BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9842

Length=833
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011082184.1|  PREDICTED: uncharacterized protein LOC105165...    276   3e-84   Sesamum indicum [beniseed]
ref|XP_011082183.1|  PREDICTED: uncharacterized protein LOC105165...    276   3e-84   Sesamum indicum [beniseed]
ref|XP_012079766.1|  PREDICTED: uncharacterized protein LOC105640147    272   2e-82   Jatropha curcas
gb|KJB25105.1|  hypothetical protein B456_004G177500                    268   2e-82   Gossypium raimondii
gb|KJB25103.1|  hypothetical protein B456_004G177500                    268   3e-82   Gossypium raimondii
ref|XP_007210882.1|  hypothetical protein PRUPE_ppa002815mg             270   8e-82   Prunus persica
gb|KJB25104.1|  hypothetical protein B456_004G177500                    270   8e-82   Gossypium raimondii
gb|KJB25102.1|  hypothetical protein B456_004G177500                    270   1e-81   Gossypium raimondii
ref|XP_004300682.1|  PREDICTED: uncharacterized protein LOC101298609    269   2e-81   Fragaria vesca subsp. vesca
emb|CBI29197.3|  unnamed protein product                                269   2e-81   Vitis vinifera
ref|XP_002269181.2|  PREDICTED: uncharacterized protein LOC100263017    269   2e-81   Vitis vinifera
ref|XP_010518959.1|  PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D...    269   2e-81   Tarenaya hassleriana [spider flower]
ref|XP_011082185.1|  PREDICTED: uncharacterized protein LOC105165...    268   4e-81   Sesamum indicum [beniseed]
ref|XP_006385158.1|  hypothetical protein POPTR_0004s24390g             268   4e-81   
ref|XP_002519934.1|  reticulon3-A3, putative                            268   7e-81   Ricinus communis
ref|XP_004142646.1|  PREDICTED: uncharacterized protein LOC101203732    266   3e-80   Cucumis sativus [cucumbers]
ref|XP_009141501.1|  PREDICTED: uncharacterized protein LOC103865...    266   3e-80   Brassica rapa
ref|XP_009141500.1|  PREDICTED: uncharacterized protein LOC103865...    266   3e-80   Brassica rapa
ref|XP_009769854.1|  PREDICTED: uncharacterized protein LOC104220660    265   5e-80   Nicotiana sylvestris
ref|XP_007156344.1|  hypothetical protein PHAVU_003G278600g             251   6e-80   Phaseolus vulgaris [French bean]
ref|XP_008365916.1|  PREDICTED: uncharacterized protein LOC103429...    264   1e-79   
ref|XP_007040865.1|  Xyloglucanase 113 isoform 1                        264   2e-79   
ref|XP_009143647.1|  PREDICTED: uncharacterized protein LOC103867343    264   2e-79   Brassica rapa
emb|CDP07209.1|  unnamed protein product                                263   2e-79   Coffea canephora [robusta coffee]
ref|XP_009603199.1|  PREDICTED: uncharacterized protein LOC104098231    263   3e-79   Nicotiana tomentosiformis
gb|AAD15452.2|  unknown protein                                         261   3e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266425.1|  PREDICTED: uncharacterized protein LOC104603...    262   4e-79   Nelumbo nucifera [Indian lotus]
ref|XP_010266424.1|  PREDICTED: uncharacterized protein LOC104603...    262   6e-79   Nelumbo nucifera [Indian lotus]
ref|XP_009362859.1|  PREDICTED: uncharacterized protein LOC103952897    262   7e-79   Pyrus x bretschneideri [bai li]
ref|XP_010056115.1|  PREDICTED: uncharacterized protein LOC104444...    262   8e-79   Eucalyptus grandis [rose gum]
ref|XP_010056116.1|  PREDICTED: uncharacterized protein LOC104444...    262   8e-79   
ref|XP_008444233.1|  PREDICTED: uncharacterized protein LOC103487624    261   2e-78   Cucumis melo [Oriental melon]
ref|XP_006410719.1|  hypothetical protein EUTSA_v10016368mg             261   2e-78   Eutrema salsugineum [saltwater cress]
gb|EYU37484.1|  hypothetical protein MIMGU_mgv1a002766mg                261   2e-78   Erythranthe guttata [common monkey flower]
ref|XP_008348925.1|  PREDICTED: uncharacterized protein LOC103412105    246   2e-78   
ref|XP_011028505.1|  PREDICTED: uncharacterized protein LOC105128...    261   3e-78   Populus euphratica
ref|XP_011028504.1|  PREDICTED: uncharacterized protein LOC105128...    261   3e-78   Populus euphratica
ref|XP_004246017.1|  PREDICTED: uncharacterized protein LOC101254412    260   4e-78   Solanum lycopersicum
ref|XP_003517099.1|  PREDICTED: uncharacterized protein LOC100776463    259   7e-78   Glycine max [soybeans]
gb|KJB51493.1|  hypothetical protein B456_008G219000                    259   9e-78   Gossypium raimondii
gb|KHG12903.1|  hypothetical protein F383_16835                         258   2e-77   Gossypium arboreum [tree cotton]
ref|XP_006359953.1|  PREDICTED: uncharacterized protein LOC102605...    258   2e-77   Solanum tuberosum [potatoes]
ref|XP_006293822.1|  hypothetical protein CARUB_v10022808mg             258   4e-77   Capsella rubella
ref|XP_010516741.1|  PREDICTED: uncharacterized protein LOC104792321    257   9e-77   Camelina sativa [gold-of-pleasure]
ref|XP_007158076.1|  hypothetical protein PHAVU_002G122000g             255   2e-76   Phaseolus vulgaris [French bean]
emb|CDP07210.1|  unnamed protein product                                256   4e-76   Coffea canephora [robusta coffee]
ref|XP_010111777.1|  hypothetical protein L484_008781                   255   5e-76   Morus notabilis
ref|XP_010505074.1|  PREDICTED: uncharacterized protein LOC104781967    254   9e-76   Camelina sativa [gold-of-pleasure]
emb|CDY32116.1|  BnaC04g44500D                                          254   9e-76   Brassica napus [oilseed rape]
ref|XP_006590766.1|  PREDICTED: uncharacterized protein LOC100789338    253   2e-75   Glycine max [soybeans]
ref|XP_010509590.1|  PREDICTED: uncharacterized protein LOC104785987    253   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_003612490.1|  hypothetical protein MTR_5g025590                  252   4e-75   
gb|KFK36454.1|  hypothetical protein AALP_AA4G126700                    252   8e-75   Arabis alpina [alpine rockcress]
ref|XP_006430896.1|  hypothetical protein CICLE_v10011269mg             251   9e-75   Citrus clementina [clementine]
ref|NP_850250.1|  xyloglucanase 113                                     250   4e-74   Arabidopsis thaliana [mouse-ear cress]
emb|CDY40459.1|  BnaA04g20580D                                          250   4e-74   Brassica napus [oilseed rape]
ref|XP_006359954.1|  PREDICTED: uncharacterized protein LOC102605...    248   1e-73   Solanum tuberosum [potatoes]
gb|KDO72261.1|  hypothetical protein CISIN_1g036925mg                   248   1e-73   Citrus sinensis [apfelsine]
ref|XP_006482352.1|  PREDICTED: uncharacterized protein LOC102613765    248   1e-73   Citrus sinensis [apfelsine]
ref|XP_008804433.1|  PREDICTED: uncharacterized protein LOC103717721    242   2e-73   
ref|XP_010676705.1|  PREDICTED: uncharacterized protein LOC104892...    245   2e-73   Beta vulgaris subsp. vulgaris [field beet]
gb|AES95448.2|  nucleotide-diphospho-sugar transferase family pro...    249   2e-73   Medicago truncatula
dbj|BAH19600.1|  AT2G35610                                              248   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010676704.1|  PREDICTED: uncharacterized protein LOC104892...    246   2e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004512439.1|  PREDICTED: uncharacterized protein LOC101497257    247   3e-73   
gb|KHN05539.1|  hypothetical protein glysoja_020504                     247   4e-73   Glycine soja [wild soybean]
emb|CDP12729.1|  unnamed protein product                                246   7e-73   Coffea canephora [robusta coffee]
ref|XP_003547737.1|  PREDICTED: uncharacterized protein LOC100780346    246   1e-72   Glycine max [soybeans]
ref|XP_010676703.1|  PREDICTED: uncharacterized protein LOC104892...    245   1e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002881404.1|  hypothetical protein ARALYDRAFT_902666             245   3e-72   
gb|AET03500.2|  nucleotide-diphospho-sugar transferase family pro...    244   4e-72   Medicago truncatula
ref|XP_003629024.1|  hypothetical protein MTR_8g072310                  245   5e-72   
ref|XP_003548765.1|  PREDICTED: uncharacterized protein LOC100819032    244   5e-72   Glycine max [soybeans]
ref|XP_004509491.1|  PREDICTED: uncharacterized protein LOC101505601    243   3e-71   Cicer arietinum [garbanzo]
emb|CDP12731.1|  unnamed protein product                                241   7e-71   Coffea canephora [robusta coffee]
emb|CDY31704.1|  BnaA05g08430D                                          240   2e-70   Brassica napus [oilseed rape]
ref|XP_010907098.1|  PREDICTED: uncharacterized protein LOC105033...    240   3e-70   Elaeis guineensis
gb|KHN27499.1|  hypothetical protein glysoja_018611                     240   3e-70   Glycine soja [wild soybean]
ref|XP_010907097.1|  PREDICTED: uncharacterized protein LOC105033...    240   3e-70   Elaeis guineensis
emb|CDX84192.1|  BnaC04g09540D                                          237   2e-69   
dbj|BAD94473.1|  hypothetical protein                                   222   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009388198.1|  PREDICTED: uncharacterized protein LOC103975012    218   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388312.1|  PREDICTED: uncharacterized protein LOC103975128    218   2e-67   
ref|XP_006878624.1|  PREDICTED: uncharacterized protein LOC184227...    232   3e-67   Amborella trichopoda
ref|XP_011623933.1|  PREDICTED: uncharacterized protein LOC184227...    232   3e-67   Amborella trichopoda
ref|XP_009381925.1|  PREDICTED: uncharacterized protein LOC103970025    215   3e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383104.1|  PREDICTED: uncharacterized protein LOC103970914    225   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003562333.1|  PREDICTED: uncharacterized protein LOC100845970    221   1e-63   Brachypodium distachyon [annual false brome]
gb|KHG12902.1|  hypothetical protein F383_16835                         219   1e-62   Gossypium arboreum [tree cotton]
ref|XP_006650304.1|  PREDICTED: uncharacterized protein LOC102706084    217   6e-62   Oryza brachyantha
ref|XP_002464281.1|  hypothetical protein SORBIDRAFT_01g015590          216   1e-61   Sorghum bicolor [broomcorn]
gb|EEC75649.1|  hypothetical protein OsI_12401                          215   3e-61   Oryza sativa Indica Group [Indian rice]
gb|ABF97349.1|  expressed protein                                       215   3e-61   Oryza sativa Japonica Group [Japonica rice]
gb|EEE59420.1|  hypothetical protein OsJ_11574                          216   4e-61   Oryza sativa Japonica Group [Japonica rice]
gb|KHF98530.1|  hypothetical protein F383_12515                         214   5e-61   Gossypium arboreum [tree cotton]
ref|XP_004982506.1|  PREDICTED: uncharacterized protein LOC101753789    214   8e-61   Setaria italica
gb|EPS68350.1|  hypothetical protein M569_06419                         212   1e-60   Genlisea aurea
ref|XP_010235552.1|  PREDICTED: uncharacterized protein LOC100829311    213   4e-60   
ref|XP_009383108.1|  PREDICTED: uncharacterized protein LOC103970917    202   9e-60   
ref|XP_010540709.1|  PREDICTED: uncharacterized protein LOC104814389    211   1e-59   Tarenaya hassleriana [spider flower]
ref|NP_001143144.1|  hypothetical protein                               211   1e-59   Zea mays [maize]
gb|EPS58524.1|  hypothetical protein M569_16289                         205   2e-59   Genlisea aurea
emb|CDP12730.1|  unnamed protein product                                202   3e-56   Coffea canephora [robusta coffee]
gb|KHN03113.1|  hypothetical protein glysoja_049543                     189   2e-51   Glycine soja [wild soybean]
gb|KHN41773.1|  Pentatricopeptide repeat-containing protein, mito...    186   7e-49   Glycine soja [wild soybean]
ref|XP_002988322.1|  glycosyltransferase-like protein                   174   2e-46   
ref|XP_002991425.1|  glycosyltransferase-like protein                   170   4e-45   
gb|EPS68351.1|  hypothetical protein M569_06420                         157   1e-44   Genlisea aurea
gb|KCW72694.1|  hypothetical protein EUGRSUZ_E01147                     167   9e-44   Eucalyptus grandis [rose gum]
gb|KJB25101.1|  hypothetical protein B456_004G177500                    166   3e-43   Gossypium raimondii
ref|XP_001761094.1|  predicted protein                                  162   3e-42   
ref|XP_009383105.1|  PREDICTED: uncharacterized protein LOC103970915    124   4e-30   
ref|XP_002506735.1|  glycosyltransferase family 77 protein              124   4e-28   Micromonas commoda
gb|KJB25098.1|  hypothetical protein B456_004G177500                    120   2e-27   Gossypium raimondii
emb|CAN79199.1|  hypothetical protein VITISV_040773                     120   5e-27   Vitis vinifera
tpg|DAA50139.1|  TPA: hypothetical protein ZEAMMB73_624371              107   1e-25   
ref|XP_003062865.1|  glycosyltransferase family 77 protein              109   1e-23   Micromonas pusilla CCMP1545
emb|CDX84231.1|  BnaC04g09930D                                          101   4e-21   
gb|KIZ02111.1|  hypothetical protein MNEG_5846                        92.4    1e-18   Monoraphidium neglectum
ref|XP_005843950.1|  hypothetical protein CHLNCDRAFT_37217            94.7    3e-18   Chlorella variabilis
ref|XP_005646140.1|  hypothetical protein COCSUDRAFT_17381            92.0    2e-17   Coccomyxa subellipsoidea C-169
ref|XP_002956941.1|  hypothetical protein VOLCADRAFT_83868            92.0    2e-17   Volvox carteri f. nagariensis
ref|XP_002957630.1|  hypothetical protein VOLCADRAFT_77645            90.5    6e-17   Volvox carteri f. nagariensis
ref|XP_001692787.1|  predicted protein                                79.0    4e-13   Chlamydomonas reinhardtii
ref|XP_001690605.1|  hypothetical protein CHLREDRAFT_114491           77.0    1e-12   Chlamydomonas reinhardtii
ref|XP_005852062.1|  hypothetical protein CHLNCDRAFT_133059           75.9    5e-12   Chlorella variabilis
ref|XP_005649227.1|  hypothetical protein COCSUDRAFT_62105            64.3    3e-08   Coccomyxa subellipsoidea C-169
gb|KJB25099.1|  hypothetical protein B456_004G177500                  63.5    4e-08   Gossypium raimondii
ref|XP_007040867.1|  Xyloglucanase 113 isoform 3                      62.8    1e-07   
ref|XP_007040866.1|  Xyloglucanase 113 isoform 2                      62.4    1e-07   
ref|XP_011395852.1|  hypothetical protein F751_0343                   58.5    3e-06   Auxenochlorella protothecoides
ref|XP_010676706.1|  PREDICTED: uncharacterized protein LOC104892...  56.2    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011397701.1|  hypothetical protein F751_1692                   55.5    2e-05   Auxenochlorella protothecoides
ref|XP_001701267.1|  hypothetical protein CHLREDRAFT_179139           52.8    2e-04   Chlamydomonas reinhardtii
ref|XP_007509006.1|  predicted protein                                53.1    2e-04   Bathycoccus prasinos
gb|KDD76569.1|  nucleotide-diphospho-sugar transferase                52.0    4e-04   Helicosporidium sp. ATCC 50920
ref|XP_011397704.1|  hypothetical protein F751_1695                   51.2    6e-04   Auxenochlorella protothecoides



>ref|XP_011082184.1| PREDICTED: uncharacterized protein LOC105165007 isoform X2 [Sesamum 
indicum]
Length=639

 Score =   276 bits (707),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PEEE GPGI+FREYS FDNP +PQ+VK+SWLDV LC+EGS GC+ SN
Sbjct  478  DHVFEVNVMLKEFPEEELGPGINFREYSFFDNPSVPQQVKKSWLDVHLCQEGSHGCEASN  537

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            STT  GIL+FPK STE+ FKT+FS FKDVKVIQFSSM DAF GF+DK RE RFR RVKRY
Sbjct  538  STTQVGILKFPKRSTEQMFKTIFSSFKDVKVIQFSSMQDAFLGFSDKTREERFRKRVKRY  597

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
             GIWCCVENQ+PGH+YYDMYWDEKP WKP PPQTP+EDHPP
Sbjct  598  TGIWCCVENQSPGHIYYDMYWDEKPGWKPKPPQTPEEDHPP  638



>ref|XP_011082183.1| PREDICTED: uncharacterized protein LOC105165007 isoform X1 [Sesamum 
indicum]
Length=640

 Score =   276 bits (707),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PEEE GPGI+FREYS FDNP +PQ+VK+SWLDV LC+EGS GC+ SN
Sbjct  479  DHVFEVNVMLKEFPEEELGPGINFREYSFFDNPSVPQQVKKSWLDVHLCQEGSHGCEASN  538

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            STT  GIL+FPK STE+ FKT+FS FKDVKVIQFSSM DAF GF+DK RE RFR RVKRY
Sbjct  539  STTQVGILKFPKRSTEQMFKTIFSSFKDVKVIQFSSMQDAFLGFSDKTREERFRKRVKRY  598

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
             GIWCCVENQ+PGH+YYDMYWDEKP WKP PPQTP+EDHPP
Sbjct  599  TGIWCCVENQSPGHIYYDMYWDEKPGWKPKPPQTPEEDHPP  639



>ref|XP_012079766.1| PREDICTED: uncharacterized protein LOC105640147 [Jatropha curcas]
 gb|KDP31566.1| hypothetical protein JCGZ_15383 [Jatropha curcas]
Length=647

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PEE+FGPGI+ REYS  DNP +P++VKESWLDVQLC+EG+ GC  SN
Sbjct  486  DHVFEVNVMLKQLPEEDFGPGINIREYSFLDNPSLPKQVKESWLDVQLCQEGTHGCVASN  545

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+ +G+LRFPK+S E+  K VFS FKDVKVIQFSSM D F GFTDKARE +FRNRVKRY
Sbjct  546  RTSPSGVLRFPKHSNEDMIKAVFSSFKDVKVIQFSSMQDGFLGFTDKAREEKFRNRVKRY  605

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVEN TPGHVYYDMYWDEKP+WKP+PP+TP+ DHPPW
Sbjct  606  VGIWCCVENHTPGHVYYDMYWDEKPDWKPMPPETPELDHPPW  647



>gb|KJB25105.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=488

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PEEEFGP I+ REYS  +NPL+PQ+VKESWLDVQLC+EG+E C  S+
Sbjct  327  DHVFEVNVMLKDLPEEEFGPEINIREYSFLNNPLLPQQVKESWLDVQLCQEGTEDCHASS  386

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+  G+LRFPKNSTEE FKTVFS FKDVKVIQFSSM  AF  FTDK RE +FRNR+KRY
Sbjct  387  NTSRPGLLRFPKNSTEEMFKTVFSSFKDVKVIQFSSMQGAFYSFTDKTREGKFRNRMKRY  446

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVEN TPGH+YYDMYWDEKP WKP PPQTP+EDHPP+
Sbjct  447  VGIWCCVENHTPGHIYYDMYWDEKPGWKPAPPQTPEEDHPPF  488



>gb|KJB25103.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=533

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PEEEFGP I+ REYS  +NPL+PQ+VKESWLDVQLC+EG+E C  S+
Sbjct  372  DHVFEVNVMLKDLPEEEFGPEINIREYSFLNNPLLPQQVKESWLDVQLCQEGTEDCHASS  431

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+  G+LRFPKNSTEE FKTVFS FKDVKVIQFSSM  AF  FTDK RE +FRNR+KRY
Sbjct  432  NTSRPGLLRFPKNSTEEMFKTVFSSFKDVKVIQFSSMQGAFYSFTDKTREGKFRNRMKRY  491

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVEN TPGH+YYDMYWDEKP WKP PPQTP+EDHPP+
Sbjct  492  VGIWCCVENHTPGHIYYDMYWDEKPGWKPAPPQTPEEDHPPF  533



>ref|XP_007210882.1| hypothetical protein PRUPE_ppa002815mg [Prunus persica]
 gb|EMJ12081.1| hypothetical protein PRUPE_ppa002815mg [Prunus persica]
Length=630

 Score =   270 bits (690),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNV+ +E PEE FGP I+ REYS FDNPLMP++VKESWL+VQLC+EG+  C  SN
Sbjct  469  DHVFEVNVLLKELPEEIFGPQINIREYSFFDNPLMPKQVKESWLEVQLCQEGTRDCVASN  528

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+ +G+LRFPK S EE FKT+FS FKDVKVIQFSSM DAF GFTDKARE +FRNRVKRY
Sbjct  529  TTSPSGVLRFPKRSDEETFKTIFSSFKDVKVIQFSSMQDAFPGFTDKAREEKFRNRVKRY  588

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCCV   TPGH+YYDMYWDEKP WKPIPPQTP++DHPP
Sbjct  589  VGIWCCVAEHTPGHIYYDMYWDEKPGWKPIPPQTPEDDHPP  629



>gb|KJB25104.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=620

 Score =   270 bits (689),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PEEEFGP I+ REYS  +NPL+PQ+VKESWLDVQLC+EG+E C  S+
Sbjct  459  DHVFEVNVMLKDLPEEEFGPEINIREYSFLNNPLLPQQVKESWLDVQLCQEGTEDCHASS  518

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+  G+LRFPKNSTEE FKTVFS FKDVKVIQFSSM  AF  FTDK RE +FRNR+KRY
Sbjct  519  NTSRPGLLRFPKNSTEEMFKTVFSSFKDVKVIQFSSMQGAFYSFTDKTREGKFRNRMKRY  578

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVEN TPGH+YYDMYWDEKP WKP PPQTP+EDHPP+
Sbjct  579  VGIWCCVENHTPGHIYYDMYWDEKPGWKPAPPQTPEEDHPPF  620



>gb|KJB25102.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=634

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PEEEFGP I+ REYS  +NPL+PQ+VKESWLDVQLC+EG+E C  S+
Sbjct  473  DHVFEVNVMLKDLPEEEFGPEINIREYSFLNNPLLPQQVKESWLDVQLCQEGTEDCHASS  532

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+  G+LRFPKNSTEE FKTVFS FKDVKVIQFSSM  AF  FTDK RE +FRNR+KRY
Sbjct  533  NTSRPGLLRFPKNSTEEMFKTVFSSFKDVKVIQFSSMQGAFYSFTDKTREGKFRNRMKRY  592

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVEN TPGH+YYDMYWDEKP WKP PPQTP+EDHPP+
Sbjct  593  VGIWCCVENHTPGHIYYDMYWDEKPGWKPAPPQTPEEDHPPF  634



>ref|XP_004300682.1| PREDICTED: uncharacterized protein LOC101298609 [Fragaria vesca 
subsp. vesca]
Length=629

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E P EEFGP I+ REYS FDNPLMP++VK+SWL+VQLC+EG   C  SN
Sbjct  468  DHVFEVNIMLKELPVEEFGPQINIREYSFFDNPLMPKQVKDSWLEVQLCQEGIRDCLASN  527

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+ +G+LRFPK S+EE FKTVFS FKDVKVI+FSSM DAF GF DK RE RFRNRVKRY
Sbjct  528  NTSPSGVLRFPKRSSEETFKTVFSSFKDVKVIKFSSMQDAFLGFADKIREERFRNRVKRY  587

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCCV  QTPGH+YYDMYWDEKP WKP+PPQTPQ+DHPP
Sbjct  588  VGIWCCVAEQTPGHIYYDMYWDEKPGWKPLPPQTPQDDHPP  628



>emb|CBI29197.3| unnamed protein product [Vitis vinifera]
Length=642

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PE+EFGPGI+ REYS FDNPLMP++VK+SWLDVQLCREGS GC ++N
Sbjct  482  DHVFEVNVMLKEFPEDEFGPGINIREYSFFDNPLMPKQVKDSWLDVQLCREGSPGCNVTN  541

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T++ GI R PK+STEE FK+VFSLFKDVKVIQFS+M DAF GFTDK  E +FR RVKRY
Sbjct  542  NTSSLGI-RLPKHSTEEMFKSVFSLFKDVKVIQFSTMQDAFLGFTDKKTEEKFRKRVKRY  600

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCV+   PGH+YYDMYWDEKPNWKPIPPQ  ++DHPPW
Sbjct  601  VGIWCCVKGSDPGHIYYDMYWDEKPNWKPIPPQASEDDHPPW  642



>ref|XP_002269181.2| PREDICTED: uncharacterized protein LOC100263017 [Vitis vinifera]
Length=631

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PE+EFGPGI+ REYS FDNPLMP++VK+SWLDVQLCREGS GC ++N
Sbjct  471  DHVFEVNVMLKEFPEDEFGPGINIREYSFFDNPLMPKQVKDSWLDVQLCREGSPGCNVTN  530

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T++ GI R PK+STEE FK+VFSLFKDVKVIQFS+M DAF GFTDK  E +FR RVKRY
Sbjct  531  NTSSLGI-RLPKHSTEEMFKSVFSLFKDVKVIQFSTMQDAFLGFTDKKTEEKFRKRVKRY  589

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCV+   PGH+YYDMYWDEKPNWKPIPPQ  ++DHPPW
Sbjct  590  VGIWCCVKGSDPGHIYYDMYWDEKPNWKPIPPQASEDDHPPW  631



>ref|XP_010518959.1| PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D-xylosyltransferase 
MGP4 [Tarenaya hassleriana]
Length=631

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PEEEFGPGI  REYS  +NPL+P+ VKESWLDV+LC+EGSEGC+ SN
Sbjct  470  DHVFEVNIMLKELPEEEFGPGIGIREYSFLENPLLPKHVKESWLDVKLCQEGSEGCEASN  529

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+ +G+L+FPK S+EE+FK +FS FKDVKVI+FSS+ DAF GF++K RE +FR RVK Y
Sbjct  530  NTSPSGVLKFPKRSSEERFKAIFSSFKDVKVIKFSSIQDAFTGFSNKEREEKFRKRVKTY  589

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCCVEN+TPGH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  590  VGIWCCVENKTPGHIYYDMYWDEKPGWKPVPPQTPEEDHPP  630



>ref|XP_011082185.1| PREDICTED: uncharacterized protein LOC105165007 isoform X3 [Sesamum 
indicum]
Length=622

 Score =   268 bits (685),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = -2

Query  814  VNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTAT  635
            VNVM +E PEEE GPGI+FREYS FDNP +PQ+VK+SWLDV LC+EGS GC+ SNSTT  
Sbjct  466  VNVMLKEFPEEELGPGINFREYSFFDNPSVPQQVKKSWLDVHLCQEGSHGCEASNSTTQV  525

Query  634  GILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWC  455
            GIL+FPK STE+ FKT+FS FKDVKVIQFSSM DAF GF+DK RE RFR RVKRY GIWC
Sbjct  526  GILKFPKRSTEQMFKTIFSSFKDVKVIQFSSMQDAFLGFSDKTREERFRKRVKRYTGIWC  585

Query  454  CVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            CVENQ+PGH+YYDMYWDEKP WKP PPQTP+EDHPP
Sbjct  586  CVENQSPGHIYYDMYWDEKPGWKPKPPQTPEEDHPP  621



>ref|XP_006385158.1| hypothetical protein POPTR_0004s24390g [Populus trichocarpa]
 gb|ERP62955.1| hypothetical protein POPTR_0004s24390g [Populus trichocarpa]
Length=638

 Score =   268 bits (685),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN M +EQPEEEFGP I+FREYS  DNPL+P+ VKESWLDVQLC+EG+E C  SN
Sbjct  477  DHVFEVNNMLKEQPEEEFGPAINFREYSFLDNPLLPRHVKESWLDVQLCQEGAEDCGASN  536

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+  GILRFPK S E+ FKT FS FKDVKVIQFSSM DAF GFTDK RE +FRNR+KRY
Sbjct  537  KTSRPGILRFPKRSNEDMFKTTFSSFKDVKVIQFSSMQDAFVGFTDKRREEKFRNRMKRY  596

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVEN  PGH+YYDMYWDEK NWKP+PPQ+ ++DHPPW
Sbjct  597  VGIWCCVENHDPGHIYYDMYWDEKSNWKPMPPQSAEDDHPPW  638



>ref|XP_002519934.1| reticulon3-A3, putative [Ricinus communis]
 gb|EEF42538.1| reticulon3-A3, putative [Ricinus communis]
Length=639

 Score =   268 bits (684),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++QPEEEFGPGI+ REYS  DNP +P+ VKESWLDV LC+EG++ C  +N
Sbjct  479  DHVFEVNVMLKQQPEEEFGPGINIREYSFLDNPALPKHVKESWLDVHLCQEGAQACY-AN  537

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             TT++G+L+FPK S+EEKFKTVFS FKDVKVIQFSSM DAF GFTDK RE +FRNRVKRY
Sbjct  538  GTTSSGVLKFPKGSSEEKFKTVFSSFKDVKVIQFSSMQDAFLGFTDKEREAKFRNRVKRY  597

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            +GIWCCV++ TPGH+YYDMYWDEKP WK +PP+TP+ DHPPW
Sbjct  598  LGIWCCVDSHTPGHIYYDMYWDEKPGWKAMPPETPELDHPPW  639



>ref|XP_004142646.1| PREDICTED: uncharacterized protein LOC101203732 [Cucumis sativus]
 gb|KGN54526.1| hypothetical protein Csa_4G358640 [Cucumis sativus]
Length=640

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PEEEFGPGI FREYS  +NPL+P++VKESWLDVQLC++ SEGC  SN
Sbjct  479  DHVFEVNVMLKELPEEEFGPGIDFREYSFLENPLLPKQVKESWLDVQLCKQESEGCSASN  538

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T   G+L+FPK S E+ FK +FS FKDVKVIQFS+M DAF GF+DK RE +FRNRVKRY
Sbjct  539  DTVLPGVLKFPKGSNEDTFKAIFSTFKDVKVIQFSTMQDAFPGFSDKKREEKFRNRVKRY  598

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCCVEN  PGH+YYDMYWDEKPNWKP PP+TP+ED PP
Sbjct  599  VGIWCCVENAAPGHIYYDMYWDEKPNWKPHPPRTPEEDRPP  639



>ref|XP_009141501.1| PREDICTED: uncharacterized protein LOC103865462 isoform X2 [Brassica 
rapa]
Length=640

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PEEEFGPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC  SN
Sbjct  479  DHVFEVNIMLKEMPEEEFGPGIGIREYSFLDNPSLPKQVKESWLDVQLCQEGKEGCVASN  538

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+++G+L++PK S E+ FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRY
Sbjct  539  ITSSSGVLKYPKRSNEDTFKAIFSSFNDVKVIKFSSIEDAFTGFSDKGREERFRRRVKRY  598

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  599  VGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEEDHPP  639



>ref|XP_009141500.1| PREDICTED: uncharacterized protein LOC103865462 isoform X1 [Brassica 
rapa]
Length=644

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PEEEFGPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC  SN
Sbjct  483  DHVFEVNIMLKEMPEEEFGPGIGIREYSFLDNPSLPKQVKESWLDVQLCQEGKEGCVASN  542

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+++G+L++PK S E+ FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRY
Sbjct  543  ITSSSGVLKYPKRSNEDTFKAIFSSFNDVKVIKFSSIEDAFTGFSDKGREERFRRRVKRY  602

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  603  VGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEEDHPP  643



>ref|XP_009769854.1| PREDICTED: uncharacterized protein LOC104220660 [Nicotiana sylvestris]
Length=636

 Score =   265 bits (678),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 135/162 (83%), Gaps = 1/162 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FE+NVM +E P+EEFGPGIS REYSLF+NP MPQEVK SWLDV LC+EGS GCQ+ N
Sbjct  476  DHVFEINVMLKEMPDEEFGPGISIREYSLFENPSMPQEVKRSWLDVHLCQEGSLGCQV-N  534

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            ST+ TG+L+ P+++ EE  KTVFS F DVKVIQFSSM DAF GFTDK RE RFRNRVKRY
Sbjct  535  STSQTGVLKLPRHTNEETLKTVFSKFNDVKVIQFSSMQDAFDGFTDKTREERFRNRVKRY  594

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVEN TPGH+YYDMYWDEKP WK   P + ++DHPPW
Sbjct  595  VGIWCCVENHTPGHIYYDMYWDEKPGWKAAAPNSTEDDHPPW  636



>ref|XP_007156344.1| hypothetical protein PHAVU_003G278600g [Phaseolus vulgaris]
 gb|ESW28338.1| hypothetical protein PHAVU_003G278600g [Phaseolus vulgaris]
Length=195

 Score =   251 bits (642),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 136/163 (83%), Gaps = 1/163 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PEEEFGP I FREYS  DNP +P E+K SWLDV+LC+EG++GC +SN
Sbjct  33   DHVFEVNVMLKKLPEEEFGPQIDFREYSTLDNPSLPSEIKNSWLDVKLCKEGTQGCDVSN  92

Query  649  STTATG-ILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKR  473
             TT+ G +L+FPK+S EE F  VFS FKDVKVI+FSS+ DAFQGFTDK RE +FRNRVKR
Sbjct  93   DTTSVGGVLKFPKHSNEETFMKVFSSFKDVKVIKFSSVQDAFQGFTDKEREDKFRNRVKR  152

Query  472  YVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            YVGIWCCV + +PGH+YYDMYWDEKP WK IPPQT ++DHPPW
Sbjct  153  YVGIWCCVPDLSPGHIYYDMYWDEKPGWKAIPPQTSEDDHPPW  195



>ref|XP_008365916.1| PREDICTED: uncharacterized protein LOC103429549 isoform X1 [Malus 
domestica]
 ref|XP_008365917.1| PREDICTED: uncharacterized protein LOC103429549 isoform X2 [Malus 
domestica]
Length=630

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E P E FGP I  REYS FDNPLMP++VKESWLDVQLC++G+  C  SN
Sbjct  469  DHVFEVNVMLKELPAEIFGPPIGIREYSFFDNPLMPKQVKESWLDVQLCQQGTRDCIASN  528

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +TT +G LRFPK S EE FKTVFS FKDVKVIQFSSM DAF GFTDKARE +FRNR KRY
Sbjct  529  TTTPSGALRFPKRSNEETFKTVFSSFKDVKVIQFSSMQDAFPGFTDKAREEKFRNRAKRY  588

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCCV   TPGH+YYDMYWDEKP W+PIPPQT ++DHPP
Sbjct  589  VGIWCCVAEHTPGHIYYDMYWDEKPGWRPIPPQTREDDHPP  629



>ref|XP_007040865.1| Xyloglucanase 113 isoform 1 [Theobroma cacao]
 gb|EOY25366.1| Xyloglucanase 113 isoform 1 [Theobroma cacao]
Length=636

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ P EEFGP I+ REYS  +NPL+PQ+VKE WLDVQLC+EG+E C  S+
Sbjct  475  DHVFEVNVMLKDLPVEEFGPAINIREYSFLNNPLLPQQVKELWLDVQLCQEGTEDCHASS  534

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+  G+LRFPK+S EE FKTVFS FKDVKVIQFSSM DAF GF+DK RE +FRNRVKRY
Sbjct  535  NTSRPGLLRFPKHSGEETFKTVFSAFKDVKVIQFSSMQDAFLGFSDKTREEKFRNRVKRY  594

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCV++ TPGH+YYDMYWDEKP WKP PPQTP++DHPP+
Sbjct  595  VGIWCCVDSHTPGHIYYDMYWDEKPGWKPAPPQTPEDDHPPF  636



>ref|XP_009143647.1| PREDICTED: uncharacterized protein LOC103867343 [Brassica rapa]
Length=643

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PE+EFGPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC+ SN
Sbjct  482  DHVFEVNIMLKELPEDEFGPGIGIREYSFLDNPALPKQVKESWLDVQLCQEGKEGCEASN  541

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+ +G L+FPK S E+ FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRY
Sbjct  542  ITSPSGFLKFPKRSNEDTFKAIFSSFNDVKVIKFSSVEDAFTGFSDKGREERFRRRVKRY  601

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  602  VGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEEDHPP  642



>emb|CDP07209.1| unnamed protein product [Coffea canephora]
Length=633

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN M +E PE+EFGP I  REYSLFDNP MP++VKESWLDV LC+EGS GC++SN
Sbjct  472  DHVFEVNTMLKELPEDEFGPPIRIREYSLFDNPSMPKKVKESWLDVNLCQEGSRGCEVSN  531

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            ST+  GIL+FPK S+EE +KTVFS FKDV+VIQFSSM DAF GFTDK+ E +FR RVK Y
Sbjct  532  STSQAGILKFPKRSSEETYKTVFSSFKDVEVIQFSSMQDAFSGFTDKSMEDKFRKRVKIY  591

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
             GIWCCVEN TPGH++YD+YWDEKP+WKP PPQTP+EDHPP
Sbjct  592  TGIWCCVENHTPGHIFYDIYWDEKPDWKPKPPQTPEEDHPP  632



>ref|XP_009603199.1| PREDICTED: uncharacterized protein LOC104098231 [Nicotiana tomentosiformis]
Length=636

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FE+NVM +E P EEFGPGIS REYSLF+NP MPQEVK+SWLDV LC EGS GCQ+ N
Sbjct  476  DHVFEINVMLKEMPNEEFGPGISIREYSLFENPSMPQEVKKSWLDVHLCHEGSLGCQV-N  534

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            ST+ TG+L+ PK++ EE  KTVFS F DVKVIQFSSM DAF GFTDK RE +FRNRVKRY
Sbjct  535  STSQTGVLKLPKHTNEETLKTVFSKFNDVKVIQFSSMQDAFDGFTDKTREEQFRNRVKRY  594

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVEN TPGH+YYDMYWDEKP WK   P + ++DHPPW
Sbjct  595  VGIWCCVENHTPGHIYYDMYWDEKPGWKAAAPNSTEDDHPPW  636



>gb|AAD15452.2| unknown protein [Arabidopsis thaliana]
Length=528

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PEEEFGPGI  REYS  DNPL+P++VKESWLDVQLC+EG EGC+ SN
Sbjct  368  DHVFEVNIMLKELPEEEFGPGIGIREYSFLDNPLLPKQVKESWLDVQLCQEGKEGCEASN  427

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+ + +L+FPK S E+ FK +FS F DVKVI+FSS+ DAF GF+DKA+E RFR RVKRY
Sbjct  428  NTSPSRVLKFPKRSNEDTFKAIFSSFDDVKVIKFSSIEDAFIGFSDKAKE-RFRRRVKRY  486

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  487  VGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEEDHPP  527



>ref|XP_010266425.1| PREDICTED: uncharacterized protein LOC104603944 isoform X2 [Nelumbo 
nucifera]
Length=616

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PEEEFGP I F+EYS  DN L+P+++KESWLDVQLC  GS+ C ++N
Sbjct  455  DHVFEVNVMLKELPEEEFGPAIHFKEYSFLDNSLLPKQIKESWLDVQLCHSGSQDCHVTN  514

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+  G+LR PK+S+EE  KTV S FKDVKVIQFSSM DAF+GF+DK RE +FRNR+KRY
Sbjct  515  KTSRPGVLRLPKHSSEETLKTVLSSFKDVKVIQFSSMQDAFEGFSDKTRETKFRNRMKRY  574

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCV + TPGH+YYDMYWDEKPNW+P PP+TPQ+DHPPW
Sbjct  575  VGIWCCVLDHTPGHIYYDMYWDEKPNWEPAPPKTPQDDHPPW  616



>ref|XP_010266424.1| PREDICTED: uncharacterized protein LOC104603944 isoform X1 [Nelumbo 
nucifera]
Length=634

 Score =   262 bits (670),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PEEEFGP I F+EYS  DN L+P+++KESWLDVQLC  GS+ C ++N
Sbjct  473  DHVFEVNVMLKELPEEEFGPAIHFKEYSFLDNSLLPKQIKESWLDVQLCHSGSQDCHVTN  532

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+  G+LR PK+S+EE  KTV S FKDVKVIQFSSM DAF+GF+DK RE +FRNR+KRY
Sbjct  533  KTSRPGVLRLPKHSSEETLKTVLSSFKDVKVIQFSSMQDAFEGFSDKTRETKFRNRMKRY  592

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCV + TPGH+YYDMYWDEKPNW+P PP+TPQ+DHPPW
Sbjct  593  VGIWCCVLDHTPGHIYYDMYWDEKPNWEPAPPKTPQDDHPPW  634



>ref|XP_009362859.1| PREDICTED: uncharacterized protein LOC103952897 [Pyrus x bretschneideri]
Length=632

 Score =   262 bits (670),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PEE FGP I  REYS FDNPLMP++VKESWLDVQLC+EG+      N
Sbjct  471  DHVFEVNVMLKELPEEIFGPQIGIREYSFFDNPLMPKQVKESWLDVQLCQEGTRDSVALN  530

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+  G LRFPK S EE FKTVFS FKDVKVIQFSSM DAF GFTDKARE +FRNR KRY
Sbjct  531  TTSPLGALRFPKRSNEETFKTVFSSFKDVKVIQFSSMQDAFAGFTDKAREEKFRNRAKRY  590

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            +GIWCCV   TPGH+YYDMYWDEKP W PIPPQTP++DHPP
Sbjct  591  IGIWCCVAEHTPGHIYYDMYWDEKPGWIPIPPQTPEDDHPP  631



>ref|XP_010056115.1| PREDICTED: uncharacterized protein LOC104444183 isoform X1 [Eucalyptus 
grandis]
 gb|KCW72693.1| hypothetical protein EUGRSUZ_E01147 [Eucalyptus grandis]
Length=638

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PE+EFGPGI+ REYSL DNP MP++VKESWLDV+LC+ G++ CQ++N
Sbjct  477  DHVFEVNVMLKEMPEDEFGPGINIREYSLLDNPSMPKQVKESWLDVKLCQGGTKDCQVTN  536

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            ST++ G++R PK S EE  KT FS FKD+KVIQFSSM DAF+GFTD+  E RFRNRVKRY
Sbjct  537  STSSPGMIRLPKRSNEETLKTAFSSFKDIKVIQFSSMQDAFEGFTDQKTEERFRNRVKRY  596

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCC  +  PGH+YYDMYWDEKP WKP+PPQT  +DHPPW
Sbjct  597  VGIWCCTVDHVPGHIYYDMYWDEKPGWKPVPPQTSADDHPPW  638



>ref|XP_010056116.1| PREDICTED: uncharacterized protein LOC104444183 isoform X2 [Eucalyptus 
grandis]
Length=636

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PE+EFGPGI+ REYSL DNP MP++VKESWLDV+LC+ G++ CQ++N
Sbjct  475  DHVFEVNVMLKEMPEDEFGPGINIREYSLLDNPSMPKQVKESWLDVKLCQGGTKDCQVTN  534

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            ST++ G++R PK S EE  KT FS FKD+KVIQFSSM DAF+GFTD+  E RFRNRVKRY
Sbjct  535  STSSPGMIRLPKRSNEETLKTAFSSFKDIKVIQFSSMQDAFEGFTDQKTEERFRNRVKRY  594

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCC  +  PGH+YYDMYWDEKP WKP+PPQT  +DHPPW
Sbjct  595  VGIWCCTVDHVPGHIYYDMYWDEKPGWKPVPPQTSADDHPPW  636



>ref|XP_008444233.1| PREDICTED: uncharacterized protein LOC103487624 [Cucumis melo]
Length=640

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PE EFGPGI+FREYS  +NPL+P++VKESWLDV LC++ SEGC  SN
Sbjct  479  DHVFEVNVMLKELPEAEFGPGINFREYSFLENPLLPKQVKESWLDVHLCKQESEGCSASN  538

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T   G+L+FPK S E+ FK +FS FKDVKVIQFS+M DAF GF+DK RE +FRNRVKRY
Sbjct  539  DTVLPGVLKFPKGSNEDTFKAIFSTFKDVKVIQFSTMQDAFPGFSDKKREEKFRNRVKRY  598

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCCVEN  PGH+YYDMYWDEKP+WKP PP+TP+ED PP
Sbjct  599  VGIWCCVENAAPGHIYYDMYWDEKPDWKPHPPRTPEEDRPP  639



>ref|XP_006410719.1| hypothetical protein EUTSA_v10016368mg [Eutrema salsugineum]
 gb|ESQ52172.1| hypothetical protein EUTSA_v10016368mg [Eutrema salsugineum]
Length=645

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PE+EFGPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC+ SN
Sbjct  484  DHVFEVNIMLKELPEDEFGPGIGIREYSFLDNPSLPKQVKESWLDVQLCQEGKEGCEASN  543

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+ + +L+FPK S E+ FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRY
Sbjct  544  RTSPSRVLKFPKRSNEDTFKAIFSTFHDVKVIKFSSVEDAFIGFSDKGREERFRRRVKRY  603

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  604  VGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEEDHPP  644



>gb|EYU37484.1| hypothetical protein MIMGU_mgv1a002766mg [Erythranthe guttata]
Length=640

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FE+++M ++ PEEEFGPGI+ REYSLFDNP M Q+VK+SWLDV LC  GS+GC+LSN
Sbjct  479  DHVFEIHLMLKDLPEEEFGPGINIREYSLFDNPAMSQQVKDSWLDVHLCVPGSKGCELSN  538

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             TT  GIL+ PK STEE FKT+FS FKD KVIQFSSM +AF GFTDK RE +FR RVK Y
Sbjct  539  GTTQAGILKLPKRSTEETFKTIFSSFKDKKVIQFSSMQEAFLGFTDKKREEKFRKRVKIY  598

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
             GIWCCVEN+TPGH+YYDMYWDEKP WK +PPQTP+EDHPP+
Sbjct  599  PGIWCCVENKTPGHIYYDMYWDEKPGWKALPPQTPEEDHPPF  640



>ref|XP_008348925.1| PREDICTED: uncharacterized protein LOC103412105 [Malus domestica]
Length=154

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = -2

Query  805  MSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGIL  626
            M +E P E FGP I  REYS FDNPLMP++VKESWLDVQLC++G+  C  SN+TT +G L
Sbjct  1    MLKELPAEIFGPPIGIREYSFFDNPLMPKQVKESWLDVQLCQQGTRDCIASNTTTPSGAL  60

Query  625  RFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVE  446
            RFPK S EE FKTVFS FKDVKVIQFSSM DAF GFTDKARE +FRNR KRYVGIWCCV 
Sbjct  61   RFPKRSNEETFKTVFSSFKDVKVIQFSSMQDAFPGFTDKAREEKFRNRAKRYVGIWCCVA  120

Query  445  NQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
              TPGH+YYDMYWDEKP W+PIPPQT ++DHPP
Sbjct  121  EHTPGHIYYDMYWDEKPGWRPIPPQTREDDHPP  153



>ref|XP_011028505.1| PREDICTED: uncharacterized protein LOC105128495 isoform X2 [Populus 
euphratica]
Length=648

 Score =   261 bits (667),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN M +EQPEEEFGP I+FREYS  DNPL+P+ VKES LDVQLC+EG++ C  SN
Sbjct  487  DHVFEVNSMLKEQPEEEFGPAINFREYSFLDNPLLPRHVKESRLDVQLCQEGAKDCGASN  546

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+  GILRFPK S E+ FKT FS FKDVKVIQFSSM DAF GFTDK RE +FRNR+KRY
Sbjct  547  KTSRPGILRFPKRSNEDMFKTTFSSFKDVKVIQFSSMQDAFVGFTDKRREEKFRNRMKRY  606

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVEN  PGH+YYDMYWDEK +WKP+PPQ+ ++DHPPW
Sbjct  607  VGIWCCVENHDPGHIYYDMYWDEKSDWKPMPPQSAEDDHPPW  648



>ref|XP_011028504.1| PREDICTED: uncharacterized protein LOC105128495 isoform X1 [Populus 
euphratica]
Length=652

 Score =   261 bits (667),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN M +EQPEEEFGP I+FREYS  DNPL+P+ VKES LDVQLC+EG++ C  SN
Sbjct  491  DHVFEVNSMLKEQPEEEFGPAINFREYSFLDNPLLPRHVKESRLDVQLCQEGAKDCGASN  550

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+  GILRFPK S E+ FKT FS FKDVKVIQFSSM DAF GFTDK RE +FRNR+KRY
Sbjct  551  KTSRPGILRFPKRSNEDMFKTTFSSFKDVKVIQFSSMQDAFVGFTDKRREEKFRNRMKRY  610

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVEN  PGH+YYDMYWDEK +WKP+PPQ+ ++DHPPW
Sbjct  611  VGIWCCVENHDPGHIYYDMYWDEKSDWKPMPPQSAEDDHPPW  652



>ref|XP_004246017.1| PREDICTED: uncharacterized protein LOC101254412 [Solanum lycopersicum]
Length=635

 Score =   260 bits (665),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FE+NVM +E   EEFGPGI+ REYSLF+NP MPQEVKESWLDV LC+EGS GCQ+ N
Sbjct  475  DHVFEINVMLKEMANEEFGPGINIREYSLFENPSMPQEVKESWLDVHLCQEGSPGCQV-N  533

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            ST+ +G L+ PK+STEE  KTVFS FKDVKVIQFS+M DAF  FTDK RE +FRNRVKRY
Sbjct  534  STSQSGALKLPKHSTEETLKTVFSKFKDVKVIQFSTMQDAFDRFTDKTREEQFRNRVKRY  593

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVEN TPGH+YYDMYWDEKP WK  PP +  +DHPPW
Sbjct  594  VGIWCCVENHTPGHIYYDMYWDEKPGWKAAPPNSTVDDHPPW  635



>ref|XP_003517099.1| PREDICTED: uncharacterized protein LOC100776463 [Glycine max]
Length=627

 Score =   259 bits (663),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN M +E PEEEFGPGI  REYS+ DNP++P EVK+SWLDVQLC++G++ C  SN
Sbjct  466  DHVFEVNAMLKELPEEEFGPGIDIREYSILDNPILPSEVKKSWLDVQLCKDGTQDCFASN  525

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +TT  G+L+FP++S EE++  VFS FKD+KVIQFSSM DAF GF+DK RE RFR RVKRY
Sbjct  526  NTTVGGVLKFPRHSNEERYMKVFSSFKDIKVIQFSSMQDAFAGFSDKEREDRFRKRVKRY  585

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
             GIWCCV + TPGH+YYDMYWDEKP WKPIPPQT  +DHPPW
Sbjct  586  PGIWCCVLDHTPGHIYYDMYWDEKPEWKPIPPQTSADDHPPW  627



>gb|KJB51493.1| hypothetical protein B456_008G219000 [Gossypium raimondii]
Length=628

 Score =   259 bits (662),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM R+ P EEFGP I+ REYS  +NP +PQ V+ESWLDVQLC+EG+E C  S+
Sbjct  467  DHVFEVNVMLRDLPAEEFGPAINIREYSFLNNPFLPQRVRESWLDVQLCQEGTEDCHASS  526

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+  G+LRFPK S+EE  K VFS FKDVKVIQFSSM DAF GFTDK RE +FR RVK+Y
Sbjct  527  NTSRPGLLRFPKRSSEETLKKVFSSFKDVKVIQFSSMQDAFLGFTDKTREEKFRKRVKQY  586

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVEN  PGH+YYDMYWDEKP WKPIPP+TP++DHPP+
Sbjct  587  VGIWCCVENHIPGHIYYDMYWDEKPGWKPIPPKTPEDDHPPF  628



>gb|KHG12903.1| hypothetical protein F383_16835 [Gossypium arboreum]
Length=619

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM R+ P EEFGP I+ REYS  +NP +PQ V+ESWLDVQLC+EG+E C  S+
Sbjct  458  DHVFEVNVMLRDLPAEEFGPAINIREYSFLNNPFLPQRVRESWLDVQLCQEGTEDCHASS  517

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+  G+LRFPK S+EE  K VFS FKDVKVIQFSSM DAF GFTDK RE +FR RVK+Y
Sbjct  518  NTSQPGLLRFPKRSSEETLKKVFSSFKDVKVIQFSSMQDAFLGFTDKTREEKFRKRVKQY  577

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVEN  PGH+YYDMYWDEKP WKP+PP+TP++DHPP+
Sbjct  578  VGIWCCVENHIPGHIYYDMYWDEKPGWKPVPPKTPEDDHPPF  619



>ref|XP_006359953.1| PREDICTED: uncharacterized protein LOC102605574 isoform X1 [Solanum 
tuberosum]
Length=635

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FE+NVM +E   EEFGPGI+ REYSLF+NP MPQEVK+SWLDV LC+EGS GCQ+ N
Sbjct  475  DHVFEINVMLKEMANEEFGPGINIREYSLFENPSMPQEVKKSWLDVHLCQEGSPGCQV-N  533

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            ST+ +G+L+ PK+STEE  KT FS FKDVKVIQFSSM DAF  FTDK RE +FRNRVKRY
Sbjct  534  STSQSGVLKLPKHSTEETLKTAFSKFKDVKVIQFSSMQDAFDRFTDKTREEQFRNRVKRY  593

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVE  TPGH+YYDMYWDEKP WK  PP + ++DHPPW
Sbjct  594  VGIWCCVETGTPGHIYYDMYWDEKPGWKAAPPNSTKDDHPPW  635



>ref|XP_006293822.1| hypothetical protein CARUB_v10022808mg [Capsella rubella]
 gb|EOA26720.1| hypothetical protein CARUB_v10022808mg [Capsella rubella]
Length=645

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PE+EFGPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC+ SN
Sbjct  484  DHVFEVNIMLKELPEDEFGPGIGIREYSFLDNPALPKQVKESWLDVQLCQEGKEGCEASN  543

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+ + +L+FPK S E+ FK +FS F DVKVI+FSS+ DAF GF+DK RE +FR RVKRY
Sbjct  544  NTSPSRVLKFPKRSNEDTFKAIFSSFNDVKVIKFSSVEDAFIGFSDKEREEKFRRRVKRY  603

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHP  350
            VGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+EDHP
Sbjct  604  VGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEEDHP  643



>ref|XP_010516741.1| PREDICTED: uncharacterized protein LOC104792321 [Camelina sativa]
Length=644

 Score =   257 bits (656),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PE+EFGPGI  REYS  DNP +P++VKESWLDVQLC+EG + C+ SN
Sbjct  483  DHVFEVNIMLKELPEDEFGPGIGIREYSFLDNPALPKQVKESWLDVQLCQEGKDECEASN  542

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+ + +L+FPK S E+ FK +FS F DVKVI+FSS+ DAF GF+DK RE +FR RVKRY
Sbjct  543  KTSPSRVLKFPKRSNEDTFKAIFSFFDDVKVIKFSSVEDAFAGFSDKEREEKFRKRVKRY  602

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  603  VGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEEDHPP  643



>ref|XP_007158076.1| hypothetical protein PHAVU_002G122000g [Phaseolus vulgaris]
 gb|ESW30070.1| hypothetical protein PHAVU_002G122000g [Phaseolus vulgaris]
Length=626

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN M +E PEEEFGPGI  REYSL DNP +P EVK+SWLDV LC+EG++ C  SN
Sbjct  465  DHVFEVNAMLKELPEEEFGPGIDIREYSLLDNPSLPSEVKKSWLDVHLCKEGTQDCVASN  524

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+  G+L+FP++S EE +  +FS FKD+KVIQFSSM DAF GF+DK RE +FR RVKRY
Sbjct  525  NTSIGGVLKFPRHSNEETYMKIFSSFKDIKVIQFSSMQDAFTGFSDKEREDKFRKRVKRY  584

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCV + TPGH+YYDMYWDEKP WKP+PPQT  +DHPPW
Sbjct  585  VGIWCCVLDHTPGHIYYDMYWDEKPEWKPLPPQTSADDHPPW  626



>emb|CDP07210.1| unnamed protein product [Coffea canephora]
Length=705

 Score =   256 bits (655),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEV  M  E PE+EFGP I  REYSLF NP MP++VKESWLDV  C+EGS GC++SN
Sbjct  475  DHVFEVKTMLNELPEDEFGPPIRIREYSLFANPSMPKKVKESWLDVNFCQEGSRGCEVSN  534

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            ST+  G+L+FPK S+EE +KTVFS FKDVKVIQFSSM DAF GF DK+RE +FR RVK Y
Sbjct  535  STSQAGVLKFPKRSSEETYKTVFSSFKDVKVIQFSSMQDAFTGFADKSREDKFRKRVKAY  594

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
             G+WCCVEN TPGH+ YD+YWDEKPNWKP PPQTP+EDHPP
Sbjct  595  TGLWCCVENHTPGHILYDIYWDEKPNWKPKPPQTPEEDHPP  635



>ref|XP_010111777.1| hypothetical protein L484_008781 [Morus notabilis]
 gb|EXC31691.1| hypothetical protein L484_008781 [Morus notabilis]
Length=635

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PEE +GPGI+ REYS FDNPLMPQ+VK+SWL+V LC EG+E C  SN
Sbjct  476  DHVFEVNMMLKELPEE-YGPGINIREYSFFDNPLMPQQVKDSWLEVHLCEEGAEDCHASN  534

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+  G+LRFPK+S EE  KT+FS FKDVKVIQFSSMH AF GFTDK RE +FR R+KRY
Sbjct  535  DTSRPGVLRFPKHSNEETLKTIFSSFKDVKVIQFSSMH-AFMGFTDKTREEKFRRRMKRY  593

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCCV + TPGH+YYDMYWDEKP+WKPIPPQ P++DHPP
Sbjct  594  VGIWCCVMDHTPGHIYYDMYWDEKPDWKPIPPQKPEDDHPP  634



>ref|XP_010505074.1| PREDICTED: uncharacterized protein LOC104781967 [Camelina sativa]
Length=644

 Score =   254 bits (650),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E P++EFGPGI  REYS  DNP +P++VKESWLDVQLC++G + C+ SN
Sbjct  483  DHVFEVNIMLKELPKDEFGPGIGIREYSFLDNPALPKQVKESWLDVQLCQDGKDECEASN  542

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+ + +L+FPK S E+ FK +FS F DVKVI+FSS+ DAF GF+DK RE +FR RVKRY
Sbjct  543  KTSPSRVLKFPKRSNEDTFKAIFSFFDDVKVIKFSSVEDAFTGFSDKEREEKFRKRVKRY  602

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  603  VGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEEDHPP  643



>emb|CDY32116.1| BnaC04g44500D [Brassica napus]
Length=636

 Score =   254 bits (649),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 132/161 (82%), Gaps = 4/161 (2%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PEEEFGPGI  REYS  DNP +P++VKESWLDVQLC    +GC+ SN
Sbjct  479  DHVFEVNIMLKEMPEEEFGPGIGIREYSFLDNPSLPKQVKESWLDVQLC----QGCEASN  534

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+++G L+FPK S E+ FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RV RY
Sbjct  535  ITSSSGALKFPKRSNEDTFKAIFSTFNDVKVIKFSSVEDAFTGFSDKGREERFRRRVMRY  594

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  595  VGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEEDHPP  635



>ref|XP_006590766.1| PREDICTED: uncharacterized protein LOC100789338 [Glycine max]
Length=627

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PEEEFG G+  REYS+ DNP +P EVK SWLDVQLC++G++ C  SN
Sbjct  466  DHVFEVNVMLKELPEEEFGSGVDIREYSILDNPSLPSEVKMSWLDVQLCKDGTQDCFASN  525

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +TT  G+L+FP++S EE +  VF  FKD+KVIQFSSM DAF GF+DK RE RFR RVKRY
Sbjct  526  NTTVGGVLKFPRHSNEETYMKVFLSFKDIKVIQFSSMQDAFSGFSDKEREDRFRKRVKRY  585

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
             GIWCCV + TPGH+YYDMYWDEKP WKPIPPQT  +DHPPW
Sbjct  586  TGIWCCVLDHTPGHIYYDMYWDEKPEWKPIPPQTSADDHPPW  627



>ref|XP_010509590.1| PREDICTED: uncharacterized protein LOC104785987 [Camelina sativa]
Length=644

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PE+EFGPGI  REYS  DNP +P++VKESWLDVQLC++G + C+ SN
Sbjct  483  DHVFEVNIMLKELPEDEFGPGIGIREYSFLDNPALPKQVKESWLDVQLCQDGKDECEASN  542

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+ + +L+FPK S E+ FK++FS F DVKVI+FSS+ DAF GF+DK RE +FR RVKRY
Sbjct  543  KTSPSRVLKFPKRSNEDTFKSIFSFFDDVKVIKFSSVEDAFTGFSDKEREEKFRKRVKRY  602

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQT +EDHPP
Sbjct  603  VGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTAEEDHPP  643



>ref|XP_003612490.1| hypothetical protein MTR_5g025590 [Medicago truncatula]
Length=628

 Score =   252 bits (644),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN M  E PE+EFGP I FREYS+ DNP +P EVK+SWLDV LC+EG++ C  SN
Sbjct  467  DHVFEVNAMLNELPEDEFGPDIDFREYSILDNPSLPSEVKKSWLDVHLCKEGTQNCNASN  526

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            + T  G+L+FPK+S EE F  VFS FKDVKVIQFSSM DAF GF DK RE RFR RVK Y
Sbjct  527  NVTVGGVLKFPKHSNEEMFMKVFSSFKDVKVIQFSSMQDAFTGFKDKEREDRFRKRVKHY  586

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
             GIWCCV + TPGH+YYD+YWDEKP WKPIPPQT  +DHPPW
Sbjct  587  TGIWCCVTDHTPGHIYYDIYWDEKPGWKPIPPQTSADDHPPW  628



>gb|KFK36454.1| hypothetical protein AALP_AA4G126700 [Arabis alpina]
Length=642

 Score =   252 bits (643),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E  E+EFGPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC+ SN
Sbjct  481  DHVFEVNIMLKELAEDEFGPGIGIREYSFLDNPALPKQVKESWLDVQLCQEGKEGCEASN  540

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+ + +L+FPK S E+ FK +FS F +VKVI+FSS+ DAF GF+DK RE +FR RVKRY
Sbjct  541  NTSPSQVLKFPKRSNEDTFKAIFSSFNNVKVIKFSSVEDAFIGFSDKGREEKFRRRVKRY  600

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCC EN+TPGH+YY+MYWDEKP WKP+PP TP+EDHPP+
Sbjct  601  VGIWCCEENKTPGHIYYNMYWDEKPGWKPVPPLTPEEDHPPF  642



>ref|XP_006430896.1| hypothetical protein CICLE_v10011269mg [Citrus clementina]
 gb|ESR44136.1| hypothetical protein CICLE_v10011269mg [Citrus clementina]
Length=639

 Score =   251 bits (642),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PE+E+GPGI FREYS  DNP +P++VKES L+VQLC +    CQ S+
Sbjct  478  DHVFEVNVMLQQLPEDEYGPGIGFREYSFMDNPSVPKQVKESRLEVQLCDDTLIDCQASS  537

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T++ GILRFP++S+EE FKTVFS FKDVKVI FSSM +AF  FTDK RE RFR RVKRY
Sbjct  538  NTSSPGILRFPRHSSEETFKTVFSSFKDVKVINFSSMKNAFLNFTDKTREERFRRRVKRY  597

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCV++ TPGH+YYDMYWDEKP+WKPIPPQTP +DHPPW
Sbjct  598  VGIWCCVDSHTPGHIYYDMYWDEKPDWKPIPPQTPGDDHPPW  639



>ref|NP_850250.1| xyloglucanase 113 [Arabidopsis thaliana]
 gb|AAL67023.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09128.1| xyloglucanase 113 [Arabidopsis thaliana]
 gb|AHL38813.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=644

 Score =   250 bits (638),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PEEEFGPGI  REYS  DNPL+P++VKESWLDVQLC+EG EGC+ SN
Sbjct  483  DHVFEVNIMLKELPEEEFGPGIGIREYSFLDNPLLPKQVKESWLDVQLCQEGKEGCEASN  542

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+ + +L+FPK S E+ FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRY
Sbjct  543  NTSPSRVLKFPKRSNEDTFKAIFSSFDDVKVIKFSSIEDAFIGFSDKEREERFRRRVKRY  602

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  603  VGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEEDHPP  643



>emb|CDY40459.1| BnaA04g20580D [Brassica napus]
Length=640

 Score =   250 bits (638),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PEEEFGPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC  SN
Sbjct  479  DHVFEVNIMLKEMPEEEFGPGIGIREYSFLDNPSLPKQVKESWLDVQLCQEGKEGCVASN  538

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             TT +G L+FPK S E+ FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRY
Sbjct  539  ITTPSGALKFPKRSNEDTFKAIFSSFNDVKVIKFSSVEDAFTGFSDKEREERFRRRVKRY  598

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  599  VGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEEDHPP  639



>ref|XP_006359954.1| PREDICTED: uncharacterized protein LOC102605574 isoform X2 [Solanum 
tuberosum]
Length=634

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 131/161 (81%), Gaps = 1/161 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FE+NVM +E   EEFGPGI+ REYSLF+NP MPQEVK+SWLDV LC+EGS GCQ+ N
Sbjct  475  DHVFEINVMLKEMANEEFGPGINIREYSLFENPSMPQEVKKSWLDVHLCQEGSPGCQV-N  533

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            ST+ +G+L+ PK+STEE  KT FS FKDVKVIQFSSM DAF  FTDK RE +FRNRVKRY
Sbjct  534  STSQSGVLKLPKHSTEETLKTAFSKFKDVKVIQFSSMQDAFDRFTDKTREEQFRNRVKRY  593

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCCVE  TPGH+YYDMYWDEKP WK  PP + ++ H P
Sbjct  594  VGIWCCVETGTPGHIYYDMYWDEKPGWKAAPPNSTEDYHMP  634



>gb|KDO72261.1| hypothetical protein CISIN_1g036925mg [Citrus sinensis]
Length=639

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PE+E+GPGI FREYS  DNP +P++VKES L+VQLC +    CQ S+
Sbjct  478  DHVFEVNVMLQQLPEDEYGPGIGFREYSFMDNPSVPKQVKESRLEVQLCDDTLIDCQASS  537

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T++ GILRFP++S+EE FKTVFS FKDVKVI FSSM +AF  FTDK RE RFR RVKRY
Sbjct  538  NTSSPGILRFPRHSSEETFKTVFSSFKDVKVINFSSMKNAFLNFTDKTREERFRRRVKRY  597

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCV++ TPGH+YYDMYWDEKP+WKPIPPQTP +DH PW
Sbjct  598  VGIWCCVDSHTPGHIYYDMYWDEKPDWKPIPPQTPGDDHLPW  639



>ref|XP_006482352.1| PREDICTED: uncharacterized protein LOC102613765 [Citrus sinensis]
Length=639

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PE+E+GPGI FREYS  DNP +P++VKES L+VQLC +    CQ S+
Sbjct  478  DHVFEVNVMLQQLPEDEYGPGIGFREYSFMDNPSVPKQVKESRLEVQLCDDTLIDCQASS  537

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T++ GILRFP++S+EE FKTVFS FKDVKVI FSSM +AF  FTDK RE RFR RVKRY
Sbjct  538  NTSSPGILRFPRHSSEETFKTVFSSFKDVKVINFSSMKNAFLNFTDKTREERFRRRVKRY  597

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCV++ TPGH+YYDMYWDEKP+WKPIPPQTP +DH PW
Sbjct  598  VGIWCCVDSHTPGHIYYDMYWDEKPDWKPIPPQTPGDDHLPW  639



>ref|XP_008804433.1| PREDICTED: uncharacterized protein LOC103717721 [Phoenix dactylifera]
Length=396

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M  E PE EFGP I FREYS   NPL+P+E+KES L+VQLC + S  CQ++N
Sbjct  235  DHIFEVNMMLNELPEAEFGPRIDFREYSFLQNPLVPKEIKESLLEVQLCDDHSAKCQIAN  294

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             TT  G+LRFPK+ST++ F   FSL+KDVKVIQFSSM DAFQGFTD+ RE +FR RVKRY
Sbjct  295  ETTRRGVLRFPKHSTQQMFIQAFSLYKDVKVIQFSSMEDAFQGFTDEVREEKFRKRVKRY  354

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VG+WCCVE++ PGH+YYDMYWDEKP WKP PP+T ++D PPW
Sbjct  355  VGLWCCVESRDPGHIYYDMYWDEKPGWKPEPPRTREDDRPPW  396



>ref|XP_010676705.1| PREDICTED: uncharacterized protein LOC104892459 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=531

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +  P++E+GP I  REYS  DNP +P+EVKESWLDVQLC+ GS+ C +++
Sbjct  370  DHVFEVNVMLQNLPQQEYGPRIDIREYSFLDNPALPREVKESWLDVQLCQVGSKDCHVTD  429

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +++A G+LRFPK   EE +KTVFS FK+VKVI F S+ DAF GF DK RE +FR RVKRY
Sbjct  430  NSSAPGLLRFPKYGNEETYKTVFSSFKNVKVINFLSIQDAFTGFADKEREQKFRRRVKRY  489

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCCV N+T GH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  490  VGIWCCVTNRTIGHIYYDMYWDEKPGWKPLPPQTPEEDHPP  530



>gb|AES95448.2| nucleotide-diphospho-sugar transferase family protein [Medicago 
truncatula]
Length=688

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN M  E PE+EFGP I FREYS+ DNP +P EVK+SWLDV LC+EG++ C  SN
Sbjct  467  DHVFEVNAMLNELPEDEFGPDIDFREYSILDNPSLPSEVKKSWLDVHLCKEGTQNCNASN  526

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            + T  G+L+FPK+S EE F  VFS FKDVKVIQFSSM DAF GF DK RE RFR RVK Y
Sbjct  527  NVTVGGVLKFPKHSNEEMFMKVFSSFKDVKVIQFSSMQDAFTGFKDKEREDRFRKRVKHY  586

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
             GIWCCV + TPGH+YYD+YWDEKP WKPIPPQT  +DHPP
Sbjct  587  TGIWCCVTDHTPGHIYYDIYWDEKPGWKPIPPQTSADDHPP  627



>dbj|BAH19600.1| AT2G35610 [Arabidopsis thaliana]
Length=644

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PEEEFGPGI  REYS  DNPL+P++VKESWLDVQLC+EG EGC+ SN
Sbjct  483  DHVFEVNIMLKELPEEEFGPGIGIREYSFLDNPLLPKQVKESWLDVQLCQEGKEGCEASN  542

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+ + +L+FPK S E+ FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRY
Sbjct  543  NTSPSRVLKFPKRSNEDTFKAIFSSFDDVKVIKFSSIEDAFIGFSDKEREERFRRRVKRY  602

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC EN+TPGH+YY+MYWDEKP WKP+PPQTP+EDHPP
Sbjct  603  VGIWCCEENKTPGHIYYEMYWDEKPGWKPVPPQTPEEDHPP  643



>ref|XP_010676704.1| PREDICTED: uncharacterized protein LOC104892459 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=533

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +  P++E+GP I  REYS  DNP +P+EVKESWLDVQLC+ GS+ C +++
Sbjct  372  DHVFEVNVMLQNLPQQEYGPRIDIREYSFLDNPALPREVKESWLDVQLCQVGSKDCHVTD  431

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +++A G+LRFPK   EE +KTVFS FK+VKVI F S+ DAF GF DK RE +FR RVKRY
Sbjct  432  NSSAPGLLRFPKYGNEETYKTVFSSFKNVKVINFLSIQDAFTGFADKEREQKFRRRVKRY  491

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCCV N+T GH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  492  VGIWCCVTNRTIGHIYYDMYWDEKPGWKPLPPQTPEEDHPP  532



>ref|XP_004512439.1| PREDICTED: uncharacterized protein LOC101497257 [Cicer arietinum]
Length=623

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PE+EFGP I+ REYS+ DNP +P EVK S LDV LC+EG++ C +SN
Sbjct  462  DHVFEVNVMLKELPEDEFGPRINIREYSILDNPSLPSEVKMSRLDVHLCKEGTQYCNVSN  521

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            + T  G+L+FPK+S EE F  VF+ FKDVKVIQFSSM DAF GFT+K RE RFR RVK Y
Sbjct  522  NVTVGGVLKFPKHSNEESFMKVFTSFKDVKVIQFSSMQDAFTGFTNKEREDRFRKRVKHY  581

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
             GIWCCV + TPGH+YYD+YWDEKP WKPIPPQT ++DHPPW
Sbjct  582  TGIWCCVMDHTPGHIYYDIYWDEKPGWKPIPPQTSEDDHPPW  623



>gb|KHN05539.1| hypothetical protein glysoja_020504 [Glycine soja]
Length=637

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 131/172 (76%), Gaps = 10/172 (6%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PEEEFG G+  REYS+ DNP +P EVK SWLDVQLC++G++ C  SN
Sbjct  466  DHVFEVNVMLKELPEEEFGSGVDIREYSILDNPSLPSEVKMSWLDVQLCKDGTQDCFASN  525

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKA----------RE  500
            +TT  G+L+FP++S EE +  VF  FKD+KVIQFSSM DAF GF+DKA          RE
Sbjct  526  NTTVGGVLKFPRHSNEETYMKVFLSFKDIKVIQFSSMQDAFSGFSDKARTSTLISFEERE  585

Query  499  HRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
             RFR RVKRY GIWCCV + TPGH+YYDMYWDEKP WKPIPPQT  +DHPPW
Sbjct  586  DRFRKRVKRYTGIWCCVLDHTPGHIYYDMYWDEKPEWKPIPPQTSADDHPPW  637



>emb|CDP12729.1| unnamed protein product [Coffea canephora]
Length=615

 Score =   246 bits (628),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 137/163 (84%), Gaps = 2/163 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            D+ F+V+V+ +  PE+EFGP I  +EYS+ DNP MPQ+VK+SWLDV LC+EGS GCQ+S+
Sbjct  452  DYVFQVDVIMKGLPEDEFGPSIRIKEYSILDNPSMPQKVKDSWLDVFLCQEGSHGCQVSS  511

Query  649  STTA--TGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVK  476
            S T   TG+++FPKNS+EE ++TVFSLFKDVKV+QFSSM DAF GFTDK RE +FR R+K
Sbjct  512  SATTNRTGVVKFPKNSSEETYRTVFSLFKDVKVLQFSSMQDAFIGFTDKLREEKFRKRMK  571

Query  475  RYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
             Y+G WCCVE+  PGH+YYD+YWDEKP WKP+PPQTP++DHPP
Sbjct  572  AYIGRWCCVEDHFPGHIYYDIYWDEKPGWKPVPPQTPEDDHPP  614



>ref|XP_003547737.1| PREDICTED: uncharacterized protein LOC100780346 [Glycine max]
Length=638

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 133/164 (81%), Gaps = 2/164 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGC--QL  656
            DH FEVNVM ++ PEEEFGP I FREYS+ DNP +P EVK+SWLDVQLC++G++ C    
Sbjct  475  DHVFEVNVMLKKLPEEEFGPQIDFREYSILDNPSLPSEVKKSWLDVQLCKDGTQDCDASA  534

Query  655  SNSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVK  476
            SN TT  G+L+FPK+S EE F  VFS  KDVKVI+FS++ DAF GFTDK RE +FRNRVK
Sbjct  535  SNDTTVGGVLKFPKHSNEEMFMKVFSSLKDVKVIKFSTVQDAFTGFTDKEREEKFRNRVK  594

Query  475  RYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            RYVGIWCCV + +PGH+YYDMYWDEKP WK +PPQT ++DHPP+
Sbjct  595  RYVGIWCCVPDHSPGHIYYDMYWDEKPGWKAVPPQTSEDDHPPY  638



>ref|XP_010676703.1| PREDICTED: uncharacterized protein LOC104892459 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=629

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +  P++E+GP I  REYS  DNP +P+EVKESWLDVQLC+ GS+ C +++
Sbjct  468  DHVFEVNVMLQNLPQQEYGPRIDIREYSFLDNPALPREVKESWLDVQLCQVGSKDCHVTD  527

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +++A G+LRFPK   EE +KTVFS FK+VKVI F S+ DAF GF DK RE +FR RVKRY
Sbjct  528  NSSAPGLLRFPKYGNEETYKTVFSSFKNVKVINFLSIQDAFTGFADKEREQKFRRRVKRY  587

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCCV N+T GH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  588  VGIWCCVTNRTIGHIYYDMYWDEKPGWKPLPPQTPEEDHPP  628



>ref|XP_002881404.1| hypothetical protein ARALYDRAFT_902666 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57663.1| hypothetical protein ARALYDRAFT_902666 [Arabidopsis lyrata subsp. 
lyrata]
Length=640

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PEEEFGPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC+ SN
Sbjct  479  DHVFEVNIMLKELPEEEFGPGIGIREYSFLDNPALPKQVKESWLDVQLCQEGKEGCEPSN  538

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+ + +L+FPK S E+ FK +FS F++VKVI+FSS+ DAF GF+DK RE RFR RVKRY
Sbjct  539  NTSPSQVLKFPKRSNEDTFKAIFSSFENVKVIKFSSIEDAFIGFSDKEREERFRRRVKRY  598

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  599  VGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEEDHPP  639



>gb|AET03500.2| nucleotide-diphospho-sugar transferase family protein [Medicago 
truncatula]
Length=637

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PEEEFGP I  REYS+ DNP +P EVK+SWLDVQLC+EG++GC  S 
Sbjct  476  DHVFEVNVMLKKLPEEEFGPEIGIREYSMLDNPSLPPEVKKSWLDVQLCKEGTQGCDGSY  535

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            ++T  G+L+FPK+S EE F  VFS FKDVKVI+ SS+ DAF GFT+K RE RFRNRVKRY
Sbjct  536  NSTVGGVLKFPKHSNEEMFMKVFSSFKDVKVIKLSSVEDAFTGFTNKEREDRFRNRVKRY  595

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC+ +   GH+YYDMYWDEKP WK IPPQ+P+EDHPP
Sbjct  596  VGIWCCMPDTPIGHIYYDMYWDEKPGWKAIPPQSPEEDHPP  636



>ref|XP_003629024.1| hypothetical protein MTR_8g072310 [Medicago truncatula]
Length=655

 Score =   245 bits (625),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PEEEFGP I  REYS+ DNP +P EVK+SWLDVQLC+EG++GC  S 
Sbjct  494  DHVFEVNVMLKKLPEEEFGPEIGIREYSMLDNPSLPPEVKKSWLDVQLCKEGTQGCDGSY  553

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            ++T  G+L+FPK+S EE F  VFS FKDVKVI+ SS+ DAF GFT+K RE RFRNRVKRY
Sbjct  554  NSTVGGVLKFPKHSNEEMFMKVFSSFKDVKVIKLSSVEDAFTGFTNKEREDRFRNRVKRY  613

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC+ +   GH+YYDMYWDEKP WK IPPQ+P+EDHPP
Sbjct  614  VGIWCCMPDTPIGHIYYDMYWDEKPGWKAIPPQSPEEDHPP  654



>ref|XP_003548765.1| PREDICTED: uncharacterized protein LOC100819032 [Glycine max]
Length=639

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 132/165 (80%), Gaps = 3/165 (2%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PEEEFGP I FREYS+ DNP +P EVK+SWLDVQLC+EG++ C  S 
Sbjct  475  DHVFEVNVMLKKLPEEEFGPQIDFREYSILDNPSLPSEVKKSWLDVQLCKEGTQDCDASA  534

Query  649  ST---TATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRV  479
            S       G+L+FPK+S EE F  VFS FKDVKVI+FSS+ +AF GFTDK RE +FRNRV
Sbjct  535  SNDTNVGGGVLKFPKHSNEETFMKVFSSFKDVKVIKFSSVQEAFTGFTDKEREDKFRNRV  594

Query  478  KRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            KRYVGIWCCV + TPGH+YYDMYWDEKP WK +PPQT ++DHPP+
Sbjct  595  KRYVGIWCCVPDHTPGHIYYDMYWDEKPGWKAVPPQTSEDDHPPY  639



>ref|XP_004509491.1| PREDICTED: uncharacterized protein LOC101505601 [Cicer arietinum]
Length=638

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PEE FGP I  REYS+ DNP +P EVK+SWLDVQLC+EG++ C  S 
Sbjct  477  DHVFEVNVMLKKLPEEYFGPEIDIREYSILDNPSLPPEVKKSWLDVQLCKEGTQDCDGSY  536

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            ++T  G+L+FPKNS+EE F  VFS FKDVKVIQ SS+ DAF GFT+K RE RFRNRVK+Y
Sbjct  537  NSTVEGVLKFPKNSSEEMFTKVFSSFKDVKVIQLSSVQDAFTGFTNKEREDRFRNRVKQY  596

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCC+ + T GH+YYDMYWDEKP WKPIPPQ+ ++DHPP+
Sbjct  597  VGIWCCMPDTTIGHIYYDMYWDEKPGWKPIPPQSSEDDHPPF  638



>emb|CDP12731.1| unnamed protein product [Coffea canephora]
Length=646

 Score =   241 bits (616),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 133/163 (82%), Gaps = 2/163 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            D  F V+VM R  PEEEFGP I  +EYS+ DNP MP++VK+SWLDV LC EGS+GCQ+S+
Sbjct  483  DSVFLVDVMVRGLPEEEFGPSIRIKEYSILDNPSMPRKVKDSWLDVDLCHEGSQGCQVSS  542

Query  649  STTA--TGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVK  476
              T   TG+L+FPKNS++E + TVFSLFKDVKV+QFSSM DAF GFTDK RE +FR R+K
Sbjct  543  YATINQTGVLKFPKNSSQETYWTVFSLFKDVKVLQFSSMEDAFIGFTDKLREEKFRKRMK  602

Query  475  RYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
             Y+G WCCVE+ +PGH+YYD+YWDEKP WKP PP+TP++DHPP
Sbjct  603  AYIGRWCCVEDHSPGHIYYDIYWDEKPGWKPEPPRTPEDDHPP  645



>emb|CDY31704.1| BnaA05g08430D [Brassica napus]
Length=632

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 126/161 (78%), Gaps = 11/161 (7%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PE+EFGPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC+ SN
Sbjct  482  DHVFEVNIMLKELPEDEFGPGIGIREYSFLDNPALPKQVKESWLDVQLCQEGKEGCEASN  541

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T+ +G L+FPK S E+ FK +FS F DVKVI+FSS            RE RFR RVKRY
Sbjct  542  ITSPSGFLKFPKRSNEDTFKAIFSSFNDVKVIKFSS-----------GREERFRRRVKRY  590

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  591  VGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEEDHPP  631



>ref|XP_010907098.1| PREDICTED: uncharacterized protein LOC105033849 isoform X2 [Elaeis 
guineensis]
Length=641

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PE EFGP I FREYS   NPL+ +EVKES L+VQLC + S  CQ++N
Sbjct  480  DHVFEVNMMLKELPEAEFGPRIDFREYSFLQNPLVLKEVKESLLEVQLCDDRSAKCQIAN  539

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             TT  G+LRFPK+ST++ F  VFSL+KDVKV+QFSSM D FQGFTD+ARE +FR RVKRY
Sbjct  540  ETTRRGVLRFPKHSTQQMFIQVFSLYKDVKVLQFSSMEDVFQGFTDEAREEKFRKRVKRY  599

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VG+WCCVE++  GH+YYDMYWDEKP WKP PPQT ++D PPW
Sbjct  600  VGLWCCVEHRDRGHIYYDMYWDEKPGWKPEPPQTREDDRPPW  641



>gb|KHN27499.1| hypothetical protein glysoja_018611 [Glycine soja]
Length=648

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 134/174 (77%), Gaps = 12/174 (7%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGC--QL  656
            DH FEVNVM ++ PEEEFGP I FREYS+ DNP +P EVK+SWLDVQLC++G++ C    
Sbjct  475  DHVFEVNVMLKKLPEEEFGPQIDFREYSILDNPSLPSEVKKSWLDVQLCKDGTQDCDASA  534

Query  655  SNSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKA----------  506
            SN TT  G+L+FPK+S EE F  VFS  KDVKVI+FS++ DAF GFTDKA          
Sbjct  535  SNDTTVGGVLKFPKHSNEEMFMKVFSSLKDVKVIKFSTVQDAFTGFTDKAGTFCFFSFEE  594

Query  505  REHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            RE +FRNRVKRYVGIWCCV + +PGH+YYDMYWDEKP WK +PPQT ++DHPP+
Sbjct  595  REEKFRNRVKRYVGIWCCVPDHSPGHIYYDMYWDEKPGWKAVPPQTSEDDHPPY  648



>ref|XP_010907097.1| PREDICTED: uncharacterized protein LOC105033849 isoform X1 [Elaeis 
guineensis]
Length=643

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PE EFGP I FREYS   NPL+ +EVKES L+VQLC + S  CQ++N
Sbjct  482  DHVFEVNMMLKELPEAEFGPRIDFREYSFLQNPLVLKEVKESLLEVQLCDDRSAKCQIAN  541

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             TT  G+LRFPK+ST++ F  VFSL+KDVKV+QFSSM D FQGFTD+ARE +FR RVKRY
Sbjct  542  ETTRRGVLRFPKHSTQQMFIQVFSLYKDVKVLQFSSMEDVFQGFTDEAREEKFRKRVKRY  601

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VG+WCCVE++  GH+YYDMYWDEKP WKP PPQT ++D PPW
Sbjct  602  VGLWCCVEHRDRGHIYYDMYWDEKPGWKPEPPQTREDDRPPW  643



>emb|CDX84192.1| BnaC04g09540D [Brassica napus]
Length=632

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 125/161 (78%), Gaps = 11/161 (7%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PE+EFGPG   REYS  DNP +P++VK+SWLDVQLC+EG EGC+ +N
Sbjct  482  DHVFEVNIMLKELPEDEFGPGTGIREYSFLDNPALPKQVKDSWLDVQLCQEGKEGCEATN  541

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             TT +G L+FPK S E+ FK +FS F DVKVI+FSS            RE RFR RVKRY
Sbjct  542  ITTPSGFLKFPKRSNEDTFKAIFSSFNDVKVIKFSS-----------GREERFRRRVKRY  590

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+EDHPP
Sbjct  591  VGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEEDHPP  631



>dbj|BAD94473.1| hypothetical protein [Arabidopsis thaliana]
Length=145

 Score =   222 bits (566),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -2

Query  778  FGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEE  599
            FGPGI  REYS  DNPL+P++VKESWLDVQLC+EG EGC+ SN+T+ + +L+FPK S E+
Sbjct  1    FGPGIGIREYSFLDNPLLPKQVKESWLDVQLCQEGKEGCEASNNTSPSRVLKFPKRSNED  60

Query  598  KFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYY  419
             FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YY
Sbjct  61   TFKAIFSSFDDVKVIKFSSIEDAFIGFSDKEREERFRRRVKRYVGIWCCEENKTPGHIYY  120

Query  418  DMYWDEKPNWKPIPPQTPQEDHPP  347
            DMYWDEKP WKP+PPQTP+EDHPP
Sbjct  121  DMYWDEKPGWKPVPPQTPEEDHPP  144



>ref|XP_009388198.1| PREDICTED: uncharacterized protein LOC103975012 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  787  EEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNS  608
            EEEFGP I FREYS   NP +P+ VKES L+VQLC   S+GC +S+ TT+ G ++FP+NS
Sbjct  7    EEEFGPQIHFREYSFLQNPSVPKHVKESLLNVQLCDAHSKGCNISDGTTSRGFIQFPRNS  66

Query  607  TEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGH  428
            TE+ +  VFS +KD+KV+ FSSM +AFQGF D+ARE +FRNR+KRYVG+WCCVEN+ PGH
Sbjct  67   TEQMYMQVFSQYKDIKVLHFSSMANAFQGFNDEAREVKFRNRMKRYVGLWCCVENRDPGH  126

Query  427  VYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            +YYD+YWDEKP WKP PP+T Q+DHPPW
Sbjct  127  IYYDIYWDEKPEWKPEPPRTSQDDHPPW  154



>ref|XP_009388312.1| PREDICTED: uncharacterized protein LOC103975128 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  787  EEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNS  608
            EEEFGP I FREYS   NP +P+ VKES L+VQLC   S+GC +S+ TT+ G ++FP+NS
Sbjct  7    EEEFGPQIHFREYSFLQNPSVPKHVKESLLNVQLCDAHSKGCNISDGTTSRGFIQFPRNS  66

Query  607  TEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGH  428
            TE+ +  VFS +KD+KV+ FSSM +AFQGF D+ARE +FRNR+KRYVG+WCCVEN+ PGH
Sbjct  67   TEQMYMQVFSQYKDIKVLHFSSMANAFQGFNDEAREVKFRNRMKRYVGMWCCVENRDPGH  126

Query  427  VYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            +YYD+YWDEKP WKP PP+T Q+DHPPW
Sbjct  127  IYYDIYWDEKPEWKPEPPRTSQDDHPPW  154



>ref|XP_006878624.1| PREDICTED: uncharacterized protein LOC18422702 isoform X2 [Amborella 
trichopoda]
 gb|ERM94769.1| hypothetical protein AMTR_s00011p00260650 [Amborella trichopoda]
Length=638

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH  EVNVM    PE+EFGP I FREYS  DNPL+P++VKES LDV+LC EGS  C  +N
Sbjct  478  DHVLEVNVMLHGLPEDEFGPVIDFREYSFLDNPLLPKQVKESMLDVELCDEGSFNCH-AN  536

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
                 G+LRFPK+S EE FK VFS +K VKVI+FSSM DAFQGF+D+ RE +FR+RVKRY
Sbjct  537  EKEQHGVLRFPKHSNEETFKAVFSSYKHVKVIRFSSMQDAFQGFSDEGREEKFRHRVKRY  596

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCV+ +  GH+YYDMYWDEKPNWKP+ P+T  EDHP W
Sbjct  597  VGIWCCVDQKRIGHIYYDMYWDEKPNWKPVLPETEHEDHPNW  638



>ref|XP_011623933.1| PREDICTED: uncharacterized protein LOC18422702 isoform X1 [Amborella 
trichopoda]
Length=639

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH  EVNVM    PE+EFGP I FREYS  DNPL+P++VKES LDV+LC EGS  C  +N
Sbjct  479  DHVLEVNVMLHGLPEDEFGPVIDFREYSFLDNPLLPKQVKESMLDVELCDEGSFNCH-AN  537

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
                 G+LRFPK+S EE FK VFS +K VKVI+FSSM DAFQGF+D+ RE +FR+RVKRY
Sbjct  538  EKEQHGVLRFPKHSNEETFKAVFSSYKHVKVIRFSSMQDAFQGFSDEGREEKFRHRVKRY  597

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCV+ +  GH+YYDMYWDEKPNWKP+ P+T  EDHP W
Sbjct  598  VGIWCCVDQKRIGHIYYDMYWDEKPNWKPVLPETEHEDHPNW  639



>ref|XP_009381925.1| PREDICTED: uncharacterized protein LOC103970025 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  787  EEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNS  608
            EEEFGP I FREYS   NP +P+ VKES L+VQLC   S+GC +S+ TT+   ++FP+NS
Sbjct  7    EEEFGPQIHFREYSFLQNPSVPKHVKESLLNVQLCDAHSKGCNISDGTTSRDFIQFPRNS  66

Query  607  TEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGH  428
            TE+ +  VFS +KD+KV+ FSSM +AFQGF D+ARE +FRNR+KRYVG+WCCVEN+ PGH
Sbjct  67   TEQMYMQVFSQYKDIKVLHFSSMANAFQGFDDEAREVKFRNRMKRYVGMWCCVENRDPGH  126

Query  427  VYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            +YYD+YWDEKP WKP PP+T Q+DHPPW
Sbjct  127  IYYDIYWDEKPEWKPEPPRTSQDDHPPW  154



>ref|XP_009383104.1| PREDICTED: uncharacterized protein LOC103970914 [Musa acuminata 
subsp. malaccensis]
Length=682

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            D  FE++ M R   EEEFGP I FREYS   NP MP+ VKES L+VQLC   S+GC +SN
Sbjct  520  DQLFEIHTMVRGLSEEEFGPQIHFREYSFLQNPSMPKHVKESLLNVQLCDAHSKGCNISN  579

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             TT+ G ++FP+NSTE+ +  VFS +KD+KV+ FSSM +AF+GF+D+ARE +FR+RVKRY
Sbjct  580  ETTSRGFIQFPRNSTEQMYMQVFSQYKDIKVLHFSSMANAFKGFSDEAREAKFRSRVKRY  639

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VG WCC+EN+  GHVYYDMYWDEKP WKP PP+T ++D+PPW
Sbjct  640  VGKWCCLENRDLGHVYYDMYWDEKPGWKPEPPRTNEDDYPPW  681



>ref|XP_003562333.1| PREDICTED: uncharacterized protein LOC100845970 [Brachypodium 
distachyon]
Length=614

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FE+NVM+++ PEEEFGP I FREYS  +NP +P++VKES+L+VQLC E S  C  +N
Sbjct  452  DHVFEINVMTKDLPEEEFGPHIDFREYSFLENPSLPKQVKESFLEVQLCDEHSTRCSTAN  511

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T     L   +NSTEE    VFSL+K++K+IQFSSM DAF+GF D A E +FR+RVKRY
Sbjct  512  GTNKHRPLILARNSTEETLLNVFSLYKNIKIIQFSSMVDAFRGFADAAVETKFRDRVKRY  571

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVE +  GH+YYDMYWDEKP WKP PP+  +EDHPPW
Sbjct  572  VGIWCCVELREIGHIYYDMYWDEKPGWKPHPPRNREEDHPPW  613



>gb|KHG12902.1| hypothetical protein F383_16835 [Gossypium arboreum]
Length=611

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 119/162 (73%), Gaps = 17/162 (10%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM R+ P EEFGP I+ REYS  +NP +PQ V+ESWLDVQLC+EG+E C  S+
Sbjct  467  DHVFEVNVMLRDLPAEEFGPAINIREYSFLNNPFLPQRVRESWLDVQLCQEGTEDCHASS  526

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+  G+LRFPK S+EE  K VFS FKDV                 K RE +FR RVK+Y
Sbjct  527  NTSQPGLLRFPKRSSEETLKKVFSSFKDV-----------------KTREEKFRKRVKQY  569

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVEN  PGH+YYDMYWDEKP WKP+PP+TP++DHPP+
Sbjct  570  VGIWCCVENHIPGHIYYDMYWDEKPGWKPVPPKTPEDDHPPF  611



>ref|XP_006650304.1| PREDICTED: uncharacterized protein LOC102706084 [Oryza brachyantha]
Length=618

 Score =   217 bits (552),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++  E+EFGP I FREYS  +NP +P++VKES+ +V+LC E S  C  +N
Sbjct  456  DHVFEVNVMLKDLSEDEFGPLIDFREYSFLENPSLPKQVKESFREVELCNEHSTRCSATN  515

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T     +  P+NSTE+    +F  +KD+K++QFSSM DAF+GF+D A E +FRNRVKRY
Sbjct  516  RTNKGAPVLLPRNSTEQTILNIFKPYKDIKILQFSSMVDAFRGFSDAAVETKFRNRVKRY  575

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VG+WCCV+ +  GH+YYDMYWDEKP WKP+PPQT +EDHPPW
Sbjct  576  VGLWCCVQFREIGHIYYDMYWDEKPGWKPLPPQTKEEDHPPW  617



>ref|XP_002464281.1| hypothetical protein SORBIDRAFT_01g015590 [Sorghum bicolor]
 gb|EER91279.1| hypothetical protein SORBIDRAFT_01g015590 [Sorghum bicolor]
Length=615

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 120/162 (74%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEV+VM ++ P+EEFGP I FREYS  +NP +P+EVK+S LDVQLC E S  C   +
Sbjct  453  DHVFEVHVMLKDLPKEEFGPHIDFREYSFLENPSLPKEVKDSLLDVQLCDEHSSRCSAVD  512

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T        P+NSTEEK   + S +KDVK+IQFSSM DAF GF D A E +FRNRVKRY
Sbjct  513  ETDKHRPFLLPRNSTEEKLLDLLSPYKDVKIIQFSSMVDAFGGFADAAVEKKFRNRVKRY  572

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VG+WCCVE +  GH+YYDMYWDEKP WKP PP+T ++DHPPW
Sbjct  573  VGLWCCVEFRDIGHIYYDMYWDEKPGWKPHPPETREQDHPPW  614



>gb|EEC75649.1| hypothetical protein OsI_12401 [Oryza sativa Indica Group]
Length=622

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEV+VM ++ P+EEFGP I FREYS  +NP +P++VKES+L+V+LC E S  C  +N
Sbjct  456  DHVFEVHVMLKDLPKEEFGPHIDFREYSFLENPSLPKQVKESFLEVELCNEHSTRCSTTN  515

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T     +  P+NSTE+    +F  +KD+K++QFSSM +AF GF+D A + +FRNRVKRY
Sbjct  516  RTNKGAPVLLPRNSTEQTLLDIFKPYKDIKILQFSSMVNAFGGFSDAAVDTKFRNRVKRY  575

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VG+WCCV+ +  GH+YYDMYWDEKP WKP+PPQT  EDHPPW
Sbjct  576  VGLWCCVQLREIGHIYYDMYWDEKPGWKPLPPQTKVEDHPPW  617



>gb|ABF97349.1| expressed protein [Oryza sativa Japonica Group]
Length=622

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEV+VM ++ P+EEFGP I FREYS  +NP +P++VKES+L+V+LC E S  C  +N
Sbjct  456  DHVFEVHVMLKDLPKEEFGPHIDFREYSFLENPSLPKQVKESFLEVELCNEHSTRCSTTN  515

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T     +  P+NSTE+    +F  +KD+K++QFSSM +AF GF+D A + +FRNRVKRY
Sbjct  516  RTNKGAPVLLPRNSTEQTLLDIFKPYKDIKILQFSSMVNAFGGFSDAAVDTKFRNRVKRY  575

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VG+WCCV+ +  GH+YYDMYWDEKP WKP+PPQT  EDHPPW
Sbjct  576  VGLWCCVQLREIGHIYYDMYWDEKPGWKPLPPQTKVEDHPPW  617



>gb|EEE59420.1| hypothetical protein OsJ_11574 [Oryza sativa Japonica Group]
Length=683

 Score =   216 bits (550),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEV+VM ++ P+EEFGP I FREYS  +NP +P++VKES+L+V+LC E S  C  +N
Sbjct  392  DHVFEVHVMLKDLPKEEFGPHIDFREYSFLENPSLPKQVKESFLEVELCNEHSTRCSTTN  451

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T     +  P+NSTE+    +F  +KD+K++QFSSM +AF GF+D A + +FRNRVKRY
Sbjct  452  RTNKGAPVLLPRNSTEQTLLDIFKPYKDIKILQFSSMVNAFGGFSDAAVDTKFRNRVKRY  511

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VG+WCCV+ +  GH+YYDMYWDEKP WKP+PPQT  EDHPPW
Sbjct  512  VGLWCCVQLREIGHIYYDMYWDEKPGWKPLPPQTKVEDHPPW  553



>gb|KHF98530.1| hypothetical protein F383_12515 [Gossypium arboreum]
Length=605

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 114/161 (71%), Gaps = 29/161 (18%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ P+EEFGP I+ REYS  +NPL+PQ+VKESWLDVQLC+EG+E C  S+
Sbjct  473  DHVFEVNVMLKDLPQEEFGPAINIREYSFLNNPLLPQQVKESWLDVQLCQEGTEDCHASS  532

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+  G+LRFPKNSTEE                               RE +FRNR+KRY
Sbjct  533  NTSRPGLLRFPKNSTEE-----------------------------MTREEKFRNRMKRY  563

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
            VGIWCCVEN TPGH+YYDMYWDEKP WKP PPQTP+EDHPP
Sbjct  564  VGIWCCVENHTPGHIYYDMYWDEKPGWKPAPPQTPEEDHPP  604



>ref|XP_004982506.1| PREDICTED: uncharacterized protein LOC101753789 [Setaria italica]
Length=619

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEV+VM ++ P+EEFGP I FREYS  +NP +P+EVKES L+VQLC + S  C   N
Sbjct  457  DHVFEVHVMLKDLPKEEFGPHIDFREYSFLENPSLPKEVKESLLEVQLCDDHSSRCSAVN  516

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T     L   +NSTEEK   +FS +K VKVIQFSSM DAF GF D   E +FRNRVKRY
Sbjct  517  GTDKHRPLLLSRNSTEEKLLNIFSSYKSVKVIQFSSMVDAFGGFADADVEMKFRNRVKRY  576

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VG+WCCVE +  GH+YYDMYWDEKP WKP PP+T ++DHPPW
Sbjct  577  VGLWCCVELREIGHIYYDMYWDEKPGWKPHPPETREQDHPPW  618



>gb|EPS68350.1| hypothetical protein M569_06419, partial [Genlisea aurea]
Length=546

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 122/169 (72%), Gaps = 8/169 (5%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQE-------VKESWLDVQLCREGS  671
            DH F V++M +  PE EFGP I  REYS  DNP +PQ+       VK SWLDV LC   S
Sbjct  379  DHVFNVDMMVKVLPEVEFGPQIGIREYSFLDNPALPQQAIAYFTTVKYSWLDVTLCNPKS  438

Query  670  EGCQLSNSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRF  491
            +GC+++ +T +T +++FP+ S EE F  VFS FKDVKVI+FSSM  AF  F D+ RE  F
Sbjct  439  KGCEVT-TTNSTALIKFPRESAEETFMAVFSAFKDVKVIRFSSMQRAFSRFNDETREELF  497

Query  490  RNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            R RVKRY+G WCC+EN+  GH++YDMYWDEKPNWKP+PP+T  EDHPP+
Sbjct  498  RKRVKRYLGAWCCLENKALGHIFYDMYWDEKPNWKPVPPKTKAEDHPPF  546



>ref|XP_010235552.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235553.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235554.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235555.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_003572620.2| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
Length=642

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 122/162 (75%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PEE+FGP I FREYS  +NP +P++VKES+L+VQLC E S  C  +N
Sbjct  480  DHVFEVNVMLKDLPEEDFGPHIDFREYSFLENPSLPKQVKESFLEVQLCDEHSTRCSTAN  539

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             T     L   +N+TEE    VFS +K++K++QFSS+ DAF+GF D A E +FR+RVKRY
Sbjct  540  ETNKHRPLILARNNTEETLLNVFSPYKNIKILQFSSIVDAFRGFADAAVETKFRDRVKRY  599

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VGIWCCVE +  GH+YYDMYWDEKP WKP PPQ  ++DHPPW
Sbjct  600  VGIWCCVEFREIGHIYYDMYWDEKPGWKPHPPQNREDDHPPW  641



>ref|XP_009383108.1| PREDICTED: uncharacterized protein LOC103970917 [Musa acuminata 
subsp. malaccensis]
Length=272

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FE++ M R   EEEFGP I FREYS   NP +P+ VKES L+VQLC   S+GC +SN
Sbjct  128  DHLFEIHTMVRGLSEEEFGPQIHFREYSFLQNPSVPKHVKESLLNVQLCDAHSKGCNISN  187

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
             TT+ G ++FP+NSTE+ +  VFS +KD++V+ FSSM +AF GF+D+ARE  FRNRVKRY
Sbjct  188  ETTSRGFIQFPRNSTEQVYMQVFSQYKDIQVLHFSSMSNAFLGFSDEAREATFRNRVKRY  247

Query  469  VGIWCCVENQTPGHVYYDMYWDEKP  395
            VG WCCV NQ+P H+YYDMYWDEKP
Sbjct  248  VGTWCCVRNQSPSHIYYDMYWDEKP  272



>ref|XP_010540709.1| PREDICTED: uncharacterized protein LOC104814389 [Tarenaya hassleriana]
Length=598

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 116/145 (80%), Gaps = 3/145 (2%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH F+++ M +E PE+EFGPGI  REYS FDNPL+P+ VKESWLDV+LC EG   C+ S+
Sbjct  453  DHVFKIDTMLKELPEDEFGPGIGIREYSFFDNPLLPKHVKESWLDVKLCHEG---CETSD  509

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T ++G ++FPK S+EE+FK  FS  KDVKVI F S+ DAF GF+DK RE +FR RVKRY
Sbjct  510  NTISSGFIKFPKRSSEERFKATFSSLKDVKVINFYSVQDAFTGFSDKEREEKFRRRVKRY  569

Query  469  VGIWCCVENQTPGHVYYDMYWDEKP  395
            VG WCCVEN+T GH+YYDMYWDEKP
Sbjct  570  VGRWCCVENRTLGHIYYDMYWDEKP  594



>ref|NP_001143144.1| hypothetical protein [Zea mays]
 gb|ACG29327.1| hypothetical protein [Zea mays]
 gb|ACN27867.1| unknown [Zea mays]
 gb|ACR35913.1| unknown [Zea mays]
 tpg|DAA50140.1| TPA: hypothetical protein ZEAMMB73_624371 [Zea mays]
Length=615

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 118/162 (73%), Gaps = 0/162 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEV+VM ++ P+EEFG  I FREYS  +NP +P+EVK+S L+V+LC E S  C   +
Sbjct  453  DHVFEVHVMLKDLPKEEFGQHIDFREYSFLENPSLPKEVKDSLLEVELCDEHSSRCSAID  512

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
                 G    P+NSTEEK   + S +KDVK+IQFSSM DAF GF D A E +FRNRV RY
Sbjct  513  EIDKHGTFLLPRNSTEEKLLDLLSSYKDVKIIQFSSMVDAFGGFADAAVEKKFRNRVNRY  572

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            VG+WCCVE +  GH+YYDMYWDEKP WKP PP+T ++DHPPW
Sbjct  573  VGLWCCVEFREIGHIYYDMYWDEKPGWKPHPPETREQDHPPW  614



>gb|EPS58524.1| hypothetical protein M569_16289, partial [Genlisea aurea]
Length=402

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKE--SWLDVQLCREGSEGCQL  656
            DH F V+ M    PE E+GP I FRE++ F+NP  P EVKE  SWL V LC   S+GC++
Sbjct  254  DHVFAVDNMQNAWPENEYGPHIDFREHTFFENPSSPHEVKEEESWLKVHLCDTKSKGCRI  313

Query  655  SNSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVK  476
            SN+TT   IL+ P+NS+EE  + VFS FKDVK IQFSSM DAF+GFTDK R   FR R+K
Sbjct  314  SNATTTGRILKLPENSSEETLRAVFSRFKDVKTIQFSSMQDAFRGFTDKTRAESFRRRMK  373

Query  475  RYVGIWCCVENQTPGHVYYDMYWDEKPNW  389
            RY G+WCCVEN TPGH+YYDMYWDEKPNW
Sbjct  374  RYTGLWCCVENVTPGHIYYDMYWDEKPNW  402



>emb|CDP12730.1| unnamed protein product [Coffea canephora]
Length=622

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 120/156 (77%), Gaps = 2/156 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            D+ FEVNVM  E  E+E+G  I  RE+S F+NPLMPQ+VKES L V LC+EGSE CQ+SN
Sbjct  469  DYVFEVNVMLMELQEDEYGQPIRIREHSFFENPLMPQKVKESRLVVSLCQEGSEDCQVSN  528

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +T+ TG+L+ PKNS+EE +KTVFS FKDVKV+QFSSM DAF+GFTDK+ E  FR RV  Y
Sbjct  529  ATSQTGVLKVPKNSSEETYKTVFSSFKDVKVVQFSSMQDAFRGFTDKSMEENFRKRVTAY  588

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQ  362
              IWCCV N T   + YD+YWDEKP+WKP P + P+
Sbjct  589  TSIWCCV-NYTQV-ISYDIYWDEKPDWKPKPSRIPE  622



>gb|KHN03113.1| hypothetical protein glysoja_049543 [Glycine soja]
Length=610

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 108/165 (65%), Gaps = 32/165 (19%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PEEEFGP I FREYS+ DNP +P EVK+SWLDVQLC+EG++ C  S 
Sbjct  475  DHVFEVNVMLKKLPEEEFGPQIDFREYSILDNPSLPSEVKKSWLDVQLCKEGTQDCDASA  534

Query  649  S---TTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRV  479
            S       G+L+FPK+S EE                               RE +FRNRV
Sbjct  535  SNDTNVGGGVLKFPKHSNEE-----------------------------TEREDKFRNRV  565

Query  478  KRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            KRYVGIWCCV + TPGH+YYDMYWDEKP WK +PPQT ++DHPP+
Sbjct  566  KRYVGIWCCVPDHTPGHIYYDMYWDEKPGWKAVPPQTSEDDHPPY  610



>gb|KHN41773.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=1470

 Score =   186 bits (471),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 109/161 (68%), Gaps = 29/161 (18%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN M +E PEEEFGPGI  REYS+ DNP++P EVK+SWLDVQLC++G++ C  SN
Sbjct  466  DHVFEVNAMLKELPEEEFGPGIDIREYSILDNPILPSEVKKSWLDVQLCKDGTQDCFASN  525

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            +TT  G+L+FP++S EE                             + RE RFR RVKRY
Sbjct  526  NTTVGGVLKFPRHSNEE-----------------------------REREDRFRKRVKRY  556

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
             GIWCCV + TPGH+YYDMYWDEKP WKPIPPQT  +DHPP
Sbjct  557  PGIWCCVLDHTPGHIYYDMYWDEKPEWKPIPPQTSADDHPP  597



>ref|XP_002988322.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ10741.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=557

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 109/169 (64%), Gaps = 11/169 (7%)
 Frame = -2

Query  829  DHXFE-------VNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGS  671
            DH FE       V+ M +  PEEEFGP I FREYS  +NP +PQE+K S L ++LC  G 
Sbjct  392  DHVFEASFYVRIVSNMLKNMPEEEFGPAIDFREYSFLENPRVPQEIKTSRLSIRLCSRGK  451

Query  670  EGCQLSNSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRF  491
            +     +S  + G +  P N T+ + +  FS  KDVK++ FS+M + F GF DK +  +F
Sbjct  452  D----CSSEVSQGAIELPINMTDTQLRDEFSRHKDVKILDFSTMQNVFGGFVDKDKALKF  507

Query  490  RNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
            R R+++Y GIWCC+E+   GH+YYD +WDEKP WKP+PP  P+ DHPP+
Sbjct  508  RRRLQKYTGIWCCLESLERGHIYYDFFWDEKPGWKPLPPTRPENDHPPF  556



>ref|XP_002991425.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ07537.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=545

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 107/162 (66%), Gaps = 5/162 (3%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH  +V+ M +  PEEEFGP I FREYS  +NP +PQE+K S L ++LC  G + C   +
Sbjct  388  DHAQQVSNMLKNMPEEEFGPAIDFREYSFLENPRVPQEIKTSRLSIRLCSRG-KNC---S  443

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
            S  + G +  P N T+ + +  FS  KDVK++ FS+M + F GF DK    +FR R++RY
Sbjct  444  SEVSQGAIELPINMTDTQLRDEFSRHKDVKILDFSTMKNVFGGFVDKV-TLKFRRRLQRY  502

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  344
              IWCC+E+   GH+YYD +WDEKP WKP+PP  P+ DHPP+
Sbjct  503  TAIWCCLESLERGHIYYDFFWDEKPGWKPLPPTRPENDHPPF  544



>gb|EPS68351.1| hypothetical protein M569_06420, partial [Genlisea aurea]
Length=92

 Score =   157 bits (398),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -2

Query  628  LRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCV  449
            L+ P+ S+EE FK VFS FKDVKVI+FSSM  AF GFTDK RE  FR RVK Y GIWCCV
Sbjct  1    LKLPRESSEETFKAVFSPFKDVKVIRFSSMQRAFAGFTDKTREASFRKRVKGYTGIWCCV  60

Query  448  ENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDH  353
            EN+TPGH+YYDMYWDEKPNWKP+PPQTP EDH
Sbjct  61   ENKTPGHIYYDMYWDEKPNWKPVPPQTPAEDH  92



>gb|KCW72694.1| hypothetical protein EUGRSUZ_E01147 [Eucalyptus grandis]
Length=611

 Score =   167 bits (423),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PE+EFGPGI+ REYSL DNP MP++VKESWLDV+LC+ G++ CQ++N
Sbjct  477  DHVFEVNVMLKEMPEDEFGPGINIREYSLLDNPSMPKQVKESWLDVKLCQGGTKDCQVTN  536

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRF  491
            ST++ G++R PK S EE  KT FS FKD+KVIQFSSM DAF+GFTD+ R H +
Sbjct  537  STSSPGMIRLPKRSNEETLKTAFSSFKDIKVIQFSSMQDAFEGFTDQVRIHLY  589



>gb|KJB25101.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=588

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PEEEFGP I+ REYS  +NPL+PQ+VKESWLDVQLC+EG+E C  S+
Sbjct  473  DHVFEVNVMLKDLPEEEFGPEINIREYSFLNNPLLPQQVKESWLDVQLCQEGTEDCHASS  532

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAR  503
            +T+  G+LRFPKNSTEE FKTVFS FKDVKVIQFSSM  AF  FTDKA+
Sbjct  533  NTSRPGLLRFPKNSTEEMFKTVFSSFKDVKVIQFSSMQGAFYSFTDKAK  581



>ref|XP_001761094.1| predicted protein [Physcomitrella patens]
 gb|EDQ74161.1| predicted protein, partial [Physcomitrella patens]
Length=526

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 106/161 (66%), Gaps = 2/161 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN M  +  E EFGP I  REYS  +NPL+  +VK+S L V+LC     GC   N
Sbjct  367  DHVFEVNRMVADLSEIEFGPQIGIREYSFLENPLLENKVKKSVLKVKLCDRKLAGCSHKN  426

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRY  470
              + +G+L+ PKNST+E+      +F   K+++F+S  D F GF +     +F  R+K Y
Sbjct  427  KVS-SGVLKLPKNSTDEELSAKLDIFNKFKILEFTSAIDVFGGFRNIV-SMKFTRRIKSY  484

Query  469  VGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  347
             GIWCCV ++TPGH++YD+YWDEKPNWKP+PP TP +DH P
Sbjct  485  TGIWCCVMDKTPGHIWYDIYWDEKPNWKPLPPATPADDHQP  525



>ref|XP_009383105.1| PREDICTED: uncharacterized protein LOC103970915 [Musa acuminata 
subsp. malaccensis]
Length=245

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FE+  M R   EE FGP I FREYS   NP +P+ VKES L+V LC   SE C +SN
Sbjct  128  DHLFEIPTMLRGLSEEVFGPQIHFREYSFLQNPSVPKHVKESLLNVHLCDAHSEECNISN  187

Query  649  STTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKA  506
             T++ G ++FP+NSTE+ +  VFS +KD+KV+ FSSM +AFQGF+D+ 
Sbjct  188  ETSSHGFIQFPRNSTEQMYMQVFSQYKDIKVLHFSSMTNAFQGFSDQV  235



>ref|XP_002506735.1| glycosyltransferase family 77 protein [Micromonas sp. RCC299]
 gb|ACO67993.1| glycosyltransferase family 77 protein [Micromonas sp. RCC299]
Length=746

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 90/150 (60%), Gaps = 5/150 (3%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCRE-GSEGCQLS  653
            DH FEV    REQP EE GP I FREYS F NPL+P  V++S + V L  E G E C  +
Sbjct  577  DHVFEVETWMREQPVEESGPHIDFREYSFFRNPLVPTNVRDSTVTVSLVDECGREECTQA  636

Query  652  NSTTATG---ILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNR  482
                A      +   +N T+ + +T+ + +KDVKV+ F+SM  AF  F D     +F NR
Sbjct  637  VGKAAPAGQDTIVAARNFTDVQVQTLLTEYKDVKVLNFTSMVGAFSQFEDPEDAKKFSNR  696

Query  481  VKRYVGIWCCVENQTPGHVYYDMYWDEKPN  392
            +K+Y  IWCC +++ PGH++YDM +D  P+
Sbjct  697  IKKYAAIWCC-KHRNPGHIWYDMEFDIVPH  725



>gb|KJB25098.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=559

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM ++ PEEEFGP I+ REYS  +NPL+PQ+VKESWLDVQLC+EG+E C  S+
Sbjct  473  DHVFEVNVMLKDLPEEEFGPEINIREYSFLNNPLLPQQVKESWLDVQLCQEGTEDCHASS  532

Query  649  STTATGILRFPKNSTEEKFKTVFSLF  572
            +T+  G+LRFPKNSTEE    +  L 
Sbjct  533  NTSRPGLLRFPKNSTEEMVWLILHLL  558



>emb|CAN79199.1| hypothetical protein VITISV_040773 [Vitis vinifera]
Length=715

 Score =   120 bits (302),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVNVM +E PE+EFGPGI+ REYS FDNPLMP +VK+SWLDVQLCREGS GC ++N
Sbjct  565  DHVFEVNVMLKEFPEDEFGPGINIREYSFFDNPLMPXQVKDSWLDVQLCREGSPGCNVTN  624

Query  649  STTATGILRFPKNSTEE  599
            +T++ GI R PK+STEE
Sbjct  625  NTSSLGI-RLPKHSTEE  640



>tpg|DAA50139.1| TPA: hypothetical protein ZEAMMB73_624371 [Zea mays]
Length=67

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  541  MHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQ  362
            M DAF GF D A E +FRNRV RYVG+WCCVE +  GH+YYDMYWDEKP WKP PP+T +
Sbjct  1    MVDAFGGFADAAVEKKFRNRVNRYVGLWCCVEFREIGHIYYDMYWDEKPGWKPHPPETRE  60

Query  361  EDHPPW  344
            +DHPPW
Sbjct  61   QDHPPW  66



>ref|XP_003062865.1| glycosyltransferase family 77 protein [Micromonas pusilla CCMP1545]
 gb|EEH52804.1| glycosyltransferase family 77 protein [Micromonas pusilla CCMP1545]
Length=525

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 82/157 (52%), Gaps = 11/157 (7%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLC--------REG  674
            DH FEV   S + P    GPGI+FRE+S F+NP +P  V  S ++V             G
Sbjct  351  DHVFEVETWSSDMPPSVAGPGIAFREHSFFENPNVPASVAASTVEVTFVPSCGGGGGGGG  410

Query  673  SEGC-QLSNSTTATGILRF--PKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAR  503
             E C Q       +G+ R   P N+T+ +   + S    VKV+ F+S   AF    D A 
Sbjct  411  GEKCTQAEGEPAPSGVKRVVAPGNATDVEIANLLSNHAGVKVLNFTSTLGAFGRHADAAD  470

Query  502  EHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPN  392
              +F  RVKRY G+WCCV +  PGH++YDM +D  P+
Sbjct  471  AKKFSTRVKRYAGLWCCVFDAVPGHIWYDMEFDVVPH  507



>emb|CDX84231.1| BnaC04g09930D [Brassica napus]
Length=384

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 68/113 (60%), Gaps = 27/113 (24%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH FEVN+M +E PE+EFGPGI  REYS  DNP +P++VK+                   
Sbjct  277  DHVFEVNIMLKELPEDEFGPGIGIREYSFLDNPSLPKQVKD-------------------  317

Query  649  STTATGILRFPKNSTEEK-----FKTVFSLFKDVKVIQFSSMHDAFQGFTDKA  506
                +G L+FPK S E+      F ++FS F DVKVI+FSS+ DAF GF+DKA
Sbjct  318  ---PSGFLKFPKRSNEDTVTKDLFSSIFSSFNDVKVIKFSSVEDAFTGFSDKA  367



>gb|KIZ02111.1| hypothetical protein MNEG_5846 [Monoraphidium neglectum]
Length=233

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 83/148 (56%), Gaps = 10/148 (7%)
 Frame = -2

Query  829  DHXFEV-NVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLS  653
            DH  ++ N ++R+  +EEFGP I++RE+S  ++  +P  V+ S + V  CR GS GC   
Sbjct  68   DHILDLENGLARKLDKEEFGPDIAYREHSFLNHSALPDVVRGSVVHVVSCRHGSVGCATG  127

Query  652  NSTTATGILRFPKNSTEEKFKT-----VFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFR  488
            ++      L F +   EE+  +       S    + V+ F+S+  AF  F+  A   RF+
Sbjct  128  DNPA---TLEFNRLFVEERLDSDRLAMALSSVASISVLNFTSIGSAFGNFSRPADFTRFQ  184

Query  487  NRVKRYVGIWCCVENQTPGHVYYDMYWD  404
             R+ +Y  +WCCV+   PGHV+YD++WD
Sbjct  185  RRMAQYGAVWCCVDAH-PGHVHYDLWWD  211



>ref|XP_005843950.1| hypothetical protein CHLNCDRAFT_37217 [Chlorella variabilis]
 gb|EFN51848.1| hypothetical protein CHLNCDRAFT_37217 [Chlorella variabilis]
Length=631

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 76/149 (51%), Gaps = 13/149 (9%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH  ++  MS   PE EFGP I FREYS   N      +  S L + +C++         
Sbjct  475  DHVLDLEAMSNTMPENEFGPNIEFREYSFLQNQ-HAAALNASVLTLDICQDA--------  525

Query  649  STTATGILRFPKNSTEEKFKTVFSLFK--DVKVIQF-SSMHDAFQGFTDKAREHRFRNRV  479
            ST A G  +      EE  K   +  K  + KV+ F   +   F G+TD+A   RF+ R+
Sbjct  526  STCADGADKLKPQLHEEALKAALTEGKVAEAKVLHFVGGIERLFGGWTDEAAGERFKRRL  585

Query  478  KRYVGIWCCVENQTPGHVYYDMYWDEKPN  392
             RY  IWCCV N  PGH++YD ++D+ P+
Sbjct  586  DRYGSIWCCV-NAHPGHIWYDFFFDQLPH  613



>ref|XP_005646140.1| hypothetical protein COCSUDRAFT_17381, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21596.1| hypothetical protein COCSUDRAFT_17381, partial [Coccomyxa subellipsoidea 
C-169]
Length=529

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 76/147 (52%), Gaps = 7/147 (5%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWL-DVQLCREGSEGCQLS  653
            DH  ++  MS+E PE EFGP I +REYS  DNP     + E+ + +V +C+   + C+  
Sbjct  371  DHVLDLEQMSKEFPEAEFGPDIPYREYSFLDNP--KTNITEAGIFNVVVCQVRRD-CRPP  427

Query  652  NSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKR  473
            ++   +  L+   +          + F   +V+ F  M  A+  F  K    RF  R K 
Sbjct  428  DAQANSVALQ--SDPEHASLIQALAPFSSKRVLHFEDMRHAYGNFPTKEYRDRFEQRTKL  485

Query  472  YVGIWCCVENQTPGHVYYDMYWDEKPN  392
            Y  +WCCV+   PGHV+YDM+WD  P+
Sbjct  486  YTSLWCCVDKH-PGHVWYDMWWDVIPH  511



>ref|XP_002956941.1| hypothetical protein VOLCADRAFT_83868 [Volvox carteri f. nagariensis]
 gb|EFJ42066.1| hypothetical protein VOLCADRAFT_83868 [Volvox carteri f. nagariensis]
Length=647

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 69/126 (55%), Gaps = 1/126 (1%)
 Frame = -2

Query  781  EFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTE  602
            EFGP + +REYS F+NP M + V ES + V +C+ G   C   ++    G++R       
Sbjct  395  EFGPHLEYREYSFFNNPRMNKAVNESRVTVVICKPGEADCSNGDAPAPDGVVRLAPQLNS  454

Query  601  EKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVY  422
            ++        +  K+I  S+  +AF+ F+ K ++ +F NR+  Y  ++CC+ N  PG ++
Sbjct  455  DQINKALEAVRGFKIITLSNAAEAFKEFSSKEKQDQFVNRMNHYASVFCCLAN-NPGWIW  513

Query  421  YDMYWD  404
            YD + D
Sbjct  514  YDFFAD  519



>ref|XP_002957630.1| hypothetical protein VOLCADRAFT_77645 [Volvox carteri f. nagariensis]
 gb|EFJ41296.1| hypothetical protein VOLCADRAFT_77645 [Volvox carteri f. nagariensis]
Length=535

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 74/149 (50%), Gaps = 8/149 (5%)
 Frame = -2

Query  829  DHXFEV-NVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLS  653
            DH  ++ N + +  PE ++GP    REYS F+N  M   V++  + V+LC  G+  C   
Sbjct  367  DHVVDLENGVFKNLPEGDYGPRTEIREYSFFNNSKMTPRVRDDRVVVELCNPGTPECSDG  426

Query  652  NSTTATGI------LRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRF  491
                   I      +R        + +   S  K  KV+ F++M +A   F+D A   RF
Sbjct  427  REPAKLQIDGGVAKVRVQAGLPSGQLEVALSSVKTTKVLHFTTMANAMGDFSDSAVAARF  486

Query  490  RNRVKRYVGIWCCVENQTPGHVYYDMYWD  404
             NR+K Y  IWCCV    PGH++YDM +D
Sbjct  487  TNRMKLYGSIWCCVLAH-PGHIHYDMLFD  514



>ref|XP_001692787.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03806.1| predicted protein [Chlamydomonas reinhardtii]
Length=703

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 74/155 (48%), Gaps = 15/155 (10%)
 Frame = -2

Query  829  DHXFEV-NVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESW--------LDVQLCRE  677
            DH  ++ N M R+ PEE +GP   FREYS F+N  M   V++               C +
Sbjct  530  DHLLDLENGMFRKFPEEHYGPSTEFREYSFFNNSRMTPAVRDDRVVVEVCDTAGAAGCSD  589

Query  676  GSEGCQLSNSTTATGILRFPKNSTEEKFKTVFS--LFKDVKVIQFSSMH--DAFQGFTDK  509
            GS+  QL        I   P  S+ E   T  S    K  KV+ F+SM   +  Q F++ 
Sbjct  590  GSKPAQLVTEGGVKKIKIAPFLSSAE-LATALSDPAVKGAKVLHFTSMAGFNFPQAFSEP  648

Query  508  AREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWD  404
                RF  R+K Y  IWCCV    PGH++YD+ WD
Sbjct  649  GAAARFVERMKLYGSIWCCVLAH-PGHIHYDLLWD  682



>ref|XP_001690605.1| hypothetical protein CHLREDRAFT_114491 [Chlamydomonas reinhardtii]
 gb|EDP05864.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=501

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 66/121 (55%), Gaps = 4/121 (3%)
 Frame = -2

Query  781  EFGPGISFREYSLFDNPLMPQEVKESWLDVQLCR-EGSEGCQLSNSTTATGILRFPKNST  605
            EFG  + +REYS F+NP M + V ES + V++C    + GC+   +  A G+++   N  
Sbjct  384  EFGAHLHYREYSFFNNPRMSKAVNESRVTVEICAPPDATGCE-EGAGPADGVVKLMPNLK  442

Query  604  EEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHV  425
                       +D K+I   +  DAF GF+D   + R+ NR+K Y  ++CC++ + PG +
Sbjct  443  SAAVAKALEAVQDKKIIVLKNAKDAFSGFSDP-EQARYENRLKHYTSVFCCLD-KNPGWI  500

Query  424  Y  422
            +
Sbjct  501  W  501



>ref|XP_005852062.1| hypothetical protein CHLNCDRAFT_133059 [Chlorella variabilis]
 gb|EFN59960.1| hypothetical protein CHLNCDRAFT_133059 [Chlorella variabilis]
Length=727

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 70/128 (55%), Gaps = 5/128 (4%)
 Frame = -2

Query  772  PGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEKF  593
            P I FREYS   N   PQ +K+S + +    + ++  +L        ++R P+  T+ + 
Sbjct  601  PPIPFREYSFLQNERTPQALKDSKVVISPATDATKVEELKEGGKT--VVRIPQGQTDAQL  658

Query  592  KTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCC---VENQTPGHVY  422
            + + + +KDV+++ F+++H AF G+ DKA   +F++R+   +G +CC    E +  G+ Y
Sbjct  659  RELLAPYKDVQLLHFNTLHKAFGGWEDKAMVGKFQHRLSHMMGFFCCKKVKEGEDGGYAY  718

Query  421  YDMYWDEK  398
            Y    D K
Sbjct  719  YRFLEDPK  726



>ref|XP_005649227.1| hypothetical protein COCSUDRAFT_62105 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24683.1| hypothetical protein COCSUDRAFT_62105 [Coccomyxa subellipsoidea 
C-169]
Length=857

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 34/111 (31%), Positives = 56/111 (50%), Gaps = 8/111 (7%)
 Frame = -2

Query  778  FGPGISFREYSLFDNPLMPQEVKESWLDVQ--LCREGSEGCQLSNSTTATGILRFPKNST  605
            +GP I+FRE+S +DNP  P E+K++ ++V     RE +   ++ N  T       P N +
Sbjct  732  YGPPIAFREHSFWDNPDTPAELKDNQVEVVPVATREWNPAKRMGNQLT------IPANLS  785

Query  604  EEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCC  452
            +E  +       D+KV+   ++   F+GF+D      F  R+     IWCC
Sbjct  786  DEDLRRTLQPHDDIKVLMVRNVTGIFRGFSDMTAADGFWRRMAHISSIWCC  836



>gb|KJB25099.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
 gb|KJB25100.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=519

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKES  704
            DH FEVNVM ++ PEEEFGP I+ REYS  +NPL+PQ+V E+
Sbjct  473  DHVFEVNVMLKDLPEEEFGPEINIREYSFLNNPLLPQQVNEN  514



>ref|XP_007040867.1| Xyloglucanase 113 isoform 3 [Theobroma cacao]
 gb|EOY25368.1| Xyloglucanase 113 isoform 3 [Theobroma cacao]
Length=546

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKE  707
            DH FEVNVM ++ P EEFGP I+ REYS  +NPL+PQ+V E
Sbjct  475  DHVFEVNVMLKDLPVEEFGPAINIREYSFLNNPLLPQQVNE  515



>ref|XP_007040866.1| Xyloglucanase 113 isoform 2 [Theobroma cacao]
 gb|EOY25367.1| Xyloglucanase 113 isoform 2 [Theobroma cacao]
Length=518

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKE  707
            DH FEVNVM ++ P EEFGP I+ REYS  +NPL+PQ+V E
Sbjct  475  DHVFEVNVMLKDLPVEEFGPAINIREYSFLNNPLLPQQVNE  515



>ref|XP_011395852.1| hypothetical protein F751_0343 [Auxenochlorella protothecoides]
 gb|KFM22985.1| hypothetical protein F751_0343 [Auxenochlorella protothecoides]
Length=603

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 64/153 (42%), Gaps = 16/153 (10%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCR------EGSE  668
            DH FE   +  EQ  E   P + FREYS   NP  P  VK+  + ++L        EGS 
Sbjct  449  DHVFEPGNL--EQRMEGGEPLVPFREYSFLGNPRTPAVVKDDVVVLELASAAVNSPEGSS  506

Query  667  GCQLSNSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFR  488
                S +T     LR P NST    +   +  +    I  +     + G+ ++    R  
Sbjct  507  PLARSRAT-----LRLPANSTNLGLQAALAAHEATHRIHVTDPLALWGGWEEQGANARMA  561

Query  487  NRVKRYVGIWCCVE---NQTPGHVYYDMYWDEK  398
            +R  R +G WCC +    Q  G  Y D+  + +
Sbjct  562  SRFLRSLGFWCCRKVPHGQDGGMGYADLLLNTQ  594



>ref|XP_010676706.1| PREDICTED: uncharacterized protein LOC104892459 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=507

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVK  710
            DH FEVNVM +  P++E+GP I  REYS  DNP +P+EV+
Sbjct  468  DHVFEVNVMLQNLPQQEYGPRIDIREYSFLDNPALPREVR  507



>ref|XP_011397701.1| hypothetical protein F751_1692 [Auxenochlorella protothecoides]
 gb|KFM24813.1| hypothetical protein F751_1692 [Auxenochlorella protothecoides]
Length=291

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/141 (26%), Positives = 62/141 (44%), Gaps = 17/141 (12%)
 Frame = -2

Query  763  SFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTAT---GILRFPKNSTEEKF  593
             FRE+S    P    E+  S L V +C++  EGC   ++       G+   P  S E+  
Sbjct  150  GFREHSFLSKP-EAAELNASRLLVTICQDAEEGCAAGDAAAEVQDGGVRLQPGRSLEQLR  208

Query  592  KTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDM  413
              +    +  K++ F+         + +  E RF +R+  +  I CCV+    GH++YD+
Sbjct  209  VALSGALEKHKLLHFTGGMGRALILSPEEVE-RFGSRLNSFTSIHCCVKAPV-GHIWYDL  266

Query  412  YWD-----------EKPNWKP  383
            +WD           ++  WKP
Sbjct  267  FWDIPGHTDRHQRTQQGEWKP  287


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/178 (24%), Positives = 76/178 (43%), Gaps = 13/178 (7%)
 Frame = -2

Query  763  SFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTAT--GILRFPKNSTEEKFK  590
             FRE+S    P    E+  S L V +C++  EGC   ++      G +R  +  + E+ +
Sbjct  8    GFREHSFLSKP-EAAELNASRLLVTICQDAEEGCAAGDAAAEVQDGGVRLVRLRSLEQLR  66

Query  589  TVFS-LFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDM  413
               S   +  K++ F+         + +  E RF +R+  +  I CCV+    GH++YD+
Sbjct  67   VALSGALEKHKLLHFTGGMGRALILSPEEVE-RFGSRLNSFTSIHCCVKAPV-GHIWYDL  124

Query  412  YWDEKPNWKPIPPQTPQEDHPPW*NPRVALLTSLHRHSNFNTAKIGKIS*TALWLTAC  239
            +WD       IP  T +            L      HS  +  +  +++ + L +T C
Sbjct  125  FWD-------IPGHTDRHQRTQQGEMSGKLPNGFREHSFLSKPEAAELNASRLLVTIC  175



>ref|XP_001701267.1| hypothetical protein CHLREDRAFT_179139 [Chlamydomonas reinhardtii]
 gb|EDO97660.1| predicted protein [Chlamydomonas reinhardtii]
Length=695

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 44/109 (40%), Gaps = 6/109 (6%)
 Frame = -2

Query  775  GP-GISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEE  599
            GP   +FREYS+ DNP  P  VK   + V       EG    N+T    +L    N  ++
Sbjct  572  GPQNFTFREYSMLDNPRTPAAVKTGQVLVV-----PEGEAPGNTTGFVQVLSIKPNLKQD  626

Query  598  KFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCC  452
            +         D KVI+   +   F GF D+  +  F          WCC
Sbjct  627  ELAKALEPIHDAKVIRLRHVMKLFGGFDDQVLKASFEAFANAVTANWCC  675



>ref|XP_007509006.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20092.1| predicted protein [Bathycoccus prasinos]
Length=980

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 64/147 (44%), Gaps = 17/147 (12%)
 Frame = -2

Query  829  DHXFEVNV-MSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLS  653
            DH FE+   + R +P         FREYS+ +NP  P  VK    D     +  +   L 
Sbjct  830  DHIFELETWVRRNEP---------FREYSILENPRTPDGVKNGVFD---ATDKLKSIPLE  877

Query  652  NSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKR  473
            + T    +       + +K K +   F   K+++  S       F D   +  F N++  
Sbjct  878  DFTDVKVLQALDDVRSSDKHKVL--KFDGKKLMEKFS-EKKLDYFADANVKREFENKIIN  934

Query  472  YVGIWCCVENQTPGHVYYDMYWDEKPN  392
            Y  IWCC ++  PGH++YDM  D  P+
Sbjct  935  YCSIWCC-KHAHPGHIWYDMSLDVLPH  960



>gb|KDD76569.1| nucleotide-diphospho-sugar transferase [Helicosporidium sp. ATCC 
50920]
Length=662

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 69/150 (46%), Gaps = 15/150 (10%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            DH  ++      +P        +FREYS        + +  S L + +C+EG  GC   +
Sbjct  506  DHVMDLEAWHDRKPN-------TFREYSFLRKD-QAKGLLNSKLTLVVCQEGEAGCADGS  557

Query  649  STTAT--GILRF-PKNSTEEKFKTVFSLFKDVKVIQF-SSMHDAFQGFTDKAREHRFRNR  482
            +  A     +R  P+ +  +    V +  +  +++     +   FQ   D+ +E +  N 
Sbjct  558  APAAARNDTIRLQPRRTAAQVLTAVQAAAQGRQLVHVEGKIAQLFQLTQDELKEAK--NT  615

Query  481  VKRYVGIWCCVENQTPGHVYYDMYWDEKPN  392
             + +   +CCV N+ PGH++YD++WD  P+
Sbjct  616  WQDFTSHYCCV-NKNPGHIWYDLFWDVGPH  644



>ref|XP_011397704.1| hypothetical protein F751_1695 [Auxenochlorella protothecoides]
 gb|KFM24816.1| hypothetical protein F751_1695 [Auxenochlorella protothecoides]
Length=482

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 68/152 (45%), Gaps = 25/152 (16%)
 Frame = -2

Query  829  DHXFEVNVMSREQPEEEFGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSN  650
            D+  ++  M  E P+E       +RE+S  + P     +    + V    E    C+   
Sbjct  324  DYTMDLEWMDHEIPDE-------YREFSFLEKPEATPLLASRVVIVICQAEADADCEEGE  376

Query  649  STTAT---GILRFPKNSTEEKFKTVFS-LFKDVKVIQFSSMHDAFQGFTDKA-----REH  497
            +         +R   N    + +T  S L+K  K++ F       QG  +KA      E 
Sbjct  377  APAIPKEDDTVRLKPNRNLYQLRTALSHLYKSYKIVHF-------QGRMEKAIHLNPVET  429

Query  496  RFRN-RVKRYVGIWCCVENQTPGHVYYDMYWD  404
             F N R++ ++G +CCVE + PGH++YD++WD
Sbjct  430  AFYNERMRGWMGAFCCVE-EKPGHIFYDLFWD  460



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1793589148520