RBP47C [Glycine soja]
Length=318

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 194/267 (73%), Positives = 216/267 (81%), Gaps = 9/267 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+K S+N  DLSIFVGDLAADVTD+LL +TF S YPSVKAAKVV DAN
Sbjct  61    QPFRLNWATFSTGDKGSDNVPDLSIFVGDLAADVTDSLLHETFASVYPSVKAAKVVFDAN  120

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDN+R+QA+T+MNGVYCSSRPMRIGAATPRKSSG+QQ   +     N
Sbjct  121   TGRSKGYGFVRFGDDNQRTQAMTQMNGVYCSSRPMRIGAATPRKSSGHQQGGQS-----N  175

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+    +QS+ DS+NTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN
Sbjct  176   GT---ANQSEADSTNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  232

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQKL G  IGKQTVRLSWGRNPA++Q R DF N W GAYYG   YDGY YA  
Sbjct  233   RNNAEEALQKLNGTSIGKQTVRLSWGRNPANKQFRMDFGNPWTGAYYGAPMYDGYGYALT  292

Query  330   APHNPNmyapaaygaypmyGTHQQQVS  250
               H+P++YA A        G HQQQVS
Sbjct  293   PRHDPSIYAAAYGAYPLYGG-HQQQVS  318



>ref|XP_007136663.1| hypothetical protein PHAVU_009G063200g [Phaseolus vulgaris]
 gb|ESW08657.1| hypothetical protein PHAVU_009G063200g [Phaseolus vulgaris]
Length=420

 Score =   338 bits (867),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 192/269 (71%), Positives = 219/269 (81%), Gaps = 13/269 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FS G+KRS+N  DLSIFVGDLAADVTD++L +TF ++YPSVKAAKVV DAN
Sbjct  163   QPFRLNWASFSTGDKRSDNVPDLSIFVGDLAADVTDSMLHETFSNRYPSVKAAKVVFDAN  222

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNERSQA+T+MNGVYCSSRPMRIGAATPRK+SGYQ           
Sbjct  223   TGRSKGYGFVRFGDDNERSQAMTDMNGVYCSSRPMRIGAATPRKTSGYQ----------Q  272

Query  690   GSPAHGS--QSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             GS ++G+  QS+ DS+NTTIFVGGLDPNV+ EDLRQPFSQYGEIVSVKIPVGKGCGFVQF
Sbjct  273   GSQSNGTSNQSEADSTNTTIFVGGLDPNVTAEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  332

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
             A R +AEEALQKL G  IGKQ VRLSWGRNPA++Q R DF + W+GAYYGG  YDGY YA
Sbjct  333   AIRNNAEEALQKLNGTTIGKQMVRLSWGRNPANKQFRGDFGSPWSGAYYGGPVYDGYGYA  392

Query  336   FPAPHNPNmyapaaygaypmyGTHQQQVS  250
              P PH+P++YA A        G HQQQVS
Sbjct  393   LPPPHDPSIYAAAYGAYPIYGG-HQQQVS  420



>ref|XP_003549410.2| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=413

 Score =   337 bits (865),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 195/267 (73%), Positives = 217/267 (81%), Gaps = 9/267 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+K S+N  DLSIFVGDLAADVTD+LL +TF S YPSVKAAKVV DAN
Sbjct  156   QPFRLNWATFSTGDKGSDNVPDLSIFVGDLAADVTDSLLHETFASVYPSVKAAKVVFDAN  215

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNER+QA+T+MNGVYCSSRPMRIGAATPRKSSG+QQ   +     N
Sbjct  216   TGRSKGYGFVRFGDDNERTQAMTQMNGVYCSSRPMRIGAATPRKSSGHQQGGLS-----N  270

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+    +QS+ DS+NTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN
Sbjct  271   GT---ANQSEADSTNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  327

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQKL G  IGKQTVRLSWGRNPA++Q R DF + W GAYYG   YDGY YA P
Sbjct  328   RNNAEEALQKLNGTTIGKQTVRLSWGRNPANKQFRMDFGSPWTGAYYGAPMYDGYGYALP  387

Query  330   APHNPNmyapaaygaypmyGTHQQQVS  250
               H+P++YA A        G HQQQVS
Sbjct  388   PRHDPSIYAAAYGAYPLYGG-HQQQVS  413



>ref|XP_010061775.1| PREDICTED: polyadenylate-binding protein RBP47-like [Eucalyptus 
grandis]
 gb|KCW68768.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=452

 Score =   338 bits (867),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 202/269 (75%), Positives = 229/269 (85%), Gaps = 2/269 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS NA DLSIFVGDLAADVTD LL +TF +KYPSVKAAKVV D N
Sbjct  184   QPFRLNWATFSTGDKRSENAPDLSIFVGDLAADVTDNLLHETFANKYPSVKAAKVVFDVN  243

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS-  694
             TGRSKGYGFVRFGD+NERSQA++EMNGVYCSSRPMRIGAATPRKSSGYQ Q+++QGGYS 
Sbjct  244   TGRSKGYGFVRFGDENERSQAMSEMNGVYCSSRPMRIGAATPRKSSGYQSQYSSQGGYSS  303

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+ +   QSDGDS+NTTIFVGGLDP+V+DEDLRQ FSQYGEIVSVKIP GKGCGFVQFA
Sbjct  304   NGASSQSFQSDGDSANTTIFVGGLDPSVNDEDLRQQFSQYGEIVSVKIPSGKGCGFVQFA  363

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR++AEEALQKL G VIGKQTVRLSWGRNPA++Q R+DF NQW   YYGG  YDGY Y  
Sbjct  364   NRSNAEEALQKLNGTVIGKQTVRLSWGRNPANKQFRADFGNQWGPVYYGGQVYDGYGYGV  423

Query  333   PAPHNPNmyapaaygayp-myGTHQQQVS  250
             P  ++P+MYA A   A   +YG+HQQQV+
Sbjct  424   PPHYDPSMYATATAYAAYPVYGSHQQQVN  452


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 89/194 (46%), Gaps = 31/194 (16%)
 Frame = -2

Query  996  NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYGFVRFGDDNER  817
            N  + +++VGDL   + +  L   FVS    + + KV+ +  TG S+GYGFV F      
Sbjct  109  NGENRTVWVGDLHHWMDENYLHSCFVST-GEIASIKVIRNKQTGLSEGYGFVEFFTHGTA  167

Query  816  SQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHGSQSDGDSSNT  643
             + L   +G+    + +P R+  AT                      + G +   ++ + 
Sbjct  168  EKVLQNYSGIMMPNTEQPFRLNWAT---------------------FSTGDKRSENAPDL  206

Query  642  TIFVGGLDPNVSDEDLRQPFS-QYGEIVSVKIPV------GKGCGFVQFANRTDAEEALQ  484
            +IFVG L  +V+D  L + F+ +Y  + + K+         KG GFV+F +  +  +A+ 
Sbjct  207  SIFVGDLAADVTDNLLHETFANKYPSVKAAKVVFDVNTGRSKGYGFVRFGDENERSQAMS  266

Query  483  KLKGLVIGKQTVRL  442
            ++ G+    + +R+
Sbjct  267  EMNGVYCSSRPMRI  280



>gb|KHN22302.1| Polyadenylate-binding protein RBP47C [Glycine soja]
Length=411

 Score =   336 bits (861),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 192/269 (71%), Positives = 218/269 (81%), Gaps = 13/269 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TF  G+KRS+N  DLSIFVGDLAADVTD++L +TF ++YPSVKAAKVV DAN
Sbjct  154   QPFRLNWATFGTGDKRSDNVPDLSIFVGDLAADVTDSMLHETFSNRYPSVKAAKVVFDAN  213

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+ERSQA+TEMNGVYCSSRPMRIGAATPRK+SGYQ           
Sbjct  214   TGRSKGYGFVRFGDDDERSQAMTEMNGVYCSSRPMRIGAATPRKTSGYQ----------Q  263

Query  690   GSPAHG--SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             GS ++G  SQS+ DS+NTTIFVGGLD NV+ EDL+QPFSQYGEIVSVKIPVGKGCGFVQF
Sbjct  264   GSQSNGISSQSEADSTNTTIFVGGLDSNVTAEDLKQPFSQYGEIVSVKIPVGKGCGFVQF  323

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
             ANR +AEEALQKL G  IGKQ VRLSWGRNPA++Q R+DF N W+GAYYGG  YDGY YA
Sbjct  324   ANRNNAEEALQKLNGTTIGKQMVRLSWGRNPANKQFRADFGNAWSGAYYGGPVYDGYGYA  383

Query  336   FPAPHNPNmyapaaygaypmyGTHQQQVS  250
              P  H+P++YA A        G HQQQVS
Sbjct  384   LPPSHDPSIYAAAYGAYPIYGG-HQQQVS  411


 Score = 51.2 bits (121),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 39/163 (24%), Positives = 71/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            + + KV+ +  TG S+GYGFV F       + L    G+    + +P R+  AT      
Sbjct  109  ISSIKVIRNKQTGLSEGYGFVEFYSHGTAEKVLQNYAGILMPNTEQPFRLNWAT------  162

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFS-QYGEIVSVK  553
                              G +   +  + +IFVG L  +V+D  L + FS +Y  + + K
Sbjct  163  ---------------FGTGDKRSDNVPDLSIFVGDLAADVTDSMLHETFSNRYPSVKAAK  207

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            +         KG GFV+F +  +  +A+ ++ G+    + +R+
Sbjct  208  VVFDANTGRSKGYGFVRFGDDDERSQAMTEMNGVYCSSRPMRI  250



>ref|XP_004501589.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cicer arietinum]
Length=413

 Score =   334 bits (857),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 195/268 (73%), Positives = 217/268 (81%), Gaps = 10/268 (4%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+N  DLSIFVGDLA DVTD++L +TF +KYPSVKAAKVV DAN
Sbjct  155   QPFRLNWATFSTGDKRSDNVPDLSIFVGDLATDVTDSMLHETFSNKYPSVKAAKVVFDAN  214

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNERSQA+ EMNGVYCSSRPMRIGAATPRKSSGYQQ   +     N
Sbjct  215   TGRSKGYGFVRFGDDNERSQAMNEMNGVYCSSRPMRIGAATPRKSSGYQQGGQS-----N  269

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+    SQS+ DS+NTTIFVGGLDPN + EDLR+PFS+YGEIVSVKIPVGKGCGFVQFAN
Sbjct  270   GT---SSQSEADSTNTTIFVGGLDPNATAEDLREPFSEYGEIVSVKIPVGKGCGFVQFAN  326

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY-AF  334
             R +AEEALQKL G  IGKQTVRLSWGRNPA++Q R DF + W GAYYGG  YDGY Y A 
Sbjct  327   RNNAEEALQKLNGATIGKQTVRLSWGRNPANKQFRMDFGSPWNGAYYGGPVYDGYGYAAL  386

Query  333   PAPHNPNmyapaaygaypmyGTHQQQVS  250
             P PH+P+MYA A        G HQQQVS
Sbjct  387   PHPHDPSMYAAAYGAYPIYGG-HQQQVS  413


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 89/195 (46%), Gaps = 31/195 (16%)
 Frame = -2

Query  999  NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYGFVRFGDDNE  820
            ++A + +I+VGDL   + +  L   F S    + + KV+ + +TG+S+GYGFV F     
Sbjct  79   SSADNKTIWVGDLHHWMDENYLHCCFAST-AEIFSIKVIRNKHTGQSEGYGFVEFHSHGT  137

Query  819  RSQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHGSQSDGDSSN  646
              + L    GV    + +P R+  AT                        G +   +  +
Sbjct  138  AEKVLQNFAGVLMPNTDQPFRLNWATFST---------------------GDKRSDNVPD  176

Query  645  TTIFVGGLDPNVSDEDLRQPFS-QYGEIVSVKIPV------GKGCGFVQFANRTDAEEAL  487
             +IFVG L  +V+D  L + FS +Y  + + K+         KG GFV+F +  +  +A+
Sbjct  177  LSIFVGDLATDVTDSMLHETFSNKYPSVKAAKVVFDANTGRSKGYGFVRFGDDNERSQAM  236

Query  486  QKLKGLVIGKQTVRL  442
             ++ G+    + +R+
Sbjct  237  NEMNGVYCSSRPMRI  251



>ref|XP_003544447.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=425

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 194/267 (73%), Positives = 216/267 (81%), Gaps = 9/267 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+K S+N  DLSIFVGDLAADVTD+LL +TF S YPSVKAAKVV DAN
Sbjct  168   QPFRLNWATFSTGDKGSDNVPDLSIFVGDLAADVTDSLLHETFASVYPSVKAAKVVFDAN  227

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDN+R+QA+T+MNGVYCSSRPMRIGAATPRKSSG+QQ   +     N
Sbjct  228   TGRSKGYGFVRFGDDNQRTQAMTQMNGVYCSSRPMRIGAATPRKSSGHQQGGQS-----N  282

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+    +QS+ DS+NTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN
Sbjct  283   GT---ANQSEADSTNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  339

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQKL G  IGKQTVRLSWGRNPA++Q R DF N W GAYYG   YDGY YA  
Sbjct  340   RNNAEEALQKLNGTSIGKQTVRLSWGRNPANKQFRMDFGNPWTGAYYGAPMYDGYGYALT  399

Query  330   APHNPNmyapaaygaypmyGTHQQQVS  250
               H+P++YA A        G HQQQVS
Sbjct  400   PRHDPSIYAAAYGAYPLYGG-HQQQVS  425



>gb|AGV54251.1| RNA binding post-transcriptional regulator csx1 like protein 
[Phaseolus vulgaris]
Length=416

 Score =   329 bits (843),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 199/262 (76%), Positives = 215/262 (82%), Gaps = 9/262 (3%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             N   FS G+K SNN  DL IFVGDLAADVTD+LL +TF S YP VKAAKVV DANTGRSK
Sbjct  164   NGVPFSKGKKGSNNVPDLFIFVGDLAADVTDSLLHETFASVYPLVKAAKVVFDANTGRSK  223

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDNERSQA+T+MNGVYCSSRPMRIGAATPRKSSG+QQ   +     NG+   
Sbjct  224   GYGFVRFGDDNERSQAMTQMNGVYCSSRPMRIGAATPRKSSGHQQGGQS-----NGT---  275

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
              SQS+ DS+NTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR +AE
Sbjct  276   SSQSEADSTNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAE  335

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EALQKL G  IGKQTVRLSWGRNPA++Q R DF N W GAYYG   YDGY YA P  H+P
Sbjct  336   EALQKLNGTTIGKQTVRLSWGRNPANKQFRMDFGNPWTGAYYGAPIYDGYGYALPPRHDP  395

Query  315   NmyapaaygaypmyGTHQQQVS  250
             +    AAYGAYP+YG HQQQVS
Sbjct  396   S-IYAAAYGAYPLYGAHQQQVS  416



>ref|XP_004499084.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cicer arietinum]
Length=426

 Score =   322 bits (825),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 190/262 (73%), Positives = 215/262 (82%), Gaps = 9/262 (3%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+TFS G+K S+N +DLSIFVGDLA DVTD+LL +TF + YPSVKAAKVV DANTGRSK
Sbjct  174   NWATFSTGDKGSDNVTDLSIFVGDLAPDVTDSLLHETFATTYPSVKAAKVVYDANTGRSK  233

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGD+NERSQA+T+MNGVYCSSRPMRIGAATPRKS+G+QQ   +     NG+   
Sbjct  234   GYGFVRFGDENERSQAMTQMNGVYCSSRPMRIGAATPRKSTGHQQGGQS-----NGT---  285

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
              SQS+ D++NTTIFVGGLDPNV+DEDLRQ FSQYGEI SVKIPVGKGCGFVQFANR +AE
Sbjct  286   SSQSEADNTNTTIFVGGLDPNVTDEDLRQAFSQYGEIASVKIPVGKGCGFVQFANRNNAE  345

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EALQKL G +IGKQTVRLSWGRNPA++Q R DF   WAG Y+    YDGY YA P+PH+ 
Sbjct  346   EALQKLNGTMIGKQTVRLSWGRNPANKQFRFDF-GSWAGPYFPSPIYDGYGYAMPSPHHD  404

Query  315   NmyapaaygaypmyGTHQQQVS  250
                 P AYG YP YG HQQQVS
Sbjct  405   PNMYPLAYGGYPFYGGHQQQVS  426



>ref|XP_008444645.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
melo]
Length=429

 Score =   322 bits (824),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 201/261 (77%), Positives = 228/261 (87%), Gaps = 0/261 (0%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+TFS G+KRS N SDLSIFVGDLAADVTD++L +TF SKY SVKAAKVV D NTG SK
Sbjct  168   NWATFSTGDKRSENGSDLSIFVGDLAADVTDSVLHETFASKYSSVKAAKVVYDPNTGCSK  227

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDNERSQA+TEMNG+YCSSRPMRIGAATP+KSSGYQQQ+++QG  SNGS +H
Sbjct  228   GYGFVRFGDDNERSQAMTEMNGIYCSSRPMRIGAATPKKSSGYQQQYSSQGYASNGSFSH  287

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
             G QSDGD +NTTIF+GGLDPNV+DEDL+Q FSQ+GEIVSVKIPVGKGCGF+QFANR +AE
Sbjct  288   GHQSDGDFTNTTIFIGGLDPNVTDEDLKQLFSQHGEIVSVKIPVGKGCGFIQFANRKNAE  347

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EALQKL G VIGKQTVRLSWGR+P ++Q R+D+ N W+GAYYGG  Y GY YA P P++P
Sbjct  348   EALQKLNGTVIGKQTVRLSWGRSPTNKQYRADYGNHWSGAYYGGQMYGGYGYALPLPYDP  407

Query  315   NmyapaaygaypmyGTHQQQV  253
                  AAYGAYPMYGTHQQQV
Sbjct  408   PTMYAAAYGAYPMYGTHQQQV  428


 Score = 40.8 bits (94),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 16/18 (89%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -3

Query  1082  ALTEMNGVYCSSRPMRIG  1029
             A+TEMNG+YCSSRPMRIG
Sbjct  243   AMTEMNGIYCSSRPMRIG  260


 Score = 33.9 bits (76),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 50/94 (53%), Gaps = 7/94 (7%)
 Frame = -2

Query  1041  YANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGR  862
             YA+  +FS G +   + ++ +IF+G L  +VTD  L   F S++  + + K+ +      
Sbjct  279   YASNGSFSHGHQSDGDFTNTTIFIGGLDPNVTDEDLKQLF-SQHGEIVSVKIPV------  331

Query  861   SKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRI  760
              KG GF++F +     +AL ++NG     + +R+
Sbjct  332   GKGCGFIQFANRKNAEEALQKLNGTVIGKQTVRL  365



>ref|XP_004152729.1| PREDICTED: polyadenylate-binding protein RBP47 [Cucumis sativus]
 gb|KGN62542.1| hypothetical protein Csa_2G360590 [Cucumis sativus]
Length=429

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 201/261 (77%), Positives = 227/261 (87%), Gaps = 0/261 (0%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+TFS G+KRS N SDLSIFVGDLAADVTD++L +TF SKY SVKAAKVV D NTG SK
Sbjct  168   NWATFSTGDKRSENGSDLSIFVGDLAADVTDSVLHETFASKYSSVKAAKVVYDPNTGCSK  227

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDNERSQA+TEMNG+YCSSRPMRIGAATP+KSSGYQQQ+++QG  SNGS +H
Sbjct  228   GYGFVRFGDDNERSQAMTEMNGIYCSSRPMRIGAATPKKSSGYQQQYSSQGYASNGSFSH  287

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
             G QSDGD +NTTIF+GGLDPNV+DEDL+Q FSQ+GEIVSVKIPVGKGCGF+QFANR +AE
Sbjct  288   GHQSDGDFTNTTIFIGGLDPNVTDEDLKQLFSQHGEIVSVKIPVGKGCGFIQFANRKNAE  347

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EALQKL G VIGKQTVRLSWGR+P ++Q R D+ N W+GAYYGG  Y GY YA P P++P
Sbjct  348   EALQKLNGTVIGKQTVRLSWGRSPTNKQYRGDYGNHWSGAYYGGQVYGGYGYALPLPYDP  407

Query  315   NmyapaaygaypmyGTHQQQV  253
                  AAYGAYPMYGTHQQQV
Sbjct  408   PTMYAAAYGAYPMYGTHQQQV  428


 Score = 40.8 bits (94),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 16/18 (89%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -3

Query  1082  ALTEMNGVYCSSRPMRIG  1029
             A+TEMNG+YCSSRPMRIG
Sbjct  243   AMTEMNGIYCSSRPMRIG  260


 Score = 33.9 bits (76),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 50/94 (53%), Gaps = 7/94 (7%)
 Frame = -2

Query  1041  YANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGR  862
             YA+  +FS G +   + ++ +IF+G L  +VTD  L   F S++  + + K+ +      
Sbjct  279   YASNGSFSHGHQSDGDFTNTTIFIGGLDPNVTDEDLKQLF-SQHGEIVSVKIPV------  331

Query  861   SKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRI  760
              KG GF++F +     +AL ++NG     + +R+
Sbjct  332   GKGCGFIQFANRKNAEEALQKLNGTVIGKQTVRL  365



>ref|XP_003528246.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Glycine 
max]
Length=410

 Score =   319 bits (817),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 185/273 (68%), Positives = 212/273 (78%), Gaps = 17/273 (6%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TF  G+KRS+N  DLSIFVGDLAADVTD++L +TF ++YPSVKAAKVV DAN
Sbjct  149   QPFRLNWATFGTGDKRSDNVPDLSIFVGDLAADVTDSMLHETFSNRYPSVKAAKVVFDAN  208

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+ERSQA+TEMNGVYCSSRPMRIGAATPRK            GY  
Sbjct  209   TGRSKGYGFVRFGDDDERSQAMTEMNGVYCSSRPMRIGAATPRK----------TSGYQQ  258

Query  690   GSPAHG--SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             GS ++G  SQS+ DS+NTTIFVGGLD NV+ EDL+QPFSQYGEIVSVKIPVGKGCGF   
Sbjct  259   GSQSNGISSQSEADSTNTTIFVGGLDSNVTAEDLKQPFSQYGEIVSVKIPVGKGCGFTIC  318

Query  516   ANRT----DAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  349
              +R+    +AEEALQKL G  IGKQ VRLSWGRNPA++Q R+DF N W+GAYYGG  YDG
Sbjct  319   NSRSPGPKNAEEALQKLNGTTIGKQMVRLSWGRNPANKQFRADFGNAWSGAYYGGPVYDG  378

Query  348   YTYAFPAPHNPNmyapaaygaypmyGTHQQQVS  250
             Y YA P  H+P++YA A        G HQQQVS
Sbjct  379   YGYALPPSHDPSIYAAAYGAYPIYGG-HQQQVS  410



>ref|XP_003603009.1| RNA-binding protein [Medicago truncatula]
 gb|AES73260.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=420

 Score =   319 bits (817),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 196/269 (73%), Positives = 217/269 (81%), Gaps = 14/269 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGE-KRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW+TFS G+ KRS+N  DLSIFVGDLAADVTDT+LL+TF  KYPSVKAAKVV DA
Sbjct  164   QPFRLNWATFSTGDHKRSDNVPDLSIFVGDLAADVTDTMLLETFSDKYPSVKAAKVVFDA  223

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS  694
             NTGRSKGYGFVRFGDD ERS+AL EMNGV+CSSR MRIGAATPRKSSGYQQ   +     
Sbjct  224   NTGRSKGYGFVRFGDDGERSKALNEMNGVFCSSRAMRIGAATPRKSSGYQQGGQS-----  278

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+P   SQSD DS+NTTIFVGGLDP+ + EDLRQPFSQYGEIVSVKIPVGKGCGFVQFA
Sbjct  279   NGTP---SQSDTDSTNTTIFVGGLDPSATAEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  335

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG-AYYGGHFYDGYTYA  337
             NR +AEEALQKL G  +GKQTVRLSWGRNPA++Q RS+F + W G AYYGG  YDGY YA
Sbjct  336   NRNNAEEALQKLNGTTVGKQTVRLSWGRNPANKQFRSEFGSPWNGPAYYGGPAYDGYGYA  395

Query  336   FPAPHNPNmyapaaygaypmyGTHQQQVS  250
              P P++          AYPMYG HQQQVS
Sbjct  396   MPHPYD----QSMYAAAYPMYGGHQQQVS  420



>gb|EPS64859.1| nucleic acid binding protein, partial [Genlisea aurea]
Length=377

 Score =   317 bits (811),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 181/233 (78%), Positives = 204/233 (88%), Gaps = 3/233 (1%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW++FSMG++R+N  SDLSIFVGDLA+DVTD LL DTF +KYPSVKAAKVVID+ TGRSK
Sbjct  144   NWASFSMGDRRTNGCSDLSIFVGDLASDVTDALLHDTFATKYPSVKAAKVVIDSTTGRSK  203

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg-ySNGSPA  679
             GYGFVRFGDD+E++ ALTEMNGVYCSSRPMRIGAATPRKSSGYQQQ  +  G YSNG   
Sbjct  204   GYGFVRFGDDSEKTLALTEMNGVYCSSRPMRIGAATPRKSSGYQQQQYSSYGGYSNGGSV  263

Query  678   HGSQSDG-DSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTD  502
             +GSQSDG D+ N+TIFVG LDP+V+DEDLRQPFSQYGEIVS+KIP G+GCGFVQFANR D
Sbjct  264   NGSQSDGGDTLNSTIFVGRLDPSVTDEDLRQPFSQYGEIVSIKIPPGRGCGFVQFANRGD  323

Query  501   AEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGA-YYGGHFYDGY  346
             AEEAL+ L GL IG QTVRLSWGRNPA++QSRSD+ NQW GA YYGG FYD Y
Sbjct  324   AEEALKNLTGLTIGNQTVRLSWGRNPANKQSRSDYGNQWTGASYYGGGFYDPY  376



>ref|XP_006393576.1| hypothetical protein EUTSA_v10011476mg [Eutrema salsugineum]
 gb|ESQ30862.1| hypothetical protein EUTSA_v10011476mg [Eutrema salsugineum]
Length=447

 Score =   318 bits (814),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 188/268 (70%), Positives = 211/268 (79%), Gaps = 7/268 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR  NN  DLSIFVGDLA DV+D+LL +TF  KYPSVKAAKVVIDA
Sbjct  186   QPFRLNWASFSTGEKRLENNGPDLSIFVGDLAPDVSDSLLHNTFSEKYPSVKAAKVVIDA  245

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS  694
             NTGRSKGYGFVRFGDDNER++A+ EMNG  CSSR MRIG ATPRK++GYQQQ       +
Sbjct  246   NTGRSKGYGFVRFGDDNERTKAMEEMNGKKCSSRAMRIGPATPRKTTGYQQQGGYMPNGA  305

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
                P      DGDS NTTIFVGGLD +V+DEDLRQPF+ YGEIVSVKIP+GKGCGFVQF 
Sbjct  306   MTRP------DGDSLNTTIFVGGLDSSVTDEDLRQPFTAYGEIVSVKIPLGKGCGFVQFV  359

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR DAEEAL+KL G VIGKQTVRLSWGR+PA++Q R  + NQW G YYGG FY+GY Y  
Sbjct  360   NRPDAEEALEKLNGTVIGKQTVRLSWGRSPANKQPRDKYGNQWVGPYYGGQFYNGYGYMV  419

Query  333   PAPHNPNmyapaaygaypmyGTHQQQVS  250
             P PH+P MYA   YG YPMYG HQQQVS
Sbjct  420   PQPHDPRMYAAGPYGGYPMYGGHQQQVS  447


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 94/198 (47%), Gaps = 30/198 (15%)
 Frame = -2

Query  1008  KRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYGFVRFGD  829
             + ++N  + +I++GDL   + ++ L  +F S    V + KV+ + +TG S+GYGFV F  
Sbjct  107   QNASNGENKTIWIGDLHHWMDESYLNSSFASAGEMV-SVKVIRNKHTGLSEGYGFVEFLS  165

Query  828   DNERSQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHGSQSDGD  655
              +   + L E NG     + +P R+  A+             +    N  P         
Sbjct  166   HDIADKVLQEFNGTTMPNTEQPFRLNWAS---------FSTGEKRLENNGP---------  207

Query  654   SSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVKIPV------GKGCGFVQFANRTDAE  496
               + +IFVG L P+VSD  L   FS+ Y  + + K+ +       KG GFV+F +  +  
Sbjct  208   --DLSIFVGDLAPDVSDSLLHNTFSEKYPSVKAAKVVIDANTGRSKGYGFVRFGDDNERT  265

Query  495   EALQKLKGLVIGKQTVRL  442
             +A++++ G     + +R+
Sbjct  266   KAMEEMNGKKCSSRAMRI  283



>gb|AFK35123.1| unknown [Medicago truncatula]
Length=425

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 187/262 (71%), Positives = 212/262 (81%), Gaps = 9/262 (3%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+TFS G+K S+N +DLSIFVGDLAADVTD++L +TF S YPSVKAAKVV DANTGRSK
Sbjct  173   NWATFSTGDKGSDNVTDLSIFVGDLAADVTDSVLHETFSSSYPSVKAAKVVYDANTGRSK  232

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGD++ERSQA+T+MNGVYCSSRPMRIGAATPRKSSG+Q          NG+   
Sbjct  233   GYGFVRFGDESERSQAMTQMNGVYCSSRPMRIGAATPRKSSGHQPGGQT-----NGT---  284

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
              SQS+ DS+NTTIFVGGLD NV+DEDL+Q FSQYGEI SVKIPVGKGCGFVQFANR +AE
Sbjct  285   SSQSEADSTNTTIFVGGLDSNVTDEDLKQTFSQYGEIASVKIPVGKGCGFVQFANRNNAE  344

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EALQKL G +IGKQTVRLSWGRNPA++Q R D    WAG Y+    YDGY YA P+PH+ 
Sbjct  345   EALQKLNGTMIGKQTVRLSWGRNPAYKQFRLD-VGSWAGPYFPSPIYDGYGYAMPSPHHD  403

Query  315   NmyapaaygaypmyGTHQQQVS  250
                 P AYG YP+YG H QQVS
Sbjct  404   PSMYPLAYGGYPIYGGHSQQVS  425



>gb|KEH40058.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=425

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 187/262 (71%), Positives = 213/262 (81%), Gaps = 9/262 (3%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+TFS G+K S+N +DLSIFVGDLAADVTD++L +TF S YPSVKAAKVV DANTGRSK
Sbjct  173   NWATFSTGDKGSDNVTDLSIFVGDLAADVTDSVLHETFSSSYPSVKAAKVVYDANTGRSK  232

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGD++ERSQA+T+MNGVYCSSRPMRIGAATPRKSSG+Q    +     NG+   
Sbjct  233   GYGFVRFGDESERSQAMTQMNGVYCSSRPMRIGAATPRKSSGHQPGGQS-----NGT---  284

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
              SQS+ DS+NTTIFVGGLD NV+DEDL+Q FSQYGEI SVKIPVGKGCGFVQFANR +AE
Sbjct  285   SSQSEADSTNTTIFVGGLDSNVTDEDLKQTFSQYGEIASVKIPVGKGCGFVQFANRNNAE  344

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EALQKL G +IGKQTVRLSWGRNPA++Q R D    WAG Y+    YDGY YA P+PH+ 
Sbjct  345   EALQKLNGTMIGKQTVRLSWGRNPAYKQFRLD-VGSWAGPYFPSPIYDGYGYAMPSPHHD  403

Query  315   NmyapaaygaypmyGTHQQQVS  250
                 P AYG YP+YG H QQVS
Sbjct  404   PSMYPLAYGGYPIYGGHSQQVS  425



>ref|XP_006480131.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Citrus 
sinensis]
 gb|KDO49117.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=449

 Score =   312 bits (800),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 172/252 (68%), Positives = 203/252 (81%), Gaps = 6/252 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS  ++R+   SDLSIFVGDLA DVTD++L +TF SKYPSVK AKV+ID+N
Sbjct  187   QPFRLNWATFSGSDRRTEACSDLSIFVGDLAPDVTDSILQETFSSKYPSVKGAKVIIDSN  246

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGR+KGYGFVRFGD+NERS+A+TEMNGVYCSSRPMRI  ATP+K+SGYQQQ+++Q     
Sbjct  247   TGRTKGYGFVRFGDENERSRAMTEMNGVYCSSRPMRIDVATPKKASGYQQQYSSQALVLA  306

Query  690   GSP------AHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
             G P        GSQSDG+S+N TIFVG LD +VSDEDLR+PFSQ+GEI+SVKIPVGKGCG
Sbjct  307   GGPGSNGARVQGSQSDGESNNATIFVGALDSDVSDEDLREPFSQFGEILSVKIPVGKGCG  366

Query  528   FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  349
             FVQFANR DAE ALQKL+G  IGKQTVRLSWGRNP ++Q R D +N W GA+YGG  Y G
Sbjct  367   FVQFANRKDAEVALQKLQGTAIGKQTVRLSWGRNPGNKQWRGDHSNHWNGAHYGGQGYSG  426

Query  348   YTYAFPAPHNPN  313
               YAFP   +PN
Sbjct  427   NGYAFPPNQDPN  438


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V   KV+ +  TG+S+GYGFV F       + L   +G     + +P R+  AT      
Sbjct  142  VVNVKVIRNKQTGQSEGYGFVEFYSRAAAEKVLQSYSGSLMPNTDQPFRLNWAT------  195

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                        +GS     +     S+ +IFVG L P+V+D  L++ F S+Y  +   K
Sbjct  196  -----------FSGS----DRRTEACSDLSIFVGDLAPDVTDSILQETFSSKYPSVKGAK  240

Query  552  IPVG------KGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  241  VIIDSNTGRTKGYGFVRFGDENERSRAMTEMNGVYCSSRPMRI  283



>ref|XP_006423054.1| hypothetical protein CICLE_v10028454mg [Citrus clementina]
 gb|ESR36294.1| hypothetical protein CICLE_v10028454mg [Citrus clementina]
Length=445

 Score =   312 bits (800),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 172/252 (68%), Positives = 203/252 (81%), Gaps = 6/252 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS  ++R+   SDLSIFVGDLA DVTD++L +TF SKYPSVK AKV+ID+N
Sbjct  183   QPFRLNWATFSGNDRRTEACSDLSIFVGDLAPDVTDSILQETFSSKYPSVKGAKVIIDSN  242

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGR+KGYGFVRFGD+NERS+A+TEMNGVYCSSRPMRI  ATP+K+SGYQQQ+++Q     
Sbjct  243   TGRTKGYGFVRFGDENERSRAMTEMNGVYCSSRPMRIDVATPKKASGYQQQYSSQALVLA  302

Query  690   GSP------AHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
             G P        GSQSDG+S+N TIFVG LD +VSDEDLR+PFSQ+GEI+SVKIPVGKGCG
Sbjct  303   GGPGSNGARVQGSQSDGESNNATIFVGALDSDVSDEDLREPFSQFGEILSVKIPVGKGCG  362

Query  528   FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  349
             FVQFANR DAE ALQKL+G  IGKQTVRLSWGRNP ++Q R D +N W GA+YGG  Y G
Sbjct  363   FVQFANRKDAEVALQKLQGTAIGKQTVRLSWGRNPGNKQWRGDHSNHWNGAHYGGQGYSG  422

Query  348   YTYAFPAPHNPN  313
               YAFP   +PN
Sbjct  423   NGYAFPPNQDPN  434



>ref|XP_009391347.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   311 bits (796),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 193/242 (80%), Gaps = 11/242 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FS G++RS+ +SD SIFVGDLA+DVTD  L + F SKYPSVK AKVVIDAN
Sbjct  151   QPFRLNWASFSTGDRRSDASSDYSIFVGDLASDVTDVTLQEIFASKYPSVKGAKVVIDAN  210

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFG+++E++ A+TEMNG+YCS+RPMRIG ATPRKSSG            +
Sbjct  211   TGRSKGYGFVRFGNEDEKTLAMTEMNGIYCSTRPMRIGPATPRKSSGV-----------S  259

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             GS    +QSDGD +NTT+FVGGLDPNV+++DL Q FSQYGEI SVKIPVGK CGFVQF  
Sbjct  260   GSNGLSAQSDGDLTNTTVFVGGLDPNVNEDDLNQTFSQYGEIASVKIPVGKQCGFVQFVQ  319

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQ+L G VIG QTVRLSWGRNPA++Q RSD +NQW G YYGG FY+GY YA P
Sbjct  320   RNNAEEALQRLNGTVIGNQTVRLSWGRNPANKQLRSDSSNQWNGMYYGGPFYNGYMYAAP  379

Query  330   AP  325
              P
Sbjct  380   VP  381


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 79/190 (42%), Gaps = 40/190 (21%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+GYGFV F         L    G     + +P R+  A       
Sbjct  106  VISIKVIRNKQTGQSEGYGFVEFYTHEAAKNVLQSFVGHMMPNTDQPFRLNWA-------  158

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +    SS+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  159  --------------SFSTGDRRSDASSDYSIFVGDLASDVTDVTLQEIFASKYPSVKGAK  204

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLS----------WGRNPA  421
            + +       KG GFV+F N  +   A+ ++ G+    + +R+            G N  
Sbjct  205  VVIDANTGRSKGYGFVRFGNEDEKTLAMTEMNGIYCSTRPMRIGPATPRKSSGVSGSNGL  264

Query  420  HRQSRSDFTN  391
              QS  D TN
Sbjct  265  SAQSDGDLTN  274



>ref|XP_007017333.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
 gb|EOY14558.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
Length=380

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 195/217 (90%), Gaps = 4/217 (2%)
 Frame = -2

Query  1056  LFKPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVID  877
             + +P   NW+TFS GEKRS N  DLSIFVGDLAADVTD+LL +TF SKY SVKAAKVVID
Sbjct  167   MEQPFRLNWATFSTGEKRSENGPDLSIFVGDLAADVTDSLLHETFASKYSSVKAAKVVID  226

Query  876   ANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-g  700
             ANTGRSKGYGFVRFGDD ERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++QG  
Sbjct  227   ANTGRSKGYGFVRFGDDTERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSQGGY  286

Query  699   ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  520
              SNG+    +QSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGEIVSVKIPVGKGCGFVQ
Sbjct  287   ASNGA---SNQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  343

Query  519   FANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQS  409
             FANR +AEEALQKL G VIGKQTVRLSWGRNPA++QS
Sbjct  344   FANRNNAEEALQKLNGTVIGKQTVRLSWGRNPANKQS  380


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            + + KV+ +  TG S+GYGFV F       + L    G+      +P R+  AT      
Sbjct  124  IASIKVIRNKQTGLSEGYGFVEFFSHATAEKVLQNYGGILMPNMEQPFRLNWAT------  177

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +   +  + +IFVG L  +V+D  L + F S+Y  + + K
Sbjct  178  ---------------FSTGEKRSENGPDLSIFVGDLAADVTDSLLHETFASKYSSVKAAK  222

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + T+  +A+ ++ G+    + +R+
Sbjct  223  VVIDANTGRSKGYGFVRFGDDTERSQAMTEMNGVYCSSRPMRI  265



>ref|XP_009417617.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Musa acuminata 
subsp. malaccensis]
Length=399

 Score =   310 bits (794),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 190/242 (79%), Gaps = 11/242 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ +SD SIFVGDLA+DVTD  L + F SKYPSVK AKVVIDAN
Sbjct  148   QPFRLNWASFSMGDRRSDASSDYSIFVGDLASDVTDATLQEIFASKYPSVKGAKVVIDAN  207

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFG++NE++ ++TEMNGVYCS+RPMRIG ATPRKSSG             
Sbjct  208   TGRSKGYGFVRFGNENEKTLSMTEMNGVYCSTRPMRIGPATPRKSSGVSGSN--------  259

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
                   +QSDGD +NTT+FVGGLDPNVS++DL++ FS YGEI SVKIPVGK CGFVQF  
Sbjct  260   ---GSSAQSDGDLTNTTVFVGGLDPNVSEDDLKRTFSLYGEIASVKIPVGKQCGFVQFVQ  316

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQ L G VIGKQTVRLSWGRNPA++Q RSD  NQW G YYGG FY+GY YA P
Sbjct  317   RNNAEEALQGLNGTVIGKQTVRLSWGRNPANKQLRSDLGNQWNGMYYGGQFYNGYVYAAP  376

Query  330   AP  325
              P
Sbjct  377   VP  378


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 74/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNG--VYCSSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+GYGFV F       + L    G  +  + +P R+  A       
Sbjct  103  VVSIKVIRNKQTGQSEGYGFVEFYTHAAAEKVLQNFGGHTMPNTDQPFRLNWA-------  155

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +    SS+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  156  --------------SFSMGDRRSDASSDYSIFVGDLASDVTDATLQEIFASKYPSVKGAK  201

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F N  +   ++ ++ G+    + +R+
Sbjct  202  VVIDANTGRSKGYGFVRFGNENEKTLSMTEMNGVYCSTRPMRI  244



>ref|XP_007017330.1| RNA-binding protein 47C isoform 2 [Theobroma cacao]
 gb|EOY14555.1| RNA-binding protein 47C isoform 2 [Theobroma cacao]
Length=394

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 194/216 (90%), Gaps = 4/216 (2%)
 Frame = -2

Query  1056  LFKPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVID  877
             + +P   NW+TFS GEKRS N  DLSIFVGDLAADVTD+LL +TF SKY SVKAAKVVID
Sbjct  167   MEQPFRLNWATFSTGEKRSENGPDLSIFVGDLAADVTDSLLHETFASKYSSVKAAKVVID  226

Query  876   ANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-g  700
             ANTGRSKGYGFVRFGDD ERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++QG  
Sbjct  227   ANTGRSKGYGFVRFGDDTERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSQGGY  286

Query  699   ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  520
              SNG+    +QSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGEIVSVKIPVGKGCGFVQ
Sbjct  287   ASNGA---SNQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  343

Query  519   FANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQ  412
             FANR +AEEALQKL G VIGKQTVRLSWGRNPA++Q
Sbjct  344   FANRNNAEEALQKLNGTVIGKQTVRLSWGRNPANKQ  379


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            + + KV+ +  TG S+GYGFV F       + L    G+      +P R+  AT      
Sbjct  124  IASIKVIRNKQTGLSEGYGFVEFFSHATAEKVLQNYGGILMPNMEQPFRLNWAT------  177

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +   +  + +IFVG L  +V+D  L + F S+Y  + + K
Sbjct  178  ---------------FSTGEKRSENGPDLSIFVGDLAADVTDSLLHETFASKYSSVKAAK  222

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + T+  +A+ ++ G+    + +R+
Sbjct  223  VVIDANTGRSKGYGFVRFGDDTERSQAMTEMNGVYCSSRPMRI  265



>ref|XP_010500273.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=444

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 186/268 (69%), Positives = 212/268 (79%), Gaps = 7/268 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR  NN  DLSIFVGDLA DV+DTLL +TF  KYPSVKAAKVV DA
Sbjct  183   QPFRLNWASFSTGEKRLENNGPDLSIFVGDLAPDVSDTLLHETFSEKYPSVKAAKVVFDA  242

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS  694
              T RSKGYGFVRFGDDNER++A+TEMNGV CSSR MRIG ATPRK++GYQQQ        
Sbjct  243   TTRRSKGYGFVRFGDDNERTKAMTEMNGVKCSSRAMRIGPATPRKTTGYQQQGGYMP---  299

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+ A   + +GD+ NTTIFVGGLD +V+DEDLRQPFS YGEIVSVKIPVGKGCGFVQF 
Sbjct  300   NGAMA---RPEGDTLNTTIFVGGLDSSVTDEDLRQPFSDYGEIVSVKIPVGKGCGFVQFV  356

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR +AEEAL+KL G VIGKQTVRLSWGR+PA++Q R  + NQW   YYGG +++GY Y  
Sbjct  357   NRPNAEEALEKLNGTVIGKQTVRLSWGRSPANKQPRDKYGNQWVVPYYGGQYFNGYGYMA  416

Query  333   PAPHNPNmyapaaygaypmyGTHQQQVS  250
             P PH+P MY  A YG YPMYG HQQQVS
Sbjct  417   PQPHDPRMYPAAPYGGYPMYGGHQQQVS  444


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 75/163 (46%), Gaps = 29/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNG--VYCSSRPMRIGAATPRKssg  730
            + + KV+ + + G S+GYGFV F   +   + L + NG  +  + +P R+  A+      
Sbjct  138  IVSVKVIRNKHNGYSEGYGFVEFESHDVAEKVLQKFNGATMPTTEQPFRLNWAS------  191

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVK  553
                   +    N  P           + +IFVG L P+VSD  L + FS+ Y  + + K
Sbjct  192  ---FSTGEKRLENNGP-----------DLSIFVGDLAPDVSDTLLHETFSEKYPSVKAAK  237

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            +         KG GFV+F +  +  +A+ ++ G+    + +R+
Sbjct  238  VVFDATTRRSKGYGFVRFGDDNERTKAMTEMNGVKCSSRAMRI  280



>gb|KDO49116.1| hypothetical protein CISIN_1g013061mg [Citrus sinensis]
Length=450

 Score =   308 bits (788),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 172/253 (68%), Positives = 203/253 (80%), Gaps = 7/253 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS  ++R+   SDLSIFVGDLA DVTD++L +TF SKYPSVK AKV+ID+N
Sbjct  187   QPFRLNWATFSGSDRRTEACSDLSIFVGDLAPDVTDSILQETFSSKYPSVKGAKVIIDSN  246

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGR+KGYGFVRFGD+NERS+A+TEMNGVYCSSRPMRI  ATP+K+SGYQQQ+++Q     
Sbjct  247   TGRTKGYGFVRFGDENERSRAMTEMNGVYCSSRPMRIDVATPKKASGYQQQYSSQALVLA  306

Query  690   GSP------AHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
             G P        GSQSDG+S+N TIFVG LD +VSDEDLR+PFSQ+GEI+SVKIPVGKGCG
Sbjct  307   GGPGSNGARVQGSQSDGESNNATIFVGALDSDVSDEDLREPFSQFGEILSVKIPVGKGCG  366

Query  528   FVQFAN-RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
             FVQFAN R DAE ALQKL+G  IGKQTVRLSWGRNP ++Q R D +N W GA+YGG  Y 
Sbjct  367   FVQFANSRKDAEVALQKLQGTAIGKQTVRLSWGRNPGNKQWRGDHSNHWNGAHYGGQGYS  426

Query  351   GYTYAFPAPHNPN  313
             G  YAFP   +PN
Sbjct  427   GNGYAFPPNQDPN  439


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V   KV+ +  TG+S+GYGFV F       + L   +G     + +P R+  AT      
Sbjct  142  VVNVKVIRNKQTGQSEGYGFVEFYSRAAAEKVLQSYSGSLMPNTDQPFRLNWAT------  195

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                        +GS     +     S+ +IFVG L P+V+D  L++ F S+Y  +   K
Sbjct  196  -----------FSGS----DRRTEACSDLSIFVGDLAPDVTDSILQETFSSKYPSVKGAK  240

Query  552  IPVG------KGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  241  VIIDSNTGRTKGYGFVRFGDENERSRAMTEMNGVYCSSRPMRI  283



>ref|XP_007017332.1| RNA-binding protein 47C isoform 4, partial [Theobroma cacao]
 gb|EOY14557.1| RNA-binding protein 47C isoform 4, partial [Theobroma cacao]
Length=387

 Score =   305 bits (781),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 191/212 (90%), Gaps = 4/212 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS GEKRS N  DLSIFVGDLAADVTD+LL +TF SKY SVKAAKVVIDAN
Sbjct  169   QPFRLNWATFSTGEKRSENGPDLSIFVGDLAADVTDSLLHETFASKYSSVKAAKVVIDAN  228

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg-gyS  694
             TGRSKGYGFVRFGDD ERSQA+TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++QG   S
Sbjct  229   TGRSKGYGFVRFGDDTERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSQGGYAS  288

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+    +QSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGEIVSVKIPVGKGCGFVQFA
Sbjct  289   NGA---SNQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  345

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAH  418
             NR +AEEALQKL G VIGKQTVRLSWGRNPA+
Sbjct  346   NRNNAEEALQKLNGTVIGKQTVRLSWGRNPAN  377


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            + + KV+ +  TG S+GYGFV F       + L    G+      +P R+  AT      
Sbjct  124  IASIKVIRNKQTGLSEGYGFVEFFSHATAEKVLQNYGGILMPNMEQPFRLNWAT------  177

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +   +  + +IFVG L  +V+D  L + F S+Y  + + K
Sbjct  178  ---------------FSTGEKRSENGPDLSIFVGDLAADVTDSLLHETFASKYSSVKAAK  222

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + T+  +A+ ++ G+    + +R+
Sbjct  223  VVIDANTGRSKGYGFVRFGDDTERSQAMTEMNGVYCSSRPMRI  265



>gb|KJB58433.1| hypothetical protein B456_009G209600 [Gossypium raimondii]
Length=385

 Score =   305 bits (780),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 191/215 (89%), Gaps = 2/215 (1%)
 Frame = -2

Query  1056  LFKPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVID  877
             + +P   NW+TFSMG+K S N  DLSIFVGDLAADVTD+LL +TF SKYPSVKA KVVID
Sbjct  167   MEQPFRLNWATFSMGDKHSENGPDLSIFVGDLAADVTDSLLHETFASKYPSVKAVKVVID  226

Query  876   ANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy  697
             ANTGRSKGYGFVRFGDD ERS A+TEMNGVYCSSRPMRIGAATPRKSS YQQQ++ QGGY
Sbjct  227   ANTGRSKGYGFVRFGDDTERSLAMTEMNGVYCSSRPMRIGAATPRKSSSYQQQYSLQGGY  286

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             ++ S +  SQSDGDSSNTTIFVGGLDPNV++EDLRQPFSQYGEIVSVKIPVGKGCGFVQF
Sbjct  287   ASNSAS--SQSDGDSSNTTIFVGGLDPNVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  344

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQ  412
             A R +AEEALQKL G +IGKQTVRLSWGRNP ++Q
Sbjct  345   AGRNNAEEALQKLNGTIIGKQTVRLSWGRNPTNKQ  379


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 74/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            + + KV+ +  TG S+GYGFV F       + L   +G+      +P R+  AT      
Sbjct  124  ISSIKVIRNKQTGLSEGYGFVEFFSHATAEKVLQNYSGILMPNMEQPFRLNWAT------  177

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +   +  + +IFVG L  +V+D  L + F S+Y  + +VK
Sbjct  178  ---------------FSMGDKHSENGPDLSIFVGDLAADVTDSLLHETFASKYPSVKAVK  222

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + T+   A+ ++ G+    + +R+
Sbjct  223  VVIDANTGRSKGYGFVRFGDDTERSLAMTEMNGVYCSSRPMRI  265



>ref|NP_175181.1| RNA-binding protein 47C' [Arabidopsis thaliana]
 sp|Q9SX80.1|R47CP_ARATH RecName: Full=Polyadenylate-binding protein RBP47C'; Short=Poly(A)-binding 
protein RBP47C'; AltName: Full=RNA-binding protein 
47C'; Short=AtRBP47C prime; Short=AtRBP47C' [Arabidopsis 
thaliana]
 gb|AAD46037.1|AC007519_22 Contains 3 PF|00076 RNA recognition motif domains. EST gb|T20424 
comes from this gene [Arabidopsis thaliana]
 dbj|BAE99410.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABN04767.1| At1g47500 [Arabidopsis thaliana]
 gb|AEE32178.1| RNA-binding protein 47C' [Arabidopsis thaliana]
Length=434

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 165/251 (66%), Positives = 191/251 (76%), Gaps = 23/251 (9%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR  NN  DLSIFVGDLA DV+D LL +TF  KYPSVKAAKVV+DA
Sbjct  176   QPFRLNWASFSTGEKRLENNGPDLSIFVGDLAPDVSDALLHETFSEKYPSVKAAKVVLDA  235

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS  694
             NTGRSKGYGFVRFGD+NER++A+TEMNGV CSSR MRIG ATPRK+              
Sbjct  236   NTGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRIGPATPRKT--------------  281

Query  693   NGSPAHG--------SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGK  538
             NG    G        ++S+GD+ NTTIFVGGLD +V+DEDL+QPFS++GEIVSVKIPVGK
Sbjct  282   NGYQQQGGYMPSGAFTRSEGDTINTTIFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPVGK  341

Query  537   GCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHF  358
             GCGFVQF NR +AEEAL+KL G VIGKQTVRLSWGRNPA++Q R  + NQW   YYGG F
Sbjct  342   GCGFVQFVNRPNAEEALEKLNGTVIGKQTVRLSWGRNPANKQPRDKYGNQWVDPYYGGQF  401

Query  357   YDGYTYAFPAP  325
             Y+GY Y  P P
Sbjct  402   YNGYGYMVPQP  412


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 98/214 (46%), Gaps = 32/214 (15%)
 Frame = -2

Query  1047  PAYANWSTFSMGEKRSN--NASDLSIFVGdlaadvtdtllldTFVS-KYPSVKAAKVVID  877
             P + ++   S G K  N  N  + +I+VGDL   + +  L   F S +   + + KV+ +
Sbjct  80    PNHHHFHHQSRGNKHQNAFNGENKTIWVGDLQNWMDEAYLNSAFTSAEEREIVSLKVIRN  139

Query  876   ANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqg  703
              + G S+GYGFV F   +   + L E NG     + +P R+  A+             + 
Sbjct  140   KHNGSSEGYGFVEFESHDVADKVLQEFNGAPMPNTDQPFRLNWAS---------FSTGEK  190

Query  702   gySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVKIPV------  544
                N  P           + +IFVG L P+VSD  L + FS+ Y  + + K+ +      
Sbjct  191   RLENNGP-----------DLSIFVGDLAPDVSDALLHETFSEKYPSVKAAKVVLDANTGR  239

Query  543   GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
              KG GFV+F +  +  +A+ ++ G+    + +R+
Sbjct  240   SKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI  273



>ref|XP_008813036.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Phoenix dactylifera]
Length=398

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 190/242 (79%), Gaps = 12/242 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLAADVTD +L +TF SKYPSVK AKVVIDAN
Sbjct  147   QPFRLNWASFSMGDRRSDVASDHSIFVGDLAADVTDAMLQETFASKYPSVKGAKVVIDAN  206

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFG+DNE++ A+TEMNGVYCSSRPMRIG ATPRKSSG             
Sbjct  207   TGRSKGYGFVRFGNDNEKTLAMTEMNGVYCSSRPMRIGPATPRKSSGGS-----------  255

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
                +   QSDGDS+NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK CGFVQF  
Sbjct  256   -GNSASGQSDGDSTNTTVFVGGLDPNVSEDDLRQAFSQYGEIASVKIPVGKQCGFVQFVQ  314

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +A+EALQ L G VIGKQ VRLSWGRNPA++Q R D  NQW   YYG  FY+GY YA P
Sbjct  315   RNNAQEALQALNGTVIGKQQVRLSWGRNPANKQLRGDHGNQWNNFYYGAPFYNGYGYAAP  374

Query  330   AP  325
              P
Sbjct  375   FP  376



>ref|XP_008782204.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Phoenix dactylifera]
Length=409

 Score =   303 bits (776),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 161/246 (65%), Positives = 195/246 (79%), Gaps = 9/246 (4%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG+KRS+ ASD SIFVGDL +DVTD +L +TF S+Y SVK AKVVIDAN
Sbjct  154   QPFRLNWASFSMGDKRSDAASDHSIFVGDLTSDVTDAMLQETFASRYSSVKGAKVVIDAN  213

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNE+++A+TEMNGV+CSSRPMR+G ATPRKSSG            N
Sbjct  214   TGRSKGYGFVRFGDDNEKTRAMTEMNGVFCSSRPMRLGLATPRKSSGGFGS--------N  265

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+ A   QSDGD +NTT+FVGGLDPNVS++DL+Q FSQYGE+ SVKIPVGK CGFVQF +
Sbjct  266   GASAQSFQSDGDPTNTTVFVGGLDPNVSEDDLKQAFSQYGEVASVKIPVGKQCGFVQFVH  325

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQ+L G VIGKQ VRLSWGRNP ++Q R+   + W G Y+GG  ++GY Y  P
Sbjct  326   RNNAEEALQQLNGTVIGKQLVRLSWGRNPTNKQLRARPGSHWNGVYHGGQVHNGYGYVLP  385

Query  330   APHNPN  313
             A H+P+
Sbjct  386   A-HDPS  390


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+GYGFV F       + L    G     + +P R+  A       
Sbjct  109  VVSIKVIRNKKTGQSEGYGFVEFFSHAAAEKVLQNFCGYAMPNTEQPFRLNWA-------  161

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  162  --------------SFSMGDKRSDAASDHSIFVGDLTSDVTDAMLQETFASRYSSVKGAK  207

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +RL
Sbjct  208  VVIDANTGRSKGYGFVRFGDDNEKTRAMTEMNGVFCSSRPMRL  250



>ref|XP_010461546.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=446

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 184/268 (69%), Positives = 211/268 (79%), Gaps = 7/268 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR  NN  DLSIFVGDLA DV+DTLL +TF  KYPSVKAAKVV DA
Sbjct  185   QPFRLNWASFSTGEKRLENNGPDLSIFVGDLAPDVSDTLLHETFSEKYPSVKAAKVVFDA  244

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS  694
              T RSKGYGFVRFGDDNER++A+TEMNGV CSSR MRIG ATPRK++GYQQQ        
Sbjct  245   TTRRSKGYGFVRFGDDNERNKAMTEMNGVKCSSRAMRIGPATPRKTTGYQQQGGYMP---  301

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+ A   + +G++ NTTIFVGGLD +V+DEDLRQPFS YGEIVSVKIPVGKGCGFVQF 
Sbjct  302   NGAMA---RPEGETLNTTIFVGGLDSSVTDEDLRQPFSDYGEIVSVKIPVGKGCGFVQFV  358

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR +AEEAL+KL G VIGKQTVRLSWG +PA++Q R  + NQW   YYGG +++GY Y  
Sbjct  359   NRPNAEEALEKLNGTVIGKQTVRLSWGHSPANKQPRDKYGNQWVVPYYGGQYFNGYGYMA  418

Query  333   PAPHNPNmyapaaygaypmyGTHQQQVS  250
             P PH+P MY  A YG YPMYG HQQQVS
Sbjct  419   PQPHDPRMYPAAPYGGYPMYGGHQQQVS  446


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 75/163 (46%), Gaps = 29/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNG--VYCSSRPMRIGAATPRKssg  730
            + + KV+ + + G S+GYGFV F   +   + L + NG  +  + +P R+  A+      
Sbjct  140  IVSVKVIRNKHNGYSEGYGFVEFESHDVADKVLQKFNGATMPTTEQPFRLNWAS------  193

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVK  553
                   +    N  P           + +IFVG L P+VSD  L + FS+ Y  + + K
Sbjct  194  ---FSTGEKRLENNGP-----------DLSIFVGDLAPDVSDTLLHETFSEKYPSVKAAK  239

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            +         KG GFV+F +  +  +A+ ++ G+    + +R+
Sbjct  240  VVFDATTRRSKGYGFVRFGDDNERNKAMTEMNGVKCSSRAMRI  282



>ref|NP_175180.1| RNA-binding protein 47C [Arabidopsis thaliana]
 sp|Q9SX79.1|RB47C_ARATH RecName: Full=Polyadenylate-binding protein RBP47C; Short=Poly(A)-binding 
protein RBP47C; AltName: Full=RNA-binding protein 
47C; Short=AtRBP47C [Arabidopsis thaliana]
 gb|AAD46038.1|AC007519_23 Contains 3 PF|00076 RNA recognition motif domains. ESTs gb|R30092, 
gb|R30093, gb|AA394338, gb|N65719 and gb|AA597577 come 
from this gene [Arabidopsis thaliana]
 gb|AAK06876.1|AF344325_1 putative DNA binding protein [Arabidopsis thaliana]
 gb|AAK59684.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AAL33806.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AEE32174.1| RNA-binding protein 47C [Arabidopsis thaliana]
Length=432

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 195/243 (80%), Gaps = 7/243 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR  NN  DLSIFVGDL+ DV+D LL +TF  KYPSVKAAKVV+DA
Sbjct  174   QPFRLNWASFSTGEKRLENNGPDLSIFVGDLSPDVSDNLLHETFSEKYPSVKAAKVVLDA  233

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS  694
             NTGRSKGYGFVRFGD+NER++A+TEMNGV CSSR MRIG ATPRK++GYQQQ        
Sbjct  234   NTGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRIGPATPRKTNGYQQQGGYMP---  290

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+    ++ +GD  NTTIFVGGLD +V+DEDL+QPF+++GEIVSVKIPVGKGCGFVQF 
Sbjct  291   NGT---LTRPEGDIMNTTIFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVGKGCGFVQFV  347

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR +AEEAL+KL G VIGKQTVRLSWGRNPA++Q R  + NQW   YYGG FY+GY Y  
Sbjct  348   NRPNAEEALEKLNGTVIGKQTVRLSWGRNPANKQPRDKYGNQWVDPYYGGQFYNGYGYMV  407

Query  333   PAP  325
             P P
Sbjct  408   PQP  410


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 94/205 (46%), Gaps = 32/205 (16%)
 Frame = -2

Query  1020  SMGEKRSN--NASDLSIFVGdlaadvtdtllldTFVS-KYPSVKAAKVVIDANTGRSKGY  850
             S G K  N  N  + +I+VGDL   + +  L  +F S     + + KV+ + N G S+GY
Sbjct  87    SRGNKHQNAFNGENKTIWVGDLHHWMDEAYLNSSFASGDEREIVSVKVIRNKNNGLSEGY  146

Query  849   GFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GFV F   +   + L E NG     + +P R+  A+             +    N  P  
Sbjct  147   GFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWAS---------FSTGEKRLENNGP--  195

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVKIPV------GKGCGFVQF  517
                      + +IFVG L P+VSD  L + FS+ Y  + + K+ +       KG GFV+F
Sbjct  196   ---------DLSIFVGDLSPDVSDNLLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRF  246

Query  516   ANRTDAEEALQKLKGLVIGKQTVRL  442
              +  +  +A+ ++ G+    + +R+
Sbjct  247   GDENERTKAMTEMNGVKCSSRAMRI  271



>ref|XP_011623994.1| PREDICTED: polyadenylate-binding protein RBP47 [Amborella trichopoda]
Length=409

 Score =   301 bits (772),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 177/264 (67%), Positives = 209/264 (79%), Gaps = 11/264 (4%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+TFSMG++RS+  SD SIFVGDLA+DVTD LL +TF S+Y SVK AKVV DANTGRSK
Sbjct  155   NWATFSMGDRRSDMGSDHSIFVGDLASDVTDALLQETFASRYSSVKGAKVVFDANTGRSK  214

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDD+ER +A+TEMNG+YCSSRPMRIG ATPRKS+  Q           G P++
Sbjct  215   GYGFVRFGDDSERLRAMTEMNGLYCSSRPMRIGVATPRKSTQQQYVSQ------GGFPSN  268

Query  675   GS--QSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTD  502
             G   QS+GDS+NTTIFVGGLD +V+++DLR+ FS+YG+I SVKIPV KGCGFVQFANR++
Sbjct  269   GQNFQSEGDSNNTTIFVGGLDSSVTEDDLREAFSKYGDIASVKIPVNKGCGFVQFANRSN  328

Query  501   AEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPH  322
             AEEALQ L G VIGK T+RLSWGRNP ++Q R+D  NQW G+YYGG  YDGY YA   P 
Sbjct  329   AEEALQGLNGTVIGKVTIRLSWGRNPGNKQPRADAANQWNGSYYGGQVYDGYGYA-AQPQ  387

Query  321   NPNmyapaaygaypmyGTHQQQVS  250
             +P     AAYG YP+YG HQQQVS
Sbjct  388   DP--AVYAAYGTYPVYGNHQQQVS  409



>gb|KCW68769.1| hypothetical protein EUGRSUZ_F02369 [Eucalyptus grandis]
Length=428

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 194/216 (90%), Gaps = 1/216 (0%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS NA DLSIFVGDLAADVTD LL +TF +KYPSVKAAKVV D N
Sbjct  184   QPFRLNWATFSTGDKRSENAPDLSIFVGDLAADVTDNLLHETFANKYPSVKAAKVVFDVN  243

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS-  694
             TGRSKGYGFVRFGD+NERSQA++EMNGVYCSSRPMRIGAATPRKSSGYQ Q+++QGGYS 
Sbjct  244   TGRSKGYGFVRFGDENERSQAMSEMNGVYCSSRPMRIGAATPRKSSGYQSQYSSQGGYSS  303

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+ +   QSDGDS+NTTIFVGGLDP+V+DEDLRQ FSQYGEIVSVKIP GKGCGFVQFA
Sbjct  304   NGASSQSFQSDGDSANTTIFVGGLDPSVNDEDLRQQFSQYGEIVSVKIPSGKGCGFVQFA  363

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSR  406
             NR++AEEALQKL G VIGKQTVRLSWGRNPA++Q R
Sbjct  364   NRSNAEEALQKLNGTVIGKQTVRLSWGRNPANKQVR  399


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 89/194 (46%), Gaps = 31/194 (16%)
 Frame = -2

Query  996  NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYGFVRFGDDNER  817
            N  + +++VGDL   + +  L   FVS    + + KV+ +  TG S+GYGFV F      
Sbjct  109  NGENRTVWVGDLHHWMDENYLHSCFVST-GEIASIKVIRNKQTGLSEGYGFVEFFTHGTA  167

Query  816  SQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHGSQSDGDSSNT  643
             + L   +G+    + +P R+  AT                      + G +   ++ + 
Sbjct  168  EKVLQNYSGIMMPNTEQPFRLNWAT---------------------FSTGDKRSENAPDL  206

Query  642  TIFVGGLDPNVSDEDLRQPFS-QYGEIVSVKIPV------GKGCGFVQFANRTDAEEALQ  484
            +IFVG L  +V+D  L + F+ +Y  + + K+         KG GFV+F +  +  +A+ 
Sbjct  207  SIFVGDLAADVTDNLLHETFANKYPSVKAAKVVFDVNTGRSKGYGFVRFGDENERSQAMS  266

Query  483  KLKGLVIGKQTVRL  442
            ++ G+    + +R+
Sbjct  267  EMNGVYCSSRPMRI  280



>ref|XP_010479152.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=446

 Score =   301 bits (772),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 183/268 (68%), Positives = 210/268 (78%), Gaps = 7/268 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR  NN  DLSIFVGDLA DV+DTLL +TF  KYPSVKAAKVV DA
Sbjct  185   QPFRLNWASFSTGEKRLENNGPDLSIFVGDLAPDVSDTLLHETFSEKYPSVKAAKVVFDA  244

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS  694
              T RSKGYGFVRFGDDNER++A+TEMNGV CSSR MRIG ATPRK++GYQQQ        
Sbjct  245   TTRRSKGYGFVRFGDDNERNKAMTEMNGVKCSSRAMRIGPATPRKTTGYQQQGGYMP---  301

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+ A   + +G++ NTTIFVGGLD +V+DEDLRQPFS YGEIVSVKIPVGKGCGFVQF 
Sbjct  302   NGAMA---RPEGETLNTTIFVGGLDSSVTDEDLRQPFSDYGEIVSVKIPVGKGCGFVQFV  358

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR +AEEAL+KL G VIGKQTVRLSWGR+PA++Q R  + NQW   YYGG +++GY Y  
Sbjct  359   NRPNAEEALEKLNGTVIGKQTVRLSWGRSPANKQPRDKYGNQWVVPYYGGQYFNGYGYMA  418

Query  333   PAPHNPNmyapaaygaypmyGTHQQQVS  250
             P P +P MY    YG YPMYG HQQQVS
Sbjct  419   PQPLDPRMYPATPYGGYPMYGGHQQQVS  446


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 75/163 (46%), Gaps = 29/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNG--VYCSSRPMRIGAATPRKssg  730
            + + KV+ + + G S+GYGFV F   +   + L + NG  +  + +P R+  A+      
Sbjct  140  IVSVKVIRNKHNGHSEGYGFVEFESHDVADKVLQKFNGATMPTTEQPFRLNWAS------  193

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVK  553
                   +    N  P           + +IFVG L P+VSD  L + FS+ Y  + + K
Sbjct  194  ---FSTGEKRLENNGP-----------DLSIFVGDLAPDVSDTLLHETFSEKYPSVKAAK  239

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            +         KG GFV+F +  +  +A+ ++ G+    + +R+
Sbjct  240  VVFDATTRRSKGYGFVRFGDDNERNKAMTEMNGVKCSSRAMRI  282



>emb|CBI32444.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   297 bits (760),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 159/228 (70%), Positives = 187/228 (82%), Gaps = 6/228 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G++R++  SDLSIFVGDLA+DVTD LL +TF ++YPSVK AKVV D+N
Sbjct  80    QPFRLNWATFSTGDRRTDAGSDLSIFVGDLASDVTDALLQETFATRYPSVKGAKVVTDSN  139

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKss------gyqqqfaa  709
             TGRSKGYGFVRFGD+NERS+A+ EMNG+YCSSRPMRIG ATP+K+S        Q    A
Sbjct  140   TGRSKGYGFVRFGDENERSRAMNEMNGIYCSSRPMRIGVATPKKASGYQQQYSSQALVLA  199

Query  708   qggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
              G  SNG+ A GSQ++GDS+NTTIFVGGLD  V+DEDLRQ FSQ+GE+VSVKIPVGKGCG
Sbjct  200   GGNASNGAVAQGSQANGDSTNTTIFVGGLDSEVTDEDLRQSFSQFGEVVSVKIPVGKGCG  259

Query  528   FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             FVQFANR  AE+ALQ+L G VIGKQTVRLSWGRNPA +Q R+D  NQW
Sbjct  260   FVQFANRNSAEDALQRLNGTVIGKQTVRLSWGRNPASKQWRNDSNNQW  307


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 72/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + K++ +  TG+S+GYGFV F       + L   NG     + +P R+  AT      
Sbjct  35   VSSIKIIRNKQTGQSEGYGFVEFFSRATAEKILHSYNGTLMPNTEQPFRLNWAT------  88

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +     S+ +IFVG L  +V+D  L++ F ++Y  +   K
Sbjct  89   ---------------FSTGDRRTDAGSDLSIFVGDLASDVTDALLQETFATRYPSVKGAK  133

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            +         KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  134  VVTDSNTGRSKGYGFVRFGDENERSRAMNEMNGIYCSSRPMRI  176



>ref|XP_010907889.1| PREDICTED: polyadenylate-binding protein RBP47 [Elaeis guineensis]
Length=402

 Score =   298 bits (762),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 166/242 (69%), Positives = 190/242 (79%), Gaps = 12/242 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLAADVTD +L +TF SKYPSVK AKVVIDAN
Sbjct  151   QPFRLNWASFSMGDRRSDVASDHSIFVGDLAADVTDAMLQETFASKYPSVKGAKVVIDAN  210

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFG+D E++ A+TEMNGVYCS+RPMRIG ATPRKSSG     A+      
Sbjct  211   TGRSKGYGFVRFGNDGEKTLAMTEMNGVYCSTRPMRIGPATPRKSSGGSGNGAS------  264

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
                    QSDGDS+NTT+FVGGLDPNVS++DLRQ FS +G+I SVKIPVGK CGFVQF  
Sbjct  265   ------GQSDGDSTNTTVFVGGLDPNVSEDDLRQAFSPFGDIASVKIPVGKQCGFVQFVQ  318

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQ L G VIGKQ VRLSWGRNPA++Q R D  NQW G YYG  FY+GY YA P
Sbjct  319   RNNAEEALQALNGAVIGKQQVRLSWGRNPANKQLRGDHGNQWNGFYYGAPFYNGYGYAAP  378

Query  330   AP  325
              P
Sbjct  379   FP  380



>ref|XP_009794615.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Nicotiana 
sylvestris]
Length=402

 Score =   298 bits (762),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 191/242 (79%), Gaps = 5/242 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS GEKR+   SD SIFVGDLA+DVTDT+L DTF S+YPS+K AKVV+DAN
Sbjct  129   QPFRLNWAGFSTGEKRAETGSDFSIFVGDLASDVTDTMLRDTFASRYPSLKGAKVVVDAN  188

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg---  700
             TG SKGYGFVRFGD++ERS+A+TEMNGVYCSSR MRIG ATP+K S  QQ  +       
Sbjct  189   TGHSKGYGFVRFGDESERSRAMTEMNGVYCSSRAMRIGVATPKKPSAQQQYSSQAVILSG  248

Query  699   --ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGF  526
                SNG+  HGSQSDGDSSNTTIFVGGLD  V+DE+LRQ F+Q+GE+VSVKIP GKGCGF
Sbjct  249   GYASNGAATHGSQSDGDSSNTTIFVGGLDSEVTDEELRQSFNQFGEVVSVKIPAGKGCGF  308

Query  525   VQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGY  346
             VQF++R+ A+EA+QKL G +IGKQ VRLSWGR+PA++Q R+D  +QW G Y G   Y GY
Sbjct  309   VQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGRSPANKQMRTDSGSQWNGGYNGRQNYGGY  368

Query  345   TY  340
              Y
Sbjct  369   GY  370



>ref|XP_009380242.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=404

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 196/245 (80%), Gaps = 11/245 (4%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG+KRS+ ASD SIFVGDLA+DVTD++L +TF +K+ SVK AKVV+DAN
Sbjct  151   QPFRLNWASFSMGDKRSDLASDHSIFVGDLASDVTDSILHETFATKFSSVKGAKVVVDAN  210

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGD++E+  A+TEMNGVYCS+RPMRIG ATPRKS G   Q        N
Sbjct  211   TGRSKGYGFVRFGDESEKKLAITEMNGVYCSTRPMRIGLATPRKSYGGFGQ--------N  262

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             GSPA GSQSD DS+NTT+FVGGLDP+VS++DL++ FSQYGEI SVKIP GK CGFV F +
Sbjct  263   GSPAAGSQSDVDSANTTVFVGGLDPDVSEDDLKEAFSQYGEIASVKIPFGKQCGFVLFIH  322

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEA+ +L G VIGKQTVRLSWGRNPA++QSR++   +W G YYGG  YDG  Y  P
Sbjct  323   RNNAEEAMNQLNGTVIGKQTVRLSWGRNPANKQSRAERGKRWNGMYYGGQMYDG--YGLP  380

Query  330   APHNP  316
              PH P
Sbjct  381   -PHYP  384



>ref|XP_009794616.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Nicotiana 
sylvestris]
Length=431

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 191/242 (79%), Gaps = 5/242 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS GEKR+   SD SIFVGDLA+DVTDT+L DTF S+YPS+K AKVV+DAN
Sbjct  158   QPFRLNWAGFSTGEKRAETGSDFSIFVGDLASDVTDTMLRDTFASRYPSLKGAKVVVDAN  217

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg---  700
             TG SKGYGFVRFGD++ERS+A+TEMNGVYCSSR MRIG ATP+K S  QQ  +       
Sbjct  218   TGHSKGYGFVRFGDESERSRAMTEMNGVYCSSRAMRIGVATPKKPSAQQQYSSQAVILSG  277

Query  699   --ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGF  526
                SNG+  HGSQSDGDSSNTTIFVGGLD  V+DE+LRQ F+Q+GE+VSVKIP GKGCGF
Sbjct  278   GYASNGAATHGSQSDGDSSNTTIFVGGLDSEVTDEELRQSFNQFGEVVSVKIPAGKGCGF  337

Query  525   VQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGY  346
             VQF++R+ A+EA+QKL G +IGKQ VRLSWGR+PA++Q R+D  +QW G Y G   Y GY
Sbjct  338   VQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGRSPANKQMRTDSGSQWNGGYNGRQNYGGY  397

Query  345   TY  340
              Y
Sbjct  398   GY  399



>ref|XP_002285031.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Vitis vinifera]
Length=416

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/228 (71%), Positives = 193/228 (85%), Gaps = 6/228 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G++R++  SDLSIFVGDLA+DVTD LL +TF ++YPSVK AKVV D+N
Sbjct  154   QPFRLNWATFSTGDRRTDAGSDLSIFVGDLASDVTDALLQETFATRYPSVKGAKVVTDSN  213

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg----  703
             TGRSKGYGFVRFGD+NERS+A+ EMNG+YCSSRPMRIG ATP+K+SGYQQQ+++Q     
Sbjct  214   TGRSKGYGFVRFGDENERSRAMNEMNGIYCSSRPMRIGVATPKKASGYQQQYSSQALVLA  273

Query  702   --gySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
                 SNG+ A GSQ++GDS+NTTIFVGGLD  V+DEDLRQ FSQ+GE+VSVKIPVGKGCG
Sbjct  274   GGNASNGAVAQGSQANGDSTNTTIFVGGLDSEVTDEDLRQSFSQFGEVVSVKIPVGKGCG  333

Query  528   FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             FVQFANR  AE+ALQ+L G VIGKQTVRLSWGRNPA +Q R+D  NQW
Sbjct  334   FVQFANRNSAEDALQRLNGTVIGKQTVRLSWGRNPASKQWRNDSNNQW  381


 Score = 51.6 bits (122),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 72/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + K++ +  TG+S+GYGFV F       + L   NG     + +P R+  AT      
Sbjct  109  VSSIKIIRNKQTGQSEGYGFVEFFSRATAEKILHSYNGTLMPNTEQPFRLNWAT------  162

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +     S+ +IFVG L  +V+D  L++ F ++Y  +   K
Sbjct  163  ---------------FSTGDRRTDAGSDLSIFVGDLASDVTDALLQETFATRYPSVKGAK  207

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            +         KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  208  VVTDSNTGRSKGYGFVRFGDENERSRAMNEMNGIYCSSRPMRI  250



>ref|XP_010647773.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Vitis vinifera]
Length=414

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 159/228 (70%), Positives = 187/228 (82%), Gaps = 6/228 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G++R++  SDLSIFVGDLA+DVTD LL +TF ++YPSVK AKVV D+N
Sbjct  152   QPFRLNWATFSTGDRRTDAGSDLSIFVGDLASDVTDALLQETFATRYPSVKGAKVVTDSN  211

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKss------gyqqqfaa  709
             TGRSKGYGFVRFGD+NERS+A+ EMNG+YCSSRPMRIG ATP+K+S        Q    A
Sbjct  212   TGRSKGYGFVRFGDENERSRAMNEMNGIYCSSRPMRIGVATPKKASGYQQQYSSQALVLA  271

Query  708   qggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
              G  SNG+ A GSQ++GDS+NTTIFVGGLD  V+DEDLRQ FSQ+GE+VSVKIPVGKGCG
Sbjct  272   GGNASNGAVAQGSQANGDSTNTTIFVGGLDSEVTDEDLRQSFSQFGEVVSVKIPVGKGCG  331

Query  528   FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             FVQFANR  AE+ALQ+L G VIGKQTVRLSWGRNPA +Q R+D  NQW
Sbjct  332   FVQFANRNSAEDALQRLNGTVIGKQTVRLSWGRNPASKQWRNDSNNQW  379


 Score = 51.6 bits (122),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 72/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + K++ +  TG+S+GYGFV F       + L   NG     + +P R+  AT      
Sbjct  107  VSSIKIIRNKQTGQSEGYGFVEFFSRATAEKILHSYNGTLMPNTEQPFRLNWAT------  160

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +     S+ +IFVG L  +V+D  L++ F ++Y  +   K
Sbjct  161  ---------------FSTGDRRTDAGSDLSIFVGDLASDVTDALLQETFATRYPSVKGAK  205

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            +         KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  206  VVTDSNTGRSKGYGFVRFGDENERSRAMNEMNGIYCSSRPMRI  248



>sp|Q9LEB3.1|RBP47_NICPL RecName: Full=Polyadenylate-binding protein RBP47; Short=Poly(A)-binding 
protein RBP47; AltName: Full=RNA-binding protein 
47; Short=NplRBP47 [Nicotiana plumbaginifolia]
 emb|CAC01238.1| RNA Binding Protein 47 [Nicotiana plumbaginifolia]
Length=428

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 192/242 (79%), Gaps = 5/242 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS GEKR+   SD SIFVGDLA+DVTDT+L DTF S+YPS+K AKVV+DAN
Sbjct  155   QPFRLNWAGFSTGEKRAETGSDFSIFVGDLASDVTDTMLRDTFASRYPSLKGAKVVVDAN  214

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg---  700
             TG SKGYGFVRFGD++ERS+A+TEMNGVYCSSR MRIG ATP+K S ++Q  +       
Sbjct  215   TGHSKGYGFVRFGDESERSRAMTEMNGVYCSSRAMRIGVATPKKPSAHEQYSSQAVILSG  274

Query  699   --ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGF  526
                SNG+  HGSQSDGDSSNTTIFVGGLD  V+DE+LRQ F+Q+GE+VSVKIP GKGCGF
Sbjct  275   GYASNGAATHGSQSDGDSSNTTIFVGGLDSEVTDEELRQSFNQFGEVVSVKIPAGKGCGF  334

Query  525   VQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGY  346
             VQF++R+ A+EA+QKL G +IGKQ VRLSWGR+PA++Q R+D  +QW G Y G   Y GY
Sbjct  335   VQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGRSPANKQMRTDSGSQWNGGYNGRQNYGGY  394

Query  345   TY  340
              Y
Sbjct  395   GY  396



>ref|XP_008797245.1| PREDICTED: polyadenylate-binding protein RBP47-like [Phoenix 
dactylifera]
Length=393

 Score =   296 bits (758),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 186/242 (77%), Gaps = 12/242 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++R++ A D SIFVGDLA+DVTD +L + F S+YPSVK AKVVIDAN
Sbjct  142   QPFRLNWASFSMGDRRADVAPDHSIFVGDLASDVTDAMLQEIFASRYPSVKGAKVVIDAN  201

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRF +DNE++ ALTEMNGV+CS RPMRIG ATPRKSSG            N
Sbjct  202   TGRSKGYGFVRFRNDNEKTLALTEMNGVFCSGRPMRIGPATPRKSSGGSG---------N  252

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G P    QS GDS+NTT+FVGGLD NVS++DLRQ FSQYGEI SVKIP GK CGFVQF  
Sbjct  253   GVPG---QSHGDSTNTTVFVGGLDTNVSEDDLRQVFSQYGEIASVKIPSGKQCGFVQFVQ  309

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R +AEEALQ L G VIGKQ VRLSWGRNPA++Q R D +N W G YYG  FY+GY YA P
Sbjct  310   RNNAEEALQALNGTVIGKQPVRLSWGRNPANKQLRGDPSNLWNGVYYGAQFYNGYGYAAP  369

Query  330   AP  325
              P
Sbjct  370   VP  371



>ref|XP_004230808.1| PREDICTED: polyadenylate-binding protein RBP47 [Solanum lycopersicum]
Length=413

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 192/242 (79%), Gaps = 7/242 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS GEKR+   SD SIFVGDLA+DVTDT+L DTF S+YPSVK AKVV+DAN
Sbjct  147   QPFRLNWAAFSAGEKRAETGSDFSIFVGDLASDVTDTMLRDTFASRYPSVKGAKVVVDAN  206

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg---  700
             TG SKGYGFVRFGD++ERS+A+TEMNG+YCSSRPMR+G ATP+K S  QQ  +       
Sbjct  207   TGHSKGYGFVRFGDESERSRAMTEMNGIYCSSRPMRVGVATPKKPSAQQQFSSQAVILSG  266

Query  699   --ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGF  526
                SNG+  HGSQSDGDSSNTTIFVGGLD +V+DE+LRQ F+Q+GE+VSVKIP GKGCGF
Sbjct  267   GYASNGAATHGSQSDGDSSNTTIFVGGLDSDVTDEELRQSFTQFGEVVSVKIPAGKGCGF  326

Query  525   VQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGY  346
             VQF++R+ A+EA+QKL G VIGKQ VRLSWGR+P+++Q RSD  N   G YYG   Y GY
Sbjct  327   VQFSDRSSAQEAIQKLSGAVIGKQAVRLSWGRSPSNKQMRSDSGN--GGGYYGRQNYGGY  384

Query  345   TY  340
              Y
Sbjct  385   GY  386


 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 72/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + K++ +  TG+S+ YGFV F       + L   NG     + +P R+  A       
Sbjct  102  VISVKIIRNKQTGQSERYGFVEFNSHAAAEKVLQSYNGTMMPNAEQPFRLNWA-------  154

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          + + G +     S+ +IFVG L  +V+D  LR  F S+Y  +   K
Sbjct  155  --------------AFSAGEKRAETGSDFSIFVGDLASDVTDTMLRDTFASRYPSVKGAK  200

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + V       KG GFV+F + ++   A+ ++ G+    + +R+
Sbjct  201  VVVDANTGHSKGYGFVRFGDESERSRAMTEMNGIYCSSRPMRV  243



>gb|EEE69858.1| hypothetical protein OsJ_29658 [Oryza sativa Japonica Group]
Length=310

 Score =   293 bits (749),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 163/247 (66%), Positives = 190/247 (77%), Gaps = 13/247 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLA+DV DT LL+TF  +Y SVK AKVVIDAN
Sbjct  55    QPFRINWASFSMGDRRSDIASDHSIFVGDLASDVNDTTLLETFSKRYSSVKGAKVVIDAN  114

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNE++ A+TEMNGVYCS+RPMRIG ATPRK+SG            +
Sbjct  115   TGRSKGYGFVRFGDDNEKTHAMTEMNGVYCSTRPMRIGPATPRKTSGT-----------S  163

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G     ++SDGD +NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK CGFVQF  
Sbjct  164   GPTGSAARSDGDLTNTTVFVGGLDPNVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFVQ  223

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTYA  337
             R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  +QW  G YY    FY GY Y 
Sbjct  224   RKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGSQWNNGMYYAASPFYSGYGYP  283

Query  336   FPAPHNP  316
              P P +P
Sbjct  284   APFPADP  290


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 72/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V A KV+ +  TG+S+GYGFV F       + L    G     + +P RI  A       
Sbjct  10   VVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKVLEGFAGHIMPNTDQPFRINWA-------  62

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+D  L + FS+ Y  +   K
Sbjct  63   --------------SFSMGDRRSDIASDHSIFVGDLASDVNDTTLLETFSKRYSSVKGAK  108

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  109  VVIDANTGRSKGYGFVRFGDDNEKTHAMTEMNGVYCSTRPMRI  151



>ref|XP_009590296.1| PREDICTED: polyadenylate-binding protein RBP47 [Nicotiana tomentosiformis]
Length=430

 Score =   297 bits (760),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 192/242 (79%), Gaps = 5/242 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS GEKR+   SD SIFVGDLA+DVTDT+L DTF S+YPS+K AKVV+DAN
Sbjct  157   QPFRLNWAGFSTGEKRAETGSDFSIFVGDLASDVTDTMLRDTFASRYPSLKGAKVVVDAN  216

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg---  700
             TG SKGYGFVRFGD++ERS+A+TEMNGVYCSSR MRIG ATP+K S  QQ  +       
Sbjct  217   TGHSKGYGFVRFGDESERSRAMTEMNGVYCSSRAMRIGVATPKKPSAQQQYSSQAVILSG  276

Query  699   --ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGF  526
                SNG+  HGSQSDGD+SNTTIFVGGLD +V+DE+LRQ F+Q+GE+VSVKIP GKGCGF
Sbjct  277   GYASNGAATHGSQSDGDASNTTIFVGGLDSDVTDEELRQSFNQFGEVVSVKIPAGKGCGF  336

Query  525   VQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGY  346
             VQF++R+ A+EA+QKL G +IGKQ VRLSWGR+PA++Q R+D  +QW G Y G   Y GY
Sbjct  337   VQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGRSPANKQMRADSGSQWNGGYNGRQNYGGY  396

Query  345   TY  340
              Y
Sbjct  397   GY  398



>ref|XP_006346456.1| PREDICTED: polyadenylate-binding protein RBP47 [Solanum tuberosum]
Length=420

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 192/242 (79%), Gaps = 7/242 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS GEKR+   SD SIFVGDLA+DVTDT+L DTF S++PSVK AKVV+DAN
Sbjct  154   QPFRLNWAAFSAGEKRAETGSDFSIFVGDLASDVTDTMLRDTFASRFPSVKGAKVVVDAN  213

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg---  700
             TG SKGYGFVRFGD++ERS+A+TEMNG+YCSSRPMR+G ATP+K S  QQ  +       
Sbjct  214   TGHSKGYGFVRFGDESERSRAMTEMNGIYCSSRPMRVGVATPKKPSAQQQFSSQAVILSG  273

Query  699   --ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGF  526
                SNGS  HGSQSDGDSSNTTIFVGGLD +V+DE+LRQ F+Q+GE+VSVKIP GKGCGF
Sbjct  274   GYASNGSATHGSQSDGDSSNTTIFVGGLDSDVTDEELRQSFTQFGEVVSVKIPAGKGCGF  333

Query  525   VQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGY  346
             VQF++R+ A+EA+QKL G +IGKQ VRLSWGR+PA++Q R+D  N   G YYG   Y GY
Sbjct  334   VQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGRSPANKQMRTDSGN--GGGYYGRQNYGGY  391

Query  345   TY  340
              Y
Sbjct  392   GY  393



>ref|XP_009404023.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=403

 Score =   295 bits (755),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 164/244 (67%), Positives = 193/244 (79%), Gaps = 12/244 (5%)
 Frame = -2

Query  1047  PAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANT  868
             P   NW++FSMG KRS+ + D SIFVGDLA+DVTD +L +TF +KYPSVK AKVVID NT
Sbjct  152   PFRLNWASFSMGNKRSDLSFDHSIFVGDLASDVTDAILHETFATKYPSVKGAKVVIDVNT  211

Query  867   GRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNG  688
             GRSKGYGFVRFGD+NE+  A+TEMNGVYCS+RPMRIG ATPRKSSG            +G
Sbjct  212   GRSKGYGFVRFGDENEKKVAITEMNGVYCSTRPMRIGLATPRKSSGGLGP--------DG  263

Query  687   SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  508
             + A GSQSD DS+NTT+FVGGLDP VS++DL++ FSQYGEI SVKIPVGK CGFV FA+R
Sbjct  264   ASATGSQSDIDSANTTVFVGGLDPEVSEDDLKEAFSQYGEITSVKIPVGKQCGFVLFAHR  323

Query  507   TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  328
              +AEEALQ+L G +IGKQTVRLSWGRNPA RQSR++ + +W G Y+GG  YDG  Y  P 
Sbjct  324   NNAEEALQQLNGTIIGKQTVRLSWGRNPA-RQSRAERSKRWNGVYFGGQAYDG--YGLP-  379

Query  327   PHNP  316
             PH P
Sbjct  380   PHYP  383



>dbj|BAD33940.1| putative nucleic acid binding protein [Oryza sativa Japonica 
Group]
 dbj|BAD38554.1| putative nucleic acid binding protein [Oryza sativa Japonica 
Group]
Length=316

 Score =   292 bits (747),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 163/247 (66%), Positives = 190/247 (77%), Gaps = 13/247 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLA+DV DT LL+TF  +Y SVK AKVVIDAN
Sbjct  61    QPFRINWASFSMGDRRSDIASDHSIFVGDLASDVNDTTLLETFSKRYSSVKGAKVVIDAN  120

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNE++ A+TEMNGVYCS+RPMRIG ATPRK+SG            +
Sbjct  121   TGRSKGYGFVRFGDDNEKTHAMTEMNGVYCSTRPMRIGPATPRKTSGT-----------S  169

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G     ++SDGD +NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK CGFVQF  
Sbjct  170   GPTGSAARSDGDLTNTTVFVGGLDPNVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFVQ  229

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTYA  337
             R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  +QW  G YY    FY GY Y 
Sbjct  230   RKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGSQWNNGMYYAASPFYSGYGYP  289

Query  336   FPAPHNP  316
              P P +P
Sbjct  290   APFPADP  296


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 72/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V A KV+ +  TG+S+GYGFV F       + L    G     + +P RI  A       
Sbjct  16   VVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKVLEGFAGHIMPNTDQPFRINWA-------  68

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+D  L + FS+ Y  +   K
Sbjct  69   --------------SFSMGDRRSDIASDHSIFVGDLASDVNDTTLLETFSKRYSSVKGAK  114

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  115  VVIDANTGRSKGYGFVRFGDDNEKTHAMTEMNGVYCSTRPMRI  157



>emb|CAN74486.1| hypothetical protein VITISV_029928 [Vitis vinifera]
Length=434

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 162/228 (71%), Positives = 193/228 (85%), Gaps = 6/228 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G++R++  SDLSIFVGDLA+DVTD LL +TF ++YPSVK AKVV D+N
Sbjct  172   QPFRLNWATFSTGDRRTDAGSDLSIFVGDLASDVTDALLQETFATRYPSVKGAKVVTDSN  231

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg---  700
             TGRSKGYGFVRFGD+NERS+A+ EMNG+YCSSRPMRIG ATP+K+SGYQQQ+++Q     
Sbjct  232   TGRSKGYGFVRFGDENERSRAMNEMNGIYCSSRPMRIGVATPKKASGYQQQYSSQALVLA  291

Query  699   ---ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
                 SNG+ A GSQ++GDS+NTTIFVGGLD  V+DEDLRQ FSQ+GE+VSVKIPVGKGCG
Sbjct  292   GGNASNGAVAQGSQANGDSTNTTIFVGGLDSEVTDEDLRQSFSQFGEVVSVKIPVGKGCG  351

Query  528   FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             FVQFANR  AE+ALQ+L G VIGKQTVRLSWGRNPA +Q R+D  NQW
Sbjct  352   FVQFANRNSAEDALQRLNGTVIGKQTVRLSWGRNPASKQWRNDSNNQW  399



>gb|AAB92518.1| putative RNA binding protein [Nicotiana tabacum]
Length=482

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 192/242 (79%), Gaps = 5/242 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS GEKR+   SD SIFVGDLA+DVTDT+L DTF S+YPS+K AKVV+DAN
Sbjct  209   QPFRLNWAGFSTGEKRAETGSDFSIFVGDLASDVTDTMLRDTFASRYPSLKGAKVVVDAN  268

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg---  700
             TG SKGYGFVRFGD++ERS+A+TEMNGVYCSSR MRIG ATP+K S  QQ  +       
Sbjct  269   TGHSKGYGFVRFGDESERSRAMTEMNGVYCSSRAMRIGVATPKKPSAQQQYSSQAVILSG  328

Query  699   --ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGF  526
                SNG+  HGSQSDGD+SNTTIFVGGLD +V+DE+LRQ F+Q+GE+VSVKIP GKGCGF
Sbjct  329   GYASNGAATHGSQSDGDASNTTIFVGGLDSDVTDEELRQSFNQFGEVVSVKIPAGKGCGF  388

Query  525   VQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGY  346
             VQF++R+ A+EA+QKL G +IGKQ VRLSWGR+PA++Q R+D  +QW G Y G   Y GY
Sbjct  389   VQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGRSPANKQMRADSGSQWNGGYNGRQNYGGY  448

Query  345   TY  340
              Y
Sbjct  449   GY  450



>dbj|BAG87507.1| unnamed protein product [Oryza sativa Japonica Group]
Length=345

 Score =   291 bits (745),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 163/247 (66%), Positives = 190/247 (77%), Gaps = 13/247 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLA+DV DT LL+TF  +Y SVK AKVVIDAN
Sbjct  90    QPFRINWASFSMGDRRSDIASDHSIFVGDLASDVNDTTLLETFSKRYSSVKGAKVVIDAN  149

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNE++ A+TEMNGVYCS+RPMRIG ATPRK+SG            +
Sbjct  150   TGRSKGYGFVRFGDDNEKTHAMTEMNGVYCSTRPMRIGPATPRKTSGT-----------S  198

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G     ++SDGD +NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK CGFVQF  
Sbjct  199   GPTGSAARSDGDLTNTTVFVGGLDPNVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFVQ  258

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTYA  337
             R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  +QW  G YY    FY GY Y 
Sbjct  259   RKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGSQWNNGMYYAASPFYSGYGYP  318

Query  336   FPAPHNP  316
              P P +P
Sbjct  319   APFPADP  325


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 72/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V A KV+ +  TG+S+GYGFV F       + L    G     + +P RI  A       
Sbjct  45   VVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKVLEGFAGHIMPNTDQPFRINWA-------  97

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+D  L + FS+ Y  +   K
Sbjct  98   --------------SFSMGDRRSDIASDHSIFVGDLASDVNDTTLLETFSKRYSSVKGAK  143

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  144  VVIDANTGRSKGYGFVRFGDDNEKTHAMTEMNGVYCSTRPMRI  186



>ref|NP_001275480.1| DNA binding protein ACBF-like [Solanum tuberosum]
 gb|ABB86267.1| DNA binding protein ACBF-like [Solanum tuberosum]
Length=372

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 188/233 (81%), Gaps = 7/233 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS GEKR+   SD SIFVGDLA+DVTDT+L DTF S++PSVK AKVV+DAN
Sbjct  104   QPFRLNWAAFSAGEKRAETGSDFSIFVGDLASDVTDTMLRDTFASRFPSVKGAKVVVDAN  163

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg---  700
             TG SKGYGFVRFGD++ERS+A+TEMNG+YCSSRPMR+G ATP+K S  QQ  +       
Sbjct  164   TGHSKGYGFVRFGDESERSRAMTEMNGIYCSSRPMRVGVATPKKPSAQQQFSSQAVILSG  223

Query  699   --ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGF  526
                SNGS  HGSQSDGDSSNTTIFVGGLD +V+DE+LRQ F+Q+GE+VSVKIP GKGCGF
Sbjct  224   GYASNGSATHGSQSDGDSSNTTIFVGGLDSDVTDEELRQSFTQFGEVVSVKIPAGKGCGF  283

Query  525   VQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYG  367
             VQF++R+ A+EA+QKL G +IGKQ VRLSWGR+PA++Q R+D  N   G YYG
Sbjct  284   VQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGRSPANKQMRTDSGN--GGGYYG  334



>ref|XP_010926371.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Elaeis 
guineensis]
Length=791

 Score =   303 bits (776),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 159/240 (66%), Positives = 191/240 (80%), Gaps = 9/240 (4%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW++FSMG+KRS+ +SD S+FVGDLA+DVTD +L +TF S+Y SVK AKVVIDANTGRSK
Sbjct  498   NWASFSMGDKRSDASSDHSLFVGDLASDVTDAILQETFASRYSSVKGAKVVIDANTGRSK  557

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDNE++ A+TEMNGV+CS+RPMR+G ATPRK SG            N + A 
Sbjct  558   GYGFVRFGDDNEKTHAMTEMNGVFCSTRPMRLGLATPRKCSGGFGS--------NCASAQ  609

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
               QS+GD +NTT+FVGGLDPNVS+EDL+Q FSQYGE+ SVKIPVGK CGFVQF +R +AE
Sbjct  610   SFQSNGDPTNTTVFVGGLDPNVSEEDLKQAFSQYGELASVKIPVGKQCGFVQFVHRNNAE  669

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EALQ+L G  IGKQ VRLSWGRNP ++Q R+D  + W GAYYGG  Y+GY Y  PA H+P
Sbjct  670   EALQQLNGTAIGKQVVRLSWGRNPTNKQLRTDPGSHWNGAYYGGQVYNGYGYVLPA-HDP  728



>ref|XP_009390905.1| PREDICTED: polyadenylate-binding protein RBP47-like [Musa acuminata 
subsp. malaccensis]
Length=403

 Score =   292 bits (748),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 156/244 (64%), Positives = 195/244 (80%), Gaps = 11/244 (5%)
 Frame = -2

Query  1047  PAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANT  868
             P   NW++FSMG+K S+ ASD SIFVGDLA+DVTDT+L +TFV+KY SVK AKVV+DA+T
Sbjct  150   PYRLNWASFSMGDKHSDLASDHSIFVGDLASDVTDTILQETFVTKYSSVKGAKVVVDAHT  209

Query  867   GRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNG  688
             GRSKGYGFVRFGD+NE+  A+TEMNGVYCS+RPMR+G ATP++ SG            NG
Sbjct  210   GRSKGYGFVRFGDENEKKLAITEMNGVYCSTRPMRVGLATPKRFSGGFGP--------NG  261

Query  687   SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  508
             + A GSQ+D DS+NTT+FVGGLDP+V+++DL++ FS+YGE+ SVKIPVGK CGFV F +R
Sbjct  262   ASAAGSQTDMDSANTTVFVGGLDPDVNEDDLKEAFSRYGEVASVKIPVGKQCGFVLFVHR  321

Query  507   TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPA  328
              +AEEA+Q+L G +IGKQTVRLSWGRNPA +QSR++   +W GAYYGG  YDGY+     
Sbjct  322   NNAEEAMQQLNGTIIGKQTVRLSWGRNPAKKQSRAERGKRWNGAYYGGQVYDGYSL---P  378

Query  327   PHNP  316
             PH P
Sbjct  379   PHYP  382



>ref|XP_006660711.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=344

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 190/247 (77%), Gaps = 13/247 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLA+DV DT LL+TF  +Y SVK AKVVIDAN
Sbjct  88    QPFRINWASFSMGDRRSDIASDHSIFVGDLASDVNDTTLLETFSKRYSSVKGAKVVIDAN  147

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNE++ A+TEMNG+YCS+RPMRIG ATPRK+SG            +
Sbjct  148   TGRSKGYGFVRFGDDNEKTHAMTEMNGLYCSTRPMRIGPATPRKTSGT-----------S  196

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G     ++SDGD +NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK CGFVQF  
Sbjct  197   GPTGSSARSDGDLTNTTVFVGGLDPNVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFIQ  256

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTYA  337
             R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  +QW  G YY    FY GY Y 
Sbjct  257   RKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGSQWNNGMYYAASPFYSGYGYP  316

Query  336   FPAPHNP  316
              P P +P
Sbjct  317   APFPADP  323


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/163 (27%), Positives = 72/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V A KV+ +  TG+S+GYGFV F       + L    G     + +P RI  A       
Sbjct  43   VVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKVLEGFAGHIMPNTDQPFRINWA-------  95

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+D  L + FS+ Y  +   K
Sbjct  96   --------------SFSMGDRRSDIASDHSIFVGDLASDVNDTTLLETFSKRYSSVKGAK  141

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ GL    + +R+
Sbjct  142  VVIDANTGRSKGYGFVRFGDDNEKTHAMTEMNGLYCSTRPMRI  184



>gb|EEC84714.1| hypothetical protein OsI_31675 [Oryza sativa Indica Group]
Length=377

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 190/247 (77%), Gaps = 13/247 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLA+DV DT LL+TF  +Y SVK AKVVIDAN
Sbjct  122   QPFRINWASFSMGDRRSDIASDHSIFVGDLASDVNDTTLLETFSKRYSSVKGAKVVIDAN  181

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNE++ A+TEMNGVYCS+RPMRIG ATPRK+SG            +
Sbjct  182   TGRSKGYGFVRFGDDNEKTHAMTEMNGVYCSTRPMRIGPATPRKTSGT-----------S  230

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G     ++SDGD +NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK CGFVQF  
Sbjct  231   GPTGSAARSDGDLTNTTVFVGGLDPNVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFVQ  290

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTYA  337
             R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  +QW  G +Y    FY GY Y 
Sbjct  291   RKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGSQWNNGMFYAASPFYSGYGYP  350

Query  336   FPAPHNP  316
              P P +P
Sbjct  351   APFPADP  357


 Score = 51.2 bits (121),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 72/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V A KV+ +  TG+S+GYGFV F       + L    G     + +P RI  A       
Sbjct  77   VVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKVLEGFAGHIMPNTDQPFRINWA-------  129

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+D  L + FS+ Y  +   K
Sbjct  130  --------------SFSMGDRRSDIASDHSIFVGDLASDVNDTTLLETFSKRYSSVKGAK  175

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  176  VVIDANTGRSKGYGFVRFGDDNEKTHAMTEMNGVYCSTRPMRI  218



>ref|XP_010525621.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Tarenaya 
hassleriana]
Length=434

 Score =   292 bits (747),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 189/262 (72%), Positives = 210/262 (80%), Gaps = 7/262 (3%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW++FS GEKR  +  DLSIFVGDLA DVTD LL +TF  KYPSVKAAKVVID NTGRSK
Sbjct  180   NWASFSTGEKRLESGPDLSIFVGDLAPDVTDKLLHETFSVKYPSVKAAKVVIDVNTGRSK  239

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDNER++A+TEMNGV CS+R MRIG ATPRKS+GYQQ         NG+  H
Sbjct  240   GYGFVRFGDDNERAKAITEMNGVNCSNRAMRIGPATPRKSNGYQQGGYTL----NGAQGH  295

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
                 DGDS NTTIFVGGLDPNV+DEDLRQPF+ YG+IVSVKIP GKGCGFVQF NRT AE
Sbjct  296   ---PDGDSLNTTIFVGGLDPNVTDEDLRQPFADYGDIVSVKIPTGKGCGFVQFVNRTSAE  352

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EAL KL G+VIGKQTVRLSWGR+PA++Q R +F NQW G YYGG +Y+GY Y  P PH+P
Sbjct  353   EALDKLNGVVIGKQTVRLSWGRSPANKQVRGEFGNQWVGPYYGGQYYNGYGYMIPPPHDP  412

Query  315   NmyapaaygaypmyGTHQQQVS  250
              MY  A YGAYPMYG  QQQVS
Sbjct  413   IMYTAAPYGAYPMYGGDQQQVS  434



>ref|XP_012089580.1| PREDICTED: polyadenylate-binding protein RBP47-like [Jatropha 
curcas]
 gb|KDP23018.1| hypothetical protein JCGZ_01681 [Jatropha curcas]
Length=429

 Score =   291 bits (745),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 194/231 (84%), Gaps = 7/231 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++F+ G++R+++ SDLSIFVGDLA DVTD++L +TF SKY SVK AKVV D N
Sbjct  168   QPFRLNWASFA-GDRRADSGSDLSIFVGDLATDVTDSMLQETFASKYSSVKGAKVVTDLN  226

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS-  694
             TGRSKGYGFVRFGD+NERS+A++EMNGVYCSSRPMRIG ATP+KSS YQQQ+++Q     
Sbjct  227   TGRSKGYGFVRFGDENERSRAMSEMNGVYCSSRPMRIGVATPKKSSAYQQQYSSQALVLA  286

Query  693   -----NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
                  NG+ A GSQSDGDS+NTTIFVGG+D ++SDEDLRQPFSQ+GE+VSVKIPVGKGCG
Sbjct  287   GGHAPNGAIAQGSQSDGDSNNTTIFVGGIDSDISDEDLRQPFSQFGEVVSVKIPVGKGCG  346

Query  528   FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGA  376
             FVQFANR +AE+ALQ L G  IGKQTVRLSWGR+PA++Q R D  +QW GA
Sbjct  347   FVQFANRKNAEDALQSLNGTTIGKQTVRLSWGRSPANKQWRGDHHSQWNGA  397


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 70/163 (43%), Gaps = 31/163 (19%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V   KV+ +  TG+S+GYGFV F       + L   NG     + +P R+          
Sbjct  123  VSTVKVIRNKQTGQSEGYGFVEFHSHATAEKVLQNYNGSVMPNTEQPFRL----------  172

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                        N +   G +     S+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  173  ------------NWASFAGDRRADSGSDLSIFVGDLATDVTDSMLQETFASKYSSVKGAK  220

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            +         KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  221  VVTDLNTGRSKGYGFVRFGDENERSRAMSEMNGVYCSSRPMRI  263



>ref|XP_011088289.1| PREDICTED: polyadenylate-binding protein RBP47 [Sesamum indicum]
Length=423

 Score =   291 bits (744),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 161/246 (65%), Positives = 192/246 (78%), Gaps = 3/246 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS G++R    SDLSIFVGDLA DVTDTLL DTF S++PSVK AKVV+DAN
Sbjct  163   QPFRLNWAAFSSGDRRPEAGSDLSIFVGDLATDVTDTLLHDTFASRFPSVKGAKVVVDAN  222

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             +GRSKGYGFVRFGD+NERS+A+TEMNGVYCSSRPMRIG ATP+K S  QQ  +     + 
Sbjct  223   SGRSKGYGFVRFGDENERSRAMTEMNGVYCSSRPMRIGVATPKKPSPQQQYSSQAVVLAG  282

Query  690   GSP---AHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  520
             G P       QS+ DSSNTTIFVGGLD +V+DE+LRQ FS +G++VSVKIP GKGCGFVQ
Sbjct  283   GYPNGIVPQGQSENDSSNTTIFVGGLDSDVTDEELRQSFSPFGDVVSVKIPAGKGCGFVQ  342

Query  519   FANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
             FANR++AE+A+Q+L G VIGKQTVRLSWGRN  ++QSR D  +QW GAYYG   Y+GY Y
Sbjct  343   FANRSNAEDAIQRLNGTVIGKQTVRLSWGRNMGNKQSRVDPNSQWNGAYYGRQGYNGYGY  402

Query  339   AFPAPH  322
                A +
Sbjct  403   GAVAAY  408



>gb|KHN31058.1| Polyadenylate-binding protein RBP47 [Glycine soja]
Length=266

 Score =   285 bits (729),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 188/240 (78%), Gaps = 11/240 (5%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNA-SDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW+TFS GE+RS++A SDLSIFVGDLA DVTD +L +TF  +Y S+K AKVVID+NTGRS
Sbjct  12    NWATFSAGERRSSDATSDLSIFVGDLAIDVTDAMLQETFAGRYSSIKGAKVVIDSNTGRS  71

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKss------gyqqqfaaqggy  697
             KGYGFVRFGD+NER++A+TEMNGVYCSSRPMRIG ATP+K+         Q    A G  
Sbjct  72    KGYGFVRFGDENERTRAMTEMNGVYCSSRPMRIGVATPKKTYGYQQQYSSQAVLLAGGHA  131

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             +NG+ A GS S+GD +NTTIFVGGLD + SDEDLRQPF Q+GE+VSVKIPVGKGCGFVQF
Sbjct  132   ANGAVAQGSHSEGDLNNTTIFVGGLDSDTSDEDLRQPFLQFGEVVSVKIPVGKGCGFVQF  191

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
             A+R +AEEA+  L G VIGKQTVRLSWGR+P ++  RSD      G Y+GG  Y G+ +A
Sbjct  192   ADRKNAEEAIHALNGTVIGKQTVRLSWGRSPGNKHWRSDSN----GGYFGGQSYGGHGFA  247



>ref|XP_010539063.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010539064.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X2 [Tarenaya hassleriana]
Length=426

 Score =   290 bits (743),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 195/242 (81%), Gaps = 11/242 (5%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW++FS GEKR  N  DLSIFVGDLA DVTD +L +TF  KYPSVKAAKVVIDANTGRSK
Sbjct  171   NWASFSTGEKRLENGPDLSIFVGDLAPDVTDKMLHETFCVKYPSVKAAKVVIDANTGRSK  230

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDNER++A+TEMNG  CSSR MRIG ATP+KS+ YQ           G  ++
Sbjct  231   GYGFVRFGDDNERTKAMTEMNGAKCSSRSMRIGPATPKKSTSYQH---------GGYMSN  281

Query  675   GSQS--DGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTD  502
             G+Q   +GDS NTTIFVGGLDP+V+DEDLRQPF++YG+I+SVKIP GKGCGFVQF NRT 
Sbjct  282   GAQCRPEGDSLNTTIFVGGLDPSVTDEDLRQPFAEYGDIISVKIPSGKGCGFVQFVNRTS  341

Query  501   AEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPH  322
             AEEAL+KL G VIG+QTVRLSWGRNPA++Q R +F NQW G YYGG +Y+GY Y  P PH
Sbjct  342   AEEALEKLNGSVIGQQTVRLSWGRNPANKQHRGEFRNQWVGPYYGGEYYNGYGYMIPPPH  401

Query  321   NP  316
             +P
Sbjct  402   DP  403



>ref|NP_001063403.1| Os09g0462700 [Oryza sativa Japonica Group]
 dbj|BAF25317.1| Os09g0462700, partial [Oryza sativa Japonica Group]
Length=441

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 163/247 (66%), Positives = 190/247 (77%), Gaps = 13/247 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLA+DV DT LL+TF  +Y SVK AKVVIDAN
Sbjct  186   QPFRINWASFSMGDRRSDIASDHSIFVGDLASDVNDTTLLETFSKRYSSVKGAKVVIDAN  245

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNE++ A+TEMNGVYCS+RPMRIG ATPRK+SG            +
Sbjct  246   TGRSKGYGFVRFGDDNEKTHAMTEMNGVYCSTRPMRIGPATPRKTSGT-----------S  294

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G     ++SDGD +NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK CGFVQF  
Sbjct  295   GPTGSAARSDGDLTNTTVFVGGLDPNVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFVQ  354

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTYA  337
             R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  +QW  G YY    FY GY Y 
Sbjct  355   RKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGSQWNNGMYYAASPFYSGYGYP  414

Query  336   FPAPHNP  316
              P P +P
Sbjct  415   APFPADP  421


 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 72/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V A KV+ +  TG+S+GYGFV F       + L    G     + +P RI  A       
Sbjct  141  VVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKVLEGFAGHIMPNTDQPFRINWA-------  193

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+D  L + FS+ Y  +   K
Sbjct  194  --------------SFSMGDRRSDIASDHSIFVGDLASDVNDTTLLETFSKRYSSVKGAK  239

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  240  VVIDANTGRSKGYGFVRFGDDNEKTHAMTEMNGVYCSTRPMRI  282



>ref|XP_008236618.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Prunus mume]
Length=446

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 191/225 (85%), Gaps = 3/225 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS+G++R++ +SDLSIFVGDLA DVTDT+L +TF S+Y SVK AKVV+DAN
Sbjct  187   QPFRLNWATFSVGDRRADTSSDLSIFVGDLATDVTDTMLQETFGSRYSSVKGAKVVLDAN  246

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg---g  700
             TGRSKGYGFVRFGD+NERS+A+TEMNG YCSSRPMRIG ATP+KS  YQQQ+++Q     
Sbjct  247   TGRSKGYGFVRFGDENERSRAITEMNGAYCSSRPMRIGVATPKKSPAYQQQYSSQAGGGH  306

Query  699   ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  520
              SNG+ A GSQ D +++NTTIFVGGLD +V+DEDLRQPFSQ+GE+VSVKIPVGK CGFVQ
Sbjct  307   ASNGAVAQGSQFDSETNNTTIFVGGLDSDVNDEDLRQPFSQFGEVVSVKIPVGKACGFVQ  366

Query  519   FANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             FANR DAE A+Q L G VIGKQTVRLSWGR+  ++Q RSD +NQW
Sbjct  367   FANRKDAENAMQMLNGTVIGKQTVRLSWGRSQGNKQWRSDSSNQW  411


 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 86/197 (44%), Gaps = 40/197 (20%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V   KV+ +  T +S+GYGFV F       + L   NG     + +P R+  AT      
Sbjct  142  VSTVKVIRNKQTAQSEGYGFVEFFSREAAEEVLQSYNGAAMPNTEQPFRLNWAT------  195

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +    SS+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  196  ---------------FSVGDRRADTSSDLSIFVGDLATDVTDTMLQETFGSRYSSVKGAK  240

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG---RNPAHRQSRSD  400
            + +       KG GFV+F +  +   A+ ++ G     + +R+      ++PA++Q    
Sbjct  241  VVLDANTGRSKGYGFVRFGDENERSRAITEMNGAYCSSRPMRIGVATPKKSPAYQQ----  296

Query  399  FTNQWAGAYYGGHFYDG  349
               Q++    GGH  +G
Sbjct  297  ---QYSSQAGGGHASNG  310



>gb|KFK36144.1| hypothetical protein AALP_AA4G083000 [Arabis alpina]
Length=426

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 190/268 (71%), Positives = 212/268 (79%), Gaps = 7/268 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR  NN  DLSIFVGDLA DV+DTLL  TF  KYPSVK AKVVIDA
Sbjct  165   QPFRLNWASFSTGEKRLENNGPDLSIFVGDLAPDVSDTLLHTTFFEKYPSVKGAKVVIDA  224

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS  694
             NTGRSKGYGFVRFGDD ER++A+TEM+GV CSSR MRIG ATPRK++GYQQQ        
Sbjct  225   NTGRSKGYGFVRFGDDEERTKAMTEMHGVKCSSRAMRIGPATPRKTTGYQQQGGYMP---  281

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+ A   + +GDS NTTIFVGGLD  VSDEDLRQPF+ YGEIVSVKIPVGKGCGFVQF 
Sbjct  282   NGALA---RPEGDSLNTTIFVGGLDSTVSDEDLRQPFANYGEIVSVKIPVGKGCGFVQFV  338

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             +R DAEEAL+KL G VIGKQTVRLSWGRNP ++Q R  + NQWAG YYGG +Y+GY Y  
Sbjct  339   SRPDAEEALEKLNGTVIGKQTVRLSWGRNPGNKQPRDKYGNQWAGPYYGGQYYNGYGYMV  398

Query  333   PAPHNPNmyapaaygaypmyGTHQQQVS  250
             P PH+P MYA A YG Y MYG HQQQVS
Sbjct  399   PQPHDPRMYAAAPYGGYQMYGGHQQQVS  426


 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 93/198 (47%), Gaps = 31/198 (16%)
 Frame = -2

Query  1008  KRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYGFVRFGD  829
             + +NN  + +I+VGDL   + +  L  +F S    + + KV+ + +TG S+GYGFV FG 
Sbjct  87    QNANNGENKTIWVGDLHHWMDENYLNSSFASA--EITSVKVIRNKHTGLSEGYGFVEFGS  144

Query  828   DNERSQALTEMNG--VYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHGSQSDGD  655
              +   + L E NG  +  + +P R+  A+             +    N  P         
Sbjct  145   HDIADKVLEEFNGTTMLNTEQPFRLNWAS---------FSTGEKRLENNGP---------  186

Query  654   SSNTTIFVGGLDPNVSDEDLRQP-FSQYGEIVSVKIPV------GKGCGFVQFANRTDAE  496
               + +IFVG L P+VSD  L    F +Y  +   K+ +       KG GFV+F +  +  
Sbjct  187   --DLSIFVGDLAPDVSDTLLHTTFFEKYPSVKGAKVVIDANTGRSKGYGFVRFGDDEERT  244

Query  495   EALQKLKGLVIGKQTVRL  442
             +A+ ++ G+    + +R+
Sbjct  245   KAMTEMHGVKCSSRAMRI  262



>ref|NP_001275430.1| DNA-binding protein-like [Solanum tuberosum]
 gb|ABB86246.1| DNA-binding protein-like [Solanum tuberosum]
Length=423

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 191/243 (79%), Gaps = 6/243 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSN------NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAK  889
             +P   NWS FS GEKR++      + SDLSIFVGDLA+DVTDT+L DTF S+YPSVK AK
Sbjct  150   QPFRLNWSAFSTGEKRADVGAAAGSGSDLSIFVGDLASDVTDTMLRDTFSSRYPSVKGAK  209

Query  888   VVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaa  709
             VVID+NTGRSKGYGFVRF D++ERS+A+TEMNG+YCSSR MRIG ATP+K S  QQ  + 
Sbjct  210   VVIDSNTGRSKGYGFVRFDDESERSRAMTEMNGIYCSSRAMRIGVATPKKPSAMQQYSSQ  269

Query  708   qggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
              G  SNG+    SQ+D D SNTT+FVGGLD +V+DE+LRQ FSQ+G +VSVKIP GKGCG
Sbjct  270   GGHASNGAATQTSQTDSDLSNTTVFVGGLDSDVTDEELRQSFSQFGNVVSVKIPAGKGCG  329

Query  528   FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  349
             FVQF+ R+ AE+A++KL G VIG QTVRLSWGRNPA++Q R+D  +QW G YYG   Y G
Sbjct  330   FVQFSERSAAEDAIEKLNGTVIGTQTVRLSWGRNPANKQFRTDSGSQWNGGYYGRQNYGG  389

Query  348   YTY  340
             Y Y
Sbjct  390   YGY  392


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 75/163 (46%), Gaps = 24/163 (15%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+ YGF+ F       + L   NG     + +P R+  +       
Sbjct  105  VISVKVIRNKQTGQSERYGFIEFNTHEAAEKVLQSYNGTMMPNAEQPFRLNWSA------  158

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                F+     ++   A GS SD      +IFVG L  +V+D  LR  F S+Y  +   K
Sbjct  159  ----FSTGEKRADVGAAAGSGSD-----LSIFVGDLASDVTDTMLRDTFSSRYPSVKGAK  209

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + ++   A+ ++ G+    + +R+
Sbjct  210  VVIDSNTGRSKGYGFVRFDDESERSRAMTEMNGIYCSSRAMRI  252



>gb|AAC49850.1| DNA binding protein ACBF [Nicotiana tabacum]
Length=428

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 190/242 (79%), Gaps = 6/242 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS GEKR+   SD SIFVGDLA+DVTDT+L DTF S+YPS+K AKVV+DAN
Sbjct  155   QPFRLNWAGFSTGEKRAETGSDFSIFVGDLASDVTDTMLRDTFASRYPSLKGAKVVVDAN  214

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg---  700
             TG SKGYGFVRFGD++ERS+A+TEMNGVYCSSR MRIG ATP+K S  QQ  +       
Sbjct  215   TGHSKGYGFVRFGDESERSRAMTEMNGVYCSSRAMRIGVATPKKPSAQQQYSSQAVILSG  274

Query  699   --ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGF  526
                SNG+  HGSQSDGD+SNTTIFVGGLD +V+DE+LRQ F+Q+GE+VSVKIP GKGCGF
Sbjct  275   GYASNGAATHGSQSDGDASNTTIFVGGLDSDVTDEELRQSFNQFGEVVSVKIPAGKGCGF  334

Query  525   VQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGY  346
             VQF++R+ A+EA+QKL G +IGKQ VRLSWGR  A++Q R+D  +QW G Y G   Y GY
Sbjct  335   VQFSDRSSAQEAIQKLSGAIIGKQAVRLSWGR-TANKQMRADSGSQWNGGYNGRQNYGGY  393

Query  345   TY  340
              Y
Sbjct  394   GY  395



>gb|ACF83065.1| unknown [Zea mays]
 tpg|DAA61809.1| TPA: hypothetical protein ZEAMMB73_995180 [Zea mays]
Length=320

 Score =   285 bits (730),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 187/246 (76%), Gaps = 15/246 (6%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS++ASD SIFVGDLA+DV D  LL+ F S+Y SVK AKVVIDAN
Sbjct  61    QPFRLNWASFSMGDRRSDSASDHSIFVGDLASDVNDATLLEAFSSRYSSVKGAKVVIDAN  120

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+E++QA+TEMNGVYCSSRPMRIG ATPRKSSG             
Sbjct  121   TGRSKGYGFVRFGDDSEKTQAMTEMNGVYCSSRPMRIGPATPRKSSGTSGSN--------  172

Query  690   GSPAHGSQSDG-DSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
                   ++SDG D +NTT+FVGGLDPNVS+EDLRQ FSQYGEI SVKIP+GK CGFVQFA
Sbjct  173   ---GSAARSDGGDLTNTTVFVGGLDPNVSEEDLRQTFSQYGEISSVKIPIGKQCGFVQFA  229

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW--AGAYYGG-HFYDGYT  343
              R +AE+ALQ L G  IGKQ VRLSWGRNPA++Q R D  NQW   G YY    FY+GY 
Sbjct  230   QRKNAEDALQGLNGSTIGKQNVRLSWGRNPANKQFRGDNGNQWNNGGMYYAAPPFYNGYG  289

Query  342   YAFPAP  325
             Y   AP
Sbjct  290   YPAAAP  295


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 75/163 (46%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V A KV+ +  TG+S+GYGFV F       + L   +G     + +P R+  A       
Sbjct  16   VVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKVLEGFSGHIMPNTDQPFRLNWA-------  68

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+D  L + F S+Y  +   K
Sbjct  69   --------------SFSMGDRRSDSASDHSIFVGDLASDVNDATLLEAFSSRYSSVKGAK  114

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + ++  +A+ ++ G+    + +R+
Sbjct  115  VVIDANTGRSKGYGFVRFGDDSEKTQAMTEMNGVYCSSRPMRI  157



>ref|XP_008236617.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Prunus mume]
Length=450

 Score =   289 bits (740),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 191/229 (83%), Gaps = 7/229 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS+G++R++ +SDLSIFVGDLA DVTDT+L +TF S+Y SVK AKVV+DAN
Sbjct  187   QPFRLNWATFSVGDRRADTSSDLSIFVGDLATDVTDTMLQETFGSRYSSVKGAKVVLDAN  246

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg----  703
             TGRSKGYGFVRFGD+NERS+A+TEMNG YCSSRPMRIG ATP+KS  YQQQ+++Q     
Sbjct  247   TGRSKGYGFVRFGDENERSRAITEMNGAYCSSRPMRIGVATPKKSPAYQQQYSSQALVLA  306

Query  702   ---gySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  SNG+ A GSQ D +++NTTIFVGGLD +V+DEDLRQPFSQ+GE+VSVKIPVGK C
Sbjct  307   GGGHASNGAVAQGSQFDSETNNTTIFVGGLDSDVNDEDLRQPFSQFGEVVSVKIPVGKAC  366

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             GFVQFANR DAE A+Q L G VIGKQTVRLSWGR+  ++Q RSD +NQW
Sbjct  367   GFVQFANRKDAENAMQMLNGTVIGKQTVRLSWGRSQGNKQWRSDSSNQW  415


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 86/197 (44%), Gaps = 36/197 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V   KV+ +  T +S+GYGFV F       + L   NG     + +P R+  AT      
Sbjct  142  VSTVKVIRNKQTAQSEGYGFVEFFSREAAEEVLQSYNGAAMPNTEQPFRLNWAT------  195

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +    SS+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  196  ---------------FSVGDRRADTSSDLSIFVGDLATDVTDTMLQETFGSRYSSVKGAK  240

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG---RNPAHRQSRSD  400
            + +       KG GFV+F +  +   A+ ++ G     + +R+      ++PA++Q  S 
Sbjct  241  VVLDANTGRSKGYGFVRFGDENERSRAITEMNGAYCSSRPMRIGVATPKKSPAYQQQYSS  300

Query  399  FTNQWAGAYYGGHFYDG  349
                 AG   GGH  +G
Sbjct  301  QALVLAG---GGHASNG  314



>ref|XP_010540323.1| PREDICTED: polyadenylate-binding protein RBP47B [Tarenaya hassleriana]
Length=410

 Score =   288 bits (736),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 167/254 (66%), Positives = 202/254 (80%), Gaps = 13/254 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR S N SDLSIFVGDLA DVTDTLLL+TF S YPSVK AKVVID+
Sbjct  151   QPFRLNWASFSTGEKRVSENGSDLSIFVGDLAPDVTDTLLLETFASGYPSVKGAKVVIDS  210

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy-  697
              TGRSKGYGFVRFGD++ERS+A+TEMNGV CSSR MRIG ATP++++ +QQQ+++Q    
Sbjct  211   TTGRSKGYGFVRFGDESERSRAMTEMNGVLCSSRQMRIGIATPKRAASHQQQYSSQAVIL  270

Query  696   -----SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  +NGS  HGSQ DG++ N+TIFVGGLD  V+DEDLRQPFSQ+GE+VSVKIP+GKGC
Sbjct  271   AGGHGANGSIPHGSQFDGETINSTIFVGGLDAEVTDEDLRQPFSQFGEVVSVKIPLGKGC  330

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFY-  355
             GF+Q +NR +AEEA+QKL G VIGK TVRLSWGRNP ++Q RSD ++QW G Y  G  + 
Sbjct  331   GFIQLSNRKNAEEAIQKLNGTVIGKNTVRLSWGRNPGNKQWRSDTSHQWNGGYARGQGFN  390

Query  354   --DGYT---YAFPA  328
               +GYT   YA PA
Sbjct  391   NGNGYTNQDYASPA  404


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 81/187 (43%), Gaps = 28/187 (15%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyq  724
            V + KV+ +  T +S+GYGFV F       + L   NG      PM   A  P + +   
Sbjct  106  VSSVKVIRNKQTCQSEGYGFVEFSSRAAAEEVLQNYNG-----SPMP-NADQPFRLNWAS  159

Query  723  qqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVKIP  547
                 +    NG            S+ +IFVG L P+V+D  L + F S Y  +   K+ 
Sbjct  160  FSTGEKRVSENG------------SDLSIFVGDLAPDVTDTLLLETFASGYPSVKGAKVV  207

Query  546  V------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG---RNPAHRQSRSDFT  394
            +       KG GFV+F + ++   A+ ++ G++   + +R+      R  +H+Q  S   
Sbjct  208  IDSTTGRSKGYGFVRFGDESERSRAMTEMNGVLCSSRQMRIGIATPKRAASHQQQYSSQA  267

Query  393  NQWAGAY  373
               AG +
Sbjct  268  VILAGGH  274



>ref|XP_007199852.1| hypothetical protein PRUPE_ppa005661mg [Prunus persica]
 gb|EMJ01051.1| hypothetical protein PRUPE_ppa005661mg [Prunus persica]
Length=449

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 190/229 (83%), Gaps = 7/229 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G++R++ +SDLSIFVGDLA DVTDT+L +TF S+Y SVK AKVV+DAN
Sbjct  186   QPFRLNWATFSAGDRRADTSSDLSIFVGDLATDVTDTMLQETFGSRYSSVKGAKVVLDAN  245

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg----  703
             TGRSKGYGFVRFGD+NERS+A+TEMNG YCSSRPMRIG ATP+KS  YQQQ+++Q     
Sbjct  246   TGRSKGYGFVRFGDENERSRAITEMNGAYCSSRPMRIGVATPKKSPAYQQQYSSQALVLA  305

Query  702   ---gySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  SNG+ A GSQ D +++NTTIFVGGLD +V+DEDLRQPFSQ+GE+VSVKIPVGK C
Sbjct  306   GGGHASNGAVAQGSQFDSETNNTTIFVGGLDSDVNDEDLRQPFSQFGEVVSVKIPVGKAC  365

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             GFVQFANR DAE A+Q L G VIGKQTVRLSWGR+  ++Q RSD +NQW
Sbjct  366   GFVQFANRKDAENAMQMLNGTVIGKQTVRLSWGRSQGNKQWRSDSSNQW  414


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 86/197 (44%), Gaps = 36/197 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V   KV+ +  T +S+GYGFV F       + L   NG     + +P R+  AT      
Sbjct  141  VSTVKVIRNKQTAQSEGYGFVEFFSREAAEEVLQSYNGAAMPNTEQPFRLNWAT------  194

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +    SS+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  195  ---------------FSAGDRRADTSSDLSIFVGDLATDVTDTMLQETFGSRYSSVKGAK  239

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG---RNPAHRQSRSD  400
            + +       KG GFV+F +  +   A+ ++ G     + +R+      ++PA++Q  S 
Sbjct  240  VVLDANTGRSKGYGFVRFGDENERSRAITEMNGAYCSSRPMRIGVATPKKSPAYQQQYSS  299

Query  399  FTNQWAGAYYGGHFYDG  349
                 AG   GGH  +G
Sbjct  300  QALVLAG---GGHASNG  313



>ref|XP_010327390.1| PREDICTED: DNA-binding protein isoform X2 [Solanum lycopersicum]
Length=423

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 160/243 (66%), Positives = 191/243 (79%), Gaps = 6/243 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSN------NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAK  889
             +P   NWS FS GEKR++      + SDLSIFVGDLA+DVTDT+L DTF S+YPSVK AK
Sbjct  150   QPFRLNWSAFSSGEKRADVGAGAGSGSDLSIFVGDLASDVTDTMLRDTFSSRYPSVKGAK  209

Query  888   VVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaa  709
             VVID+NTGRSKGYGFVRF D++ERS+A+TEMNG+YCSSR MRIG ATP+K S  QQ F+ 
Sbjct  210   VVIDSNTGRSKGYGFVRFDDESERSRAMTEMNGIYCSSRAMRIGVATPKKPSPMQQYFSQ  269

Query  708   qggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
              G  SNG+    SQ+D D SNTT+FVGGLD  V+DE+LRQ FSQ+G +VSVKIP GKGCG
Sbjct  270   GGHASNGAATQTSQTDSDLSNTTVFVGGLDSEVTDEELRQSFSQFGNVVSVKIPAGKGCG  329

Query  528   FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDG  349
             FVQF+ R+ AE+A++KL G VIG QTVRLSWGRNPA++Q R+D  +QW G YYG   Y G
Sbjct  330   FVQFSERSAAEDAIEKLNGTVIGAQTVRLSWGRNPANKQFRTDSGSQWNGGYYGRQNYGG  389

Query  348   YTY  340
             Y Y
Sbjct  390   YGY  392



>ref|XP_006349628.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Solanum 
tuberosum]
Length=424

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 159/244 (65%), Positives = 191/244 (78%), Gaps = 7/244 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSN------NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAK  889
             +P   NWS FS GEKR++      + SDLSIFVGDLA+DVTDT+L DTF S+YPSVK AK
Sbjct  150   QPFRLNWSAFSTGEKRADVGAAAGSGSDLSIFVGDLASDVTDTMLRDTFSSRYPSVKGAK  209

Query  888   VVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRK-ssgyqqqfa  712
             VVID+NTGRSKGYGFVRF D++ERS+A+TEMNG+YCSSR MRIG ATP+K S+  Q    
Sbjct  210   VVIDSNTGRSKGYGFVRFDDESERSRAMTEMNGIYCSSRAMRIGVATPKKPSAMQQYSSQ  269

Query  711   aqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
             A G  SNG+    SQ+D D SNTT+FVGGLD +V+DE+LRQ FSQ+G +VSVKIP GKGC
Sbjct  270   AGGHASNGAATQTSQTDSDLSNTTVFVGGLDSDVTDEELRQSFSQFGNVVSVKIPAGKGC  329

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
             GFVQF+ R+ AE+A++KL G VIG QTVRLSWGRNPA++Q R+D  +QW G YYG   Y 
Sbjct  330   GFVQFSERSAAEDAIEKLNGTVIGTQTVRLSWGRNPANKQFRTDSGSQWNGGYYGRQNYG  389

Query  351   GYTY  340
             GY Y
Sbjct  390   GYGY  393


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 75/163 (46%), Gaps = 24/163 (15%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+ YGF+ F       + L   NG     + +P R+  +       
Sbjct  105  VISVKVIRNKQTGQSERYGFIEFNTHEAAEKVLQSYNGTMMPNAEQPFRLNWSA------  158

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                F+     ++   A GS SD      +IFVG L  +V+D  LR  F S+Y  +   K
Sbjct  159  ----FSTGEKRADVGAAAGSGSD-----LSIFVGDLASDVTDTMLRDTFSSRYPSVKGAK  209

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + ++   A+ ++ G+    + +R+
Sbjct  210  VVIDSNTGRSKGYGFVRFDDESERSRAMTEMNGIYCSSRAMRI  252



>ref|XP_002518798.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF43723.1| nuclear acid binding protein, putative [Ricinus communis]
Length=438

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 186/228 (82%), Gaps = 7/228 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++F+ GE+R+   SDLSIFVGDLAADVTD +L +TF SKY SVK AKVV D N
Sbjct  177   QPFRLNWASFA-GERRTETGSDLSIFVGDLAADVTDAMLQETFSSKYLSVKGAKVVTDLN  235

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS-  694
             TGRSKGYGFVRFGD+NERS+A+ EMNGVYCSSRPMRIG ATP+KS  YQQQ+++Q     
Sbjct  236   TGRSKGYGFVRFGDENERSRAMMEMNGVYCSSRPMRIGVATPKKSPAYQQQYSSQALVLA  295

Query  693   -----NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
                  NGS A GSQSDGDS+NTTIFVGG+D ++SDEDLRQPFSQ+GE+VSVKIP GKGCG
Sbjct  296   GGHAPNGSMAQGSQSDGDSNNTTIFVGGIDSDISDEDLRQPFSQFGEVVSVKIPAGKGCG  355

Query  528   FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             FVQFA+R  AE+ALQ L G  IGKQTVRLSWGR+PA++Q R D  NQW
Sbjct  356   FVQFADRKSAEDALQSLNGTTIGKQTVRLSWGRSPANKQWRGDHNNQW  403


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 78/179 (44%), Gaps = 34/179 (19%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+ +GYGF+ F       + L   NG     + +P R+          
Sbjct  132  VTSVKVIRNKQTGQPEGYGFIEFYSHATAEKVLQNYNGSMMPNADQPFRL----------  181

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                        N +   G +     S+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  182  ------------NWASFAGERRTETGSDLSIFVGDLAADVTDAMLQETFSSKYLSVKGAK  229

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG---RNPAHRQSRS  403
            +         KG GFV+F +  +   A+ ++ G+    + +R+      ++PA++Q  S
Sbjct  230  VVTDLNTGRSKGYGFVRFGDENERSRAMMEMNGVYCSSRPMRIGVATPKKSPAYQQQYS  288



>gb|EMS62393.1| Uncharacterized RNA-binding protein C23E6.01c [Triticum urartu]
Length=384

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 171/269 (64%), Positives = 199/269 (74%), Gaps = 15/269 (6%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLA+DV DT LL+TF S+Y SVK AKVVIDAN
Sbjct  129   QPFRINWASFSMGDRRSDIASDHSIFVGDLASDVNDTALLETFSSRYSSVKGAKVVIDAN  188

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+E++ A+TEMNGVYCS+RPMRIG ATPRKSSG             
Sbjct  189   TGRSKGYGFVRFGDDSEKTNAMTEMNGVYCSTRPMRIGPATPRKSSGTSG----------  238

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
              S    ++SDGD +NTT+FVGGLDPNVS++DL+Q FSQYGEI SVKIPVGK CGFVQF  
Sbjct  239   -STGSSARSDGDLTNTTVFVGGLDPNVSEDDLKQTFSQYGEISSVKIPVGKQCGFVQFLQ  297

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYG-GHFYDGYTYA  337
             R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  NQW  G YY    FY+GY Y 
Sbjct  298   RKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGNQWNNGMYYAPSPFYNGYGY-  356

Query  336   FPAPHNPNmyapaaygaypmyGTHQQQVS  250
              PA   P+    AA         +QQQVS
Sbjct  357   -PAAPFPDPGMYAAAYGAYPVYGNQQQVS  384


 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V A KV+ +  TG+S+GYGFV F       + L    G     + +P RI  A       
Sbjct  84   VVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKVLDGFAGHIMPNTDQPFRINWA-------  136

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+D  L + F S+Y  +   K
Sbjct  137  --------------SFSMGDRRSDIASDHSIFVGDLASDVNDTALLETFSSRYSSVKGAK  182

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + ++   A+ ++ G+    + +R+
Sbjct  183  VVIDANTGRSKGYGFVRFGDDSEKTNAMTEMNGVYCSTRPMRI  225



>ref|XP_002313840.2| RNA-binding protein 47 [Populus trichocarpa]
 gb|EEE87795.2| RNA-binding protein 47 [Populus trichocarpa]
Length=435

 Score =   286 bits (733),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 190/231 (82%), Gaps = 7/231 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++F+ GE+R++  SDLSIFVGDLAADVTD +L +TF +KY SVK AKVV D+N
Sbjct  174   QPFRLNWASFA-GERRADAGSDLSIFVGDLAADVTDAMLQETFATKYASVKGAKVVADSN  232

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg----  703
             TGRSKGYGFVRFGD+NE+++A+TEMNG YCSSRPMRIG ATP+K S YQQQ+++Q     
Sbjct  233   TGRSKGYGFVRFGDENEKTRAITEMNGAYCSSRPMRIGVATPKKPSAYQQQYSSQALVLA  292

Query  702   --gySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
                 SNG+ A GSQSDGDS+NTTIFVGG+D +V+DEDLRQPFSQ+GE+VSVK+P GKGC 
Sbjct  293   GGHASNGTMAQGSQSDGDSNNTTIFVGGIDSDVTDEDLRQPFSQFGEVVSVKMPTGKGCA  352

Query  528   FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGA  376
             FVQFANR +AE+ALQ L G  IGKQTVRLSWGR PA++Q R D  NQW GA
Sbjct  353   FVQFANRKNAEDALQSLNGTTIGKQTVRLSWGRTPANKQWRGDHGNQWHGA  403



>ref|XP_006307520.1| hypothetical protein CARUB_v10009143mg [Capsella rubella]
 gb|EOA40418.1| hypothetical protein CARUB_v10009143mg [Capsella rubella]
Length=443

 Score =   286 bits (733),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 184/268 (69%), Positives = 210/268 (78%), Gaps = 7/268 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR  NN  DLSIFVGDLA DV+D LL +TF  KYPSVKAAKVVIDA
Sbjct  182   QPFRLNWASFSTGEKRLENNGPDLSIFVGDLAPDVSDALLHETFSEKYPSVKAAKVVIDA  241

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS  694
             NTGRSKGYGFVRFGD+NER++A+TEMNGV CSSR MRIG ATPRK++GYQQQ        
Sbjct  242   NTGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRIGPATPRKTTGYQQQGGYMPNGP  301

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
                P      +GD+ NTTIFVGGLD +V+DEDLRQPF++YGEIVSVKIPVGKGCGFVQF 
Sbjct  302   MARP------EGDTLNTTIFVGGLDSSVTDEDLRQPFAEYGEIVSVKIPVGKGCGFVQFV  355

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             +R  AE+AL+KL G VIGKQTVRLSWGRNPA++Q R  + NQW   YYGG +Y+GY Y  
Sbjct  356   SRPSAEDALEKLNGTVIGKQTVRLSWGRNPANKQPRDKYGNQWVVPYYGGQYYNGYGYMA  415

Query  333   PAPHNPNmyapaaygaypmyGTHQQQVS  250
             P PH+P MY  A YG YPMYG HQQQVS
Sbjct  416   PQPHDPRMYPAAPYGGYPMYGGHQQQVS  443


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 77/163 (47%), Gaps = 29/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNG--VYCSSRPMRIGAATPRKssg  730
            + + KV+ + +TG S+GYGFV F   +   + L + NG  +  + +P R+  A+      
Sbjct  137  IVSVKVIRNKHTGLSEGYGFVEFESHDVADKVLQKFNGTTMLRTEQPFRLNWAS------  190

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVK  553
                   +    N  P           + +IFVG L P+VSD  L + FS+ Y  + + K
Sbjct  191  ---FSTGEKRLENNGP-----------DLSIFVGDLAPDVSDALLHETFSEKYPSVKAAK  236

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +  +A+ ++ G+    + +R+
Sbjct  237  VVIDANTGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI  279



>ref|XP_004957051.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Setaria 
italica]
Length=437

 Score =   286 bits (732),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 167/248 (67%), Positives = 190/248 (77%), Gaps = 17/248 (7%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLA+DV D  LL+TF S+Y SVK AKVVIDAN
Sbjct  180   QPFRLNWASFSMGDRRSDVASDHSIFVGDLASDVNDATLLETFSSRYSSVKGAKVVIDAN  239

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+E++ A+TEMNGVYCSSRPMRIG ATPRKSSG             
Sbjct  240   TGRSKGYGFVRFGDDSEKTHAMTEMNGVYCSSRPMRIGPATPRKSSGT-----------T  288

Query  690   GSPAHGSQSDG-DSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             GS    ++SDG D +NTT+FVGGLDPNVS+EDLRQ FSQYGEI SVKIPVGK CGFVQFA
Sbjct  289   GSNGSSARSDGGDLTNTTVFVGGLDPNVSEEDLRQTFSQYGEISSVKIPVGKQCGFVQFA  348

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTY  340
              R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q R D  NQW  G YY    FY+GY Y
Sbjct  349   QRKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQFRGDNGNQWNNGMYYAASPFYNGYGY  408

Query  339   ---AFPAP  325
                 FP P
Sbjct  409   PAAPFPDP  416


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 74/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V A KV+ +  TG+S+GYGFV F       + L   +G     + +P R+  A       
Sbjct  135  VVAIKVIRNKQTGQSEGYGFVEFYSHGAAEKVLEGFSGHIMPNTDQPFRLNWA-------  187

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+D  L + F S+Y  +   K
Sbjct  188  --------------SFSMGDRRSDVASDHSIFVGDLASDVNDATLLETFSSRYSSVKGAK  233

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + ++   A+ ++ G+    + +R+
Sbjct  234  VVIDANTGRSKGYGFVRFGDDSEKTHAMTEMNGVYCSSRPMRI  276



>ref|XP_006406535.1| hypothetical protein EUTSA_v10020763mg [Eutrema salsugineum]
 gb|ESQ47988.1| hypothetical protein EUTSA_v10020763mg [Eutrema salsugineum]
Length=436

 Score =   286 bits (732),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 159/245 (65%), Positives = 194/245 (79%), Gaps = 8/245 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR+  N  +LSIFVGDL+ DVTDTLL + FV KYPSVK+AKVVID+
Sbjct  181   QPFRLNWASFSTGEKRAVENGPELSIFVGDLSPDVTDTLLQELFVEKYPSVKSAKVVIDS  240

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy-  697
             NTGRSKGYGFVRFGD+NERS+AL EMNG +CS+R MR+G ATP+++   QQQ ++Q    
Sbjct  241   NTGRSKGYGFVRFGDENERSRALIEMNGAFCSNRQMRVGIATPKRAVANQQQHSSQALIL  300

Query  696   -----SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  +NGS AHGSQ+DG+S+N+TIFVGGLDP+V+DEDLRQPFSQ+GE+VSVKIPVGKGC
Sbjct  301   AGGHGANGSMAHGSQTDGESNNSTIFVGGLDPDVTDEDLRQPFSQFGEVVSVKIPVGKGC  360

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
             GFVQFANR  A++A+Q L G VIGK TVRLSWGR+P ++Q R D   QW G Y  G  Y+
Sbjct  361   GFVQFANRKSADDAIQSLNGTVIGKNTVRLSWGRSP-NKQWRGDSGQQWNGGYSRGQGYN  419

Query  351   GYTYA  337
                YA
Sbjct  420   NGGYA  424



>ref|XP_006384437.1| hypothetical protein POPTR_0004s15080g [Populus trichocarpa]
 gb|ERP62234.1| hypothetical protein POPTR_0004s15080g [Populus trichocarpa]
Length=435

 Score =   286 bits (731),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 158/228 (69%), Positives = 190/228 (83%), Gaps = 7/228 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++F+ GE+R++  SDLSIFVGDLAADVTD++L +TF  KYPSVK AKVVID+N
Sbjct  174   QPFRLNWASFA-GERRADPGSDLSIFVGDLAADVTDSMLQETFAGKYPSVKGAKVVIDSN  232

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg----  703
             TGRSKGYGFVRFGD+NE+++A+ EMNG +CSSRPMRIG ATP+K S YQQQ+++Q     
Sbjct  233   TGRSKGYGFVRFGDENEKTRAMMEMNGAFCSSRPMRIGVATPKKPSAYQQQYSSQALVLA  292

Query  702   --gySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
                 SNG+ A GSQSDGDS+NTTIFVGG+D +V+DEDLRQPFSQ+GE+VSVKIPVGKGC 
Sbjct  293   GGHASNGAMAQGSQSDGDSNNTTIFVGGIDSDVTDEDLRQPFSQFGEVVSVKIPVGKGCA  352

Query  528   FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             FVQFANR +AE+ALQ L G  IGKQTVRLSWGR PA++Q R D  NQW
Sbjct  353   FVQFANRKNAEDALQSLNGTTIGKQTVRLSWGRTPANKQWRGDHGNQW  400



>gb|EEE61093.1| hypothetical protein OsJ_14988 [Oryza sativa Japonica Group]
Length=373

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 192/246 (78%), Gaps = 13/246 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+++SMGEKRS  ASD SIFVGDLAADVTD +L++ F +KY SVK AKV+IDAN
Sbjct  122   RPFKLNWASYSMGEKRSEVASDYSIFVGDLAADVTDEMLMELFANKYRSVKGAKVIIDAN  181

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRS+GYGFVRFGDDN++S A+TEMNG YCS+RP+RIG ATPR+SSG             
Sbjct  182   TGRSRGYGFVRFGDDNDKSHAMTEMNGAYCSTRPIRIGPATPRRSSGDSGSS--------  233

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
              +P H   SDGDS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQF +
Sbjct  234   -TPGH---SDGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVS  289

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             RTDAEEALQ L G VIGKQ VRLSWGR+P+H+QSR+D  ++    YYG  FY GY YA P
Sbjct  290   RTDAEEALQGLNGSVIGKQAVRLSWGRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASP  349

Query  330   APHNPN  313
              PH PN
Sbjct  350   VPH-PN  354


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/167 (26%), Positives = 74/167 (44%), Gaps = 30/167 (18%)
 Frame = -2

Query  915  KYPSVKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPR  742
            + P V   KV+ +  TG+S+GYGFV F       +AL    G     + RP ++  A   
Sbjct  73   ELPKVVTIKVIRNRQTGQSEGYGFVEFYSHGSAEKALQNFTGHVMPNTDRPFKLNWA---  129

Query  741  KssgyqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFS-QYGEI  565
                              S + G +    +S+ +IFVG L  +V+DE L + F+ +Y  +
Sbjct  130  ------------------SYSMGEKRSEVASDYSIFVGDLAADVTDEMLMELFANKYRSV  171

Query  564  VSVKIPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
               K+ +       +G GFV+F +  D   A+ ++ G     + +R+
Sbjct  172  KGAKVIIDANTGRSRGYGFVRFGDDNDKSHAMTEMNGAYCSTRPIRI  218



>ref|XP_011000065.1| PREDICTED: polyadenylate-binding protein RBP47 [Populus euphratica]
Length=436

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 190/231 (82%), Gaps = 7/231 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++F+ GE+R++  SDLSIFVGDLAADVTD +L +TF +KY SVK AKVV D+N
Sbjct  175   QPFRLNWASFA-GERRADAGSDLSIFVGDLAADVTDAMLQETFATKYASVKGAKVVADSN  233

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg----  703
             TGRSKGYGFVRFGD+NE+++A+TEMNG YCSSRPMRIG ATP+K S YQQQ+++Q     
Sbjct  234   TGRSKGYGFVRFGDENEKTRAITEMNGAYCSSRPMRIGVATPKKPSAYQQQYSSQALVLA  293

Query  702   --gySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
                 SNG+ A GSQSDGDS+NTTIFVGG+D +V+DEDLRQPFSQ+GE+VSVK+P GKGC 
Sbjct  294   GGHASNGAMAQGSQSDGDSNNTTIFVGGIDSDVTDEDLRQPFSQFGEVVSVKMPTGKGCA  353

Query  528   FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGA  376
             FVQFANR +AE+ALQ L G  IGKQTVRLSWGR PA++Q R D  NQW GA
Sbjct  354   FVQFANRKNAEDALQSLNGTTIGKQTVRLSWGRTPANKQWRGDHGNQWHGA  404



>ref|XP_002446570.1| hypothetical protein SORBIDRAFT_06g018280 [Sorghum bicolor]
 gb|EES10898.1| hypothetical protein SORBIDRAFT_06g018280 [Sorghum bicolor]
Length=423

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/241 (66%), Positives = 191/241 (79%), Gaps = 13/241 (5%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+++SMGEKRS  ASD SIFVGDLAADVTD +LL+ F SKY SVK AKV+IDANTGRS+
Sbjct  177   NWASYSMGEKRSEVASDHSIFVGDLAADVTDEMLLELFSSKYRSVKGAKVIIDANTGRSR  236

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDN++S A++EMNGVYCS+RP+RIG ATPR+SSG              +P H
Sbjct  237   GYGFVRFGDDNDKSHAMSEMNGVYCSTRPIRIGPATPRRSSGDSGSS---------TPGH  287

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
                SDGDSSN T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQFA+RTDAE
Sbjct  288   ---SDGDSSNRTVYVGGLDPNVSEDELRKAFAKYGDLASVKIPLGKQCGFVQFASRTDAE  344

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EALQ L G +IGKQ VRLSWGR+P+H+QSR D  N+    YYG  FY GY YA P PH P
Sbjct  345   EALQGLNGSLIGKQAVRLSWGRSPSHKQSRGDSGNRRNNMYYGTPFYGGYGYASPVPH-P  403

Query  315   N  313
             N
Sbjct  404   N  404



>ref|XP_003579863.1| PREDICTED: polyadenylate-binding protein RBP47-like [Brachypodium 
distachyon]
Length=428

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 191/246 (78%), Gaps = 13/246 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+++SMGEKRS   SD SIFVGDLAADVTD +L++ F SKY SVK AKV+IDAN
Sbjct  175   RPFKLNWASYSMGEKRSEVVSDHSIFVGDLAADVTDEMLMELFASKYRSVKGAKVIIDAN  234

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRS+GYGFVRFG+D+++S+A+TEMNGVYCS+RP+RIG ATPR+++G            +
Sbjct  235   TGRSRGYGFVRFGEDSDKSRAMTEMNGVYCSTRPIRIGPATPRRTAGDSG---------S  285

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
              +P H   SDGDS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP GK CGFVQ+ N
Sbjct  286   STPGH---SDGDSTNRTVYVGGLDPNVSEDELRKSFAKYGDVASVKIPQGKQCGFVQYVN  342

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             RTDAEEALQ L G VIGKQ VRLSWGR+P+H+Q R D  N+    YYG  FY GY YA P
Sbjct  343   RTDAEEALQGLNGSVIGKQAVRLSWGRSPSHKQPRGDSGNRRNNMYYGTPFYGGYGYASP  402

Query  330   APHNPN  313
              PH PN
Sbjct  403   VPH-PN  407


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNG--VYCSSRPMRIGAATPRKssg  730
            V   KV+ +  TG+++GYGFV F       +AL    G  +  + RP ++  A       
Sbjct  130  VVTIKVIRNRQTGQTEGYGFVEFYSHASADKALQNFTGHAMPNTDRPFKLNWA-------  182

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +     S+ +IFVG L  +V+DE L + F S+Y  +   K
Sbjct  183  --------------SYSMGEKRSEVVSDHSIFVGDLAADVTDEMLMELFASKYRSVKGAK  228

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       +G GFV+F   +D   A+ ++ G+    + +R+
Sbjct  229  VIIDANTGRSRGYGFVRFGEDSDKSRAMTEMNGVYCSTRPIRI  271



>ref|XP_006349627.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Solanum 
tuberosum]
Length=428

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/248 (64%), Positives = 190/248 (77%), Gaps = 11/248 (4%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSN------NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAK  889
             +P   NWS FS GEKR++      + SDLSIFVGDLA+DVTDT+L DTF S+YPSVK AK
Sbjct  150   QPFRLNWSAFSTGEKRADVGAAAGSGSDLSIFVGDLASDVTDTMLRDTFSSRYPSVKGAK  209

Query  888   VVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaa  709
             VVID+NTGRSKGYGFVRF D++ERS+A+TEMNG+YCSSR MRIG ATP+K S  QQ  + 
Sbjct  210   VVIDSNTGRSKGYGFVRFDDESERSRAMTEMNGIYCSSRAMRIGVATPKKPSAMQQYSSQ  269

Query  708   qg-----gySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPV  544
                      SNG+    SQ+D D SNTT+FVGGLD +V+DE+LRQ FSQ+G +VSVKIP 
Sbjct  270   AVILAGGHASNGAATQTSQTDSDLSNTTVFVGGLDSDVTDEELRQSFSQFGNVVSVKIPA  329

Query  543   GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG  364
             GKGCGFVQF+ R+ AE+A++KL G VIG QTVRLSWGRNPA++Q R+D  +QW G YYG 
Sbjct  330   GKGCGFVQFSERSAAEDAIEKLNGTVIGTQTVRLSWGRNPANKQFRTDSGSQWNGGYYGR  389

Query  363   HFYDGYTY  340
               Y GY Y
Sbjct  390   QNYGGYGY  397


 Score = 51.2 bits (121),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 75/163 (46%), Gaps = 24/163 (15%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+ YGF+ F       + L   NG     + +P R+  +       
Sbjct  105  VISVKVIRNKQTGQSERYGFIEFNTHEAAEKVLQSYNGTMMPNAEQPFRLNWSA------  158

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                F+     ++   A GS SD      +IFVG L  +V+D  LR  F S+Y  +   K
Sbjct  159  ----FSTGEKRADVGAAAGSGSD-----LSIFVGDLASDVTDTMLRDTFSSRYPSVKGAK  209

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + ++   A+ ++ G+    + +R+
Sbjct  210  VVIDSNTGRSKGYGFVRFDDESERSRAMTEMNGIYCSSRAMRI  252



>ref|NP_001052934.2| Os04g0449900 [Oryza sativa Japonica Group]
 dbj|BAF14848.2| Os04g0449900 [Oryza sativa Japonica Group]
Length=387

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 192/246 (78%), Gaps = 13/246 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+++SMGEKRS  ASD SIFVGDLAADVTD +L++ F +KY SVK AKV+IDAN
Sbjct  136   RPFKLNWASYSMGEKRSEVASDYSIFVGDLAADVTDEMLMELFANKYRSVKGAKVIIDAN  195

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRS+GYGFVRFGDDN++S A+TEMNG YCS+RP+RIG ATPR+SSG             
Sbjct  196   TGRSRGYGFVRFGDDNDKSHAMTEMNGAYCSTRPIRIGPATPRRSSGDSGSS--------  247

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
              +P H   SDGDS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQF +
Sbjct  248   -TPGH---SDGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVS  303

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             RTDAEEALQ L G VIGKQ VRLSWGR+P+H+QSR+D  ++    YYG  FY GY YA P
Sbjct  304   RTDAEEALQGLNGSVIGKQAVRLSWGRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASP  363

Query  330   APHNPN  313
              PH PN
Sbjct  364   VPH-PN  368


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 72/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V   KV+ +  TG+S+GYGFV F       +AL    G     + RP ++  A       
Sbjct  91   VVTIKVIRNRQTGQSEGYGFVEFYSHGSAEKALQNFTGHVMPNTDRPFKLNWA-------  143

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFS-QYGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+DE L + F+ +Y  +   K
Sbjct  144  --------------SYSMGEKRSEVASDYSIFVGDLAADVTDEMLMELFANKYRSVKGAK  189

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       +G GFV+F +  D   A+ ++ G     + +R+
Sbjct  190  VIIDANTGRSRGYGFVRFGDDNDKSHAMTEMNGAYCSTRPIRI  232



>ref|XP_003578248.1| PREDICTED: polyadenylate-binding protein RBP47-like [Brachypodium 
distachyon]
Length=431

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 188/247 (76%), Gaps = 16/247 (6%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLA+DV D  LL+ F S+Y SVK AKVVIDAN
Sbjct  175   QPFRINWASFSMGDRRSDIASDHSIFVGDLASDVNDATLLEIFSSRYSSVKGAKVVIDAN  234

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+E++ A+TEMNGVYCS+RPMRIG ATPRKSSG      +      
Sbjct  235   TGRSKGYGFVRFGDDSEKTHAMTEMNGVYCSTRPMRIGPATPRKSSGNSGSTGSS-----  289

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
                   ++SDGD +NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK CGFVQF  
Sbjct  290   ------ARSDGDLTNTTVFVGGLDPNVSEDDLRQSFSQYGEISSVKIPVGKQCGFVQFLQ  343

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYGGH-FYDGYTY-  340
             R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  NQW  G YY    FY+GY Y 
Sbjct  344   RKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGNQWNNGMYYAASPFYNGYGYP  403

Query  339   --AFPAP  325
                FP P
Sbjct  404   AAPFPDP  410



>ref|XP_003529385.1| PREDICTED: polyadenylate-binding protein RBP47-like [Glycine 
max]
Length=431

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 160/240 (67%), Positives = 194/240 (81%), Gaps = 11/240 (5%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNA-SDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW+TFS GE+RS++A SDLSIFVGDLA DVTD +L +TF  +Y S+K AKVVID+NTGRS
Sbjct  177   NWATFSAGERRSSDATSDLSIFVGDLAIDVTDAMLQETFAGRYSSIKGAKVVIDSNTGRS  236

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg------gy  697
             KGYGFVRFGD+NER++A+TEMNGVYCSSRPMRIG ATP+K+ GYQQQ+++Q         
Sbjct  237   KGYGFVRFGDENERTRAMTEMNGVYCSSRPMRIGVATPKKTYGYQQQYSSQAVLLAGGHA  296

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             +NG+ A GS S+GD +NTTIFVGGLD + SDEDLRQPF Q+GE+VSVKIPVGKGCGFVQF
Sbjct  297   ANGAVAQGSHSEGDLNNTTIFVGGLDSDTSDEDLRQPFLQFGEVVSVKIPVGKGCGFVQF  356

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
             A+R +AEEA+  L G VIGKQTVRLSWGR+P ++  RSD      G Y+GG  Y G+ +A
Sbjct  357   ADRKNAEEAIHALNGTVIGKQTVRLSWGRSPGNKHWRSDSN----GGYFGGQSYGGHGFA  412


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 29/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V +AKV+ +  TG+S+GYGFV F       + L   NG     + +  R+  AT      
Sbjct  127  VVSAKVIRNKQTGQSEGYGFVEFYSRATAEKVLQNYNGTMMPNTDQAFRLNWAT------  180

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFS-QYGEIVSVK  553
                            A   +S   +S+ +IFVG L  +V+D  L++ F+ +Y  I   K
Sbjct  181  --------------FSAGERRSSDATSDLSIFVGDLAIDVTDAMLQETFAGRYSSIKGAK  226

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  227  VVIDSNTGRSKGYGFVRFGDENERTRAMTEMNGVYCSSRPMRI  269



>gb|EMT27298.1| Putative RNA-binding protein [Aegilops tauschii]
Length=302

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 152/241 (63%), Positives = 185/241 (77%), Gaps = 13/241 (5%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+++S+GEKRS  ASD SIFVGDLA DVTD +L++ F +KY SVK AKV+IDANTGRS+
Sbjct  56    NWASYSVGEKRSELASDHSIFVGDLAVDVTDDMLMELFANKYRSVKGAKVIIDANTGRSR  115

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDD +R+ A+TEMNGVYCS+RP+RIG ATPR++SG              SP  
Sbjct  116   GYGFVRFGDDIDRTHAMTEMNGVYCSTRPIRIGPATPRRTSGDSGT----------SPP-  164

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
              +QSDGDS+N T++VGGLDPN+S+++LR+ F +YG++ SVKIPVGK CGFVQF NR DAE
Sbjct  165   -TQSDGDSTNRTVYVGGLDPNISEDELRKAFVKYGDVASVKIPVGKQCGFVQFVNRADAE  223

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EALQ L G  IGKQ VRLSWGR+PA +QSR D  ++  G YYG  FY GY Y  P PH P
Sbjct  224   EALQGLSGSTIGKQAVRLSWGRSPASKQSRGDSGHRRNGMYYGTPFYGGYGYGSPVPH-P  282

Query  315   N  313
             N
Sbjct  283   N  283



>gb|EMS68577.1| Uncharacterized RNA-binding protein C23E6.01c [Triticum urartu]
Length=314

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 152/243 (63%), Positives = 187/243 (77%), Gaps = 15/243 (6%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+++SMGEKRS   SD SIFVGDLAADVTD +L++ F SKY SVK AKV+IDANTGRS+
Sbjct  66    NWASYSMGEKRSEVVSDHSIFVGDLAADVTDEMLMELFASKYRSVKGAKVIIDANTGRSR  125

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDD +++ A+TEMNGVYCS+RP+R+G ATPR++SG            + +P H
Sbjct  126   GYGFVRFGDDTDKAHAMTEMNGVYCSTRPIRVGPATPRRTSGDSG---------SSTPGH  176

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
                SDGDS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQ+ NRTDAE
Sbjct  177   ---SDGDSNNRTVYVGGLDPNVSEDELRKSFAKYGDVASVKIPLGKQCGFVQYVNRTDAE  233

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD--FTNQWAGAYYGGHFYDGYTYAFPAPH  322
             EALQ L G VIGKQ VRLSWGR+P+H+QSR D          YYG  FY GY YA P PH
Sbjct  234   EALQGLNGAVIGKQAVRLSWGRSPSHKQSRGDSGNRRNNNNMYYGTPFYGGYGYASPVPH  293

Query  321   NPN  313
              PN
Sbjct  294   -PN  295



>gb|EAY94326.1| hypothetical protein OsI_16094 [Oryza sativa Indica Group]
Length=426

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 192/246 (78%), Gaps = 13/246 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+++SMGEKRS  ASD SIFVGDLAADVTD +L++ F +KY SVK AKV+IDAN
Sbjct  175   RPFKLNWASYSMGEKRSEVASDYSIFVGDLAADVTDEMLMELFANKYRSVKGAKVIIDAN  234

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRS+GYGFVRFGDDN++S A+TEMNG YCS+RP+RIG ATPR+SSG             
Sbjct  235   TGRSRGYGFVRFGDDNDKSHAMTEMNGAYCSTRPIRIGPATPRRSSGDSGSS--------  286

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
              +P H   SDGDS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQF +
Sbjct  287   -TPGH---SDGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVS  342

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             RTDAEEALQ L G VIGKQ VRLSWGR+P+H+QSR+D  ++    YYG  FY GY YA P
Sbjct  343   RTDAEEALQGLNGSVIGKQAVRLSWGRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASP  402

Query  330   APHNPN  313
              PH PN
Sbjct  403   VPH-PN  407


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 72/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V   KV+ +  TG+S+GYGFV F       +AL    G     + RP ++  A       
Sbjct  130  VVTIKVIRNRQTGQSEGYGFVEFYSHGSAEKALQNFTGHVMPNTDRPFKLNWA-------  182

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFS-QYGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+DE L + F+ +Y  +   K
Sbjct  183  --------------SYSMGEKRSEVASDYSIFVGDLAADVTDEMLMELFANKYRSVKGAK  228

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       +G GFV+F +  D   A+ ++ G     + +R+
Sbjct  229  VIIDANTGRSRGYGFVRFGDDNDKSHAMTEMNGAYCSTRPIRI  271



>emb|CAH67097.1| H0818E04.14 [Oryza sativa Indica Group]
Length=426

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 192/246 (78%), Gaps = 13/246 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+++SMGEKRS  ASD SIFVGDLAADVTD +L++ F +KY SVK AKV+IDAN
Sbjct  175   RPFKLNWASYSMGEKRSEVASDYSIFVGDLAADVTDEMLMELFANKYRSVKGAKVIIDAN  234

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRS+GYGFVRFGDDN++S A+TEMNG YCS+RP+RIG ATPR+SSG             
Sbjct  235   TGRSRGYGFVRFGDDNDKSHAMTEMNGAYCSTRPIRIGPATPRRSSGDSGSS--------  286

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
              +P H   SDGDS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQF +
Sbjct  287   -TPGH---SDGDSTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVS  342

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             RTDAEEALQ L G VIGKQ VRLSWGR+P+H+QSR+D  ++    YYG  FY GY YA P
Sbjct  343   RTDAEEALQGLNGSVIGKQAVRLSWGRSPSHKQSRADSGSRRNNMYYGTPFYGGYGYASP  402

Query  330   APHNPN  313
              PH PN
Sbjct  403   VPH-PN  407


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 72/163 (44%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V   KV+ +  TG+S+GYGFV F       +AL    G     + RP ++  A       
Sbjct  130  VVTIKVIRNRQTGQSEGYGFVEFYSHGSAEKALQNFTGHVMPNTDRPFKLNWA-------  182

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFS-QYGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+DE L + F+ +Y  +   K
Sbjct  183  --------------SYSMGEKRSEVASDYSIFVGDLAADVTDEMLMELFANKYRSVKGAK  228

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       +G GFV+F +  D   A+ ++ G     + +R+
Sbjct  229  VIIDANTGRSRGYGFVRFGDDNDKSHAMTEMNGAYCSTRPIRI  271



>gb|ACF87959.1| unknown [Zea mays]
 tpg|DAA61808.1| TPA: hypothetical protein ZEAMMB73_995180 [Zea mays]
Length=433

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 187/246 (76%), Gaps = 15/246 (6%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS++ASD SIFVGDLA+DV D  LL+ F S+Y SVK AKVVIDAN
Sbjct  174   QPFRLNWASFSMGDRRSDSASDHSIFVGDLASDVNDATLLEAFSSRYSSVKGAKVVIDAN  233

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+E++QA+TEMNGVYCSSRPMRIG ATPRKSSG             
Sbjct  234   TGRSKGYGFVRFGDDSEKTQAMTEMNGVYCSSRPMRIGPATPRKSSGTSGSN--------  285

Query  690   GSPAHGSQSDG-DSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
                   ++SDG D +NTT+FVGGLDPNVS+EDLRQ FSQYGEI SVKIP+GK CGFVQFA
Sbjct  286   ---GSAARSDGGDLTNTTVFVGGLDPNVSEEDLRQTFSQYGEISSVKIPIGKQCGFVQFA  342

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW--AGAYYGG-HFYDGYT  343
              R +AE+ALQ L G  IGKQ VRLSWGRNPA++Q R D  NQW   G YY    FY+GY 
Sbjct  343   QRKNAEDALQGLNGSTIGKQNVRLSWGRNPANKQFRGDNGNQWNNGGMYYAAPPFYNGYG  402

Query  342   YAFPAP  325
             Y   AP
Sbjct  403   YPAAAP  408


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 76/163 (47%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNG--VYCSSRPMRIGAATPRKssg  730
            V A KV+ +  TG+S+GYGFV F       + L   +G  +  + +P R+  A       
Sbjct  129  VVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKVLEGFSGHIMPNTDQPFRLNWA-------  181

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+D  L + F S+Y  +   K
Sbjct  182  --------------SFSMGDRRSDSASDHSIFVGDLASDVNDATLLEAFSSRYSSVKGAK  227

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + ++  +A+ ++ G+    + +R+
Sbjct  228  VVIDANTGRSKGYGFVRFGDDSEKTQAMTEMNGVYCSSRPMRI  270



>ref|XP_006653468.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=409

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 190/246 (77%), Gaps = 13/246 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+++SMGEKRS  ASD SIFVGDLAADVTD +L++ F  KY SVK AKV+IDAN
Sbjct  158   RPFKLNWASYSMGEKRSEVASDYSIFVGDLAADVTDEMLMELFADKYRSVKGAKVIIDAN  217

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRS+GYGFVRFGDDN++S A+TEMNG YCS+RP+RIG ATPR+SSG             
Sbjct  218   TGRSRGYGFVRFGDDNDKSHAMTEMNGAYCSTRPIRIGPATPRRSSGDSGSS--------  269

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
              +P H   SDGD +N T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQF +
Sbjct  270   -TPGH---SDGDFTNRTVYVGGLDPNVSEDELRKAFAKYGDVASVKIPLGKQCGFVQFVS  325

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             RTDAEEALQ L G VIGKQ VRLSWGR+P+H+QSR+D  N+    YYG  FY GY YA P
Sbjct  326   RTDAEEALQGLNGSVIGKQAVRLSWGRSPSHKQSRADSGNRRNNMYYGTPFYGGYGYASP  385

Query  330   APHNPN  313
              PH PN
Sbjct  386   VPH-PN  390


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/200 (27%), Positives = 84/200 (42%), Gaps = 45/200 (23%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V   KV+ +  TG+S+GYGFV F       +AL    G     + RP ++  A       
Sbjct  113  VVTIKVIRNRQTGQSEGYGFVEFYSHGSAEKALQNFTGHVMPNTDRPFKLNWA-------  165

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFS-QYGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+DE L + F+ +Y  +   K
Sbjct  166  --------------SYSMGEKRSEVASDYSIFVGDLAADVTDEMLMELFADKYRSVKGAK  211

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL-----------SWGRNP  424
            + +       +G GFV+F +  D   A+ ++ G     + +R+           S    P
Sbjct  212  VIIDANTGRSRGYGFVRFGDDNDKSHAMTEMNGAYCSTRPIRIGPATPRRSSGDSGSSTP  271

Query  423  AHRQSRSDFTNQWAGAYYGG  364
             H  S  DFTN+    Y GG
Sbjct  272  GH--SDGDFTNR--TVYVGG  287



>gb|EMT16295.1| Putative RNA-binding protein [Aegilops tauschii]
Length=481

 Score =   285 bits (730),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 169/269 (63%), Positives = 198/269 (74%), Gaps = 15/269 (6%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLA+DV DT LL+TF S+Y SVK AKVVIDAN
Sbjct  226   QPFRINWASFSMGDRRSDIASDHSIFVGDLASDVNDTALLETFSSRYSSVKGAKVVIDAN  285

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+E++ A+TEMNGVYCS+RPMRIG ATPRKSSG             
Sbjct  286   TGRSKGYGFVRFGDDSEKTNAMTEMNGVYCSTRPMRIGPATPRKSSGTSGST--------  337

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
                   ++SDGD +NTT+FVGGLDPNVS++DL+Q F+QYGEI SVKIPVGK CGFVQF  
Sbjct  338   ---GSSARSDGDLTNTTVFVGGLDPNVSEDDLKQTFTQYGEISSVKIPVGKQCGFVQFLQ  394

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA-GAYYG-GHFYDGYTYA  337
             R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  NQW  G YY    FY+GY Y 
Sbjct  395   RKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGNQWTNGMYYAPSPFYNGYGY-  453

Query  336   FPAPHNPNmyapaaygaypmyGTHQQQVS  250
              PA   P+    AA         +QQQVS
Sbjct  454   -PAAPFPDPGMYAAAYGAYPVYGNQQQVS  481



>ref|XP_010327389.1| PREDICTED: DNA-binding protein isoform X1 [Solanum lycopersicum]
Length=424

 Score =   283 bits (725),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 159/244 (65%), Positives = 189/244 (77%), Gaps = 7/244 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSN------NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAK  889
             +P   NWS FS GEKR++      + SDLSIFVGDLA+DVTDT+L DTF S+YPSVK AK
Sbjct  150   QPFRLNWSAFSSGEKRADVGAGAGSGSDLSIFVGDLASDVTDTMLRDTFSSRYPSVKGAK  209

Query  888   VVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKss-gyqqqfa  712
             VVID+NTGRSKGYGFVRF D++ERS+A+TEMNG+YCSSR MRIG ATP+K S   Q    
Sbjct  210   VVIDSNTGRSKGYGFVRFDDESERSRAMTEMNGIYCSSRAMRIGVATPKKPSPMQQYFSQ  269

Query  711   aqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
             A G  SNG+    SQ+D D SNTT+FVGGLD  V+DE+LRQ FSQ+G +VSVKIP GKGC
Sbjct  270   AGGHASNGAATQTSQTDSDLSNTTVFVGGLDSEVTDEELRQSFSQFGNVVSVKIPAGKGC  329

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
             GFVQF+ R+ AE+A++KL G VIG QTVRLSWGRNPA++Q R+D  +QW G YYG   Y 
Sbjct  330   GFVQFSERSAAEDAIEKLNGTVIGAQTVRLSWGRNPANKQFRTDSGSQWNGGYYGRQNYG  389

Query  351   GYTY  340
             GY Y
Sbjct  390   GYGY  393



>ref|NP_001144988.1| uncharacterized protein LOC100278143 [Zea mays]
 gb|ACG44236.1| hypothetical protein [Zea mays]
Length=436

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 162/246 (66%), Positives = 186/246 (76%), Gaps = 15/246 (6%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLA+DV D  LL+ F S+Y SVK AKVVIDAN
Sbjct  177   QPFRLNWASFSMGDRRSDAASDHSIFVGDLASDVNDATLLEAFSSRYSSVKGAKVVIDAN  236

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+E++QA+TEMNGVYCSSRPMRIG ATPRKSSG             
Sbjct  237   TGRSKGYGFVRFGDDSEKTQAMTEMNGVYCSSRPMRIGPATPRKSSGTSGSN--------  288

Query  690   GSPAHGSQSDG-DSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
                   ++SDG D +NTT+FVGGLDPNVS+EDLRQ FSQYGEI SVKIP+GK CGFVQFA
Sbjct  289   ---GSAARSDGGDLTNTTVFVGGLDPNVSEEDLRQTFSQYGEISSVKIPIGKQCGFVQFA  345

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW--AGAYYGG-HFYDGYT  343
              R +AE+ALQ L G  IGKQ VRLSWGRNPA++Q R D  NQW   G YY    FY+GY 
Sbjct  346   QRKNAEDALQGLNGSTIGKQNVRLSWGRNPANKQFRGDNGNQWNNGGMYYAAPPFYNGYG  405

Query  342   YAFPAP  325
             Y   AP
Sbjct  406   YPAAAP  411


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 76/163 (47%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNG--VYCSSRPMRIGAATPRKssg  730
            V A KV+ +  TG+S+GYGFV F       + L   +G  +  + +P R+  A       
Sbjct  132  VVAIKVIRNKQTGQSEGYGFVEFYSHAAAEKVLEGFSGHIMPNTDQPFRLNWA-------  184

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+D  L + F S+Y  +   K
Sbjct  185  --------------SFSMGDRRSDAASDHSIFVGDLASDVNDATLLEAFSSRYSSVKGAK  230

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + ++  +A+ ++ G+    + +R+
Sbjct  231  VVIDANTGRSKGYGFVRFGDDSEKTQAMTEMNGVYCSSRPMRI  273



>ref|XP_008782206.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Phoenix dactylifera]
Length=385

 Score =   281 bits (720),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 152/229 (66%), Positives = 182/229 (79%), Gaps = 8/229 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG+KRS+ ASD SIFVGDL +DVTD +L +TF S+Y SVK AKVVIDAN
Sbjct  154   QPFRLNWASFSMGDKRSDAASDHSIFVGDLTSDVTDAMLQETFASRYSSVKGAKVVIDAN  213

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDDNE+++A+TEMNGV+CSSRPMR+G ATPRKSSG            N
Sbjct  214   TGRSKGYGFVRFGDDNEKTRAMTEMNGVFCSSRPMRLGLATPRKSSGGFGS--------N  265

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G+ A   QSDGD +NTT+FVGGLDPNVS++DL+Q FSQYGE+ SVKIPVGK CGFVQF +
Sbjct  266   GASAQSFQSDGDPTNTTVFVGGLDPNVSEDDLKQAFSQYGEVASVKIPVGKQCGFVQFVH  325

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG  364
             R +AEEALQ+L G VIGKQ VRLSWGRNP ++QS S  + +W   +  G
Sbjct  326   RNNAEEALQQLNGTVIGKQLVRLSWGRNPTNKQSSSWQSLEWCIPWRTG  374


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+GYGFV F       + L    G     + +P R+  A       
Sbjct  109  VVSIKVIRNKKTGQSEGYGFVEFFSHAAAEKVLQNFCGYAMPNTEQPFRLNWA-------  161

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  162  --------------SFSMGDKRSDAASDHSIFVGDLTSDVTDAMLQETFASRYSSVKGAK  207

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +RL
Sbjct  208  VVIDANTGRSKGYGFVRFGDDNEKTRAMTEMNGVFCSSRPMRL  250



>dbj|BAJ85879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 199/269 (74%), Gaps = 15/269 (6%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLA+DV DT LL+TF S+Y SVK AKVVIDAN
Sbjct  224   QPFRINWASFSMGDRRSDIASDHSIFVGDLASDVNDTALLETFSSRYSSVKGAKVVIDAN  283

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+E++ A+TEMNGVYCS+RPMRIG ATPRKSSG      +      
Sbjct  284   TGRSKGYGFVRFGDDSEKTNAMTEMNGVYCSTRPMRIGPATPRKSSGTSGSTGSS-----  338

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
                   ++SDGD +NTT+FVGGLDPNVS++DL+Q FSQYGEI SVKIPVGK CGFVQF  
Sbjct  339   ------ARSDGDLTNTTVFVGGLDPNVSEDDLKQTFSQYGEISSVKIPVGKQCGFVQFLQ  392

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW-AGAYYG-GHFYDGYTYA  337
             R +AE+ALQ L G  IGKQTVRLSWGRNPA++Q RSD  NQW  G YY    FY+GY Y 
Sbjct  393   RKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQLRSDNGNQWNNGMYYAPSPFYNGYGY-  451

Query  336   FPAPHNPNmyapaaygaypmyGTHQQQVS  250
              PA   P+    AA         +QQQVS
Sbjct  452   -PAAPFPDPGMYAAAYGAYPLYGNQQQVS  479



>ref|XP_007156541.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
 gb|ESW28535.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
Length=363

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 188/216 (87%), Gaps = 4/216 (2%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNA-SDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW+TFS G++RS++A SDLSIFVGDLA DVTD +L +TF  ++ S+K AKVVID+NTGRS
Sbjct  110   NWATFSAGDRRSSDATSDLSIFVGDLAIDVTDAMLQETFAGRFSSIKGAKVVIDSNTGRS  169

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg---gySNG  688
             KGYGFVRFGD+NER++A+TEMNGVYCSSRPMRIG ATP+K+ GYQQQ+++Q      +NG
Sbjct  170   KGYGFVRFGDENERTRAMTEMNGVYCSSRPMRIGVATPKKTYGYQQQYSSQAGGGHSANG  229

Query  687   SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANR  508
             + A GSQS+GDS+NTTIFVGGLD ++SDEDLRQPF Q+GE+VSVKIPVGKGCGFVQFA+R
Sbjct  230   AVAQGSQSEGDSNNTTIFVGGLDSDISDEDLRQPFLQFGEVVSVKIPVGKGCGFVQFADR  289

Query  507   TDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  400
              +AE+A+Q L G VIGKQTVRLSWGR+P ++  RSD
Sbjct  290   KNAEDAIQALNGTVIGKQTVRLSWGRSPGNKHWRSD  325



>gb|KHN37491.1| Polyadenylate-binding protein RBP47 [Glycine soja]
Length=321

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 179/219 (82%), Gaps = 7/219 (3%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNA-SDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW+TFS GE+RS++A SDLSIFVGDLA DVTD +L DTF  +Y S+K AKVVID+NTGRS
Sbjct  66    NWATFSAGERRSSDATSDLSIFVGDLAIDVTDAMLQDTFAGRYSSIKGAKVVIDSNTGRS  125

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKss------gyqqqfaaqggy  697
             KGYGFVRFGD+NER++A+TEMNGVYCSSRPMRIG ATP+K+         Q    A G  
Sbjct  126   KGYGFVRFGDENERTRAMTEMNGVYCSSRPMRIGVATPKKTYGFQQQYSSQAVVLAGGHS  185

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             +NG+ A GS S+GD +NTTIFVGGLD + SDEDLRQPF Q+GE+VSVKIPVGKGCGFVQF
Sbjct  186   ANGAVAQGSHSEGDINNTTIFVGGLDSDTSDEDLRQPFLQFGEVVSVKIPVGKGCGFVQF  245

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  400
             A+R +AEEA+Q L G VIGKQTVRLSWGR+P ++  RSD
Sbjct  246   ADRKNAEEAIQGLNGTVIGKQTVRLSWGRSPGNKHWRSD  284


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 73/163 (45%), Gaps = 29/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V +AKV+ +  TG+S+GYGFV F       + L   NG     + +  R+  AT      
Sbjct  16   VVSAKVIRNKQTGQSEGYGFVEFYSRGTAEKVLQNYNGTMMPNTDQAFRLNWAT------  69

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFS-QYGEIVSVK  553
                            A   +S   +S+ +IFVG L  +V+D  L+  F+ +Y  I   K
Sbjct  70   --------------FSAGERRSSDATSDLSIFVGDLAIDVTDAMLQDTFAGRYSSIKGAK  115

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  116  VVIDSNTGRSKGYGFVRFGDENERTRAMTEMNGVYCSSRPMRI  158



>ref|XP_004975779.1| PREDICTED: polyadenylate-binding protein RBP47-like [Setaria 
italica]
Length=420

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 190/241 (79%), Gaps = 14/241 (6%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+++SMGEKRS  ASD SIFVGDLAADVTD +L++ F SKY SVK AKV+IDANTGRS+
Sbjct  174   NWASYSMGEKRSEVASDHSIFVGDLAADVTDEMLMELFASKYRSVKGAKVIIDANTGRSR  233

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDN++S A++EMNGVYCS+RP+RIG ATPR+SSG              +P H
Sbjct  234   GYGFVRFGDDNDKSHAMSEMNGVYCSTRPIRIGPATPRRSSGDSGSS---------TPGH  284

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
                SDGDSSN T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQF +RTDAE
Sbjct  285   ---SDGDSSNRTVYVGGLDPNVSEDELRKAFAKYGDLASVKIPLGKQCGFVQFVSRTDAE  341

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EALQ L G VIGKQ VRLSWGR+P+H+QSR D  N+    YYG  FY GY YA P PH P
Sbjct  342   EALQGLNGSVIGKQAVRLSWGRSPSHKQSRGDSGNR-RNMYYGTPFYGGYGYASPVPH-P  399

Query  315   N  313
             N
Sbjct  400   N  400



>ref|XP_011461514.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=448

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 187/223 (84%), Gaps = 1/223 (0%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G++R++ +SDLSIFVGDLA DVTDT+L +TF S+Y SVK AKVV DAN
Sbjct  190   QPFRLNWATFSAGDRRADTSSDLSIFVGDLATDVTDTMLQETFASRYSSVKGAKVVQDAN  249

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqq-faaqggyS  694
             TGRSKGYGFVRFGD+NER++A+ EMNG YCSSRPMRIG ATP+KSSGYQQQ  +  GG++
Sbjct  250   TGRSKGYGFVRFGDENERTKAIVEMNGAYCSSRPMRIGVATPKKSSGYQQQYSSQGGGHA  309

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG  A GSQSDG+ +NTTIFVGGLD +V++EDLRQPFSQ+GE++SVKIPVGK CGFVQFA
Sbjct  310   NGGVAQGSQSDGEPNNTTIFVGGLDSDVNEEDLRQPFSQFGEVISVKIPVGKACGFVQFA  369

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             NR DAE A+  L   VIGKQTVRLSWGR+  ++Q RSD  NQW
Sbjct  370   NRKDAENAMNMLNATVIGKQTVRLSWGRSQGNKQWRSDSNNQW  412


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+++GYGFV F       + L   NG     + +P R+  AT      
Sbjct  145  VSSVKVIRNKQTGQTEGYGFVEFYSREAAEEVLQTYNGTPMPNTEQPFRLNWAT------  198

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +    SS+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  199  ---------------FSAGDRRADTSSDLSIFVGDLATDVTDTMLQETFASRYSSVKGAK  243

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            +         KG GFV+F +  +  +A+ ++ G     + +R+
Sbjct  244  VVQDANTGRSKGYGFVRFGDENERTKAIVEMNGAYCSSRPMRI  286



>gb|KCW63816.1| hypothetical protein EUGRSUZ_G01492 [Eucalyptus grandis]
Length=432

 Score =   282 bits (721),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 159/244 (65%), Positives = 196/244 (80%), Gaps = 10/244 (4%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS G+KR +  SDLSIFVGDLA+DVTD LL +TF +KY SVK AKVVID+N
Sbjct  170   QPFRLNWAMFSSGDKRLDMGSDLSIFVGDLASDVTDALLQETFAAKYTSVKGAKVVIDSN  229

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGD+NE+S+A+TEMNG YCSSRPMRIG ATP+KSSGYQQQ+++Q     
Sbjct  230   TGRSKGYGFVRFGDENEKSRAMTEMNGAYCSSRPMRIGVATPKKSSGYQQQYSSQALVLA  289

Query  690   GSPAHGSQSDG---------DSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGK  538
             G  A G  S+G         +S+N+TIFVGGLD +VSDEDLRQ FSQ+GE+VSVKIP GK
Sbjct  290   GGHAGGHASNGATSQGSQAHESNNSTIFVGGLDSDVSDEDLRQTFSQFGEVVSVKIPAGK  349

Query  537   GCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHF  358
             GCGFV FA+R +AEEA+Q L G  IGKQ+VRLSWGR+PA++Q R++ +NQW G+Y+GG +
Sbjct  350   GCGFVHFADRKNAEEAMQDLNGTTIGKQSVRLSWGRSPANKQWRTERSNQWNGSYHGG-Y  408

Query  357   YDGY  346
              +GY
Sbjct  409   ANGY  412



>ref|NP_001234487.1| DNA-binding protein [Solanum lycopersicum]
 gb|AAR91698.1| DNA-binding protein [Solanum lycopersicum]
Length=428

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 159/248 (64%), Positives = 189/248 (76%), Gaps = 11/248 (4%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSN------NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAK  889
             +P   NWS FS GEKR++      + SDLSIFVGDLA+DVTDT+L DTF S+YPSVK AK
Sbjct  150   QPFRLNWSAFSSGEKRADVGAGAGSGSDLSIFVGDLASDVTDTMLRDTFSSRYPSVKGAK  209

Query  888   VVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyq-----  724
             VVID+NTGRSKGYGFVRF D++ERS+A+TEMNG+YCSSR MRIG ATP+K S  Q     
Sbjct  210   VVIDSNTGRSKGYGFVRFDDESERSRAMTEMNGIYCSSRAMRIGVATPKKPSPMQQYFPQ  269

Query  723   qqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPV  544
                 A G  SNG+    SQ+D D SNTT+FVGGLD  V+DE+LRQ FSQ+G +VSVKIP 
Sbjct  270   AVILAGGHASNGAATQTSQTDSDLSNTTVFVGGLDSEVTDEELRQSFSQFGNVVSVKIPA  329

Query  543   GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG  364
             GKGCGFVQF+ R+ AE+A++KL G VIG QTVRLSWGRNPA++Q R+D  +QW G YYG 
Sbjct  330   GKGCGFVQFSERSAAEDAIEKLNGTVIGAQTVRLSWGRNPANKQFRTDSGSQWNGGYYGR  389

Query  363   HFYDGYTY  340
               Y GY Y
Sbjct  390   QNYGGYGY  397



>ref|XP_010066047.1| PREDICTED: polyadenylate-binding protein RBP47 [Eucalyptus grandis]
Length=445

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 159/244 (65%), Positives = 196/244 (80%), Gaps = 10/244 (4%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS G+KR +  SDLSIFVGDLA+DVTD LL +TF +KY SVK AKVVID+N
Sbjct  183   QPFRLNWAMFSSGDKRLDMGSDLSIFVGDLASDVTDALLQETFAAKYTSVKGAKVVIDSN  242

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGD+NE+S+A+TEMNG YCSSRPMRIG ATP+KSSGYQQQ+++Q     
Sbjct  243   TGRSKGYGFVRFGDENEKSRAMTEMNGAYCSSRPMRIGVATPKKSSGYQQQYSSQALVLA  302

Query  690   GSPAHGSQSDG---------DSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGK  538
             G  A G  S+G         +S+N+TIFVGGLD +VSDEDLRQ FSQ+GE+VSVKIP GK
Sbjct  303   GGHAGGHASNGATSQGSQAHESNNSTIFVGGLDSDVSDEDLRQTFSQFGEVVSVKIPAGK  362

Query  537   GCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHF  358
             GCGFV FA+R +AEEA+Q L G  IGKQ+VRLSWGR+PA++Q R++ +NQW G+Y+GG +
Sbjct  363   GCGFVHFADRKNAEEAMQDLNGTTIGKQSVRLSWGRSPANKQWRTERSNQWNGSYHGG-Y  421

Query  357   YDGY  346
              +GY
Sbjct  422   ANGY  425



>ref|XP_011004995.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=434

 Score =   281 bits (719),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 156/228 (68%), Positives = 189/228 (83%), Gaps = 7/228 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++F+ GE+R++  SD SIFVGDLAADVTD++L +TF  KYPSVK AKVVID+N
Sbjct  173   QPFRLNWASFA-GERRADPGSDPSIFVGDLAADVTDSMLQETFAGKYPSVKGAKVVIDSN  231

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg----  703
             TGRSKGYGFVRFGD+NE+++A+ EMNG +CSSRPMRIG ATP+K S YQQQ+++Q     
Sbjct  232   TGRSKGYGFVRFGDENEKTRAMMEMNGAFCSSRPMRIGVATPKKPSAYQQQYSSQALVLA  291

Query  702   --gySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCG  529
                 SNG+ A GSQS+GDS+NTTIFVGG+D +V+DEDLRQPFSQ+GE+VSVKIPVGKGC 
Sbjct  292   GGHASNGAMAQGSQSNGDSNNTTIFVGGIDSDVTDEDLRQPFSQFGEVVSVKIPVGKGCA  351

Query  528   FVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             FVQFANR +AE+ALQ L G  IGKQTVRLSWGR PA++Q R D  NQW
Sbjct  352   FVQFANRKNAEDALQSLNGTTIGKQTVRLSWGRTPANKQGRGDHGNQW  399



>ref|XP_007156542.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
 gb|ESW28536.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
Length=367

 Score =   279 bits (713),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 182/220 (83%), Gaps = 8/220 (4%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNA-SDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW+TFS G++RS++A SDLSIFVGDLA DVTD +L +TF  ++ S+K AKVVID+NTGRS
Sbjct  110   NWATFSAGDRRSSDATSDLSIFVGDLAIDVTDAMLQETFAGRFSSIKGAKVVIDSNTGRS  169

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKs-------sgyqqqfaaqgg  700
             KGYGFVRFGD+NER++A+TEMNGVYCSSRPMRIG ATP+K+       S      A  G 
Sbjct  170   KGYGFVRFGDENERTRAMTEMNGVYCSSRPMRIGVATPKKTYGYQQQYSSQAVVLAGGGH  229

Query  699   ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  520
              +NG+ A GSQS+GDS+NTTIFVGGLD ++SDEDLRQPF Q+GE+VSVKIPVGKGCGFVQ
Sbjct  230   SANGAVAQGSQSEGDSNNTTIFVGGLDSDISDEDLRQPFLQFGEVVSVKIPVGKGCGFVQ  289

Query  519   FANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  400
             FA+R +AE+A+Q L G VIGKQTVRLSWGR+P ++  RSD
Sbjct  290   FADRKNAEDAIQALNGTVIGKQTVRLSWGRSPGNKHWRSD  329



>ref|XP_003575198.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Brachypodium 
distachyon]
Length=421

 Score =   280 bits (716),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 153/241 (63%), Positives = 185/241 (77%), Gaps = 13/241 (5%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+++S+GEKRS  ASD SIFVGDLA DVTD +L++ F +KY SVK AKV+IDANTGRS+
Sbjct  175   NWASYSVGEKRSELASDHSIFVGDLAVDVTDDMLMELFANKYRSVKGAKVIIDANTGRSR  234

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDN+R+ A+TEMNGVYCS+RP+RIG ATPR++SG              SP  
Sbjct  235   GYGFVRFGDDNDRTHAMTEMNGVYCSTRPIRIGPATPRRTSGDS----------GSSPPR  284

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
               QSDGD +N T++VGGLDPNVS+++LR+ F++YG++ SVKIPVGK CGFVQF NR DAE
Sbjct  285   --QSDGDLTNRTVYVGGLDPNVSEDELRKTFAKYGDVASVKIPVGKQCGFVQFVNRADAE  342

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EALQ L G  IGKQ VRLSWGR+PA +Q R D  ++  G YYG  FY GY YA P PH P
Sbjct  343   EALQALSGSTIGKQAVRLSWGRSPASKQPRGDSGHRRNGMYYGTPFYGGYGYASPVPH-P  401

Query  315   N  313
             N
Sbjct  402   N  402



>ref|XP_009628458.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
tomentosiformis]
Length=418

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 158/248 (64%), Positives = 188/248 (76%), Gaps = 11/248 (4%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEK------RSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAK  889
             +P   NWS F+ GEK       + + SDLSIFVGDLA DVTD +L DTF S+Y SVK AK
Sbjct  138   QPFRLNWSAFNAGEKCADAGAGAGSGSDLSIFVGDLAPDVTDAMLRDTFASRYTSVKGAK  197

Query  888   VVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaa  709
             VVID+NTGRSKGYGFVRFGD+NERSQA+TEMNG+YCSSRPMRIG ATP+K S  QQ  + 
Sbjct  198   VVIDSNTGRSKGYGFVRFGDENERSQAMTEMNGIYCSSRPMRIGVATPKKPSALQQYSSQ  257

Query  708   qg-----gySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPV  544
                      SNG+    S SD D SNTT+FVGGLD +V+D++LRQ F+Q+G +VSVKIP 
Sbjct  258   AVILAGGHASNGAATQTSHSDSDLSNTTVFVGGLDSDVTDDELRQSFNQFGNVVSVKIPA  317

Query  543   GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG  364
             GKGCGFVQF++R+ AE+A+QKL G VIGKQTVRLSWGRNPA++Q R+D  +QW G YYG 
Sbjct  318   GKGCGFVQFSDRSAAEDAIQKLNGAVIGKQTVRLSWGRNPANKQLRTDSGSQWNGGYYGR  377

Query  363   HFYDGYTY  340
               Y GY Y
Sbjct  378   QNYGGYGY  385



>ref|XP_006297697.1| hypothetical protein CARUB_v10013726mg [Capsella rubella]
 gb|EOA30595.1| hypothetical protein CARUB_v10013726mg [Capsella rubella]
Length=439

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 192/246 (78%), Gaps = 8/246 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR+  N  DLS+FVGDL+ DVTD LL +TF ++YPSVK AKVVID+
Sbjct  182   QPFRLNWASFSTGEKRAVENGPDLSVFVGDLSPDVTDDLLHETFSTRYPSVKGAKVVIDS  241

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy-  697
             NTGRSKGYGFVRFGD+NERS+ALTEMNG +CS+R MR+G ATP+++   QQQ ++Q    
Sbjct  242   NTGRSKGYGFVRFGDENERSRALTEMNGAFCSNRQMRVGIATPKRAVANQQQHSSQALIL  301

Query  696   -----SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  +NG  AHGSQSDG+S+N+TIFVGG+DP+V+DEDLRQPFSQ+GE+VSVKIPVGKGC
Sbjct  302   AGGHGANGYMAHGSQSDGESTNSTIFVGGIDPDVTDEDLRQPFSQFGEVVSVKIPVGKGC  361

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSR-SDFTNQWAGAYYGGHFY  355
             GFVQFA+R  AE+A++ L G VIGK TVRLSWGR+P  +Q R  D   QW G Y  G  Y
Sbjct  362   GFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRSPNKQQWRGGDSGQQWNGGYSRGQGY  421

Query  354   DGYTYA  337
             +   YA
Sbjct  422   NNGGYA  427



>ref|XP_002885294.1| RNA-binding protein 47B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61553.1| RNA-binding protein 47B [Arabidopsis lyrata subsp. lyrata]
Length=435

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 186/233 (80%), Gaps = 8/233 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR+  N  DLSIFVGDL+ DVTD LL +TF  +YPSVK+AKVVID+
Sbjct  179   QPFRINWASFSTGEKRAVENGPDLSIFVGDLSPDVTDALLHETFFDRYPSVKSAKVVIDS  238

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy-  697
             NTGRSKGYGFVRFGD+NERS+ALTEMNG YCS+R MR+G ATP+++   QQQ ++Q    
Sbjct  239   NTGRSKGYGFVRFGDENERSRALTEMNGAYCSNRQMRVGVATPKRAIANQQQHSSQALIL  298

Query  696   -----SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  +NGS AHGSQSDG+S+N TIFVGG+D +V+DEDLRQPFSQ+GE+VSVKIPVGKGC
Sbjct  299   AGGHGANGSMAHGSQSDGESTNATIFVGGIDADVTDEDLRQPFSQFGEVVSVKIPVGKGC  358

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAY  373
             GFVQFA R  AE+A++ L G VIGK TVRLSWGR+P ++Q R D   QW G Y
Sbjct  359   GFVQFAERKSAEDAIETLNGTVIGKNTVRLSWGRSP-NKQWRGDSGQQWNGGY  410



>ref|XP_009783555.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Nicotiana sylvestris]
Length=437

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/254 (62%), Positives = 188/254 (74%), Gaps = 17/254 (7%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASD------------LSIFVGdlaadvtdtllldTFVSKYP  907
             +P   NWS F+ GEKR++  +             LSIFVGDLA DVTD +L DTF S+Y 
Sbjct  152   QPFRLNWSAFNAGEKRADAGAGAGAGAGSGSGSDLSIFVGDLAPDVTDAMLRDTFASRYT  211

Query  906   SVKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgy  727
             SVK AKVVID+NTGRSKGYGFVRFGD+NERSQA+TEMNG+YCSSRPMRIG ATP+K S  
Sbjct  212   SVKGAKVVIDSNTGRSKGYGFVRFGDENERSQAMTEMNGIYCSSRPMRIGVATPKKPSTL  271

Query  726   qqqfaaqg-----gySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIV  562
             QQ  +          SNG+    S SD D SNTT+FVGGLD +V+D++LRQ F+Q G +V
Sbjct  272   QQYSSQAVILAGGHASNGAATQTSHSDSDLSNTTVFVGGLDSDVTDDELRQSFNQCGNVV  331

Query  561   SVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  382
             SVKIP GKGCGFVQF++R++AE+A+QKL G VIGKQTVRLSWGRNPA++Q R+D  +QW 
Sbjct  332   SVKIPAGKGCGFVQFSDRSEAEDAIQKLNGAVIGKQTVRLSWGRNPANKQLRTDSGSQWN  391

Query  381   GAYYGGHFYDGYTY  340
             G YYG   Y GY Y
Sbjct  392   GGYYGRQNYGGYGY  405



>gb|ACN40970.1| unknown [Picea sitchensis]
Length=430

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 161/247 (65%), Positives = 191/247 (77%), Gaps = 10/247 (4%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+TFSMGE+R +   D SIFVGDL +DV+D +L +TF S+Y SVKAAKVV+DANTGRSK
Sbjct  168   NWATFSMGERRLDGGPDFSIFVGDLDSDVSDLVLQETFQSRYSSVKAAKVVMDANTGRSK  227

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFG+++ER++A+TEMNGVYCS+RPMRI AATPRKS+G Q Q++ + G   GS A 
Sbjct  228   GYGFVRFGEESERARAMTEMNGVYCSTRPMRISAATPRKSAGVQHQYSGRAGN-GGSHAQ  286

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
             G  SD D +NTTIFVG LDPN +DEDLRQ F QYGE+VSVKIPVGKGCGFVQF NR  AE
Sbjct  287   GFPSDNDLNNTTIFVGRLDPNATDEDLRQVFGQYGELVSVKIPVGKGCGFVQFGNRASAE  346

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFT-------NQWAGAYYGGHFYDGYTYA  337
             EALQ+L G VI +QTVRLSWGR+PA++Q             NQW GAYY G  Y+ Y YA
Sbjct  347   EALQRLHGTVIRQQTVRLSWGRSPANKQQPQPQGQQPQSDPNQWNGAYY-GQGYESYGYA  405

Query  336   FPAPHNP  316
              P P +P
Sbjct  406   -PPPQDP  411



>gb|KFK39248.1| hypothetical protein AALP_AA3G219800 [Arabis alpina]
Length=436

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 156/245 (64%), Positives = 190/245 (78%), Gaps = 7/245 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR+  N  +LSIFVGDL+ DVTDTLL + FV +YPSVK+AKVVID+
Sbjct  179   QPFRLNWASFSTGEKRAVENGPELSIFVGDLSPDVTDTLLQELFVERYPSVKSAKVVIDS  238

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy-  697
             NTGRSKGYGFVRFGD++ERS+ALTEMNG +CS+R MR+  ATP+++    QQ A+Q    
Sbjct  239   NTGRSKGYGFVRFGDESERSRALTEMNGAFCSNRQMRVNIATPKRAVANPQQHASQALIL  298

Query  696   -----SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  +NGS A+ SQSDG+S+N TIFVGGLDP+V+DEDLRQPFSQ+G++VSVKIPVGKGC
Sbjct  299   AGGHGANGSMAYSSQSDGESNNATIFVGGLDPDVTDEDLRQPFSQFGDVVSVKIPVGKGC  358

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
             GFVQFANR  AE+A+Q L G VIGK TVRLSWGR+P  +Q R D   QW G Y  G  Y+
Sbjct  359   GFVQFANRNGAEDAIQNLNGTVIGKNTVRLSWGRSPNKQQWRGDSGQQWNGGYSRGQGYN  418

Query  351   GYTYA  337
                YA
Sbjct  419   NGGYA  423



>gb|ACN39849.1| unknown [Picea sitchensis]
Length=429

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 161/247 (65%), Positives = 191/247 (77%), Gaps = 11/247 (4%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+TFSMGE+R +   D SIFVGDL +DV+D +L +TF S+Y SVKAAKVV+DANTGRSK
Sbjct  168   NWATFSMGERRLDGGPDFSIFVGDLDSDVSDLVLQETFQSRYSSVKAAKVVMDANTGRSK  227

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFG+++ER++A+TEMNGVYCS+RPMRI AATPRKS+G Q Q++ +G    GS A 
Sbjct  228   GYGFVRFGEESERARAMTEMNGVYCSTRPMRISAATPRKSAGVQHQYSGRGN--GGSHAQ  285

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
             G  SD D +NTTIFVG LDPN +DEDLRQ F QYGE+VSVKIPVGKGCGFVQF NR  AE
Sbjct  286   GFPSDNDLNNTTIFVGRLDPNATDEDLRQVFGQYGELVSVKIPVGKGCGFVQFGNRASAE  345

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFT-------NQWAGAYYGGHFYDGYTYA  337
             EALQ+L G VI +QTVRLSWGR+PA++Q             NQW GAYY G  Y+ Y YA
Sbjct  346   EALQRLHGTVIRQQTVRLSWGRSPANKQQPQPQGQQPQSDPNQWNGAYY-GQGYESYGYA  404

Query  336   FPAPHNP  316
              P P +P
Sbjct  405   -PPPQDP  410



>emb|CDY52067.1| BnaA09g53390D [Brassica napus]
Length=419

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 176/249 (71%), Gaps = 18/249 (7%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FS GEKR  N  D SIFVGDLA +VTD LL   F  KYPSVK AKVVID  
Sbjct  160   QPYRLNWASFSTGEKRLENGPDHSIFVGDLAPEVTDELLHKLFFDKYPSVKTAKVVIDGT  219

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD ERS+AL EMNGV C SR MR+GAATPRK               N
Sbjct  220   TGRSKGYGFVRFGDDGERSKALVEMNGVKCCSRAMRVGAATPRKP--------------N  265

Query  690   GSPAHG---SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  520
             G    G   +  DGDS NTTIFVGGLD +V+DE LRQPF+ +GEIVSVKIPVGKGCGF+Q
Sbjct  266   GYQHQGGGAAPRDGDSLNTTIFVGGLDADVTDEVLRQPFAGFGEIVSVKIPVGKGCGFIQ  325

Query  519   FANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
             F NR +AEEAL+KL G VIGKQTVRLSWGRN  ++Q R  + +QW   +Y G +Y+GY Y
Sbjct  326   FVNRENAEEALEKLNGSVIGKQTVRLSWGRNQGNKQPRGGYGDQWVEPFYRGQYYNGYGY  385

Query  339   A-FPAPHNP  316
                P P +P
Sbjct  386   MPLPPPIDP  394


 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 95/204 (47%), Gaps = 33/204 (16%)
 Frame = -2

Query  1020  SMGEKRSN--NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYG  847
             S G K  N  NA + +I++GDL   + +  L   F      + + KV+ + +TG S+GYG
Sbjct  75    SRGNKHQNASNAENKTIWIGDLLHWMDENYLNSCFAPA-GEMASVKVIRNKHTGLSEGYG  133

Query  846   FVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHG  673
             FV F   +   + L + NGV    S +P R+  A                     S + G
Sbjct  134   FVEFDSHDIAEKVLQDFNGVTMLQSDQPYRLNWA---------------------SFSTG  172

Query  672   SQSDGDSSNTTIFVGGLDPNVSDEDLRQP-FSQYGEIVSVKIPV------GKGCGFVQFA  514
              +   +  + +IFVG L P V+DE L +  F +Y  + + K+ +       KG GFV+F 
Sbjct  173   EKRLENGPDHSIFVGDLAPEVTDELLHKLFFDKYPSVKTAKVVIDGTTGRSKGYGFVRFG  232

Query  513   NRTDAEEALQKLKGLVIGKQTVRL  442
             +  +  +AL ++ G+    + +R+
Sbjct  233   DDGERSKALVEMNGVKCCSRAMRV  256



>ref|XP_010519119.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
RBP47C-like [Tarenaya hassleriana]
Length=424

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 182/264 (69%), Positives = 205/264 (78%), Gaps = 12/264 (5%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW++FS GEKR  N  DLSIFVGDL+ DVTD LL +TF  KYPSVKAAKVVIDANTGRSK
Sbjct  171   NWASFSTGEKRLENGPDLSIFVGDLSPDVTDKLLHETFSVKYPSVKAAKVVIDANTGRSK  230

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDNER++A++EMNGV CSSR MRIG ATPRK        +       G   +
Sbjct  231   GYGFVRFGDDNERAKAMSEMNGVKCSSRAMRIGPATPRK--------SINYQQQGGYMLN  282

Query  675   GSQS--DGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTD  502
             G QS  DGDS NTTIFVGGLDP+V+DEDLRQPF +YG+IVS   P GKGCGFVQF NRT 
Sbjct  283   GVQSYPDGDSLNTTIFVGGLDPSVTDEDLRQPFIEYGDIVSX--PAGKGCGFVQFVNRTS  340

Query  501   AEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPH  322
             AEEAL+KL G VIGKQTVRLSWGRNPA++Q R  F NQW G YYGG +Y+GY Y  P P 
Sbjct  341   AEEALEKLNGTVIGKQTVRLSWGRNPANKQLRGGFGNQWVGPYYGGQYYNGYGYMIPPPL  400

Query  321   NPNmyapaaygaypmyGTHQQQVS  250
             +P MY+PAAYGAYP+Y  +QQQVS
Sbjct  401   DPIMYSPAAYGAYPVYVGNQQQVS  424



>ref|XP_009114049.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Brassica 
rapa]
Length=419

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 176/249 (71%), Gaps = 18/249 (7%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FS GEKR  N  D SIFVGDLA +VTD LL   F  KYPSVK AKVVID  
Sbjct  160   QPYRLNWASFSTGEKRLENGPDHSIFVGDLAPEVTDELLHKLFFDKYPSVKTAKVVIDGT  219

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD ERS+AL EMNGV C SR MR+GAATPRK               N
Sbjct  220   TGRSKGYGFVRFGDDGERSKALVEMNGVKCCSRAMRVGAATPRKP--------------N  265

Query  690   GSPAHG---SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  520
             G    G   +  DGDS NTTIFVGGLD +V+DE LRQPF+ +GEIVSVKIPVGKGCGF+Q
Sbjct  266   GYQHQGGGAAPRDGDSLNTTIFVGGLDADVTDEVLRQPFAGFGEIVSVKIPVGKGCGFIQ  325

Query  519   FANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
             F NR +AEEAL+KL G VIGKQTVRLSWGRN  ++Q R  + +QW   +Y G +Y+GY Y
Sbjct  326   FVNRENAEEALEKLNGSVIGKQTVRLSWGRNQGNKQPRGGYGDQWVEPFYRGQYYNGYGY  385

Query  339   A-FPAPHNP  316
                P P +P
Sbjct  386   MPLPPPIDP  394


 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 95/204 (47%), Gaps = 33/204 (16%)
 Frame = -2

Query  1020  SMGEKRSN--NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYG  847
             S G K  N  NA + +I++GDL   + +  L   F      + + KV+ + +TG S+GYG
Sbjct  75    SRGNKHQNASNAENKTIWIGDLLHWMDENYLNSCFAPA-GEMASVKVIRNKHTGLSEGYG  133

Query  846   FVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHG  673
             FV F   +   + L + NGV    S +P R+  A                     S + G
Sbjct  134   FVEFDSHDIAEKVLQDFNGVTMLQSDQPYRLNWA---------------------SFSTG  172

Query  672   SQSDGDSSNTTIFVGGLDPNVSDEDLRQP-FSQYGEIVSVKIPV------GKGCGFVQFA  514
              +   +  + +IFVG L P V+DE L +  F +Y  + + K+ +       KG GFV+F 
Sbjct  173   EKRLENGPDHSIFVGDLAPEVTDELLHKLFFDKYPSVKTAKVVIDGTTGRSKGYGFVRFG  232

Query  513   NRTDAEEALQKLKGLVIGKQTVRL  442
             +  +  +AL ++ G+    + +R+
Sbjct  233   DDGERSKALVEMNGVKCCSRAMRV  256



>ref|XP_006297696.1| hypothetical protein CARUB_v10013726mg [Capsella rubella]
 gb|EOA30594.1| hypothetical protein CARUB_v10013726mg [Capsella rubella]
Length=438

 Score =   279 bits (714),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 190/245 (78%), Gaps = 7/245 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR+  N  DLS+FVGDL+ DVTD LL +TF ++YPSVK AKVVID+
Sbjct  182   QPFRLNWASFSTGEKRAVENGPDLSVFVGDLSPDVTDDLLHETFSTRYPSVKGAKVVIDS  241

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy-  697
             NTGRSKGYGFVRFGD+NERS+ALTEMNG +CS+R MR+G ATP+++   QQQ ++Q    
Sbjct  242   NTGRSKGYGFVRFGDENERSRALTEMNGAFCSNRQMRVGIATPKRAVANQQQHSSQALIL  301

Query  696   -----SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  +NG  AHGSQSDG+S+N+TIFVGG+DP+V+DEDLRQPFSQ+GE+VSVKIPVGKGC
Sbjct  302   AGGHGANGYMAHGSQSDGESTNSTIFVGGIDPDVTDEDLRQPFSQFGEVVSVKIPVGKGC  361

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
             GFVQFA+R  AE+A++ L G VIGK TVRLSWGR+P  +    D   QW G Y  G  Y+
Sbjct  362   GFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRSPNKQWRGGDSGQQWNGGYSRGQGYN  421

Query  351   GYTYA  337
                YA
Sbjct  422   NGGYA  426



>ref|NP_001047180.1| Os02g0567900 [Oryza sativa Japonica Group]
 dbj|BAF09094.1| Os02g0567900, partial [Oryza sativa Japonica Group]
Length=259

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 151/241 (63%), Positives = 182/241 (76%), Gaps = 13/241 (5%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+++SMGEKR+  ASD SIFVGDLA DVTD +L+D F  KY SVK AKV+IDANTGRS+
Sbjct  13    NWASYSMGEKRAELASDHSIFVGDLAVDVTDEMLMDLFAKKYRSVKGAKVIIDANTGRSR  72

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDN+++ A+TEMNG YCS+RP+RIG ATPR+SSG                + 
Sbjct  73    GYGFVRFGDDNDKTHAMTEMNGAYCSTRPIRIGPATPRRSSGDSGS------------SP  120

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
               QSD DS+N TI+VGGLDPN ++++LR+ F++YG++ SVKIPVGK CGFVQF NR DAE
Sbjct  121   PRQSDSDSTNRTIYVGGLDPNATEDELRKAFAKYGDLASVKIPVGKQCGFVQFVNRPDAE  180

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EALQ L G  IGKQ VRLSWGR+PA +QSR D  ++  G YYG  FY GY YA P PH P
Sbjct  181   EALQGLNGSTIGKQAVRLSWGRSPASKQSRGDSGHRRNGMYYGTPFYGGYGYASPLPH-P  239

Query  315   N  313
             N
Sbjct  240   N  240



>ref|XP_002891364.1| ATRBP47C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67623.1| ATRBP47C [Arabidopsis lyrata subsp. lyrata]
Length=443

 Score =   279 bits (714),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 180/268 (67%), Positives = 207/268 (77%), Gaps = 7/268 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR  NN  DLSIFVGDLA DV+DTLL +TF  KYPSVKAAKVVIDA
Sbjct  182   QPFRLNWASFSTGEKRLENNGPDLSIFVGDLAPDVSDTLLHETFSEKYPSVKAAKVVIDA  241

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS  694
             NTGRSKGYGFVRFGD+NER++A+TEMNGV CSSR MRIG ATPRK++GYQQQ        
Sbjct  242   NTGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRIGPATPRKTTGYQQQGGYMP---  298

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+    ++ +GD+ NTTIFVGGLD +V+D+DLRQPFS++GEIVSVKIPVGKGCGFVQF 
Sbjct  299   NGA---LTRPEGDTLNTTIFVGGLDSSVTDDDLRQPFSEFGEIVSVKIPVGKGCGFVQFV  355

Query  513   NRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAF  334
             NR  AEEAL+KL G VIGKQTVRLSWGRN A++Q R  + NQW   YYGG +Y+GY Y  
Sbjct  356   NRPSAEEALEKLNGTVIGKQTVRLSWGRNQANKQPRDKYGNQWVAPYYGGQYYNGYGYMV  415

Query  333   PAPHNPNmyapaaygaypmyGTHQQQVS  250
             P P      A    G Y MYG HQQQVS
Sbjct  416   PQPDPRMYPATPYGGGYRMYGGHQQQVS  443


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 95/200 (48%), Gaps = 31/200 (16%)
 Frame = -2

Query  1008  KRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVK--AAKVVIDANTGRSKGYGFVRF  835
             + ++N  + +I+VGDL   + +T L  +F S    ++  + KV+ + + G S+GYGFV F
Sbjct  100   QNASNGENKTIWVGDLHHWMDETYLNSSFASADGEIQIVSVKVIRNKHNGLSEGYGFVEF  159

Query  834   GDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHGSQSD  661
                +   + L E NG     + +P R+  A+             +    N  P       
Sbjct  160   DSHDVADKVLQEFNGTTMPDTEQPFRLNWAS---------FSTGEKRLENNGP-------  203

Query  660   GDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVKIPV------GKGCGFVQFANRTD  502
                 + +IFVG L P+VSD  L + FS+ Y  + + K+ +       KG GFV+F +  +
Sbjct  204   ----DLSIFVGDLAPDVSDTLLHETFSEKYPSVKAAKVVIDANTGRSKGYGFVRFGDENE  259

Query  501   AEEALQKLKGLVIGKQTVRL  442
               +A+ ++ G+    + +R+
Sbjct  260   RTKAMTEMNGVKCSSRAMRI  279



>emb|CDX95176.1| BnaC09g16940D [Brassica napus]
Length=419

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 178/246 (72%), Gaps = 12/246 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FS GEKR  N  D SIFVGDLA +VTD LL   F  KYPSVK AKVVID +
Sbjct  160   QPYRLNWASFSTGEKRLENGPDHSIFVGDLAPEVTDELLHKLFFHKYPSVKTAKVVIDGS  219

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD ERS+AL EMNGV C SR MR+GAATPRK +GY           N
Sbjct  220   TGRSKGYGFVRFGDDGERSKALVEMNGVKCCSRAMRVGAATPRKPNGY-----------N  268

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
                   +  DGDS NTTIFVGGLD +V+DE LRQPF+ +GEIVSVKIP+GKGCGF+QF N
Sbjct  269   HQGGGAAPRDGDSLNTTIFVGGLDADVTDEVLRQPFAGFGEIVSVKIPIGKGCGFIQFVN  328

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA-F  334
             R +AEEAL+KL G VIGKQTVRLSWGRN  ++Q R  + +QW   +Y G +Y+GY Y   
Sbjct  329   RENAEEALEKLNGSVIGKQTVRLSWGRNQGNKQPRGGYGDQWVEPFYRGQYYNGYGYMPL  388

Query  333   PAPHNP  316
             P P +P
Sbjct  389   PPPIDP  394


 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 95/204 (47%), Gaps = 33/204 (16%)
 Frame = -2

Query  1020  SMGEKRSN--NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYG  847
             S G K  N  NA + +I++GDL   + +  L   F      + + KV+ + +TG S+GYG
Sbjct  75    SRGNKHQNASNAENKTIWIGDLLHWMDENYLNSCFAPA-GEMASVKVIRNKHTGLSEGYG  133

Query  846   FVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHG  673
             FV F   +   + L + NGV    S +P R+  A                     S + G
Sbjct  134   FVEFDSHDVAEKVLQDFNGVTMLQSDQPYRLNWA---------------------SFSTG  172

Query  672   SQSDGDSSNTTIFVGGLDPNVSDEDLRQP-FSQYGEIVSVKIPV------GKGCGFVQFA  514
              +   +  + +IFVG L P V+DE L +  F +Y  + + K+ +       KG GFV+F 
Sbjct  173   EKRLENGPDHSIFVGDLAPEVTDELLHKLFFHKYPSVKTAKVVIDGSTGRSKGYGFVRFG  232

Query  513   NRTDAEEALQKLKGLVIGKQTVRL  442
             +  +  +AL ++ G+    + +R+
Sbjct  233   DDGERSKALVEMNGVKCCSRAMRV  256



>ref|XP_009358068.1| PREDICTED: polyadenylate-binding protein RBP47-like [Pyrus x 
bretschneideri]
Length=390

 Score =   277 bits (708),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 184/229 (80%), Gaps = 7/229 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS  +KR++ ++DLSIFVGDLA DVTDT+L +TF S+Y SVK AKVV+DAN
Sbjct  127   QPFRLNWATFSASDKRADTSADLSIFVGDLATDVTDTMLQETFSSRYSSVKGAKVVLDAN  186

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg----  703
             TGRSKGYGFVRFGD+NERS+A+ EMNG YCSSR MRIG ATP+K+  YQQQ+A+Q     
Sbjct  187   TGRSKGYGFVRFGDENERSRAIAEMNGAYCSSRAMRIGVATPKKAPAYQQQYASQALVLA  246

Query  702   ---gySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  SNG+ A GSQ D + +NTTIFVGGLD  V+DEDLRQPFS +GE+VSVKIPVGK C
Sbjct  247   GGGHASNGAVAQGSQFDSEPNNTTIFVGGLDSEVNDEDLRQPFSHFGEVVSVKIPVGKAC  306

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             GFVQFANR DAE A+Q L G VIGKQTVRLSWGR+  ++Q RSD +NQW
Sbjct  307   GFVQFANRKDAENAIQMLNGTVIGKQTVRLSWGRSQGNKQWRSDSSNQW  355


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 88/197 (45%), Gaps = 36/197 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+GYGFV F       + L   NG     + +P R+  AT      
Sbjct  82   VSSIKVIRNKQTGQSEGYGFVEFYSREAAEEVLQNYNGTAMPNTEQPFRLNWAT------  135

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            A   ++D  S++ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  136  --------------FSASDKRAD-TSADLSIFVGDLATDVTDTMLQETFSSRYSSVKGAK  180

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG---RNPAHRQSRSD  400
            + +       KG GFV+F +  +   A+ ++ G     + +R+      + PA++Q  + 
Sbjct  181  VVLDANTGRSKGYGFVRFGDENERSRAIAEMNGAYCSSRAMRIGVATPKKAPAYQQQYAS  240

Query  399  FTNQWAGAYYGGHFYDG  349
                 AG   GGH  +G
Sbjct  241  QALVLAG---GGHASNG  254



>ref|XP_011092726.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Sesamum indicum]
Length=403

 Score =   277 bits (709),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 186/245 (76%), Gaps = 13/245 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS G++R    SDLSIFVGDLA DVTD LL DTF SKYPSVK AKVV+D+N
Sbjct  152   QPFRLNWAAFSTGDRRPEAGSDLSIFVGDLATDVTDALLHDTFASKYPSVKGAKVVVDSN  211

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGD+N++S+A+TEMNGVYCSSRPMRIG ATP+K S  Q   +     S 
Sbjct  212   TGRSKGYGFVRFGDENDKSRAMTEMNGVYCSSRPMRIGVATPKKPSPQQLYSSQAMVLSG  271

Query  690   GSPAHGS----QSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFV  523
             G  ++G+     SD DSSNTT+FVGGLD +V+DE LR+ F+ YGE+VSVKIP GKGCGFV
Sbjct  272   GYASNGAGPVGHSDSDSSNTTVFVGGLDSDVTDEQLRESFTPYGEVVSVKIPAGKGCGFV  331

Query  522   QFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYT  343
             QFANR++AE+A+Q+L G VIGKQTVRLSWGRN  ++Q+         GAYYG   Y+GY 
Sbjct  332   QFANRSNAEDAIQRLNGTVIGKQTVRLSWGRNLGNKQN---------GAYYGRQGYNGYG  382

Query  342   YAFPA  328
             YA  A
Sbjct  383   YAGAA  387



>gb|ACG32072.1| nucleic acid binding protein [Zea mays]
 gb|ACG34530.1| nucleic acid binding protein [Zea mays]
 gb|AFW58432.2| hypothetical protein ZEAMMB73_000058 [Zea mays]
Length=369

 Score =   276 bits (705),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 190/246 (77%), Gaps = 14/246 (6%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+++SMGEKRS  ASD SIFVGDLAADVTD +LL+ F SKY SVK AKV+IDAN
Sbjct  119   RPFKLNWASYSMGEKRSEVASDHSIFVGDLAADVTDEMLLELFSSKYRSVKGAKVIIDAN  178

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRS+GYGFVRFGDDN++S A++EMNGVYCS+RP+RIG ATPR+SSG             
Sbjct  179   TGRSRGYGFVRFGDDNDKSHAMSEMNGVYCSTRPIRIGPATPRRSSGDSGSS--------  230

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
              +P H   SDGDSSN T++VGGLDPNVS+++LR+ F++Y ++ SVKIP+GK CGFVQF +
Sbjct  231   -TPGH---SDGDSSNRTVYVGGLDPNVSEDELRKAFAKY-DLASVKIPLGKQCGFVQFVS  285

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             RTDAEEALQ L G +IGKQ VRLSW R+P+H+QSR D  N+    YYG  FY GY YA P
Sbjct  286   RTDAEEALQGLNGSLIGKQAVRLSWVRSPSHKQSRGDSVNRRNNMYYGTPFYGGYGYASP  345

Query  330   APHNPN  313
              PH PN
Sbjct  346   VPH-PN  350


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V   KV+ +  TG+S+GYGFV F       +AL    G     + RP ++  A       
Sbjct  74   VVTIKVIRNRQTGQSEGYGFVEFFSHASAEKALQNFTGHVMPNTDRPFKLNWA-------  126

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+DE L + F S+Y  +   K
Sbjct  127  --------------SYSMGEKRSEVASDHSIFVGDLAADVTDEMLLELFSSKYRSVKGAK  172

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       +G GFV+F +  D   A+ ++ G+    + +R+
Sbjct  173  VIIDANTGRSRGYGFVRFGDDNDKSHAMSEMNGVYCSTRPIRI  215



>ref|XP_004952707.1| PREDICTED: polyadenylate-binding protein RBP47C'-like [Setaria 
italica]
Length=428

 Score =   278 bits (710),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 157/243 (65%), Positives = 185/243 (76%), Gaps = 15/243 (6%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+++SMGEKRS  ASD SIFVGDLA DVTD +LLD F SKY SVK AKV+IDANTGRS+
Sbjct  180   NWASYSMGEKRSELASDHSIFVGDLAVDVTDDMLLDLFSSKYRSVKGAKVIIDANTGRSR  239

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDN+++ A+TEMNGVYCS+RP+R+G ATPR+S G              SP  
Sbjct  240   GYGFVRFGDDNDKTHAMTEMNGVYCSTRPIRVGPATPRRSQGDS----------GSSPPR  289

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
               QSD DS+N T++VGGLDPNVS+E+LR+ F++YG++ SVKIPVGK CGFVQF NR DAE
Sbjct  290   --QSDADSTNRTVYVGGLDPNVSEEELRKAFAKYGDLASVKIPVGKQCGFVQFVNRADAE  347

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW--AGAYYGGHFYDGYTYAFPAPH  322
             EALQ L G  IGKQ VRLSWGR+PA +QSR D  ++    G YYG  FY GY YA P PH
Sbjct  348   EALQGLNGSTIGKQAVRLSWGRSPASKQSRGDSGHRRNGNGMYYGTPFYGGYGYASPVPH  407

Query  321   NPN  313
              PN
Sbjct  408   -PN  409



>ref|XP_003518846.1| PREDICTED: polyadenylate-binding protein RBP47-like [Glycine 
max]
Length=431

 Score =   278 bits (710),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 179/219 (82%), Gaps = 7/219 (3%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNA-SDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW+TFS GE+RS++A SDLSIFVGDLA DVTD +L DTF  +Y S+K AKVVID+NTGRS
Sbjct  176   NWATFSAGERRSSDATSDLSIFVGDLAIDVTDAMLQDTFAGRYSSIKGAKVVIDSNTGRS  235

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKss------gyqqqfaaqggy  697
             KGYGFVRFGD+NER++A+TEMNGVYCSSRPMRIG ATP+K+         Q    A G  
Sbjct  236   KGYGFVRFGDENERTRAMTEMNGVYCSSRPMRIGVATPKKTYGFQQQYSSQAVVLAGGHS  295

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             +NG+ A GS S+GD +NTTIFVGGLD + SDEDLRQPF Q+GE+VSVKIPVGKGCGFVQF
Sbjct  296   ANGAVAQGSHSEGDINNTTIFVGGLDSDTSDEDLRQPFLQFGEVVSVKIPVGKGCGFVQF  355

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  400
             A+R +AEEA+Q L G VIGKQTVRLSWGR+P ++  RSD
Sbjct  356   ADRKNAEEAIQGLNGTVIGKQTVRLSWGRSPGNKHWRSD  394


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 73/163 (45%), Gaps = 29/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V +AKV+ +  TG+S+GYGFV F       + L   NG     + +  R+  AT      
Sbjct  126  VVSAKVIRNKQTGQSEGYGFVEFYSRGTAEKVLQNYNGTMMPNTDQAFRLNWAT------  179

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFS-QYGEIVSVK  553
                            A   +S   +S+ +IFVG L  +V+D  L+  F+ +Y  I   K
Sbjct  180  --------------FSAGERRSSDATSDLSIFVGDLAIDVTDAMLQDTFAGRYSSIKGAK  225

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  226  VVIDSNTGRSKGYGFVRFGDENERTRAMTEMNGVYCSSRPMRI  268



>gb|EEC73442.1| hypothetical protein OsI_07730 [Oryza sativa Indica Group]
Length=312

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 152/241 (63%), Positives = 182/241 (76%), Gaps = 13/241 (5%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+++SMGEKRS  ASD SIFVGDLA DVTD +L+D F  KY SVK AKV+IDANTGRS+
Sbjct  66    NWASYSMGEKRSELASDHSIFVGDLAVDVTDEMLMDLFAKKYRSVKGAKVIIDANTGRSR  125

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDN+++ A+TEMNG YCS+RP+RIG ATPR+SSG       +          
Sbjct  126   GYGFVRFGDDNDKTHAMTEMNGAYCSTRPIRIGPATPRRSSGDSGSSPPR----------  175

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
               QSD DS+N TI+VGGLDPN ++++LR+ F++YG++ SVKIPVGK CGFVQF NR DAE
Sbjct  176   --QSDSDSTNRTIYVGGLDPNATEDELRKAFAKYGDLASVKIPVGKQCGFVQFVNRPDAE  233

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EALQ L G  IGKQ VRLSWGR+PA +QSR D  ++  G YYG  FY GY YA P PH P
Sbjct  234   EALQGLNGSTIGKQAVRLSWGRSPASKQSRGDSGHRRNGMYYGTPFYGGYGYASPLPH-P  292

Query  315   N  313
             N
Sbjct  293   N  293



>ref|XP_009356988.1| PREDICTED: polyadenylate-binding protein RBP47-like [Pyrus x 
bretschneideri]
Length=445

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 187/233 (80%), Gaps = 7/233 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G++R++ +SDLSIFVGDLA DVTDT+L +TF S+Y SVK AKVV+DAN
Sbjct  183   QPFRLNWATFSAGDRRADPSSDLSIFVGDLATDVTDTMLQETFSSRYSSVKGAKVVLDAN  242

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg----  703
             TGRSKGYGFVRFGD+NERS+A+ EMNG YCSSR MRIG ATP+KS  YQQQ+++Q     
Sbjct  243   TGRSKGYGFVRFGDENERSRAIAEMNGAYCSSRAMRIGVATPKKSPAYQQQYSSQALVLA  302

Query  702   ---gySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  SN + A GSQ D + +NTTIFVGGLD  V+DEDLRQPFS +GE+VSVKIPVGK C
Sbjct  303   GGGHASNVAVAQGSQFDSEPNNTTIFVGGLDSEVNDEDLRQPFSHFGEVVSVKIPVGKAC  362

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAY  373
             GFVQFANR DAE A+Q L G VIGKQTVRLSWGR+  ++Q RSD +NQW GA+
Sbjct  363   GFVQFANRKDAENAIQMLNGTVIGKQTVRLSWGRSQGNKQWRSDSSNQWNGAH  415


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 87/193 (45%), Gaps = 36/193 (19%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+GYGFV F       + L   NGV    + +P R+  AT      
Sbjct  138  VSSVKVIRNKQTGQSEGYGFVEFYSREVAEEVLQNCNGVPMPNTEQPFRLNWAT------  191

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +    SS+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  192  ---------------FSAGDRRADPSSDLSIFVGDLATDVTDTMLQETFSSRYSSVKGAK  236

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG---RNPAHRQSRSD  400
            + +       KG GFV+F +  +   A+ ++ G     + +R+      ++PA++Q  S 
Sbjct  237  VVLDANTGRSKGYGFVRFGDENERSRAIAEMNGAYCSSRAMRIGVATPKKSPAYQQQYSS  296

Query  399  FTNQWAGAYYGGH  361
                 AG   GGH
Sbjct  297  QALVLAG---GGH  306



>ref|XP_010442131.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=432

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 155/244 (64%), Positives = 181/244 (74%), Gaps = 8/244 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FS GEKR  +  DLSIFVGDLA +VTDTLL   F  KYPSVK AKVVID  
Sbjct  170   QPFRLNWASFSTGEKRLESGPDLSIFVGDLAPEVTDTLLEKLFSEKYPSVKNAKVVIDGI  229

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             +GRSKGYGFVRFGDD+ERS+A+ EMNGV CSSR MRIG ATPRK SGY  Q         
Sbjct  230   SGRSKGYGFVRFGDDSERSKAMLEMNGVKCSSRAMRIGPATPRKPSGYHHQGGYMSN--G  287

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G P H    DG+S NTTIFVGGLD +V+DEDLRQPF+ +G+IVSVKIP+G+GCGF+QF N
Sbjct  288   GLPRH----DGESLNTTIFVGGLDSSVTDEDLRQPFTAFGDIVSVKIPIGRGCGFIQFVN  343

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG-AYYGGHFYDGYTYAF  334
             R +AEEAL+KL G +IGKQTVRLSWG N  ++Q R ++   W    YYGG FY+GY Y  
Sbjct  344   RENAEEALEKLNGSLIGKQTVRLSWGHNTGNKQPRGEYAEHWVDHPYYGGQFYNGYGYMV  403

Query  333   PAPH  322
             P PH
Sbjct  404   P-PH  406


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 94/204 (46%), Gaps = 33/204 (16%)
 Frame = -2

Query  1020  SMGEKRSN--NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYG  847
             S G K  N  N  + +I+VGDL   + +  L   F S    + + KV+ + + G S+GYG
Sbjct  85    SRGNKHQNASNTENKTIWVGDLLYWMDENYLNSAFSSS-GEISSVKVIRNKHNGSSEGYG  143

Query  846   FVRFGDDNERSQALTEMNG--VYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHG  673
             FV F   +   + L E NG  +  + +P R+  A                     S + G
Sbjct  144   FVEFVSHDVAEKVLQEFNGETMINAEQPFRLNWA---------------------SFSTG  182

Query  672   SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVKIPV------GKGCGFVQFA  514
              +      + +IFVG L P V+D  L + FS+ Y  + + K+ +       KG GFV+F 
Sbjct  183   EKRLESGPDLSIFVGDLAPEVTDTLLEKLFSEKYPSVKNAKVVIDGISGRSKGYGFVRFG  242

Query  513   NRTDAEEALQKLKGLVIGKQTVRL  442
             + ++  +A+ ++ G+    + +R+
Sbjct  243   DDSERSKAMLEMNGVKCSSRAMRI  266



>ref|XP_008813039.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X3 
[Phoenix dactylifera]
Length=350

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 173/213 (81%), Gaps = 12/213 (6%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLAADVTD +L +TF SKYPSVK AKVVIDAN
Sbjct  147   QPFRLNWASFSMGDRRSDVASDHSIFVGDLAADVTDAMLQETFASKYPSVKGAKVVIDAN  206

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFG+DNE++ A+TEMNGVYCSSRPMRIG ATPRKSSG             
Sbjct  207   TGRSKGYGFVRFGNDNEKTLAMTEMNGVYCSSRPMRIGPATPRKSSGGS-----------  255

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
                +   QSDGDS+NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK CGFVQF  
Sbjct  256   -GNSASGQSDGDSTNTTVFVGGLDPNVSEDDLRQAFSQYGEIASVKIPVGKQCGFVQFVQ  314

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQ  412
             R +A+EALQ L G VIGKQ VRLSWGRNPA++Q
Sbjct  315   RNNAQEALQALNGTVIGKQQVRLSWGRNPANKQ  347



>gb|ACF85767.1| unknown [Zea mays]
 gb|AFW58431.2| hypothetical protein ZEAMMB73_000058 [Zea mays]
Length=420

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 190/246 (77%), Gaps = 14/246 (6%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+++SMGEKRS  ASD SIFVGDLAADVTD +LL+ F SKY SVK AKV+IDAN
Sbjct  170   RPFKLNWASYSMGEKRSEVASDHSIFVGDLAADVTDEMLLELFSSKYRSVKGAKVIIDAN  229

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRS+GYGFVRFGDDN++S A++EMNGVYCS+RP+RIG ATPR+SSG             
Sbjct  230   TGRSRGYGFVRFGDDNDKSHAMSEMNGVYCSTRPIRIGPATPRRSSGDSGSS--------  281

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
              +P H   SDGDSSN T++VGGLDPNVS+++LR+ F++Y ++ SVKIP+GK CGFVQF +
Sbjct  282   -TPGH---SDGDSSNRTVYVGGLDPNVSEDELRKAFAKY-DLASVKIPLGKQCGFVQFVS  336

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             RTDAEEALQ L G +IGKQ VRLSW R+P+H+QSR D  N+    YYG  FY GY YA P
Sbjct  337   RTDAEEALQGLNGSLIGKQAVRLSWVRSPSHKQSRGDSVNRRNNMYYGTPFYGGYGYASP  396

Query  330   APHNPN  313
              PH PN
Sbjct  397   VPH-PN  401


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V   KV+ +  TG+S+GYGFV F       +AL    G     + RP ++  A       
Sbjct  125  VVTIKVIRNRQTGQSEGYGFVEFFSHASAEKALQNFTGHVMPNTDRPFKLNWA-------  177

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+DE L + F S+Y  +   K
Sbjct  178  --------------SYSMGEKRSEVASDHSIFVGDLAADVTDEMLLELFSSKYRSVKGAK  223

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       +G GFV+F +  D   A+ ++ G+    + +R+
Sbjct  224  VIIDANTGRSRGYGFVRFGDDNDKSHAMSEMNGVYCSTRPIRI  266



>ref|XP_008813037.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Phoenix dactylifera]
Length=355

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 173/213 (81%), Gaps = 12/213 (6%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLAADVTD +L +TF SKYPSVK AKVVIDAN
Sbjct  147   QPFRLNWASFSMGDRRSDVASDHSIFVGDLAADVTDAMLQETFASKYPSVKGAKVVIDAN  206

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFG+DNE++ A+TEMNGVYCSSRPMRIG ATPRKSSG             
Sbjct  207   TGRSKGYGFVRFGNDNEKTLAMTEMNGVYCSSRPMRIGPATPRKSSGGS-----------  255

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
                +   QSDGDS+NTT+FVGGLDPNVS++DLRQ FSQYGEI SVKIPVGK CGFVQF  
Sbjct  256   -GNSASGQSDGDSTNTTVFVGGLDPNVSEDDLRQAFSQYGEIASVKIPVGKQCGFVQFVQ  314

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQ  412
             R +A+EALQ L G VIGKQ VRLSWGRNPA++Q
Sbjct  315   RNNAQEALQALNGTVIGKQQVRLSWGRNPANKQ  347



>gb|KFK39249.1| hypothetical protein AALP_AA3G219800 [Arabis alpina]
Length=435

 Score =   276 bits (707),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 156/245 (64%), Positives = 191/245 (78%), Gaps = 8/245 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR+  N  +LSIFVGDL+ DVTDTLL + FV +YPSVK+AKVVID+
Sbjct  179   QPFRLNWASFSTGEKRAVENGPELSIFVGDLSPDVTDTLLQELFVERYPSVKSAKVVIDS  238

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy-  697
             NTGRSKGYGFVRFGD++ERS+ALTEMNG +CS+R MR+  ATP+++    QQ A+Q    
Sbjct  239   NTGRSKGYGFVRFGDESERSRALTEMNGAFCSNRQMRVNIATPKRAVANPQQHASQALIL  298

Query  696   -----SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  +NGS A+ SQSDG+S+N TIFVGGLDP+V+DEDLRQPFSQ+G++VSVKIPVGKGC
Sbjct  299   AGGHGANGSMAYSSQSDGESNNATIFVGGLDPDVTDEDLRQPFSQFGDVVSVKIPVGKGC  358

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
             GFVQFANR  AE+A+Q L G VIGK TVRLSWGR+P ++Q R D   QW G Y  G  Y+
Sbjct  359   GFVQFANRNGAEDAIQNLNGTVIGKNTVRLSWGRSP-NKQWRGDSGQQWNGGYSRGQGYN  417

Query  351   GYTYA  337
                YA
Sbjct  418   NGGYA  422



>ref|NP_001150649.1| nucleic acid binding protein [Zea mays]
 gb|ACG39896.1| nucleic acid binding protein [Zea mays]
Length=420

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 190/246 (77%), Gaps = 14/246 (6%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+++SMGEKRS  ASD SIFVGDLAADVTD +LL+ F SKY SVK AKV+IDAN
Sbjct  170   RPFKLNWASYSMGEKRSEVASDHSIFVGDLAADVTDEMLLELFSSKYRSVKGAKVIIDAN  229

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRS+GYGFVRFGDDN++S A++EMNGVYCS+RP+RIG ATPR+SSG             
Sbjct  230   TGRSRGYGFVRFGDDNDKSHAMSEMNGVYCSTRPIRIGPATPRRSSGDSGSS--------  281

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
              +P H   SDGDSSN T++VGGLDPNVS+++LR+ F++Y ++ SVKIP+GK CGFVQF +
Sbjct  282   -TPGH---SDGDSSNRTVYVGGLDPNVSEDELRKAFAKY-DLASVKIPLGKQCGFVQFVS  336

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             RTDAEEALQ L G +IGKQ VRLSW R+P+H+QSR D  N+    YYG  FY GY YA P
Sbjct  337   RTDAEEALQGLNGSLIGKQAVRLSWVRSPSHKQSRGDSVNRRNNMYYGTPFYGGYGYASP  396

Query  330   APHNPN  313
              PH PN
Sbjct  397   VPH-PN  401


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V   KV+ +  TG+S+GYGFV F       +AL    G     + RP ++  A       
Sbjct  125  VVTIKVIRNRQTGQSEGYGFVEFFSHASAEKALQNFTGHVMPNTDRPFKLNWA-------  177

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                          S + G +    +S+ +IFVG L  +V+DE L + F S+Y  +   K
Sbjct  178  --------------SYSMGEKRSEVASDHSIFVGDLAADVTDEMLLELFSSKYRSVKGAK  223

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       +G GFV+F +  D   A+ ++ G+    + +R+
Sbjct  224  VIIDANTGRSRGYGFVRFGDDNDKSHAMSEMNGVYCSTRPIRI  266



>ref|XP_010481964.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=434

 Score =   276 bits (707),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 155/244 (64%), Positives = 180/244 (74%), Gaps = 8/244 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FS GEKR  +  DLSIFVGDLA +VTDTLL   F  KYPSVK AKVVID  
Sbjct  172   QPFRLNWASFSTGEKRLESGPDLSIFVGDLAPEVTDTLLEKLFSEKYPSVKNAKVVIDGI  231

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             +GRSKGYGFVRFGDD+ERS+A+ EMNGV CSSR MRIG ATPRK SGY  Q         
Sbjct  232   SGRSKGYGFVRFGDDSERSKAMLEMNGVKCSSRAMRIGPATPRKPSGYHHQGGYMSN--G  289

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G P H    DG+S NTTIFVGGLD +V+DEDLRQPF+ +G+IVSVKIP+G+GCGF+QF N
Sbjct  290   GLPRH----DGESLNTTIFVGGLDSSVTDEDLRQPFAAFGDIVSVKIPIGRGCGFIQFVN  345

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG-AYYGGHFYDGYTYAF  334
             R +AEEAL+KL G +IGKQTVRLSWG N   +Q R ++   W    YYGG FY+GY Y  
Sbjct  346   RENAEEALEKLNGSLIGKQTVRLSWGHNTGKKQPRGEYAEHWVDHPYYGGQFYNGYGYMV  405

Query  333   PAPH  322
             P PH
Sbjct  406   P-PH  408


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 94/204 (46%), Gaps = 33/204 (16%)
 Frame = -2

Query  1020  SMGEKRSN--NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYG  847
             S G K  N  N  + +I+VGDL   + +  L   F S    + + KV+ + + G S+GYG
Sbjct  87    SRGNKHQNASNTENKTIWVGDLLHWMDENYLNSAFSSS-GEISSVKVIRNKHHGLSEGYG  145

Query  846   FVRFGDDNERSQALTEMNG--VYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHG  673
             FV F   +   + L E NG  +  + +P R+  A                     S + G
Sbjct  146   FVEFVSHDVAEKVLQEFNGETMINAEQPFRLNWA---------------------SFSTG  184

Query  672   SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVKIPV------GKGCGFVQFA  514
              +      + +IFVG L P V+D  L + FS+ Y  + + K+ +       KG GFV+F 
Sbjct  185   EKRLESGPDLSIFVGDLAPEVTDTLLEKLFSEKYPSVKNAKVVIDGISGRSKGYGFVRFG  244

Query  513   NRTDAEEALQKLKGLVIGKQTVRL  442
             + ++  +A+ ++ G+    + +R+
Sbjct  245   DDSERSKAMLEMNGVKCSSRAMRI  268



>gb|AAM67293.1| nuclear acid binding protein, putative [Arabidopsis thaliana]
Length=392

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 186/233 (80%), Gaps = 8/233 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR+  N  DLS+FVGDL+ DVTD LL +TF  +YPSVK+AKVVID+
Sbjct  136   QPFRINWASFSTGEKRAVENGPDLSVFVGDLSPDVTDVLLHETFSDRYPSVKSAKVVIDS  195

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy-  697
             NTGRSKGYGFVRFGD+NERS+ALTEMNG YCS+R MR+G ATP+++   QQQ ++Q    
Sbjct  196   NTGRSKGYGFVRFGDENERSRALTEMNGAYCSNRQMRVGIATPKRAIANQQQHSSQAVIL  255

Query  696   -----SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  SNGS  +GSQSDG+S+N TIFVGG+DP+V DEDLRQPFSQ+GE+VSVKIPVGKGC
Sbjct  256   AGGHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQFGEVVSVKIPVGKGC  315

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAY  373
             GFVQFA+R  AE+A++ L G VIGK TVRLSWGR+P ++Q R D   QW G Y
Sbjct  316   GFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRSP-NKQWRGDSGQQWNGGY  367



>ref|NP_188544.1| RNA-binding protein 47B [Arabidopsis thaliana]
 sp|Q0WW84.1|RB47B_ARATH RecName: Full=Polyadenylate-binding protein RBP47B; Short=Poly(A)-binding 
protein RBP47B; AltName: Full=RNA-binding protein 
47B; Short=AtRBP47B [Arabidopsis thaliana]
 dbj|BAE98614.1| putative nuclear acid binding protein [Arabidopsis thaliana]
 gb|ABH04596.1| At3g19130 [Arabidopsis thaliana]
 gb|AEE76196.1| RNA-binding protein 47B [Arabidopsis thaliana]
Length=435

 Score =   276 bits (705),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 186/233 (80%), Gaps = 8/233 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR+  N  DLS+FVGDL+ DVTD LL +TF  +YPSVK+AKVVID+
Sbjct  179   QPFRINWASFSTGEKRAVENGPDLSVFVGDLSPDVTDVLLHETFSDRYPSVKSAKVVIDS  238

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy-  697
             NTGRSKGYGFVRFGD+NERS+ALTEMNG YCS+R MR+G ATP+++   QQQ ++Q    
Sbjct  239   NTGRSKGYGFVRFGDENERSRALTEMNGAYCSNRQMRVGIATPKRAIANQQQHSSQAVIL  298

Query  696   -----SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  SNGS  +GSQSDG+S+N TIFVGG+DP+V DEDLRQPFSQ+GE+VSVKIPVGKGC
Sbjct  299   AGGHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQFGEVVSVKIPVGKGC  358

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAY  373
             GFVQFA+R  AE+A++ L G VIGK TVRLSWGR+P ++Q R D   QW G Y
Sbjct  359   GFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRSP-NKQWRGDSGQQWNGGY  410



>ref|XP_008392304.1| PREDICTED: polyadenylate-binding protein RBP47 [Malus domestica]
Length=443

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 184/229 (80%), Gaps = 7/229 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G++R++ ++DLSIFVGDLA DVTDT+L +TF S+Y SVK AKVV+DAN
Sbjct  180   QPFRLNWATFSAGDRRADTSADLSIFVGDLATDVTDTMLQETFSSRYSSVKGAKVVLDAN  239

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqg----  703
             TGRSKGYGFVRFGD+NERS+A+ EMNG YCSSR MRIG ATP+K+  YQQQ+++Q     
Sbjct  240   TGRSKGYGFVRFGDENERSRAIAEMNGAYCSSRAMRIGVATPKKAPAYQQQYSSQALVLA  299

Query  702   ---gySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  SNG+ A GSQ D + +NTTIFVGGLD  V+DEDLR PFS +GE+VSVKIPVGK C
Sbjct  300   GGGHASNGAVAQGSQFDSEPNNTTIFVGGLDSEVNDEDLRLPFSHFGEVVSVKIPVGKAC  359

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             GFVQFANR DAE A+Q L G VIGKQTVRLSWGR+  ++Q RSD +NQW
Sbjct  360   GFVQFANRKDAENAIQMLNGTVIGKQTVRLSWGRSQGNKQWRSDSSNQW  408


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 87/197 (44%), Gaps = 36/197 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+GYGFV F       + L   NG     + +P R+  AT      
Sbjct  135  VSSIKVIRNKQTGQSEGYGFVEFYSREAAEEVLQNYNGTAMPNTEQPFRLNWAT------  188

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +    S++ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  189  ---------------FSAGDRRADTSADLSIFVGDLATDVTDTMLQETFSSRYSSVKGAK  233

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG---RNPAHRQSRSD  400
            + +       KG GFV+F +  +   A+ ++ G     + +R+      + PA++Q  S 
Sbjct  234  VVLDANTGRSKGYGFVRFGDENERSRAIAEMNGAYCSSRAMRIGVATPKKAPAYQQQYSS  293

Query  399  FTNQWAGAYYGGHFYDG  349
                 AG   GGH  +G
Sbjct  294  QALVLAG---GGHASNG  307



>ref|XP_011092727.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Sesamum indicum]
Length=387

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/241 (64%), Positives = 181/241 (75%), Gaps = 21/241 (9%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+ FS G++R    SDLSIFVGDLA DVTD LL DTF SKYPSVK AKVV+D+N
Sbjct  152   QPFRLNWAAFSTGDRRPEAGSDLSIFVGDLATDVTDALLHDTFASKYPSVKGAKVVVDSN  211

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGD+N++S+A+TEMNGVYCSSRPMRIG ATP+K S  Q           
Sbjct  212   TGRSKGYGFVRFGDENDKSRAMTEMNGVYCSSRPMRIGVATPKKPSPQQLYS--------  263

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
              S  H   SD DSSNTT+FVGGLD +V+DE LR+ F+ YGE+VSVKIP GKGCGFVQFAN
Sbjct  264   -SQGH---SDSDSSNTTVFVGGLDSDVTDEQLRESFTPYGEVVSVKIPAGKGCGFVQFAN  319

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFP  331
             R++AE+A+Q+L G VIGKQTVRLSWGRN  ++Q+         GAYYG   Y+GY YA  
Sbjct  320   RSNAEDAIQRLNGTVIGKQTVRLSWGRNLGNKQN---------GAYYGRQGYNGYGYAGA  370

Query  330   A  328
             A
Sbjct  371   A  371



>ref|XP_004145357.2| PREDICTED: polyadenylate-binding protein RBP47 [Cucumis sativus]
Length=437

 Score =   274 bits (701),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 185/226 (82%), Gaps = 5/226 (2%)
 Frame = -2

Query  1047  PAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANT  868
             P   NW+TFS  ++R +  SDLSIFVGDLAADVTD +L +TF S+Y SVK AKVVID+N+
Sbjct  172   PFRLNWATFSANDRRPDTGSDLSIFVGDLAADVTDAILQETFSSRYTSVKGAKVVIDSNS  231

Query  867   GRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS--  694
             GRSKGYGFVRFGD+NER++A+TEMNG+YCSSRPMRIG ATP+K+SGYQQ +A+Q      
Sbjct  232   GRSKGYGFVRFGDENERTRAMTEMNGIYCSSRPMRIGVATPKKASGYQQGYASQALVLAG  291

Query  693   ---NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFV  523
                NG    GSQSD +S+NTTIFVGGLD +VSDEDL+Q FS++G++VSVKIP+GKGCGFV
Sbjct  292   GHPNGMAVQGSQSDSESNNTTIFVGGLDSDVSDEDLKQAFSKFGDVVSVKIPIGKGCGFV  351

Query  522   QFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             QFANR +AE+A+Q L G VIGKQTVRLSWGR+  ++Q R D  NQW
Sbjct  352   QFANRKNAEDAIQGLNGTVIGKQTVRLSWGRSTGNKQWRGDSNNQW  397


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+GYGFV F       + L   NG     +  P R+  AT      
Sbjct  126  VSSVKVICNKQTGQSEGYGFVEFFSHTTAEKVLQNYNGTIMPNTELPFRLNWAT------  179

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                       ++  P  G       S+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  180  --------FSANDRRPDTG-------SDLSIFVGDLAADVTDAILQETFSSRYTSVKGAK  224

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  225  VVIDSNSGRSKGYGFVRFGDENERTRAMTEMNGIYCSSRPMRI  267



>ref|XP_010494212.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Camelina 
sativa]
Length=428

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 155/244 (64%), Positives = 180/244 (74%), Gaps = 8/244 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FS GEKR  +  DLSIFVGDLA +VTDTLL   F  KYPSVK AKVV+D  
Sbjct  166   QPFRLNWASFSTGEKRLESGPDLSIFVGDLAPEVTDTLLEKLFSEKYPSVKNAKVVMDGI  225

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             +GRSKGYGFVRFGD+NERS+A+ EMNGV C SR MRIG ATPRK SGY QQ         
Sbjct  226   SGRSKGYGFVRFGDENERSKAMLEMNGVKCCSRAMRIGPATPRKPSGYHQQGGYMSN--G  283

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G P H    DG+S NTTIFVGGLD +V+DEDLRQPF+ +GEIVSVKIP+G+GCGF+QF N
Sbjct  284   GLPRH----DGESLNTTIFVGGLDSSVTDEDLRQPFAAFGEIVSVKIPIGRGCGFIQFVN  339

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAG-AYYGGHFYDGYTYAF  334
             R +AEEAL KL G +IGKQTVRLSWG N  ++Q R ++   W    YYGG FY+GY Y  
Sbjct  340   RENAEEALGKLNGSLIGKQTVRLSWGHNTGNKQPRGEYAEHWVDHPYYGGQFYNGYGYMV  399

Query  333   PAPH  322
             P PH
Sbjct  400   P-PH  402


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 95/204 (47%), Gaps = 33/204 (16%)
 Frame = -2

Query  1020  SMGEKRSN--NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSKGYG  847
             S G K  N  N  + +I+VGDL   + +  L   F S    + + KV+ + +TGRS+GYG
Sbjct  81    SRGNKHQNASNTENKTIWVGDLLHWMDENYLNSAFSSS-GEISSVKVIRNKHTGRSEGYG  139

Query  846   FVRFGDDNERSQALTEMNG--VYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAHG  673
             FV F   +   + L E NG  +  + +P R+  A                     S + G
Sbjct  140   FVEFVSHDVAEKVLQEFNGETMINAEQPFRLNWA---------------------SFSTG  178

Query  672   SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVKIPV------GKGCGFVQFA  514
              +      + +IFVG L P V+D  L + FS+ Y  + + K+ +       KG GFV+F 
Sbjct  179   EKRLESGPDLSIFVGDLAPEVTDTLLEKLFSEKYPSVKNAKVVMDGISGRSKGYGFVRFG  238

Query  513   NRTDAEEALQKLKGLVIGKQTVRL  442
             +  +  +A+ ++ G+    + +R+
Sbjct  239   DENERSKAMLEMNGVKCCSRAMRI  262



>gb|ACL54800.1| unknown [Zea mays]
 tpg|DAA40261.1| TPA: hypothetical protein ZEAMMB73_589753 [Zea mays]
Length=322

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 182/245 (74%), Gaps = 15/245 (6%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLA+DV D  LL+ F S+Y SVK AKVVIDAN
Sbjct  61    QPFRLNWASFSMGDRRSDVASDHSIFVGDLASDVNDATLLEVFSSRYSSVKGAKVVIDAN  120

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+E++ A+TEMNGVYCSSRPMRIG ATPRKSSG             
Sbjct  121   TGRSKGYGFVRFGDDSEKTHAMTEMNGVYCSSRPMRIGPATPRKSSGTSGSNG-------  173

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
                +      GD +NTT+FVGGLDP+VS+EDLRQ FSQYGEI SVKIPVGK CGFVQFA 
Sbjct  174   ---SSARPDGGDLTNTTVFVGGLDPDVSEEDLRQAFSQYGEISSVKIPVGKQCGFVQFAQ  230

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTN-QW--AGAYYGG-HFYDGYT  343
             R +AE+ALQ L G  IGKQ VRLSWGRNPA++Q R D  N QW   G YY    FY+G  
Sbjct  231   RKNAEDALQGLNGSTIGKQAVRLSWGRNPANKQFRGDNGNMQWKNGGVYYAAPPFYNG-G  289

Query  342   YAFPA  328
             Y +PA
Sbjct  290   YGYPA  294



>ref|XP_006279885.1| hypothetical protein CARUB_v100264670mg, partial [Capsella rubella]
 gb|EOA12783.1| hypothetical protein CARUB_v100264670mg, partial [Capsella rubella]
Length=307

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 173/223 (78%), Gaps = 6/223 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FS GEKR  +  DLSIFVGDLA +VTDTLL   F  KYPSVK AKVVID N
Sbjct  46    QPFRLNWASFSTGEKRLESGPDLSIFVGDLAPEVTDTLLEKLFSEKYPSVKNAKVVIDGN  105

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+ERS+A+ EMNGV C SR MRIG ATPRK SGY QQ         
Sbjct  106   TGRSKGYGFVRFGDDSERSKAMLEMNGVKCISRAMRIGPATPRKPSGYHQQGGYMSN--G  163

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G P H    DGDS NTTIFVGGLD +V+DEDLRQPF+ +GEIVSVKIP+G+GCGF+QF N
Sbjct  164   GFPRH----DGDSLNTTIFVGGLDSSVTDEDLRQPFAGFGEIVSVKIPIGRGCGFIQFVN  219

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWA  382
             R +AEEAL+KL G +IGKQTVRLSWGRNP ++Q R ++T+ W 
Sbjct  220   RENAEEALEKLNGSMIGKQTVRLSWGRNPGNKQPRGEYTDPWV  262


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 77/163 (47%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNG--VYCSSRPMRIGAATPRKssg  730
            + + KV+ + +TG S+GYGFV F   +   + L E NG  +  + +P R+  A       
Sbjct  1    ISSVKVIRNKHTGLSEGYGFVEFVSHDVAEKVLQEFNGETMIDAEQPFRLNWA-------  53

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVK  553
                          S + G +      + +IFVG L P V+D  L + FS+ Y  + + K
Sbjct  54   --------------SFSTGEKRLESGPDLSIFVGDLAPEVTDTLLEKLFSEKYPSVKNAK  99

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + ++  +A+ ++ G+    + +R+
Sbjct  100  VVIDGNTGRSKGYGFVRFGDDSERSKAMLEMNGVKCISRAMRI  142



>ref|XP_004294842.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=454

 Score =   274 bits (700),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 182/229 (79%), Gaps = 7/229 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G++R++ +SDLSIFVGDLA DVTDT+L +TF S+Y SVK AKVV DAN
Sbjct  190   QPFRLNWATFSAGDRRADTSSDLSIFVGDLATDVTDTMLQETFASRYSSVKGAKVVQDAN  249

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKss-------gyqqqfa  712
             TGRSKGYGFVRFGD+NER++A+ EMNG YCSSRPMRIG ATP+KSS             A
Sbjct  250   TGRSKGYGFVRFGDENERTKAIVEMNGAYCSSRPMRIGVATPKKSSGYQQQYSSQALVLA  309

Query  711   aqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
               GG++NG  A GSQSDG+ +NTTIFVGGLD +V++EDLRQPFSQ+GE++SVKIPVGK C
Sbjct  310   GGGGHANGGVAQGSQSDGEPNNTTIFVGGLDSDVNEEDLRQPFSQFGEVISVKIPVGKAC  369

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             GFVQFANR DAE A+  L   VIGKQTVRLSWGR+  ++Q RSD  NQW
Sbjct  370   GFVQFANRKDAENAMNMLNATVIGKQTVRLSWGRSQGNKQWRSDSNNQW  418


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+++GYGFV F       + L   NG     + +P R+  AT      
Sbjct  145  VSSVKVIRNKQTGQTEGYGFVEFYSREAAEEVLQTYNGTPMPNTEQPFRLNWAT------  198

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                            + G +    SS+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  199  ---------------FSAGDRRADTSSDLSIFVGDLATDVTDTMLQETFASRYSSVKGAK  243

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            +         KG GFV+F +  +  +A+ ++ G     + +R+
Sbjct  244  VVQDANTGRSKGYGFVRFGDENERTKAIVEMNGAYCSSRPMRI  286



>ref|XP_002894197.1| hypothetical protein ARALYDRAFT_474095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70456.1| hypothetical protein ARALYDRAFT_474095 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   273 bits (699),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 185/235 (79%), Gaps = 3/235 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR S N  DLSIFVGDLA DV+D +LL+TF  +YPSVK AKVVID+
Sbjct  195   QPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDS  254

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssg-yqqqfaaqggy  697
             NTGRSKGYGFVRFGD+NERS+A+TEMNG +CSSR MR+G ATP++++   QQ  +     
Sbjct  255   NTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALTL  314

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             + G   +GS SDG+S+N+TIFVGGLD +V++EDL QPFSQ+GE+VSVKIPVGKGCGFVQF
Sbjct  315   AGGHGGNGSLSDGESNNSTIFVGGLDADVTEEDLMQPFSQFGEVVSVKIPVGKGCGFVQF  374

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
             ANR  AEEA+  L G VIGK TVRLSWGR+P ++Q RSD  NQW G Y  G  Y+
Sbjct  375   ANRQSAEEAIGNLNGTVIGKNTVRLSWGRSP-NKQWRSDTGNQWNGGYSRGQGYN  428


 Score = 51.2 bits (121),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 73/163 (45%), Gaps = 29/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  T +S+GYGFV F   +   +AL   +GV    + +P R+  A+      
Sbjct  150  VSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEALQSFSGVTMPNAEQPFRLNWAS------  203

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFS-QYGEIVSVK  553
                   +    NG             + +IFVG L P+VSD  L + F+ +Y  +   K
Sbjct  204  --FSTGEKRASENG------------PDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAK  249

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G     + +R+
Sbjct  250  VVIDSNTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRV  292



>gb|EMT05029.1| Putative RNA-binding protein [Aegilops tauschii]
Length=310

 Score =   269 bits (687),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 182/243 (75%), Gaps = 19/243 (8%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+++SMGEKRS   SD SIFVGDLAADVTD +L++ F SKY SVK AKV+IDANTGRS+
Sbjct  66    NWASYSMGEKRSEVVSDHSIFVGDLAADVTDEMLMELFASKYRSVKGAKVIIDANTGRSR  125

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDD +++ A+TEMNGVYCS+RP+R+G ATPR+           G   + +P H
Sbjct  126   GYGFVRFGDDTDKAHAMTEMNGVYCSTRPIRVGPATPRR---------TSGDSGSSTPGH  176

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
                SDGDS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP+GK CGFVQ    TDAE
Sbjct  177   ---SDGDSNNRTVYVGGLDPNVSEDELRKSFAKYGDVASVKIPLGKQCGFVQ----TDAE  229

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD--FTNQWAGAYYGGHFYDGYTYAFPAPH  322
             EALQ L G VIGKQ VRLSWGR+P+H+QSR D          YYG  FY GY YA P PH
Sbjct  230   EALQGLNGAVIGKQAVRLSWGRSPSHKQSRGDSGNRRNNNNMYYGTPFYGGYGYASPVPH  289

Query  321   NPN  313
              PN
Sbjct  290   -PN  291



>ref|XP_006648763.1| PREDICTED: polyadenylate-binding protein RBP47-like [Oryza brachyantha]
Length=378

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 182/242 (75%), Gaps = 14/242 (6%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+++SMGEKRS  ASD SIFVGDLA DVTD +L+  F  KY SVK AKV+IDANTGRS+
Sbjct  131   NWASYSMGEKRSELASDYSIFVGDLAVDVTDEMLMTLFAKKYRSVKGAKVIIDANTGRSR  190

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDN+++ A+TEMNG YCSSRP+RIG ATPR+SSG                + 
Sbjct  191   GYGFVRFGDDNDKTHAMTEMNGEYCSSRPIRIGPATPRRSSGDSGS------------SP  238

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
               QSD DS+N TI+VGGLDPNV++++LR+ F++YG++ SVKIPVGK CGFVQF NR DAE
Sbjct  239   PRQSDNDSTNRTIYVGGLDPNVTEDELRKAFAKYGDLASVKIPVGKQCGFVQFVNRPDAE  298

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGG-HFYDGYTYAFPAPHN  319
             EALQ L G  IGKQ VRLSWGR+PA +QSR D  ++  G YYG   FY GY YA P PH 
Sbjct  299   EALQGLNGSTIGKQAVRLSWGRSPASKQSRGDSGHRRNGMYYGTPPFYGGYGYASPLPH-  357

Query  318   PN  313
             PN
Sbjct  358   PN  359



>ref|XP_010500505.1| PREDICTED: polyadenylate-binding protein RBP47A-like [Camelina 
sativa]
Length=447

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/235 (64%), Positives = 185/235 (79%), Gaps = 3/235 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR S N  DLSIFVGDLA DV+D +LL+TF  +YPSVK AKVVID+
Sbjct  192   QPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDS  251

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssg-yqqqfaaqggy  697
             NTGRSKGYGFVRFGD+NERS+A+TEMNG +CSSR MR+G ATP++++   QQ  +     
Sbjct  252   NTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALTL  311

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             + G   +GS SDG+S+N+TIFVGG+DP+V++EDL QPFSQ+GE++SVKIPVGKGCGFVQF
Sbjct  312   AGGHGGNGSLSDGESNNSTIFVGGIDPDVTEEDLMQPFSQFGEVISVKIPVGKGCGFVQF  371

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
             ANR  AEEA+  L G VIGK TVRLSWGR+P ++Q R D  NQW G Y  G  Y+
Sbjct  372   ANRQSAEEAIGNLNGTVIGKNTVRLSWGRSP-NKQWRGDSGNQWNGGYSRGQGYN  425



>ref|XP_010523211.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Tarenaya 
hassleriana]
Length=449

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 195/249 (78%), Gaps = 10/249 (4%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR S N SDLSIFVGDLA DVTDTLL +TF S YPSVK AKVVID+
Sbjct  185   QPFRLNWASFSTGEKRASENGSDLSIFVGDLAPDVTDTLLHETFASSYPSVKGAKVVIDS  244

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg--  700
             NTGRSKGYGFVRFGD+ ERS+A+ EMNGV+CSSR MR G ATP++++ +QQQ+++Q    
Sbjct  245   NTGRSKGYGFVRFGDEKERSRAMVEMNGVFCSSRQMRTGIATPKRAAAHQQQYSSQALIL  304

Query  699   ------ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGK  538
                    +NGS   G  SDG+S N+TIFVGGLD +V+DEDLRQPFSQ+G++VSVKIP+GK
Sbjct  305   AGGGGHGANGSVTQGPPSDGESINSTIFVGGLDADVTDEDLRQPFSQFGDVVSVKIPIGK  364

Query  537   GCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYY-GGH  361
             GCGFVQFA+R  AEEA+Q L G VIGK TVRLSWGR+P ++Q RSD ++QW G Y  GG 
Sbjct  365   GCGFVQFADRKSAEEAIQTLNGTVIGKNTVRLSWGRSPGNKQWRSDSSHQWNGGYTRGGQ  424

Query  360   FYDGYTYAF  334
              Y+  + A+
Sbjct  425   GYNNNSNAY  433


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 75/177 (42%), Gaps = 28/177 (16%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyq  724
            V + KV+ +  T +S+GYGFV F       + L   NG      PM   A  P + +   
Sbjct  140  VSSVKVIRNKQTCQSEGYGFVEFFSRAAAEEVLQNYNG-----SPMP-NADQPFRLNWAS  193

Query  723  qqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVKIP  547
                 +    NG            S+ +IFVG L P+V+D  L + F S Y  +   K+ 
Sbjct  194  FSTGEKRASENG------------SDLSIFVGDLAPDVTDTLLHETFASSYPSVKGAKVV  241

Query  546  V------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWG---RNPAHRQSRS  403
            +       KG GFV+F +  +   A+ ++ G+    + +R       R  AH+Q  S
Sbjct  242  IDSNTGRSKGYGFVRFGDEKERSRAMVEMNGVFCSSRQMRTGIATPKRAAAHQQQYS  298



>ref|XP_010479396.1| PREDICTED: polyadenylate-binding protein RBP47A isoform X1 [Camelina 
sativa]
 ref|XP_010479397.1| PREDICTED: polyadenylate-binding protein RBP47A isoform X2 [Camelina 
sativa]
Length=454

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/235 (64%), Positives = 185/235 (79%), Gaps = 3/235 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR S N  DLSIFVGDLA DV+D +LL+TF  +YPSVK AKVVID+
Sbjct  199   QPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDS  258

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssg-yqqqfaaqggy  697
             NTGRSKGYGFVRFGD+NERS+A+TEMNG +CSSR MR+G ATP++++   QQ  +     
Sbjct  259   NTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALTL  318

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             + G   +GS SDG+S+N+TIFVGG+DP+V++EDL QPFSQ+GE++SVKIPVGKGCGFVQF
Sbjct  319   AGGHGGNGSLSDGESNNSTIFVGGIDPDVTEEDLMQPFSQFGEVISVKIPVGKGCGFVQF  378

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
             ANR  AEEA+  L G VIGK TVRLSWGR+P ++Q R D  NQW G Y  G  Y+
Sbjct  379   ANRQSAEEAIGNLNGTVIGKNTVRLSWGRSP-NKQWRGDSGNQWNGGYSRGQGYN  432



>emb|CDY22988.1| BnaC03g40810D [Brassica napus]
Length=420

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 179/226 (79%), Gaps = 6/226 (3%)
 Frame = -2

Query  1035  NWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW++FS GEKR+  N  +LSIFVGDL+ DVTDTLL + FV +YPSVK+AKVVID+NTGRS
Sbjct  171   NWASFSTGEKRAVENGPELSIFVGDLSPDVTDTLLQELFVERYPSVKSAKVVIDSNTGRS  230

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy----SN  691
             KGYGFVRFGD++ERS+ALTEMNG YCS+R MR+G ATP+++        A        +N
Sbjct  231   KGYGFVRFGDESERSRALTEMNGAYCSNRQMRVGVATPKRAVANHHPSQAVIVAGGHGAN  290

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G  AHGSQSDG+S+N+TIFVGG+DP+V++EDLRQPF+Q+GE+VSVKIPVGKGCGFVQ  N
Sbjct  291   GFMAHGSQSDGESNNSTIFVGGIDPDVTEEDLRQPFTQFGEVVSVKIPVGKGCGFVQLDN  350

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAY  373
             R  A++A+Q L G VIGK TVRLSWGR P ++Q R D   QW G Y
Sbjct  351   RKSADDAIQSLNGTVIGKNTVRLSWGRTP-NKQWRGDSGQQWNGGY  395



>ref|XP_010461802.1| PREDICTED: polyadenylate-binding protein RBP47A-like isoform 
X1 [Camelina sativa]
 ref|XP_010461803.1| PREDICTED: polyadenylate-binding protein RBP47A-like isoform 
X2 [Camelina sativa]
Length=455

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/235 (64%), Positives = 185/235 (79%), Gaps = 3/235 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR S N  DLSIFVGDLA DV+D +LL+TF  +YPSVK AKVVID+
Sbjct  200   QPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDS  259

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssg-yqqqfaaqggy  697
             NTGRSKGYGFVRFGD+NERS+A+TEMNG +CSSR MR+G ATP++++   QQ  +     
Sbjct  260   NTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALTL  319

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             + G   +GS SDG+S+N+TIFVGG+DP+V++EDL QPFSQ+GE++SVKIPVGKGCGFVQF
Sbjct  320   AGGHGGNGSLSDGESNNSTIFVGGIDPDVTEEDLMQPFSQFGEVISVKIPVGKGCGFVQF  379

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
             ANR  AEEA+  L G VIGK TVRLSWGR+P ++Q R D  NQW G Y  G  Y+
Sbjct  380   ANRQSAEEAIGNLNGTVIGKNTVRLSWGRSP-NKQWRGDSGNQWNGGYSRGQGYN  433


 Score = 51.2 bits (121),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 73/163 (45%), Gaps = 29/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  T +S+GYGFV F   +   +AL   +GV    + +P R+  A+      
Sbjct  155  VSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEALQSFSGVTMPNAEQPFRLNWAS------  208

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFS-QYGEIVSVK  553
                   +    NG             + +IFVG L P+VSD  L + F+ +Y  +   K
Sbjct  209  --FSTGEKRASENG------------PDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAK  254

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G     + +R+
Sbjct  255  VVIDSNTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRV  297



>dbj|BAD17764.1| putative nucleic acid binding protein [Oryza sativa Japonica 
Group]
Length=396

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 151/241 (63%), Positives = 182/241 (76%), Gaps = 13/241 (5%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+++SMGEKR+  ASD SIFVGDLA DVTD +L+D F  KY SVK AKV+IDANTGRS+
Sbjct  150   NWASYSMGEKRAELASDHSIFVGDLAVDVTDEMLMDLFAKKYRSVKGAKVIIDANTGRSR  209

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDN+++ A+TEMNG YCS+RP+RIG ATPR+SSG                + 
Sbjct  210   GYGFVRFGDDNDKTHAMTEMNGAYCSTRPIRIGPATPRRSSGDSGS------------SP  257

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
               QSD DS+N TI+VGGLDPN ++++LR+ F++YG++ SVKIPVGK CGFVQF NR DAE
Sbjct  258   PRQSDSDSTNRTIYVGGLDPNATEDELRKAFAKYGDLASVKIPVGKQCGFVQFVNRPDAE  317

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNP  316
             EALQ L G  IGKQ VRLSWGR+PA +QSR D  ++  G YYG  FY GY YA P PH P
Sbjct  318   EALQGLNGSTIGKQAVRLSWGRSPASKQSRGDSGHRRNGMYYGTPFYGGYGYASPLPH-P  376

Query  315   N  313
             N
Sbjct  377   N  377



>ref|XP_010487839.1| PREDICTED: polyadenylate-binding protein RBP47B isoform X1 [Camelina 
sativa]
Length=444

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/234 (64%), Positives = 185/234 (79%), Gaps = 8/234 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS  EKR+  +  DLS+FVGDL+ DVTD LL +TF ++YPSVK AKVVID+
Sbjct  186   QPFRLNWASFSTAEKRAVESGPDLSVFVGDLSPDVTDDLLHETFSTRYPSVKGAKVVIDS  245

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy-  697
             N+GRSKGYGFVRFGD+NERS+ALTEMNG +CS+R MR+G ATP+++   QQQ ++Q    
Sbjct  246   NSGRSKGYGFVRFGDENERSRALTEMNGAFCSNRQMRVGVATPKRAVANQQQHSSQALIL  305

Query  696   -----SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  +NG  AHGSQSDG+S+N+TIFVGG+DP+V+DEDLRQPFSQ+GE+VSVKIPVGKGC
Sbjct  306   AGGHGANGYMAHGSQSDGESTNSTIFVGGIDPDVTDEDLRQPFSQFGEVVSVKIPVGKGC  365

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSR-SDFTNQWAGAY  373
             GFVQFA+R  AE+A++ L G VIGK TVRLSWGR P  +Q R  D   QW G Y
Sbjct  366   GFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRTPNKQQWRGGDSGQQWNGGY  419



>gb|EEE57226.1| hypothetical protein OsJ_07197 [Oryza sativa Japonica Group]
Length=459

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 150/253 (59%), Positives = 180/253 (71%), Gaps = 15/253 (6%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+++SMGEKR+  ASD SIFVGDLA DVTD +L+D F  KY SVK AKV+IDANTGRS+
Sbjct  191   NWASYSMGEKRAELASDHSIFVGDLAVDVTDEMLMDLFAKKYRSVKGAKVIIDANTGRSR  250

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNG----  688
             GYGFVRFGDDN+++ A+TEMNG YCS+RP+RIG ATPR               +      
Sbjct  251   GYGFVRFGDDNDKTHAMTEMNGAYCSTRPIRIGPATPRDLQPTSASAYGLVAKARANIWG  310

Query  687   --------SPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                     SP    QSD DS+N TI+VGGLDPN ++++LR+ F++YG++ SVKIPVGK C
Sbjct  311   EYVGDSGSSPPR--QSDSDSTNRTIYVGGLDPNATEDELRKAFAKYGDLASVKIPVGKQC  368

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
             GFVQF NR DAEEALQ L G  IGKQ VRLSWGR+PA +QSR D  ++  G YYG  FY 
Sbjct  369   GFVQFVNRPDAEEALQGLNGSTIGKQAVRLSWGRSPASKQSRGDSGHRRNGMYYGTPFYG  428

Query  351   GYTYAFPAPHNPN  313
             GY YA P PH PN
Sbjct  429   GYGYASPLPH-PN  440



>ref|XP_006393234.1| hypothetical protein EUTSA_v10011485mg [Eutrema salsugineum]
 gb|ESQ30520.1| hypothetical protein EUTSA_v10011485mg [Eutrema salsugineum]
Length=441

 Score =   271 bits (694),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 188/240 (78%), Gaps = 9/240 (4%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR S N  D+SIFVGDLA DVTDT+LL+TF   YPSVK AKVVID+
Sbjct  182   QPFRLNWASFSTGEKRASENGPDVSIFVGDLAPDVTDTVLLETFAG-YPSVKGAKVVIDS  240

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS  694
             NTGRSKGYGFVRFGD+NERS+A+ EMNG +CSSRPMR+G ATP++++ Y QQ  +Q    
Sbjct  241   NTGRSKGYGFVRFGDENERSRAMNEMNGAFCSSRPMRVGIATPKRAAAYGQQNGSQALTL  300

Query  693   ------NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                   NGS AHGS SDG+S+N+TIFVGGLD +V++EDL QPF+Q+GE+VSVKIPVGKGC
Sbjct  301   AGGHGGNGSMAHGSMSDGESNNSTIFVGGLDADVTEEDLMQPFAQFGEVVSVKIPVGKGC  360

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
             GFVQF NR  AE+A+Q L G VIGK TVRLSWGR+P ++Q R D  +QW G Y  G  Y+
Sbjct  361   GFVQFGNRQSAEDAIQNLNGTVIGKNTVRLSWGRSP-NKQWRGDSGHQWNGGYSRGQGYN  419


 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/162 (25%), Positives = 71/162 (44%), Gaps = 28/162 (17%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  T +S+GYGFV F   +   + L   +GV    + +P R+  A+      
Sbjct  137  VSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEVLQSYSGVTMPNAEQPFRLNWAS------  190

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  550
                   +    NG             + +IFVG L P+V+D  L + F+ Y  +   K+
Sbjct  191  --FSTGEKRASENG------------PDVSIFVGDLAPDVTDTVLLETFAGYPSVKGAKV  236

Query  549  PV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
             +       KG GFV+F +  +   A+ ++ G     + +R+
Sbjct  237  VIDSNTGRSKGYGFVRFGDENERSRAMNEMNGAFCSSRPMRV  278



>ref|NP_175383.1| RNA-binding protein 47A [Arabidopsis thaliana]
 sp|F4I3B3.1|RB47A_ARATH RecName: Full=Polyadenylate-binding protein RBP47A; Short=Poly(A)-binding 
protein RBP47A; AltName: Full=RNA-binding protein 
47A; Short=AtRBP47A [Arabidopsis thaliana]
 gb|AEE32448.1| RNA-binding protein 47A [Arabidopsis thaliana]
Length=445

 Score =   271 bits (693),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 184/235 (78%), Gaps = 3/235 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR S N  DLSIFVGDLA DV+D +LL+TF  +YPSVK AKVVID+
Sbjct  190   QPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDS  249

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssg-yqqqfaaqggy  697
             NTGRSKGYGFVRFGD+NERS+A+TEMNG +CSSR MR+G ATP++++   QQ  +     
Sbjct  250   NTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALTL  309

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             + G   +GS SDG+S+N+TIFVGGLD +V++EDL QPFS +GE+VSVKIPVGKGCGFVQF
Sbjct  310   AGGHGGNGSMSDGESNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSVKIPVGKGCGFVQF  369

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
             ANR  AEEA+  L G VIGK TVRLSWGR+P ++Q RSD  NQW G Y  G  Y+
Sbjct  370   ANRQSAEEAIGNLNGTVIGKNTVRLSWGRSP-NKQWRSDSGNQWNGGYSRGQGYN  423



>ref|XP_010507446.1| PREDICTED: polyadenylate-binding protein RBP47B-like isoform 
X1 [Camelina sativa]
Length=444

 Score =   271 bits (693),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 185/234 (79%), Gaps = 8/234 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR+  +  DLS+FVGDL+ DVTD LL +TF ++YPSVK AKVVID+
Sbjct  186   QPFRLNWASFSTGEKRAVESGPDLSVFVGDLSPDVTDDLLHETFSTRYPSVKGAKVVIDS  245

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy-  697
             N+GRSKGYGFVRFGD+NERS+ALTEMNG +CS+R MR+G ATP+++   QQ  ++Q    
Sbjct  246   NSGRSKGYGFVRFGDENERSRALTEMNGAFCSNRQMRVGVATPKRAVANQQHHSSQALIL  305

Query  696   -----SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  +NG  AHGSQSDG+S+N+TIFVGG+DP+V+DEDLR+PFSQ+GE+VSVKIPVG+GC
Sbjct  306   AGGHGANGYMAHGSQSDGESTNSTIFVGGIDPDVTDEDLRKPFSQFGEVVSVKIPVGRGC  365

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSR-SDFTNQWAGAY  373
             GFVQFA+R  AE+A++ L G VIGK TVRLSWGR P  +Q R  D   QW G Y
Sbjct  366   GFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRTPNKQQWRGGDSGQQWNGGY  419



>ref|XP_010487840.1| PREDICTED: polyadenylate-binding protein RBP47B isoform X2 [Camelina 
sativa]
Length=443

 Score =   271 bits (693),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 183/233 (79%), Gaps = 7/233 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS  EKR+  +  DLS+FVGDL+ DVTD LL +TF ++YPSVK AKVVID+
Sbjct  186   QPFRLNWASFSTAEKRAVESGPDLSVFVGDLSPDVTDDLLHETFSTRYPSVKGAKVVIDS  245

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy-  697
             N+GRSKGYGFVRFGD+NERS+ALTEMNG +CS+R MR+G ATP+++   QQQ ++Q    
Sbjct  246   NSGRSKGYGFVRFGDENERSRALTEMNGAFCSNRQMRVGVATPKRAVANQQQHSSQALIL  305

Query  696   -----SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  +NG  AHGSQSDG+S+N+TIFVGG+DP+V+DEDLRQPFSQ+GE+VSVKIPVGKGC
Sbjct  306   AGGHGANGYMAHGSQSDGESTNSTIFVGGIDPDVTDEDLRQPFSQFGEVVSVKIPVGKGC  365

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAY  373
             GFVQFA+R  AE+A++ L G VIGK TVRLSWGR P  +    D   QW G Y
Sbjct  366   GFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRTPNKQWRGGDSGQQWNGGY  418



>ref|XP_008667171.1| PREDICTED: uncharacterized protein LOC100193409 isoform X1 [Zea 
mays]
 tpg|DAA40260.1| TPA: hypothetical protein ZEAMMB73_589753 [Zea mays]
Length=424

 Score =   270 bits (691),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 182/245 (74%), Gaps = 15/245 (6%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLA+DV D  LL+ F S+Y SVK AKVVIDAN
Sbjct  163   QPFRLNWASFSMGDRRSDVASDHSIFVGDLASDVNDATLLEVFSSRYSSVKGAKVVIDAN  222

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+E++ A+TEMNGVYCSSRPMRIG ATPRKSSG             
Sbjct  223   TGRSKGYGFVRFGDDSEKTHAMTEMNGVYCSSRPMRIGPATPRKSSGTSGSNG-------  275

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
                +      GD +NTT+FVGGLDP+VS+EDLRQ FSQYGEI SVKIPVGK CGFVQFA 
Sbjct  276   ---SSARPDGGDLTNTTVFVGGLDPDVSEEDLRQAFSQYGEISSVKIPVGKQCGFVQFAQ  332

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTN-QW--AGAYYGG-HFYDGYT  343
             R +AE+ALQ L G  IGKQ VRLSWGRNPA++Q R D  N QW   G YY    FY+G  
Sbjct  333   RKNAEDALQGLNGSTIGKQAVRLSWGRNPANKQFRGDNGNMQWKNGGVYYAAPPFYNG-G  391

Query  342   YAFPA  328
             Y +PA
Sbjct  392   YGYPA  396



>ref|XP_002452313.1| hypothetical protein SORBIDRAFT_04g023540 [Sorghum bicolor]
 gb|EES05289.1| hypothetical protein SORBIDRAFT_04g023540 [Sorghum bicolor]
Length=435

 Score =   270 bits (691),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 151/245 (62%), Positives = 184/245 (75%), Gaps = 17/245 (7%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+++SMGEKR+  +SD SIFVGDLA DVTD +LL+ F +KY SVK AKV+IDANTGRS+
Sbjct  185   NWASYSMGEKRTELSSDHSIFVGDLAVDVTDEMLLELFSNKYRSVKGAKVIIDANTGRSR  244

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDN+++ A+TEMNGVYCS+RP+R+G ATPR+S G              SP  
Sbjct  245   GYGFVRFGDDNDKTHAMTEMNGVYCSTRPIRVGPATPRRSQGDS----------GSSPPR  294

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
               QSD DS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP GK CGFVQF NR DAE
Sbjct  295   --QSDVDSTNRTVYVGGLDPNVSEDELRKAFAKYGDLASVKIPFGKQCGFVQFVNRADAE  352

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW----AGAYYGGHFYDGYTYAFPA  328
             EALQ L G  IGKQ VRLSWGR+PA +QSR D  ++      G YYG  FY GY YA P 
Sbjct  353   EALQGLNGATIGKQAVRLSWGRSPASKQSRGDSGHRRNGNGNGMYYGTPFYSGYGYASPV  412

Query  327   PHNPN  313
             PH PN
Sbjct  413   PH-PN  416



>emb|CDY18570.1| BnaA01g26250D [Brassica napus]
Length=434

 Score =   270 bits (691),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 148/240 (62%), Positives = 186/240 (78%), Gaps = 9/240 (4%)
 Frame = -2

Query  1035  NWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW++FS GEKR+  N  +LS+FVGDL+ DVTD +L + F  +YPSVK+AKVVID+NTGRS
Sbjct  185   NWASFSTGEKRAVENGPELSVFVGDLSPDVTDAMLQELFAERYPSVKSAKVVIDSNTGRS  244

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy------  697
             KGYGFVRFGD++ERS+ALTEMNG  CS+R MR+G ATP+++    QQ ++Q         
Sbjct  245   KGYGFVRFGDESERSRALTEMNGALCSNRQMRVGIATPKRAVANHQQHSSQAVIVAGGHG  304

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             +NGS A+GSQ+DG+S+N+TIFVGGLDP+V+DEDLRQPF+++GE+VSVKIPVGKGCGFVQF
Sbjct  305   ANGSMANGSQADGESNNSTIFVGGLDPDVTDEDLRQPFTEFGEVVSVKIPVGKGCGFVQF  364

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
             ANR  A++A+Q L G VIGK TVRLSWGR P   + R D   QW G Y  G  Y+   YA
Sbjct  365   ANRKSADDAIQSLNGTVIGKNTVRLSWGRTP--NKWRGDSGQQWNGGYSRGQGYNNGGYA  422



>ref|XP_010507452.1| PREDICTED: polyadenylate-binding protein RBP47B-like isoform 
X2 [Camelina sativa]
Length=443

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 183/233 (79%), Gaps = 7/233 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR+  +  DLS+FVGDL+ DVTD LL +TF ++YPSVK AKVVID+
Sbjct  186   QPFRLNWASFSTGEKRAVESGPDLSVFVGDLSPDVTDDLLHETFSTRYPSVKGAKVVIDS  245

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy-  697
             N+GRSKGYGFVRFGD+NERS+ALTEMNG +CS+R MR+G ATP+++   QQ  ++Q    
Sbjct  246   NSGRSKGYGFVRFGDENERSRALTEMNGAFCSNRQMRVGVATPKRAVANQQHHSSQALIL  305

Query  696   -----SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  +NG  AHGSQSDG+S+N+TIFVGG+DP+V+DEDLR+PFSQ+GE+VSVKIPVG+GC
Sbjct  306   AGGHGANGYMAHGSQSDGESTNSTIFVGGIDPDVTDEDLRKPFSQFGEVVSVKIPVGRGC  365

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAY  373
             GFVQFA+R  AE+A++ L G VIGK TVRLSWGR P  +    D   QW G Y
Sbjct  366   GFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRTPNKQWRGGDSGQQWNGGY  418



>ref|XP_010466046.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Camelina 
sativa]
Length=441

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 184/233 (79%), Gaps = 7/233 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR+  +  DLS+FVGDL+ DVTD LL +TF ++YPSVK AKVVID+
Sbjct  184   QPFRLNWASFSTGEKRAVESGPDLSVFVGDLSPDVTDDLLHETFSTRYPSVKGAKVVIDS  243

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy-  697
             N+G+SKGYGFVRFGD+NERS+ALTEMNG +CS+R MR+G ATP+++   QQQ ++Q    
Sbjct  244   NSGQSKGYGFVRFGDENERSRALTEMNGAFCSNRQMRVGVATPKRAVANQQQHSSQALIL  303

Query  696   -----SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  +NG  AHGSQSDG+S+N+TIFVGG+DP+V+DEDLRQPFSQ+G++VSVKIPVGKGC
Sbjct  304   AGGHGANGYMAHGSQSDGESTNSTIFVGGIDPDVTDEDLRQPFSQFGDVVSVKIPVGKGC  363

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAY  373
             GFVQFA+R  AE+A++ L G VIGK TVRLSWGR P  +    D   QW G Y
Sbjct  364   GFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRTPNKQWRGGDSGQQWNGGY  416



>ref|XP_008459212.1| PREDICTED: polyadenylate-binding protein RBP47 [Cucumis melo]
Length=439

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 183/226 (81%), Gaps = 5/226 (2%)
 Frame = -2

Query  1047  PAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANT  868
             P   NW+TFS  ++R +  SDLSIFVGDLAADVTD +L +TF S+Y SVK AKVVID+N+
Sbjct  172   PFRLNWATFSANDRRPDTGSDLSIFVGDLAADVTDAMLQETFSSRYTSVKGAKVVIDSNS  231

Query  867   GRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggyS--  694
             GRSKGYGFVRFGD+NER++A+ EMNG+YCSSRPMRIG ATP+K+SGYQQ +A+Q      
Sbjct  232   GRSKGYGFVRFGDENERTRAMAEMNGIYCSSRPMRIGVATPKKASGYQQGYASQALVLAG  291

Query  693   ---NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFV  523
                NG    GSQSD +S+NTTIFVGGLD +VSDEDL+  FS++G+++SVKIP+GKGCGFV
Sbjct  292   GHPNGMAVQGSQSDSESNNTTIFVGGLDSDVSDEDLKLAFSKFGDVISVKIPIGKGCGFV  351

Query  522   QFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             QFANR +AE+ALQ L G VIGKQTVRLSWGR+  ++Q R D  NQW
Sbjct  352   QFANRKNAEDALQGLNGTVIGKQTVRLSWGRSTGNKQWRGDSNNQW  397


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 73/163 (45%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  TG+S+GYGFV F       + L   NG     +  P R+  AT      
Sbjct  126  VSSVKVICNKQTGQSEGYGFVEFFSHTTAEKVLQNYNGTIMPNTELPFRLNWAT------  179

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                       ++  P  G       S+ +IFVG L  +V+D  L++ F S+Y  +   K
Sbjct  180  --------FSANDRRPDTG-------SDLSIFVGDLAADVTDAMLQETFSSRYTSVKGAK  224

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  225  VVIDSNSGRSKGYGFVRFGDENERTRAMAEMNGIYCSSRPMRI  267



>ref|XP_003608019.1| RNA Binding Protein [Medicago truncatula]
 gb|AES90216.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=454

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 183/224 (82%), Gaps = 12/224 (5%)
 Frame = -2

Query  1035  NWSTFSM----GEKRSNNA-SDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             NW+TFS     GE+RS+ A SDLS+FVGDLA DVTD +L +TF SK+ S+K AKVVID+N
Sbjct  192   NWATFSAAGGGGERRSSEATSDLSVFVGDLAIDVTDAMLQETFASKFSSIKGAKVVIDSN  251

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKs-------sgyqqqfa  712
             TGRSKGYGFVRFGD++ER++A+TEMNGVYCSSRPMR+G ATP+K+       S      A
Sbjct  252   TGRSKGYGFVRFGDESERTRAMTEMNGVYCSSRPMRVGVATPKKTYGNPQQYSSQAVVLA  311

Query  711   aqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
               GG+SNG+ A GSQS+GDS+NTTIFVGGLD ++SDEDLRQPF Q+G+++SVKIPVGKGC
Sbjct  312   GGGGHSNGAMAQGSQSEGDSNNTTIFVGGLDSDISDEDLRQPFLQFGDVISVKIPVGKGC  371

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  400
             GFVQ A+R +AEEA+Q L G VIGKQTVRLSWGR+P ++  R+D
Sbjct  372   GFVQLADRKNAEEAIQGLNGTVIGKQTVRLSWGRSPGNKHGRND  415


 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 76/163 (47%), Gaps = 25/163 (15%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V +AKV+ +  TG+S+GYGFV F       + L   NG     + +  R+  AT      
Sbjct  142  VASAKVIRNKQTGQSEGYGFVEFYTRAMAEKVLQNFNGTMMPNTDQAFRLNWAT------  195

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                         G     S++   +S+ ++FVG L  +V+D  L++ F S++  I   K
Sbjct  196  -------FSAAGGGGERRSSEA---TSDLSVFVGDLAIDVTDAMLQETFASKFSSIKGAK  245

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + ++   A+ ++ G+    + +R+
Sbjct  246  VVIDSNTGRSKGYGFVRFGDESERTRAMTEMNGVYCSSRPMRV  288



>emb|CDX95462.1| BnaC01g33540D [Brassica napus]
Length=434

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/240 (61%), Positives = 186/240 (78%), Gaps = 9/240 (4%)
 Frame = -2

Query  1035  NWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW++FS GEKR+  N  +LS+FVGDL+ DVTD +L + F  +YPSVK+AKVVID+NTGRS
Sbjct  185   NWASFSTGEKRAVENGPELSVFVGDLSPDVTDAMLQELFAERYPSVKSAKVVIDSNTGRS  244

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy------  697
             KGYGFVRFGD+++RS+ALTEMNG  CS+R MR+G ATP+++    QQ ++Q         
Sbjct  245   KGYGFVRFGDESDRSRALTEMNGALCSNRQMRVGIATPKRAVANHQQHSSQAVIVAGGHG  304

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             +NGS A+GSQ+DG+S+N+TIFVGGLDP+V+DEDLRQPF+++GE+VSVKIPVGKGCGFVQF
Sbjct  305   ANGSMANGSQADGESNNSTIFVGGLDPDVTDEDLRQPFTEFGEVVSVKIPVGKGCGFVQF  364

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
             ANR  A++A+Q L G VIGK TVRLSWGR P   + R D   QW G Y  G  Y+   YA
Sbjct  365   ANRKSADDAIQSLNGTVIGKNTVRLSWGRTP--NKWRGDSGQQWNGGYSRGQGYNNGGYA  422



>ref|XP_009112131.1| PREDICTED: polyadenylate-binding protein RBP47B-like isoform 
X2 [Brassica rapa]
Length=434

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/240 (61%), Positives = 185/240 (77%), Gaps = 9/240 (4%)
 Frame = -2

Query  1035  NWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW++FS GEKR+  N  +LS+FVGDL+ DVTD +L + F  +YPSV++AKVVID+NTGRS
Sbjct  185   NWASFSTGEKRAVENGPELSVFVGDLSPDVTDAMLQELFAERYPSVRSAKVVIDSNTGRS  244

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy------  697
             KGYGFVRFGD+ ERS+ALTEMNG  CS+R MR+G ATP+++    QQ ++Q         
Sbjct  245   KGYGFVRFGDEGERSRALTEMNGALCSNREMRVGIATPKRAVANHQQHSSQAVIVAGGHG  304

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             +NGS A+GSQ+DG+S+N+TIFVGGLDP+V+DEDLRQPF+++GE+VSVKIPVGKGCGFVQF
Sbjct  305   ANGSMANGSQADGESNNSTIFVGGLDPDVTDEDLRQPFTEFGEVVSVKIPVGKGCGFVQF  364

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
             ANR  A++A+Q L G VIGK TVRLSWGR P   + R D   QW G Y  G  Y+   YA
Sbjct  365   ANRKSADDAIQSLNGTVIGKNTVRLSWGRTP--NKWRGDSGQQWNGGYSRGQGYNNGGYA  422



>ref|XP_006307519.1| hypothetical protein CARUB_v10009142mg [Capsella rubella]
 gb|EOA40417.1| hypothetical protein CARUB_v10009142mg [Capsella rubella]
Length=443

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 183/235 (78%), Gaps = 3/235 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR S N  DLSIFVGDLA DV+D +LL+TF  +YPSVK AKVVID+
Sbjct  188   QPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDS  247

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssg-yqqqfaaqggy  697
             NTGRSKGYGFVRF D+NERS+A+TEMNG +CSSR MR+G ATP++++   QQ  +     
Sbjct  248   NTGRSKGYGFVRFADENERSRAMTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALTL  307

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             + G   +GS SDG+S+N+TIFVGGLD +V++EDL QPFSQ+GE++SVKIPVGKGCGFVQF
Sbjct  308   AGGHGGNGSLSDGESNNSTIFVGGLDADVTEEDLMQPFSQFGEVISVKIPVGKGCGFVQF  367

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
             ANR  AEEA+  L G VIGK TVRLSWGR+P ++Q R D  NQW G Y  G  Y+
Sbjct  368   ANRQSAEEAIGNLNGTVIGKNTVRLSWGRSP-NKQWRGDSGNQWNGGYSRGQGYN  421


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 29/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  T +S+GYGFV F   +   +AL   +GV    + +P R+  A+      
Sbjct  143  VSSVKVIRNKQTCQSEGYGFVEFLTRSAAEEALQSFSGVTMPNADQPFRLNWAS------  196

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFS-QYGEIVSVK  553
                   +    NG             + +IFVG L P+VSD  L + F+ +Y  +   K
Sbjct  197  --FSTGEKRASENG------------PDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAK  242

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+FA+  +   A+ ++ G     + +R+
Sbjct  243  VVIDSNTGRSKGYGFVRFADENERSRAMTEMNGAFCSSRQMRV  285



>gb|AFK40720.1| unknown [Medicago truncatula]
Length=454

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 183/224 (82%), Gaps = 12/224 (5%)
 Frame = -2

Query  1035  NWSTFSM----GEKRSNNA-SDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             NW+TFS     GE+RS+ A SDLS+FVGDLA DVTD +L +TF SK+ S+K AKVVID+N
Sbjct  192   NWATFSAAGGGGERRSSEATSDLSVFVGDLAIDVTDAMLQETFASKFSSIKGAKVVIDSN  251

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKs-------sgyqqqfa  712
             TGRSKGYGFVRFGD++ER++A+TEMNGVYCSSRPMR+G ATP+K+       S      A
Sbjct  252   TGRSKGYGFVRFGDESERTRAMTEMNGVYCSSRPMRVGVATPKKTYGNPQQYSSQAVVLA  311

Query  711   aqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
               GG+SNG+ A GSQS+GDS+NTTIFVGGLD ++SDEDLRQPF Q+G+++SVKIPVGKGC
Sbjct  312   GGGGHSNGAMAQGSQSEGDSNNTTIFVGGLDSDISDEDLRQPFLQFGDVISVKIPVGKGC  371

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  400
             GFVQ A+R +AEEA+Q L G VIGKQTVRLSWGR+P ++  R+D
Sbjct  372   GFVQLADRKNAEEAIQGLNGTVIGKQTVRLSWGRSPGNKHWRND  415


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 76/163 (47%), Gaps = 25/163 (15%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V +AKV+ +  TG+S+GYGFV F       + L   NG     + +  R+  AT      
Sbjct  142  VASAKVIRNKQTGQSEGYGFVEFYTRAMAEKVLQNFNGTMMPNTDQAFRLNWAT------  195

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSVK  553
                         G     S++   +S+ ++FVG L  +V+D  L++ F S++  I   K
Sbjct  196  -------FSAAGGGGERRSSEA---TSDLSVFVGDLAIDVTDAMLQETFASKFSSIKGAK  245

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + ++   A+ ++ G+    + +R+
Sbjct  246  VVIDSNTGRSKGYGFVRFGDESERTRAMTEMNGVYCSSRPMRV  288



>emb|CDO97156.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 154/243 (63%), Positives = 188/243 (77%), Gaps = 6/243 (2%)
 Frame = -2

Query  1041  YANWSTFSMGEKRSN-NASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTG  865
             + NW+ FSMG +R    A DLSIFVGDLAADVTD+LL +TF S++PSVK AKVV+D NTG
Sbjct  174   HLNWAAFSMGNRRQEAGAVDLSIFVGDLAADVTDSLLHETFASRFPSVKGAKVVVDPNTG  233

Query  864   RSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGS  685
             RSKGYGFVRF D+ ER+QA+TEMNG YCSSRPMRIG ATP+K+S  QQ  +     + G 
Sbjct  234   RSKGYGFVRFADEKERTQAMTEMNGAYCSSRPMRIGVATPKKASPQQQYSSQAVVLAGGY  293

Query  684   PAHG-----SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  520
             P++G     SQSD DSSNTTIFVGGLD +V+DE+LR+ FSQ+GE+VSVKIP GKGCGFVQ
Sbjct  294   PSNGVVPQGSQSDSDSSNTTIFVGGLDSDVTDEELRESFSQFGEVVSVKIPSGKGCGFVQ  353

Query  519   FANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
             F+NR++AE+A+Q+L G  IGKQ VRLSWGRNP ++Q R D + Q  G+ YG    +GY Y
Sbjct  354   FSNRSNAEDAMQRLNGAAIGKQMVRLSWGRNPVNKQLRMDSSYQLNGSNYGRQGQNGYGY  413

Query  339   AFP  331
               P
Sbjct  414   PMP  416



>ref|XP_004505196.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cicer arietinum]
Length=442

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 180/221 (81%), Gaps = 9/221 (4%)
 Frame = -2

Query  1035  NWSTFSMG--EKRSNNA-SDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTG  865
             NW++FS G  E+RS++A SDLSIFVGDLA DVTD +L + F S+Y S+K AKVVID+N+G
Sbjct  180   NWASFSAGGGERRSSDATSDLSIFVGDLAIDVTDAMLQEVFASRYSSIKGAKVVIDSNSG  239

Query  864   RSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKss------gyqqqfaaqg  703
             RSKGYGFVRFGD+NER++A+TEMNGVYCSSR MRIG ATP+K+         Q    A G
Sbjct  240   RSKGYGFVRFGDENERTRAMTEMNGVYCSSRAMRIGVATPKKTYGNPQQYASQAVVLAGG  299

Query  702   gySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFV  523
               SNG+ A GSQS+GDS+NTTIFVGGLD ++SDEDLRQPF Q+G++VSVKIPVGKGCGFV
Sbjct  300   HSSNGAVAQGSQSEGDSNNTTIFVGGLDSDISDEDLRQPFLQFGDVVSVKIPVGKGCGFV  359

Query  522   QFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSD  400
             Q A+R +AE+A+Q L G +IGKQTVRLSWGR+P ++  R+D
Sbjct  360   QLADRKNAEDAIQALNGTMIGKQTVRLSWGRSPGNKHWRND  400


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 75/164 (46%), Gaps = 29/164 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V +AKV+ +  TG+S+GYGF+ F       + L   NG     + +  R+  A+      
Sbjct  130  VVSAKVIRNKQTGQSEGYGFIEFYSRATAEKVLQNYNGTMMPNTDQAFRLNWASF-----  184

Query  729  yqqqfaaqggySNGSPAHGSQSDGD-SSNTTIFVGGLDPNVSDEDLRQPF-SQYGEIVSV  556
                          S   G +   D +S+ +IFVG L  +V+D  L++ F S+Y  I   
Sbjct  185  --------------SAGGGERRSSDATSDLSIFVGDLAIDVTDAMLQEVFASRYSSIKGA  230

Query  555  KIPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            K+ +       KG GFV+F +  +   A+ ++ G+    + +R+
Sbjct  231  KVVIDSNSGRSKGYGFVRFGDENERTRAMTEMNGVYCSSRAMRI  274



>dbj|BAB02953.1| DNA/RNA binding protein-like [Arabidopsis thaliana]
Length=489

 Score =   268 bits (684),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 177/216 (82%), Gaps = 7/216 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR+  N  DLS+FVGDL+ DVTD LL +TF  +YPSVK+AKVVID+
Sbjct  179   QPFRINWASFSTGEKRAVENGPDLSVFVGDLSPDVTDVLLHETFSDRYPSVKSAKVVIDS  238

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy-  697
             NTGRSKGYGFVRFGD+NERS+ALTEMNG YCS+R MR+G ATP+++   QQQ ++Q    
Sbjct  239   NTGRSKGYGFVRFGDENERSRALTEMNGAYCSNRQMRVGIATPKRAIANQQQHSSQAVIL  298

Query  696   -----SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGC  532
                  SNGS  +GSQSDG+S+N TIFVGG+DP+V DEDLRQPFSQ+GE+VSVKIPVGKGC
Sbjct  299   AGGHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQFGEVVSVKIPVGKGC  358

Query  531   GFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNP  424
             GFVQFA+R  AE+A++ L G VIGK TVRLSWGR+P
Sbjct  359   GFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRSP  394



>ref|XP_009147873.1| PREDICTED: polyadenylate-binding protein RBP47A [Brassica rapa]
Length=431

 Score =   265 bits (678),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 153/241 (63%), Positives = 182/241 (76%), Gaps = 5/241 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS--NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVID  877
             +P   NW++FS GEKR+  N   DLSIFVGDLA DVTD  LL+TF   Y SVK AKVVID
Sbjct  175   QPFRLNWASFSTGEKRASENGGPDLSIFVGDLAPDVTDATLLETFAG-YQSVKGAKVVID  233

Query  876   ANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssg-yqqqfaaqgg  700
             +NTGRSKGYGFVRFGD+NERS+ALTEMNG +CSSR MR+G ATP++++   QQ  +    
Sbjct  234   SNTGRSKGYGFVRFGDENERSRALTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALT  293

Query  699   ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  520
              + G   +GS SDGDS+N+TIFVGGLD +V++EDL QPFSQ+GE+VSVKIPVGKGCGFVQ
Sbjct  294   LAGGHGGNGSMSDGDSNNSTIFVGGLDADVTEEDLMQPFSQFGEVVSVKIPVGKGCGFVQ  353

Query  519   FANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
             F NR  AEEA+  L G VIGK TVRLSWGR+P +RQ R D  +QW G Y  G  Y+   Y
Sbjct  354   FGNRQSAEEAIGSLNGTVIGKNTVRLSWGRSP-NRQWRGDSGHQWNGGYSRGQGYNNNGY  412

Query  339   A  337
             A
Sbjct  413   A  413


 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/162 (26%), Positives = 72/162 (44%), Gaps = 27/162 (17%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  T +S+GYGFV F   +   + L   +GV    + +P R+  A+      
Sbjct  130  VSSVKVIRNKQTSQSEGYGFVEFLSRSAAEEVLQSYSGVTMPNAEQPFRLNWAS------  183

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  550
                   +    NG P           + +IFVG L P+V+D  L + F+ Y  +   K+
Sbjct  184  --FSTGEKRASENGGP-----------DLSIFVGDLAPDVTDATLLETFAGYQSVKGAKV  230

Query  549  PV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
             +       KG GFV+F +  +   AL ++ G     + +R+
Sbjct  231  VIDSNTGRSKGYGFVRFGDENERSRALTEMNGAFCSSRQMRV  272



>ref|XP_009112124.1| PREDICTED: polyadenylate-binding protein RBP47B-like isoform 
X1 [Brassica rapa]
Length=464

 Score =   266 bits (680),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 182/232 (78%), Gaps = 9/232 (4%)
 Frame = -2

Query  1035  NWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW++FS GEKR+  N  +LS+FVGDL+ DVTD +L + F  +YPSV++AKVVID+NTGRS
Sbjct  185   NWASFSTGEKRAVENGPELSVFVGDLSPDVTDAMLQELFAERYPSVRSAKVVIDSNTGRS  244

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy------  697
             KGYGFVRFGD+ ERS+ALTEMNG  CS+R MR+G ATP+++    QQ ++Q         
Sbjct  245   KGYGFVRFGDEGERSRALTEMNGALCSNREMRVGIATPKRAVANHQQHSSQAVIVAGGHG  304

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             +NGS A+GSQ+DG+S+N+TIFVGGLDP+V+DEDLRQPF+++GE+VSVKIPVGKGCGFVQF
Sbjct  305   ANGSMANGSQADGESNNSTIFVGGLDPDVTDEDLRQPFTEFGEVVSVKIPVGKGCGFVQF  364

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGH  361
             ANR  A++A+Q L G VIGK TVRLSWGR P   + R D   QW G Y  G+
Sbjct  365   ANRKSADDAIQSLNGTVIGKNTVRLSWGRTP--NKWRGDSGQQWNGGYSRGY  414



>ref|NP_001130489.1| uncharacterized protein LOC100191587 [Zea mays]
 gb|ACF78722.1| unknown [Zea mays]
Length=417

 Score =   265 bits (676),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 148/243 (61%), Positives = 181/243 (74%), Gaps = 15/243 (6%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+++SMGEKRS    D SIFVGDLA DVTD +LL+ F +KY SVK AKV+IDANTGRS+
Sbjct  169   NWASYSMGEKRSEVPPDHSIFVGDLAVDVTDEMLLELFSNKYRSVKGAKVIIDANTGRSR  228

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDN+++ A+TEMNGVYCS+RP+R+G ATPR+S G              SP  
Sbjct  229   GYGFVRFGDDNDKTLAMTEMNGVYCSTRPIRVGLATPRRSQGDS----------GSSPPR  278

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
               QSD DS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP GK CGFVQF NR DAE
Sbjct  279   --QSDVDSTNRTVYVGGLDPNVSEDELRKAFAKYGDLASVKIPFGKQCGFVQFVNRVDAE  336

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW--AGAYYGGHFYDGYTYAFPAPH  322
             EALQ L G  IGKQ +RLSWGR+P  +QSR D+ ++    G YYG  FY GY YA P  H
Sbjct  337   EALQGLNGSTIGKQAIRLSWGRSPTSKQSRGDYGHRRNGNGMYYGTPFYGGYGYASPVAH  396

Query  321   NPN  313
              PN
Sbjct  397   -PN  398



>ref|XP_006434824.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 ref|XP_006434826.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48064.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
 gb|ESR48066.1| hypothetical protein CICLE_v10001214mg [Citrus clementina]
Length=352

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 160/182 (88%), Gaps = 1/182 (1%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW+TFS G+KRS+N  DLSIFVGDLAADVTD+LL +TF S+YPSVKAAKVV DAN
Sbjct  163   QPFRLNWATFSTGDKRSDNGPDLSIFVGDLAADVTDSLLHETFASRYPSVKAAKVVFDAN  222

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKss-gyqqqfaaqggyS  694
             TGRSKGYGFVRFGDDNERSQA+TEMNGVYCSSRPMRIGAATPRKSS   QQ  +  G  S
Sbjct  223   TGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSQGGYAS  282

Query  693   NGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFA  514
             NG+P  G QS+GDSSNTTIFVGGLDPNV+DEDLRQPFSQYGEI SVKIPVGKGCGFVQFA
Sbjct  283   NGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFA  342

Query  513   NR  508
             NR
Sbjct  343   NR  344



>gb|KDO35910.1| hypothetical protein CISIN_1g029152mg [Citrus sinensis]
Length=189

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 161/189 (85%), Gaps = 3/189 (2%)
 Frame = -2

Query  807  LTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqgg-ySNGSPAHGSQSDGDSSNTTIFV  631
            +TEMNGVYCSSRPMRIGAATPRKSSGYQQQ+++QGG  SNG+P  G QS+GDSSNTTIFV
Sbjct  1    MTEMNGVYCSSRPMRIGAATPRKSSGYQQQYSSQGGYASNGAPGQGPQSEGDSSNTTIFV  60

Query  630  GGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQT  451
            GGLDPNV+DEDLRQPFSQYGEI SVKIPVGKGCGFVQFANR +AEEAL KL G VIGKQ+
Sbjct  61   GGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQS  120

Query  450  VRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYAFPAPHNPNmyapaaygaypmyG  271
            VRLSWGRNPA++Q R+D+ NQW+GAYYGG  YDGY YA P P++P+MYA AA        
Sbjct  121  VRLSWGRNPANKQFRADYGNQWSGAYYGGQVYDGYGYAIPPPNDPSMYAAAAAAYGAYPV  180

Query  270  --THQQQVS  250
              +HQQQVS
Sbjct  181  YGSHQQQVS  189


 Score = 39.3 bits (90),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = -3

Query  1079  LTEMNGVYCSSRPMRIG  1029
             +TEMNGVYCSSRPMRIG
Sbjct  1     MTEMNGVYCSSRPMRIG  17


 Score = 33.1 bits (74),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 48/94 (51%), Gaps = 7/94 (7%)
 Frame = -2

Query  1041  YANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGR  862
             YA+      G +   ++S+ +IFVG L  +VTD  L   F S+Y  + + K+ +      
Sbjct  37    YASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPF-SQYGEIASVKIPV------  89

Query  861   SKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRI  760
              KG GFV+F +     +AL ++NG     + +R+
Sbjct  90    GKGCGFVQFANRENAEEALHKLNGTVIGKQSVRL  123



>ref|XP_008678713.1| PREDICTED: polyadenylate-binding protein RBP47-like [Zea mays]
 gb|AFW62691.1| hypothetical protein ZEAMMB73_026342 [Zea mays]
Length=430

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 150/245 (61%), Positives = 181/245 (74%), Gaps = 17/245 (7%)
 Frame = -2

Query  1035  NWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRSK  856
             NW+++SMGEKRS  +SD SIFVGDLA DVTD +LL+ F +KY SVK AKV+IDANTGRS+
Sbjct  180   NWASYSMGEKRSEISSDHSIFVGDLAVDVTDAMLLELFSNKYRSVKGAKVIIDANTGRSR  239

Query  855   GYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySNGSPAH  676
             GYGFVRFGDDN++  A+TEMNGVYCS+RP+R+G ATPR+S G              SP  
Sbjct  240   GYGFVRFGDDNDKIHAMTEMNGVYCSTRPIRVGPATPRRSQGDSGT----------SPPR  289

Query  675   GSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRTDAE  496
               QS  DS+N T++VGGLDPNVS+++LR+ F++YG++ SVKIP GK CGFVQF NR DAE
Sbjct  290   --QSHVDSTNRTVYVGGLDPNVSEDELRKAFAKYGDLASVKIPFGKQCGFVQFVNRVDAE  347

Query  495   EALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQ----WAGAYYGGHFYDGYTYAFPA  328
             EAL  L G  IGKQ VRLSWGR+PA +QSR D  ++      G YYG  FY GY YA P 
Sbjct  348   EALHGLNGSTIGKQAVRLSWGRSPASKQSRGDSGHRRNGNCNGMYYGTPFYGGYGYASPI  407

Query  327   PHNPN  313
             PH PN
Sbjct  408   PH-PN  411



>emb|CDY50959.1| BnaA06g37550D [Brassica napus]
Length=430

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 152/241 (63%), Positives = 182/241 (76%), Gaps = 5/241 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS--NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVID  877
             +P   NW++FS GEKR+  N   DLSIFVGDLA DVTD  LL+TF   Y SVK AKVVID
Sbjct  174   QPFRLNWASFSTGEKRASENGGPDLSIFVGDLAPDVTDATLLETFAG-YQSVKGAKVVID  232

Query  876   ANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssg-yqqqfaaqgg  700
             +NTGRSKGYGFVRFGD++ERS+ALTEMNG +CSSR MR+G ATP++++   QQ  +    
Sbjct  233   SNTGRSKGYGFVRFGDESERSRALTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALT  292

Query  699   ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  520
              + G   +GS SDGDS+N+TIFVGGLD +V++EDL QPFSQ+GE+VSVKIPVGKGCGFVQ
Sbjct  293   LAGGHGGNGSMSDGDSNNSTIFVGGLDADVTEEDLMQPFSQFGEVVSVKIPVGKGCGFVQ  352

Query  519   FANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
             F NR  AEEA+  L G VIGK TVRLSWGR+P +RQ R D  +QW G Y  G  Y+   Y
Sbjct  353   FGNRQSAEEAIGNLNGTVIGKNTVRLSWGRSP-NRQWRGDSGHQWNGGYSRGQGYNNNGY  411

Query  339   A  337
             A
Sbjct  412   A  412


 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/162 (26%), Positives = 73/162 (45%), Gaps = 27/162 (17%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  T +S+GYGFV F   +   + L   +GV    + +P R+  A+      
Sbjct  129  VSSVKVIRNKQTSQSEGYGFVEFLSRSAAEEVLQSYSGVTMPNAEQPFRLNWAS------  182

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  550
                   +    NG P           + +IFVG L P+V+D  L + F+ Y  +   K+
Sbjct  183  --FSTGEKRASENGGP-----------DLSIFVGDLAPDVTDATLLETFAGYQSVKGAKV  229

Query  549  PV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
             +       KG GFV+F + ++   AL ++ G     + +R+
Sbjct  230  VIDSNTGRSKGYGFVRFGDESERSRALTEMNGAFCSSRQMRV  271



>gb|ABK24911.1| unknown [Picea sitchensis]
Length=397

 Score =   262 bits (670),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 153/254 (60%), Positives = 186/254 (73%), Gaps = 14/254 (6%)
 Frame = -2

Query  1047  PAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANT  868
             P   NW+TF  G++R+   +  SIFVGDL  +V D LL +TF S+Y SVK+AKVVIDANT
Sbjct  124   PFRLNWATFGAGDRRTEPGTGYSIFVGDLGPEVIDILLQETFQSRYSSVKSAKVVIDANT  183

Query  867   GRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaq----gg  700
             GR+KGYGFVRFGD+NE+++A+TEMNGVYC SRPMRI  ATP+KS G QQ ++ +      
Sbjct  184   GRTKGYGFVRFGDENEKNRAMTEMNGVYCCSRPMRINEATPKKSLGLQQSYSMKGNYYTQ  243

Query  699   ySNGSPA-HGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFV  523
                G+ A  G QSD D +NTTIFVGGLDPN +DEDLRQ F  +GEIV VKIPVGKGCGFV
Sbjct  244   AYGGAVAGQGFQSDNDPNNTTIFVGGLDPNATDEDLRQVFGPFGEIVYVKIPVGKGCGFV  303

Query  522   QFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRS------DFTNQW--AGAYYG  367
             QF NR+ AEEALQKL G +IG+Q++RLSWGR+PA++Q+ S         NQW   GAYY 
Sbjct  304   QFTNRSSAEEALQKLHGTIIGQQSIRLSWGRSPANKQTASWGVQPQPDPNQWNGGGAYYS  363

Query  366   -GHFYDGYTYAFPA  328
              G  Y+ Y YA PA
Sbjct  364   YGQGYEAYGYAPPA  377



>ref|XP_009145825.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Brassica 
rapa]
Length=426

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 147/240 (61%), Positives = 186/240 (78%), Gaps = 13/240 (5%)
 Frame = -2

Query  1035  NWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW++FS GEKR+  N  +LSIFVGDL+ DVTD++L + F  +YPSVK+AKVVID+NTGRS
Sbjct  181   NWASFSTGEKRAVENGPELSIFVGDLSPDVTDSMLQELFAERYPSVKSAKVVIDSNTGRS  240

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy------  697
             KGYGFVRFGD++ERS+ALTEMNG  CS+R MR+G ATP+++   QQQ ++Q         
Sbjct  241   KGYGFVRFGDESERSRALTEMNGALCSNRQMRVGVATPKRAVANQQQHSSQAVIVAGGHG  300

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             +NG  AHGSQSDGDS+N+TIFVGGLDP++++EDLRQPF+Q+GE+VSVKIP+GKGCGFVQ 
Sbjct  301   ANGFTAHGSQSDGDSNNSTIFVGGLDPDLTEEDLRQPFTQFGEVVSVKIPLGKGCGFVQL  360

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
             +NR  A++A+Q L G VIGK TVRLSWGR P ++Q R D      G Y  G  Y+   YA
Sbjct  361   SNRKSADDAIQSLNGTVIGKNTVRLSWGRTP-NKQWRGD-----NGGYSRGQGYNNGGYA  414



>emb|CDY68866.1| BnaCnng60840D [Brassica napus]
Length=415

 Score =   262 bits (670),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 181/235 (77%), Gaps = 4/235 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR S N  DLSIFVGDLA DVTD +LL+TF + Y SVK AKVVID+
Sbjct  161   QPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVTDAVLLETFAA-YQSVKGAKVVIDS  219

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssg-yqqqfaaqggy  697
             NTGRSKGYGFVRFGD+NERS+ALTEMNG +CSSR MR+G ATP++++   QQ  +     
Sbjct  220   NTGRSKGYGFVRFGDENERSKALTEMNGAFCSSRQMRVGVATPKRAAAYGQQNGSQALTL  279

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             + G   +GS +DG+S+N TIFVGGLD +V++EDL QPFS +GE+VSVKIPVGKGCGF+QF
Sbjct  280   AGGHGGNGSMADGESNNATIFVGGLDADVTEEDLMQPFSHFGEVVSVKIPVGKGCGFIQF  339

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
              NR  AEEA+  L G VIGK TVRLSWGR+P ++Q RSD  NQW G Y  G  Y+
Sbjct  340   GNRQSAEEAIGSLNGTVIGKNTVRLSWGRSP-NKQWRSDSGNQWNGGYSRGQGYN  393


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 74/169 (44%), Gaps = 28/169 (17%)
 Frame = -2

Query  924  FVSKYPSVKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAA  751
            F S    V + KV+ +  T +S+GYGFV F   +   + L   +GV    + +P R+  A
Sbjct  109  FFSHTNQVSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEVLQSYSGVTMPKAEQPFRLNWA  168

Query  750  TPRKssgyqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYG  571
            +             +    NG             + +IFVG L P+V+D  L + F+ Y 
Sbjct  169  S--------FSTGEKRASENG------------PDLSIFVGDLAPDVTDAVLLETFAAYQ  208

Query  570  EIVSVKIPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
             +   K+ +       KG GFV+F +  +  +AL ++ G     + +R+
Sbjct  209  SVKGAKVVIDSNTGRSKGYGFVRFGDENERSKALTEMNGAFCSSRQMRV  257



>emb|CDX92304.1| BnaA05g21030D [Brassica napus]
Length=424

 Score =   263 bits (671),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 147/240 (61%), Positives = 186/240 (78%), Gaps = 13/240 (5%)
 Frame = -2

Query  1035  NWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW++FS GEKR+  N  +LSIFVGDL+ DVTD++L + F  +YPSVK+AKVVID+NTGRS
Sbjct  179   NWASFSTGEKRAVENGPELSIFVGDLSPDVTDSMLQELFAERYPSVKSAKVVIDSNTGRS  238

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy------  697
             KGYGFVRFGD++ERS+ALTEMNG  CS+R MR+G ATP+++   QQQ ++Q         
Sbjct  239   KGYGFVRFGDESERSRALTEMNGALCSNRQMRVGVATPKRAVANQQQHSSQAVIVAGGHG  298

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             +NG  AHGSQSDGDS+N+TIFVGGLDP++++EDLRQPF+Q+GE+VSVKIP+GKGCGFVQ 
Sbjct  299   ANGFTAHGSQSDGDSNNSTIFVGGLDPDLTEEDLRQPFTQFGEVVSVKIPLGKGCGFVQL  358

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
             +NR  A++A+Q L G VIGK TVRLSWGR P ++Q R D      G Y  G  Y+   YA
Sbjct  359   SNRKSADDAIQSLNGTVIGKNTVRLSWGRTP-NKQWRGD-----NGGYSRGQGYNNGGYA  412



>emb|CDY29341.1| BnaA05g16080D [Brassica napus]
Length=419

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 150/235 (64%), Positives = 182/235 (77%), Gaps = 4/235 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR S N  DLSIFVGDLA DVTDT+LL+TF + Y SVK AKVVID+
Sbjct  165   QPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVTDTVLLETFAA-YQSVKGAKVVIDS  223

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssg-yqqqfaaqggy  697
             NTGRSKGYGFVRFGD+NERS+ALTEMNG +CSSR MR+G ATP++++   Q   +     
Sbjct  224   NTGRSKGYGFVRFGDENERSKALTEMNGAFCSSRQMRVGVATPKRAAAYGQLNGSQALTL  283

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             + G   +GS +DG+S+N+TIFVGGLD +V++EDL Q FSQ+GE+VSVKIPVGKGCGFVQF
Sbjct  284   AGGHGGNGSMADGESNNSTIFVGGLDADVTEEDLMQRFSQFGEVVSVKIPVGKGCGFVQF  343

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYD  352
              NR  AEEA+  L G VIGK TVRLSWGR+P ++Q RSD  NQW G Y  G  Y+
Sbjct  344   GNRQSAEEAIGSLNGTVIGKNTVRLSWGRSP-NKQWRSDSGNQWNGGYSRGQGYN  397


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 72/162 (44%), Gaps = 28/162 (17%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  T +S+GYGFV F   +   + L   +GV    + +P R+  A+      
Sbjct  120  VSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEVLQSYSGVTMPNAEQPFRLNWAS------  173

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  550
                   +    NG             + +IFVG L P+V+D  L + F+ Y  +   K+
Sbjct  174  --FSTGEKRASENG------------PDLSIFVGDLAPDVTDTVLLETFAAYQSVKGAKV  219

Query  549  PV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
             +       KG GFV+F +  +  +AL ++ G     + +R+
Sbjct  220  VIDSNTGRSKGYGFVRFGDENERSKALTEMNGAFCSSRQMRV  261



>ref|XP_009135617.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Brassica 
rapa]
 emb|CDX82310.1| BnaA03g35110D [Brassica napus]
Length=412

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 174/226 (77%), Gaps = 14/226 (6%)
 Frame = -2

Query  1035  NWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW++FS GEKR+  N+ +LSIFVGDL+ DVTDTLL + FV +YPSVK+AKVVID+NTGRS
Sbjct  171   NWASFSTGEKRAVENSPELSIFVGDLSPDVTDTLLQELFVERYPSVKSAKVVIDSNTGRS  230

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy----SN  691
             KGYGFVRFGD++ERS+ALTEMNG YCS+R MR+G ATP+++        A        +N
Sbjct  231   KGYGFVRFGDESERSRALTEMNGAYCSNRQMRVGVATPKRAVANHHPSQAVIVAGGHGAN  290

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
             G  AHGSQSDG+S+N+TIFVGG+DP+V++EDLR+PF+Q+GE+VSVKIPVGKGCGFVQ  N
Sbjct  291   GFMAHGSQSDGESNNSTIFVGGIDPDVTEEDLREPFTQFGEVVSVKIPVGKGCGFVQLDN  350

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAY  373
             R  A++A+Q L G VIGK TVRLSWGR             QW G Y
Sbjct  351   RKSADDAIQSLNGTVIGKNTVRLSWGRTS---------NKQWNGGY  387



>emb|CDY28101.1| BnaC06g02820D [Brassica napus]
Length=429

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 151/241 (63%), Positives = 182/241 (76%), Gaps = 5/241 (2%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS--NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVID  877
             +P   NW++FS GEKR+  N   DLSIFVGDLA DVTD  LL+TF   Y SVK AKVVID
Sbjct  173   QPFRLNWASFSTGEKRASENGGPDLSIFVGDLAPDVTDATLLETFAG-YQSVKGAKVVID  231

Query  876   ANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssg-yqqqfaaqgg  700
             +NTGRSKGYGFVRFGD++ERS+ALTEMNG +CSSR MR+G ATP++++   QQ  +    
Sbjct  232   SNTGRSKGYGFVRFGDESERSRALTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALT  291

Query  699   ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  520
              + G   +GS SDGDS+N+TIFVGGLD +V+++DL QPFSQ+GE+VSVKIPVGKGCGFVQ
Sbjct  292   LAGGHGGNGSMSDGDSNNSTIFVGGLDADVTEDDLMQPFSQFGEVVSVKIPVGKGCGFVQ  351

Query  519   FANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTY  340
             F NR  AEEA+  L G VIGK TVRLSWGR+P +RQ R D  +QW G Y  G  Y+   Y
Sbjct  352   FGNRQSAEEAIGSLNGTVIGKNTVRLSWGRSP-NRQWRGDSGHQWNGGYSRGQGYNNNGY  410

Query  339   A  337
             A
Sbjct  411   A  411


 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/162 (26%), Positives = 73/162 (45%), Gaps = 27/162 (17%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  T +S+GYGFV F   +   + L   +GV    + +P R+  A+      
Sbjct  128  VSSVKVIRNKQTSQSEGYGFVEFLSRSAAEEVLQSYSGVTMPNAEQPFRLNWAS------  181

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  550
                   +    NG P           + +IFVG L P+V+D  L + F+ Y  +   K+
Sbjct  182  --FSTGEKRASENGGP-----------DLSIFVGDLAPDVTDATLLETFAGYQSVKGAKV  228

Query  549  PV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
             +       KG GFV+F + ++   AL ++ G     + +R+
Sbjct  229  VIDSNTGRSKGYGFVRFGDESERSRALTEMNGAFCSSRQMRV  270



>gb|AAG13046.1|AC011807_5 Putative RNA binding protein [Arabidopsis thaliana]
Length=468

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 152/258 (59%), Positives = 185/258 (72%), Gaps = 26/258 (10%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKR-SNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDA  874
             +P   NW++FS GEKR S N  DLSIFVGDLA DV+D +LL+TF  +YPSVK AKVVID+
Sbjct  190   QPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDS  249

Query  873   NTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaa-----  709
             NTGRSKGYGFVRFGD+NERS+A+TEMNG +CSSR MR+G ATP++++ Y QQ  +     
Sbjct  250   NTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQGLIT  309

Query  708   -------------------qggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQP  586
                                    + G   +GS SDG+S+N+TIFVGGLD +V++EDL QP
Sbjct  310   CLDALNIASEVNCNVFIGLALTLAGGHGGNGSMSDGESNNSTIFVGGLDADVTEEDLMQP  369

Query  585   FSQYGEIVSVKIPVGKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSR  406
             FS +GE+VSVKIPVGKGCGFVQFANR  AEEA+  L G VIGK TVRLSWGR+P ++Q R
Sbjct  370   FSDFGEVVSVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSWGRSP-NKQWR  428

Query  405   SDFTNQWAGAYYGGHFYD  352
             SD  NQW G Y  G  Y+
Sbjct  429   SDSGNQWNGGYSRGQGYN  446



>ref|NP_001132004.1| uncharacterized protein LOC100193409 [Zea mays]
 gb|ACF80669.1| unknown [Zea mays]
Length=422

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 166/213 (78%), Gaps = 10/213 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FSMG++RS+ ASD SIFVGDLA+DV D  LL+ F S+Y SVK AKVVIDAN
Sbjct  163   QPFRLNWASFSMGDRRSDVASDHSIFVGDLASDVNDATLLEVFSSRYSSVKGAKVVIDAN  222

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGDD+E++ A+TEMNGVYCSSRPMRIG ATPRKSSG             
Sbjct  223   TGRSKGYGFVRFGDDSEKTHAMTEMNGVYCSSRPMRIGPATPRKSSGTSGSNG-------  275

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
                +      GD +NTT+FVGGLDP+VS+EDLRQ FSQYGEI SVKIPVGK CGFVQFA 
Sbjct  276   ---SSARPDGGDLTNTTVFVGGLDPDVSEEDLRQAFSQYGEISSVKIPVGKQCGFVQFAQ  332

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQ  412
             R +AE+ALQ L G  IGKQ VRLSWGRNPA++Q
Sbjct  333   RKNAEDALQGLNGSTIGKQAVRLSWGRNPANKQ  365



>gb|KFK31830.1| hypothetical protein AALP_AA6G163800 [Arabis alpina]
Length=409

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 170/224 (76%), Gaps = 17/224 (8%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FS GEKR  N  DLSIFVGDLA +VTDTLL + F  KY SVK+AKVV+D N
Sbjct  156   QPFRLNWASFSTGEKRLENGPDLSIFVGDLAPEVTDTLLHELFSEKYTSVKSAKVVLDGN  215

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGD++ERS+A+ EM+GV C SR MRIG ATPRK               +
Sbjct  216   TGRSKGYGFVRFGDESERSKAMLEMSGVKCLSRAMRIGPATPRKP--------------S  261

Query  690   GSPAHG--SQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             G    G  ++ +GDS NTTIFVGGLD +VSDEDLR+PF+++GEI SVKIP+GKGCGF+QF
Sbjct  262   GYHQQGGLARHEGDSLNTTIFVGGLDSSVSDEDLREPFAKFGEITSVKIPIGKGCGFIQF  321

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
              NR DAEEAL+KL G VIGKQTVRLSWGRNPA +  R +F +QW
Sbjct  322   VNRGDAEEALEKLNGSVIGKQTVRLSWGRNPA-KLPRGEFADQW  364


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 78/163 (48%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNG--VYCSSRPMRIGAATPRKssg  730
            + + KV+ + +TG S+GYGFV F   +   + L E NG  +  + +P R+  A       
Sbjct  111  ISSVKVIRNKHTGLSEGYGFVEFVSHDVAEKVLEEFNGETMLNTDQPFRLNWA-------  163

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVK  553
                          S + G +   +  + +IFVG L P V+D  L + FS+ Y  + S K
Sbjct  164  --------------SFSTGEKRLENGPDLSIFVGDLAPEVTDTLLHELFSEKYTSVKSAK  209

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + ++  +A+ ++ G+    + +R+
Sbjct  210  VVLDGNTGRSKGYGFVRFGDESERSKAMLEMSGVKCLSRAMRI  252



>gb|KFK31829.1| hypothetical protein AALP_AA6G163800 [Arabis alpina]
Length=410

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 172/222 (77%), Gaps = 12/222 (5%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRSNNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDAN  871
             +P   NW++FS GEKR  N  DLSIFVGDLA +VTDTLL + F  KY SVK+AKVV+D N
Sbjct  156   QPFRLNWASFSTGEKRLENGPDLSIFVGDLAPEVTDTLLHELFSEKYTSVKSAKVVLDGN  215

Query  870   TGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggySN  691
             TGRSKGYGFVRFGD++ERS+A+ EM+GV C SR MRIG ATPRK SGY QQ         
Sbjct  216   TGRSKGYGFVRFGDESERSKAMLEMSGVKCLSRAMRIGPATPRKPSGYHQQAGGL-----  270

Query  690   GSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAN  511
                   ++ +GDS NTTIFVGGLD +VSDEDLR+PF+++GEI SVKIP+GKGCGF+QF N
Sbjct  271   ------ARHEGDSLNTTIFVGGLDSSVSDEDLREPFAKFGEITSVKIPIGKGCGFIQFVN  324

Query  510   RTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQW  385
             R DAEEAL+KL G VIGKQTVRLSWGRNPA +  R +F +QW
Sbjct  325   RGDAEEALEKLNGSVIGKQTVRLSWGRNPA-KLPRGEFADQW  365


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 78/163 (48%), Gaps = 30/163 (18%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNG--VYCSSRPMRIGAATPRKssg  730
            + + KV+ + +TG S+GYGFV F   +   + L E NG  +  + +P R+  A       
Sbjct  111  ISSVKVIRNKHTGLSEGYGFVEFVSHDVAEKVLEEFNGETMLNTDQPFRLNWA-------  163

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQ-YGEIVSVK  553
                          S + G +   +  + +IFVG L P V+D  L + FS+ Y  + S K
Sbjct  164  --------------SFSTGEKRLENGPDLSIFVGDLAPEVTDTLLHELFSEKYTSVKSAK  209

Query  552  IPV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
            + +       KG GFV+F + ++  +A+ ++ G+    + +R+
Sbjct  210  VVLDGNTGRSKGYGFVRFGDESERSKAMLEMSGVKCLSRAMRI  252



>emb|CDY16528.1| BnaA08g02390D [Brassica napus]
Length=424

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 153/239 (64%), Positives = 185/239 (77%), Gaps = 6/239 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS--NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVID  877
             +P   NW++FS GEKR+  N   DLSIFVGDLA DVTD LLL+TF   Y SVK AKVVID
Sbjct  169   QPFRLNWASFSTGEKRASENGGPDLSIFVGDLAPDVTDALLLETFAG-YQSVKGAKVVID  227

Query  876   ANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssg-yqqqfaaqgg  700
             +NTGRSKGYGFVRFGD++ERS+ALTEMNG +CSSR MR+G ATP+++S   QQ  +    
Sbjct  228   SNTGRSKGYGFVRFGDESERSRALTEMNGAFCSSRQMRVGIATPKRASAYGQQNGSQALT  287

Query  699   ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  520
              + G  A+GS SDGDS+N+TIFVGG+D +V++EDL QPFSQ+GE+VSVKIPVGKGCGFVQ
Sbjct  288   LAGGHGANGSASDGDSNNSTIFVGGIDADVTEEDLMQPFSQFGEVVSVKIPVGKGCGFVQ  347

Query  519   FANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFY-DGY  346
             F NR  AEEA++ L G VIGK TVRLSWGR+P +RQ R +  +QW G Y  G  Y +GY
Sbjct  348   FGNRKSAEEAIENLNGTVIGKNTVRLSWGRSP-NRQWRGEAGHQWNGGYSRGQGYSNGY  405


 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/162 (26%), Positives = 73/162 (45%), Gaps = 27/162 (17%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  T +S+GYGFV F   +   + L   +GV    + +P R+  A+      
Sbjct  124  VSSVKVIRNKQTNQSEGYGFVEFLSRSAAEEVLQSYSGVTMPNADQPFRLNWAS------  177

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  550
                   +    NG P           + +IFVG L P+V+D  L + F+ Y  +   K+
Sbjct  178  --FSTGEKRASENGGP-----------DLSIFVGDLAPDVTDALLLETFAGYQSVKGAKV  224

Query  549  PV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
             +       KG GFV+F + ++   AL ++ G     + +R+
Sbjct  225  VIDSNTGRSKGYGFVRFGDESERSRALTEMNGAFCSSRQMRV  266



>ref|XP_009107272.1| PREDICTED: polyadenylate-binding protein RBP47A-like [Brassica 
rapa]
Length=424

 Score =   259 bits (663),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 153/239 (64%), Positives = 185/239 (77%), Gaps = 6/239 (3%)
 Frame = -2

Query  1050  KPAYANWSTFSMGEKRS--NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVID  877
             +P   NW++FS GEKR+  N   DLSIFVGDLA DVTD LLL+TF   Y SVK AKVVID
Sbjct  169   QPFRLNWASFSTGEKRASENGGPDLSIFVGDLAPDVTDALLLETFAG-YQSVKGAKVVID  227

Query  876   ANTGRSKGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssg-yqqqfaaqgg  700
             +NTGRSKGYGFVRFGD++ERS+ALTEMNG +CSSR MR+G ATP+++S   QQ  +    
Sbjct  228   SNTGRSKGYGFVRFGDESERSRALTEMNGAFCSSRQMRVGIATPKRASAYGQQNGSQALT  287

Query  699   ySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQ  520
              + G  A+GS SDGDS+N+TIFVGG+D +V++EDL QPFSQ+GE+VSVKIPVGKGCGFVQ
Sbjct  288   LAGGHGANGSVSDGDSNNSTIFVGGIDADVTEEDLMQPFSQFGEVVSVKIPVGKGCGFVQ  347

Query  519   FANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFY-DGY  346
             F NR  AEEA++ L G VIGK TVRLSWGR+P +RQ R +  +QW G Y  G  Y +GY
Sbjct  348   FGNRKSAEEAIENLNGTVIGKNTVRLSWGRSP-NRQWRGEAGHQWNGGYSRGQGYSNGY  405


 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/162 (26%), Positives = 73/162 (45%), Gaps = 27/162 (17%)
 Frame = -2

Query  903  VKAAKVVIDANTGRSKGYGFVRFGDDNERSQALTEMNGVYC--SSRPMRIGAATPRKssg  730
            V + KV+ +  T +S+GYGFV F   +   + L   +GV    + +P R+  A+      
Sbjct  124  VSSVKVIRNKQTNQSEGYGFVEFLSRSAAEEVLQSYSGVTMPNADQPFRLNWAS------  177

Query  729  yqqqfaaqggySNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKI  550
                   +    NG P           + +IFVG L P+V+D  L + F+ Y  +   K+
Sbjct  178  --FSTGEKRASENGGP-----------DLSIFVGDLAPDVTDALLLETFAGYQSVKGAKV  224

Query  549  PV------GKGCGFVQFANRTDAEEALQKLKGLVIGKQTVRL  442
             +       KG GFV+F + ++   AL ++ G     + +R+
Sbjct  225  VIDSNTGRSKGYGFVRFGDESERSRALTEMNGAFCSSRQMRV  266



>emb|CDX99265.1| BnaC05g33800D [Brassica napus]
Length=424

 Score =   259 bits (663),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 146/240 (61%), Positives = 185/240 (77%), Gaps = 13/240 (5%)
 Frame = -2

Query  1035  NWSTFSMGEKRS-NNASDLSIFVGdlaadvtdtllldTFVSKYPSVKAAKVVIDANTGRS  859
             NW++FS GEKR+  N  +LSIFVGDL+ DVTD++L + F  +YPSVK+AKVVID+NTGRS
Sbjct  179   NWASFSTGEKRAVENGPELSIFVGDLSPDVTDSMLQELFAERYPSVKSAKVVIDSNTGRS  238

Query  858   KGYGFVRFGDDNERSQALTEMNGVYCSSRPMRIGAATPRKssgyqqqfaaqggy------  697
             KGYGFVRFGD++ERS+AL+EMNG  CS+R MR+G ATP+++   QQQ ++Q         
Sbjct  239   KGYGFVRFGDESERSRALSEMNGALCSNRQMRVGVATPKRAVANQQQHSSQAVIVAGGHG  298

Query  696   SNGSPAHGSQSDGDSSNTTIFVGGLDPNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQF  517
             +NG  AHGSQSDGDS+N+TIFVGGLDP+V++EDLR+PF Q+GE+VSVKIP+GKGCGFVQ 
Sbjct  299   ANGFTAHGSQSDGDSNNSTIFVGGLDPDVTEEDLREPFIQFGEVVSVKIPLGKGCGFVQL  358

Query  516   ANRTDAEEALQKLKGLVIGKQTVRLSWGRNPAHRQSRSDFTNQWAGAYYGGHFYDGYTYA  337
             +NR  A++A+Q L G VIGK TVRLSWGR P ++Q R D      G Y  G  Y+   YA
Sbjct  359   SNRKSADDAIQSLNGTVIGKNTVRLSWGRTP-NKQWRGD-----NGGYSRGQGYNNGGYA  412



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2842483837200