BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9835

Length=930
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788026.1|  PREDICTED: uncharacterized protein LOC104235895    305   1e-116   Nicotiana sylvestris
ref|XP_009615719.1|  PREDICTED: uncharacterized protein LOC104108400    305   2e-116   Nicotiana tomentosiformis
ref|XP_011075041.1|  PREDICTED: uncharacterized protein LOC105159627    307   2e-116   Sesamum indicum [beniseed]
gb|EPS68531.1|  hypothetical protein M569_06230                         307   1e-115   Genlisea aurea
emb|CDP14324.1|  unnamed protein product                                307   1e-115   Coffea canephora [robusta coffee]
ref|XP_009771625.1|  PREDICTED: uncharacterized protein LOC104222130    305   1e-115   Nicotiana sylvestris
ref|XP_009621585.1|  PREDICTED: uncharacterized protein LOC104113184    305   1e-115   Nicotiana tomentosiformis
gb|EYU20664.1|  hypothetical protein MIMGU_mgv1a002165mg                303   6e-115   Erythranthe guttata [common monkey flower]
ref|XP_004249304.1|  PREDICTED: uncharacterized protein LOC101268442    303   2e-114   Solanum lycopersicum
ref|XP_002525432.1|  casein kinase, putative                            305   2e-114   Ricinus communis
ref|XP_011078778.1|  PREDICTED: uncharacterized protein LOC105162459    303   2e-114   Sesamum indicum [beniseed]
ref|XP_004147533.1|  PREDICTED: uncharacterized protein LOC101221479    304   2e-114   Cucumis sativus [cucumbers]
ref|XP_008441978.1|  PREDICTED: uncharacterized protein LOC103485979    304   2e-114   Cucumis melo [Oriental melon]
ref|XP_002325416.1|  kinase family protein                              303   2e-114   
ref|XP_006351365.1|  PREDICTED: uncharacterized protein LOC102603072    303   3e-114   Solanum tuberosum [potatoes]
ref|XP_012070457.1|  PREDICTED: uncharacterized protein LOC105632633    301   1e-113   Jatropha curcas
ref|XP_006443418.1|  hypothetical protein CICLE_v10019090mg             304   3e-113   Citrus clementina [clementine]
ref|XP_007030718.1|  Kinase family protein                              300   3e-113   Theobroma cacao [chocolate]
ref|XP_006479104.1|  PREDICTED: uncharacterized protein LOC102619...    304   3e-113   Citrus sinensis [apfelsine]
ref|XP_011021493.1|  PREDICTED: uncharacterized protein LOC105123555    303   4e-113   Populus euphratica
ref|XP_006297091.1|  hypothetical protein CARUB_v10013094mg             297   5e-113   Capsella rubella
ref|XP_010485760.1|  PREDICTED: uncharacterized protein LOC104764...    296   6e-113   Camelina sativa [gold-of-pleasure]
ref|XP_002884421.1|  kinase family protein                              297   6e-113   Arabidopsis lyrata subsp. lyrata
gb|KHG04306.1|  Casein kinase I-like protein                            296   7e-113   Gossypium arboreum [tree cotton]
ref|XP_010463863.1|  PREDICTED: uncharacterized protein LOC104744499    296   9e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010516062.1|  PREDICTED: uncharacterized protein LOC104791...    296   9e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010036218.1|  PREDICTED: uncharacterized protein LOC104425268    299   9e-113   Eucalyptus grandis [rose gum]
ref|XP_006408240.1|  hypothetical protein EUTSA_v10020173mg             297   9e-113   Eutrema salsugineum [saltwater cress]
ref|XP_007204249.1|  hypothetical protein PRUPE_ppa002161mg             301   1e-112   Prunus persica
gb|KJB82579.1|  hypothetical protein B456_013G203000                    296   1e-112   Gossypium raimondii
gb|KJB82583.1|  hypothetical protein B456_013G203000                    296   1e-112   Gossypium raimondii
ref|NP_187044.1|  protein kinase family protein                         297   1e-112   Arabidopsis thaliana [mouse-ear cress]
emb|CDY42890.1|  BnaC05g47610D                                          296   1e-112   Brassica napus [oilseed rape]
gb|KHG17118.1|  Casein kinase I isoform delta                           296   2e-112   Gossypium arboreum [tree cotton]
gb|KDO55049.1|  hypothetical protein CISIN_1g005214mg                   302   2e-112   Citrus sinensis [apfelsine]
emb|CDY29971.1|  BnaC01g40370D                                          298   2e-112   Brassica napus [oilseed rape]
gb|AAM91528.1|  putative casein kinase                                  296   3e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130401.1|  PREDICTED: uncharacterized protein LOC103855200    295   3e-112   Brassica rapa
ref|XP_003548750.1|  PREDICTED: uncharacterized protein LOC100801...    300   3e-112   Glycine max [soybeans]
gb|KJB45108.1|  hypothetical protein B456_007G289500                    298   3e-112   Gossypium raimondii
ref|XP_010276388.1|  PREDICTED: uncharacterized protein LOC104611151    297   4e-112   
emb|CDY21155.1|  BnaA01g33860D                                          297   4e-112   Brassica napus [oilseed rape]
ref|XP_004288418.1|  PREDICTED: uncharacterized protein LOC101290807    298   4e-112   Fragaria vesca subsp. vesca
ref|XP_002281952.1|  PREDICTED: uncharacterized protein LOC100267624    298   6e-112   Vitis vinifera
ref|XP_010558720.1|  PREDICTED: uncharacterized protein LOC104827...    298   7e-112   
ref|XP_010558719.1|  PREDICTED: uncharacterized protein LOC104827...    298   7e-112   Tarenaya hassleriana [spider flower]
ref|XP_008240478.1|  PREDICTED: uncharacterized protein LOC103338977    300   9e-112   Prunus mume [ume]
gb|AAF00624.1|AC009540_1  unknown protein, 5' partial                   295   1e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010908708.1|  PREDICTED: uncharacterized protein LOC105035016    294   1e-111   Elaeis guineensis
emb|CBI29940.3|  unnamed protein product                                298   1e-111   Vitis vinifera
ref|XP_009102089.1|  PREDICTED: uncharacterized protein LOC103828226    295   2e-111   Brassica rapa
gb|KJB80965.1|  hypothetical protein B456_013G123300                    296   2e-111   Gossypium raimondii
gb|KHG27523.1|  hypothetical protein F383_15264                         297   2e-111   Gossypium arboreum [tree cotton]
gb|KJB80963.1|  hypothetical protein B456_013G123300                    296   2e-111   Gossypium raimondii
ref|XP_004493152.1|  PREDICTED: uncharacterized protein LOC101504...    298   2e-111   Cicer arietinum [garbanzo]
ref|XP_008805378.1|  PREDICTED: uncharacterized protein LOC103718369    293   2e-111   Phoenix dactylifera
ref|XP_003624626.1|  Casein kinase I isoform alpha                      298   3e-111   Medicago truncatula
ref|XP_009413883.1|  PREDICTED: uncharacterized protein LOC103995100    295   6e-111   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY50866.1|  BnaA05g37270D                                          291   6e-111   Brassica napus [oilseed rape]
ref|XP_010485763.1|  PREDICTED: uncharacterized protein LOC104764...    290   7e-111   Camelina sativa [gold-of-pleasure]
ref|XP_007161937.1|  hypothetical protein PHAVU_001G110300g             298   8e-111   Phaseolus vulgaris [French bean]
ref|XP_010516137.1|  PREDICTED: uncharacterized protein LOC104791...    290   8e-111   Camelina sativa [gold-of-pleasure]
ref|XP_010672054.1|  PREDICTED: uncharacterized protein LOC104888...    295   2e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006400366.1|  hypothetical protein EUTSA_v10012841mg             292   3e-110   Eutrema salsugineum [saltwater cress]
gb|AAO41895.1|  putative casein kinase                                  292   3e-110   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197320.1|  protein kinase                                        291   4e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492820.1|  PREDICTED: uncharacterized protein LOC104770147    291   5e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010424160.1|  PREDICTED: uncharacterized protein LOC104709208    290   1e-109   Camelina sativa [gold-of-pleasure]
ref|XP_009418950.1|  PREDICTED: uncharacterized protein LOC103999...    292   1e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010454044.1|  PREDICTED: uncharacterized protein LOC104735873    290   1e-109   Camelina sativa [gold-of-pleasure]
ref|XP_009418951.1|  PREDICTED: uncharacterized protein LOC103999...    292   1e-109   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB46016.1|  hypothetical protein B456_007G343500                    288   2e-109   Gossypium raimondii
emb|CDY38493.1|  BnaA10g16650D                                          291   2e-109   Brassica napus [oilseed rape]
emb|CDY25451.1|  BnaC09g39660D                                          291   3e-109   Brassica napus [oilseed rape]
dbj|BAJ93086.1|  predicted protein                                      288   4e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002873876.1|  kinase family protein                              289   5e-109   
ref|XP_009121003.1|  PREDICTED: uncharacterized protein LOC103845859    290   5e-109   Brassica rapa
ref|XP_010257690.1|  PREDICTED: uncharacterized protein LOC104597684    293   6e-109   Nelumbo nucifera [Indian lotus]
ref|NP_001051531.1|  Os03g0793500                                       290   7e-109   
dbj|BAN15568.1|  heading date 16                                        289   7e-109   Oryza sativa Japonica Group [Japonica rice]
gb|EAY92152.1|  hypothetical protein OsI_13865                          289   8e-109   Oryza sativa Indica Group [Indian rice]
ref|XP_006287189.1|  hypothetical protein CARUB_v10000361mg             290   9e-109   Capsella rubella
ref|XP_004955580.1|  PREDICTED: uncharacterized protein LOC101773...    285   1e-108   Setaria italica
ref|XP_004955583.1|  PREDICTED: uncharacterized protein LOC101773...    285   1e-108   Setaria italica
ref|XP_006657490.1|  PREDICTED: uncharacterized protein LOC102719500    290   1e-108   Oryza brachyantha
ref|XP_008655390.1|  PREDICTED: uncharacterized protein LOC100502...    290   1e-108   
ref|XP_010088042.1|  Casein kinase I isoform delta                      302   2e-108   
ref|NP_001058996.1|  Os07g0171300                                       290   2e-108   
ref|XP_003569928.1|  PREDICTED: uncharacterized protein LOC100845295    290   2e-108   Brachypodium distachyon [annual false brome]
ref|XP_006644782.1|  PREDICTED: uncharacterized protein LOC102714869    289   3e-108   Oryza brachyantha
gb|ABF99312.1|  protein kinase family protein, putative, expressed      288   3e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010228600.1|  PREDICTED: uncharacterized protein LOC100829940    288   3e-108   
dbj|BAJ90552.1|  predicted protein                                      290   4e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004970128.1|  PREDICTED: uncharacterized protein LOC101772174    289   4e-108   Setaria italica
ref|NP_001152463.1|  ATP binding protein                                285   4e-108   Zea mays [maize]
ref|XP_008651588.1|  PREDICTED: ATP binding protein isoform X1          285   4e-108   Zea mays [maize]
ref|XP_003557523.1|  PREDICTED: uncharacterized protein LOC100821235    286   4e-108   Brachypodium distachyon [annual false brome]
ref|XP_010672056.1|  PREDICTED: uncharacterized protein LOC104888...    287   5e-108   
ref|NP_001044393.1|  Os01g0772600                                       290   5e-108   
gb|ADE75678.1|  unknown                                                 284   5e-108   Picea sitchensis
emb|CDY51243.1|  BnaA03g06950D                                          287   8e-108   Brassica napus [oilseed rape]
gb|EMS51431.1|  Casein kinase I isoform beta                            281   9e-108   Triticum urartu
ref|XP_009132256.1|  PREDICTED: uncharacterized protein LOC103856881    287   9e-108   Brassica rapa
emb|CDX70801.1|  BnaC03g08850D                                          287   1e-107   
gb|EYU39997.1|  hypothetical protein MIMGU_mgv1a002328mg                280   2e-107   Erythranthe guttata [common monkey flower]
gb|EEC71557.1|  hypothetical protein OsI_03913                          290   2e-107   Oryza sativa Indica Group [Indian rice]
gb|ERN03898.1|  hypothetical protein AMTR_s00078p00181940               282   3e-107   Amborella trichopoda
ref|XP_006842223.2|  PREDICTED: casein kinase I isoform delta           281   8e-107   
ref|NP_001152101.1|  LOC100285738                                       284   1e-106   Zea mays [maize]
gb|ACN36158.1|  unknown                                                 284   1e-106   Zea mays [maize]
ref|XP_009366444.1|  PREDICTED: uncharacterized protein LOC103956210    299   2e-106   Pyrus x bretschneideri [bai li]
ref|XP_002466312.1|  hypothetical protein SORBIDRAFT_01g005460          283   5e-106   Sorghum bicolor [broomcorn]
emb|CDY02641.1|  BnaC02g07940D                                          283   2e-105   
emb|CDY53253.1|  BnaA02g04010D                                          283   5e-105   Brassica napus [oilseed rape]
gb|EMT21659.1|  Casein kinase I-RAG8-like protein                       275   5e-105   
ref|XP_009126244.1|  PREDICTED: uncharacterized protein LOC103851164    281   1e-104   Brassica rapa
ref|XP_008797930.1|  PREDICTED: uncharacterized protein LOC103712...    277   2e-104   Phoenix dactylifera
ref|XP_008797915.1|  PREDICTED: uncharacterized protein LOC103712...    277   2e-104   Phoenix dactylifera
ref|XP_008797939.1|  PREDICTED: uncharacterized protein LOC103712...    277   2e-104   Phoenix dactylifera
ref|XP_008797922.1|  PREDICTED: uncharacterized protein LOC103712...    277   2e-104   Phoenix dactylifera
ref|XP_004981469.1|  PREDICTED: uncharacterized protein LOC101783...    283   3e-104   
ref|XP_010936995.1|  PREDICTED: casein kinase I isoform gamma-1-l...    278   6e-104   
ref|XP_010936996.1|  PREDICTED: casein kinase I isoform gamma-1-l...    278   6e-104   
ref|XP_008787870.1|  PREDICTED: uncharacterized protein LOC103705792    275   2e-103   Phoenix dactylifera
ref|XP_006651899.1|  PREDICTED: uncharacterized protein LOC102717146    278   3e-103   Oryza brachyantha
ref|XP_010939945.1|  PREDICTED: uncharacterized protein LOC105058...    274   3e-103   
ref|XP_010939947.1|  PREDICTED: uncharacterized protein LOC105058...    274   4e-103   Elaeis guineensis
ref|XP_009382978.1|  PREDICTED: uncharacterized protein LOC103970784    276   4e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404157.1|  PREDICTED: uncharacterized protein LOC103987553    275   1e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010534909.1|  PREDICTED: serine/threonine-protein kinase S...    278   2e-102   Tarenaya hassleriana [spider flower]
ref|XP_010542444.1|  PREDICTED: serine/threonine-protein kinase S...    277   2e-102   Tarenaya hassleriana [spider flower]
ref|XP_001770883.1|  predicted protein                                  273   2e-102   
ref|XP_010552201.1|  PREDICTED: serine/threonine-protein kinase s...    281   2e-102   Tarenaya hassleriana [spider flower]
ref|XP_001764211.1|  predicted protein                                  273   2e-102   
ref|XP_010257513.1|  PREDICTED: uncharacterized protein LOC104597586    272   4e-102   Nelumbo nucifera [Indian lotus]
ref|XP_009413490.1|  PREDICTED: uncharacterized protein LOC103994778    275   4e-102   
ref|XP_009395056.1|  PREDICTED: uncharacterized protein LOC103980...    270   7e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010249770.1|  PREDICTED: uncharacterized protein LOC104592236    267   7e-102   Nelumbo nucifera [Indian lotus]
ref|XP_009395055.1|  PREDICTED: uncharacterized protein LOC103980...    270   7e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007024284.1|  Casein kinase I protein isoform 1                  274   8e-102   
ref|XP_010656334.1|  PREDICTED: uncharacterized protein LOC100254414    272   9e-102   Vitis vinifera
ref|XP_008445007.1|  PREDICTED: uncharacterized protein LOC103488176    269   9e-102   Cucumis melo [Oriental melon]
ref|XP_012076668.1|  PREDICTED: uncharacterized protein LOC105637...    275   9e-102   Jatropha curcas
ref|XP_012076669.1|  PREDICTED: uncharacterized protein LOC105637...    275   1e-101   Jatropha curcas
ref|XP_002960894.1|  hypothetical protein SELMODRAFT_139482             272   1e-101   
ref|XP_002967119.1|  hypothetical protein SELMODRAFT_144765             272   1e-101   
emb|CBI28086.3|  unnamed protein product                                272   1e-101   Vitis vinifera
gb|KJB82582.1|  hypothetical protein B456_013G203000                    258   2e-101   Gossypium raimondii
ref|XP_011649731.1|  PREDICTED: uncharacterized protein LOC101218249    268   2e-101   Cucumis sativus [cucumbers]
ref|XP_006445886.1|  hypothetical protein CICLE_v10014444mg             275   3e-101   Citrus clementina [clementine]
gb|KHF98002.1|  hypothetical protein F383_12939                         288   3e-101   Gossypium arboreum [tree cotton]
ref|XP_006407187.1|  hypothetical protein EUTSA_v10020172mg             275   6e-101   Eutrema salsugineum [saltwater cress]
ref|XP_008367866.1|  PREDICTED: casein kinase I                         269   6e-101   
ref|XP_009406168.1|  PREDICTED: uncharacterized protein LOC103989128    271   6e-101   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB56821.1|  hypothetical protein B456_009G137100                    272   6e-101   Gossypium raimondii
ref|XP_010249522.1|  PREDICTED: uncharacterized protein LOC104592...    270   6e-101   Nelumbo nucifera [Indian lotus]
gb|KHG14825.1|  hypothetical protein F383_08945                         271   7e-101   Gossypium arboreum [tree cotton]
gb|KHN24964.1|  Casein kinase I isoform alpha                           273   7e-101   Glycine soja [wild soybean]
ref|XP_010249521.1|  PREDICTED: uncharacterized protein LOC104592...    270   7e-101   Nelumbo nucifera [Indian lotus]
ref|XP_003552750.1|  PREDICTED: serine/threonine-protein kinase V...    273   9e-101   Glycine max [soybeans]
ref|XP_003532324.1|  PREDICTED: serine/threonine-protein kinase V...    273   1e-100   Glycine max [soybeans]
ref|XP_007139114.1|  hypothetical protein PHAVU_008G002500g             273   1e-100   Phaseolus vulgaris [French bean]
ref|XP_003536792.1|  PREDICTED: uncharacterized protein LOC100783819    275   1e-100   Glycine max [soybeans]
ref|XP_002882838.1|  kinase family protein                              273   1e-100   Arabidopsis lyrata subsp. lyrata
ref|XP_006297084.1|  hypothetical protein CARUB_v10013087mg             273   1e-100   Capsella rubella
ref|XP_010465212.1|  PREDICTED: uncharacterized protein LOC104745616    273   1e-100   Camelina sativa [gold-of-pleasure]
gb|KFK38714.1|  hypothetical protein AALP_AA3G150500                    273   1e-100   Arabis alpina [alpine rockcress]
gb|KHN27094.1|  Casein kinase I                                         275   2e-100   Glycine soja [wild soybean]
ref|XP_002272679.2|  PREDICTED: serine/threonine-protein kinase S...    267   2e-100   Vitis vinifera
ref|XP_010500960.1|  PREDICTED: uncharacterized protein LOC104778...    273   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010915404.1|  PREDICTED: uncharacterized protein LOC105040538    271   2e-100   Elaeis guineensis
ref|XP_002516524.1|  casein kinase, putative                            269   2e-100   
ref|XP_009367436.1|  PREDICTED: uncharacterized protein LOC103957076    266   2e-100   Pyrus x bretschneideri [bai li]
ref|XP_003556554.1|  PREDICTED: uncharacterized protein LOC100807373    275   2e-100   Glycine max [soybeans]
ref|XP_008352012.1|  PREDICTED: uncharacterized protein LOC103415457    270   2e-100   
ref|XP_010243375.1|  PREDICTED: uncharacterized protein LOC104587456    269   2e-100   Nelumbo nucifera [Indian lotus]
ref|XP_010487127.1|  PREDICTED: serine/threonine-protein kinase S...    273   2e-100   
ref|XP_009135319.1|  PREDICTED: uncharacterized protein LOC103859531    270   3e-100   Brassica rapa
ref|XP_006476018.1|  PREDICTED: uncharacterized protein LOC102627...    268   3e-100   Citrus sinensis [apfelsine]
ref|XP_006450715.1|  hypothetical protein CICLE_v10007635mg             268   3e-100   
emb|CDY51730.1|  BnaA01g37130D                                          273   3e-100   Brassica napus [oilseed rape]
gb|KDO79859.1|  hypothetical protein CISIN_1g005420mg                   268   3e-100   Citrus sinensis [apfelsine]
gb|KHN37292.1|  Casein kinase I                                         275   3e-100   Glycine soja [wild soybean]
ref|XP_009146466.1|  PREDICTED: uncharacterized protein LOC103870106    272   3e-100   Brassica rapa
emb|CDX75726.1|  BnaC03g38090D                                          272   3e-100   
ref|XP_011626734.1|  PREDICTED: uncharacterized protein LOC184434...    270   3e-100   Amborella trichopoda
ref|XP_010915613.1|  PREDICTED: uncharacterized protein LOC105040...    266   4e-100   
ref|XP_002283957.2|  PREDICTED: uncharacterized protein LOC100253221    271   4e-100   Vitis vinifera
ref|XP_006853659.1|  PREDICTED: uncharacterized protein LOC184434...    270   4e-100   Amborella trichopoda
gb|KJB21848.1|  hypothetical protein B456_004G018000                    272   4e-100   Gossypium raimondii
emb|CDX82524.1|  BnaA03g32970D                                          270   4e-100   
ref|XP_010915579.1|  PREDICTED: uncharacterized protein LOC105040...    266   4e-100   
ref|XP_010267169.1|  PREDICTED: uncharacterized protein LOC104604...    269   4e-100   Nelumbo nucifera [Indian lotus]
emb|CAN77676.1|  hypothetical protein VITISV_013722                     271   4e-100   Vitis vinifera
emb|CBI20566.3|  unnamed protein product                                266   4e-100   Vitis vinifera
ref|XP_008462429.1|  PREDICTED: uncharacterized protein LOC103500783    268   5e-100   Cucumis melo [Oriental melon]
emb|CDY55141.1|  BnaC01g44810D                                          272   5e-100   Brassica napus [oilseed rape]
ref|XP_010267167.1|  PREDICTED: uncharacterized protein LOC104604...    269   5e-100   
gb|KDO79864.1|  hypothetical protein CISIN_1g005420mg                   267   5e-100   Citrus sinensis [apfelsine]
emb|CDX97505.1|  BnaA05g25740D                                          271   5e-100   
ref|XP_008220112.1|  PREDICTED: uncharacterized protein LOC103320244    266   6e-100   Prunus mume [ume]
ref|NP_187977.1|  protein kinase family protein                         272   6e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002283346.1|  PREDICTED: uncharacterized protein LOC100263956    271   6e-100   Vitis vinifera
ref|XP_009787105.1|  PREDICTED: uncharacterized protein LOC104235125    266   6e-100   Nicotiana sylvestris
ref|XP_008791563.1|  PREDICTED: uncharacterized protein LOC103708420    269   7e-100   Phoenix dactylifera
ref|XP_008804602.1|  PREDICTED: uncharacterized protein LOC103717...    265   7e-100   Phoenix dactylifera
ref|XP_007225173.1|  hypothetical protein PRUPE_ppa002269mg             265   7e-100   Prunus persica
ref|XP_010500967.1|  PREDICTED: uncharacterized protein LOC104778...    271   7e-100   Camelina sativa [gold-of-pleasure]
ref|XP_008804601.1|  PREDICTED: uncharacterized protein LOC103717...    265   7e-100   Phoenix dactylifera
ref|XP_012077385.1|  PREDICTED: uncharacterized protein LOC105638219    266   7e-100   Jatropha curcas
ref|XP_009117581.1|  PREDICTED: uncharacterized protein LOC103842673    271   8e-100   Brassica rapa
ref|XP_011081763.1|  PREDICTED: uncharacterized protein LOC105164726    265   8e-100   Sesamum indicum [beniseed]
ref|XP_010047289.1|  PREDICTED: uncharacterized protein LOC104436263    268   8e-100   Eucalyptus grandis [rose gum]
emb|CAN69523.1|  hypothetical protein VITISV_040873                     270   8e-100   Vitis vinifera
ref|XP_008378069.1|  PREDICTED: uncharacterized protein LOC103441148    268   9e-100   
ref|XP_006849555.1|  PREDICTED: uncharacterized protein LOC18439325     273   9e-100   Amborella trichopoda
ref|XP_010924661.1|  PREDICTED: uncharacterized protein LOC105047...    266   9e-100   Elaeis guineensis
ref|XP_010668618.1|  PREDICTED: uncharacterized protein LOC104885660    267   1e-99    
ref|XP_010924659.1|  PREDICTED: uncharacterized protein LOC105047...    266   1e-99    Elaeis guineensis
ref|XP_010033842.1|  PREDICTED: uncharacterized protein LOC104423081    270   1e-99    
emb|CBI16476.3|  unnamed protein product                                270   1e-99    Vitis vinifera
emb|CBI36074.3|  unnamed protein product                                269   1e-99    Vitis vinifera
ref|XP_007014774.1|  Casein kinase I protein isoform 1                  272   2e-99    
gb|KJB54779.1|  hypothetical protein B456_009G048800                    263   2e-99    Gossypium raimondii
ref|XP_008804603.1|  PREDICTED: negative regulator of sexual conj...    264   2e-99    
ref|XP_009592153.1|  PREDICTED: uncharacterized protein LOC104089043    264   2e-99    Nicotiana tomentosiformis
gb|ADE76410.1|  unknown                                                 266   2e-99    Picea sitchensis
gb|KFK32550.1|  hypothetical protein AALP_AA6G257400                    270   2e-99    Arabis alpina [alpine rockcress]
emb|CDY23629.1|  BnaC05g39650D                                          270   2e-99    Brassica napus [oilseed rape]
ref|XP_004141661.1|  PREDICTED: uncharacterized protein LOC101213...    266   2e-99    Cucumis sativus [cucumbers]
ref|XP_010472590.1|  PREDICTED: uncharacterized protein LOC104752211    266   2e-99    
gb|KJB54778.1|  hypothetical protein B456_009G048800                    262   2e-99    Gossypium raimondii
ref|XP_011659678.1|  PREDICTED: uncharacterized protein LOC101213...    266   2e-99    Cucumis sativus [cucumbers]
emb|CDP08183.1|  unnamed protein product                                266   2e-99    Coffea canephora [robusta coffee]
ref|XP_006426889.1|  hypothetical protein CICLE_v10025028mg             266   2e-99    Citrus clementina [clementine]
ref|XP_009416478.1|  PREDICTED: uncharacterized protein LOC103997068    265   2e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006583050.1|  PREDICTED: uncharacterized protein LOC100800869    266   3e-99    Glycine max [soybeans]
ref|XP_003523751.1|  PREDICTED: uncharacterized protein LOC100779...    268   3e-99    Glycine max [soybeans]
ref|XP_010044967.1|  PREDICTED: uncharacterized protein LOC104433...    267   3e-99    Eucalyptus grandis [rose gum]
ref|XP_006465683.1|  PREDICTED: uncharacterized protein LOC102607770    266   3e-99    Citrus sinensis [apfelsine]
ref|XP_010044966.1|  PREDICTED: uncharacterized protein LOC104433...    266   3e-99    Eucalyptus grandis [rose gum]
ref|XP_003531651.1|  PREDICTED: uncharacterized protein LOC100799630    265   3e-99    Glycine max [soybeans]
ref|XP_004491691.1|  PREDICTED: serine/threonine-protein kinase V...    270   3e-99    Cicer arietinum [garbanzo]
ref|XP_004291170.1|  PREDICTED: uncharacterized protein LOC101299149    262   3e-99    Fragaria vesca subsp. vesca
ref|XP_007208054.1|  hypothetical protein PRUPE_ppa002206mg             269   3e-99    Prunus persica
gb|KHN39248.1|  Casein kinase I isoform delta-like                      266   4e-99    Glycine soja [wild soybean]
ref|XP_004294964.1|  PREDICTED: uncharacterized protein LOC101294343    269   4e-99    Fragaria vesca subsp. vesca
gb|KHG03332.1|  hypothetical protein F383_28165                         265   4e-99    Gossypium arboreum [tree cotton]
ref|XP_010472589.1|  PREDICTED: uncharacterized protein LOC104752210    266   4e-99    Camelina sativa [gold-of-pleasure]
ref|XP_003621013.1|  Casein kinase I isoform alpha                      270   4e-99    Medicago truncatula
ref|XP_010102418.1|  Casein kinase I-2-like protein                     267   4e-99    
gb|KJB21850.1|  hypothetical protein B456_004G018100                    269   4e-99    Gossypium raimondii
ref|XP_009776610.1|  PREDICTED: uncharacterized protein LOC104226336    264   4e-99    Nicotiana sylvestris
ref|XP_010417348.1|  PREDICTED: uncharacterized protein LOC104703...    265   5e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010925551.1|  PREDICTED: uncharacterized protein LOC105048062    266   5e-99    Elaeis guineensis
ref|XP_011006418.1|  PREDICTED: uncharacterized protein LOC105112417    268   6e-99    Populus euphratica
ref|XP_009587685.1|  PREDICTED: uncharacterized protein LOC104085378    264   7e-99    
ref|XP_008228435.1|  PREDICTED: uncharacterized protein LOC103327845    270   7e-99    Prunus mume [ume]
ref|XP_009375296.1|  PREDICTED: uncharacterized protein LOC103964127    269   7e-99    
gb|KHN18151.1|  Casein kinase I like 2                                  266   7e-99    Glycine soja [wild soybean]
ref|XP_010546534.1|  PREDICTED: uncharacterized protein LOC104818596    268   1e-98    Tarenaya hassleriana [spider flower]
ref|XP_008390151.1|  PREDICTED: uncharacterized protein LOC103452441    269   1e-98    
ref|XP_008810649.1|  PREDICTED: uncharacterized protein LOC103722...    264   1e-98    Phoenix dactylifera
ref|XP_008810650.1|  PREDICTED: uncharacterized protein LOC103722...    264   1e-98    Phoenix dactylifera
ref|XP_007024285.1|  Kinase family protein isoform 2                    265   1e-98    
ref|XP_004969923.1|  PREDICTED: uncharacterized protein LOC101760429    263   1e-98    
ref|XP_010429582.1|  PREDICTED: uncharacterized protein LOC104714043    265   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_009596024.1|  PREDICTED: uncharacterized protein LOC104092197    263   1e-98    Nicotiana tomentosiformis
ref|XP_004142151.1|  PREDICTED: uncharacterized protein LOC101213194    271   1e-98    Cucumis sativus [cucumbers]
ref|NP_001044224.1|  Os01g0744300                                       265   1e-98    
gb|KHN10182.1|  Casein kinase I like 2                                  266   1e-98    Glycine soja [wild soybean]
ref|XP_012093319.1|  PREDICTED: uncharacterized protein LOC105650959    273   1e-98    Jatropha curcas
ref|XP_006644695.1|  PREDICTED: casein kinase I homolog 1-like          265   1e-98    
ref|XP_010417347.1|  PREDICTED: uncharacterized protein LOC104703...    265   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_003526502.1|  PREDICTED: uncharacterized protein LOC100800...    265   1e-98    Glycine max [soybeans]
gb|EEC78673.1|  hypothetical protein OsI_18806                          267   2e-98    Oryza sativa Indica Group [Indian rice]
ref|XP_009801165.1|  PREDICTED: uncharacterized protein LOC104246947    263   2e-98    Nicotiana sylvestris
ref|NP_001054881.2|  Os05g0200500                                       267   2e-98    
gb|AAT44311.1|  putative casein kinase                                  267   2e-98    Oryza sativa Japonica Group [Japonica rice]
dbj|BAG92829.1|  unnamed protein product                                267   2e-98    
ref|XP_003523750.1|  PREDICTED: uncharacterized protein LOC100778...    267   2e-98    
emb|CDO97984.1|  unnamed protein product                                266   2e-98    
ref|XP_002309535.1|  kinase family protein                              265   2e-98    
ref|XP_008351086.1|  PREDICTED: uncharacterized protein LOC103414488    268   2e-98    
ref|XP_002979683.1|  hypothetical protein SELMODRAFT_177864             263   2e-98    
gb|EEC71464.1|  hypothetical protein OsI_03705                          265   2e-98    
ref|XP_002985391.1|  hypothetical protein SELMODRAFT_269002             263   2e-98    
ref|XP_004960930.1|  PREDICTED: uncharacterized protein LOC101765228    264   2e-98    
dbj|BAD87518.1|  putative serine/threonine protein kinase               265   2e-98    
emb|CDP13154.1|  unnamed protein product                                273   2e-98    
ref|XP_011092199.1|  PREDICTED: uncharacterized protein LOC105172435    259   2e-98    
ref|XP_009388687.1|  PREDICTED: casein kinase I isoform delta-like      266   2e-98    
ref|XP_002297651.2|  hypothetical protein POPTR_0001s04710g             267   2e-98    
ref|XP_011072424.1|  PREDICTED: serine/threonine-protein kinase S...    266   2e-98    
ref|XP_002531638.1|  casein kinase, putative                            271   2e-98    
ref|XP_011072423.1|  PREDICTED: serine/threonine-protein kinase S...    266   2e-98    
ref|XP_011037977.1|  PREDICTED: uncharacterized protein LOC105135003    267   3e-98    
gb|KJB07483.1|  hypothetical protein B456_001G026300                    265   3e-98    
ref|XP_007012164.1|  Casein kinase I protein                            262   3e-98    
ref|XP_010062521.1|  PREDICTED: uncharacterized protein LOC104449912    265   3e-98    
ref|XP_007217013.1|  hypothetical protein PRUPE_ppa002136mg             268   3e-98    
gb|KHG27580.1|  Casein kinase I                                         266   3e-98    
ref|XP_011025189.1|  PREDICTED: uncharacterized protein LOC105126132    267   3e-98    
gb|EEE55368.1|  hypothetical protein OsJ_03423                          264   3e-98    
gb|KJB07478.1|  hypothetical protein B456_001G026300                    265   3e-98    
ref|XP_006293796.1|  hypothetical protein CARUB_v10022778mg             266   4e-98    
ref|XP_006408871.1|  hypothetical protein EUTSA_v10001925mg             268   4e-98    
ref|XP_007013205.1|  Kinase family protein isoform 1                    266   4e-98    
ref|XP_004963353.1|  PREDICTED: probable casein kinase I homolog ...    265   4e-98    
gb|EYU29288.1|  hypothetical protein MIMGU_mgv1a002190mg                263   5e-98    
ref|XP_002324211.2|  hypothetical protein POPTR_0018s08230g             267   5e-98    
ref|XP_011458971.1|  PREDICTED: uncharacterized protein LOC101301711    264   5e-98    
ref|XP_010673525.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    267   5e-98    
ref|XP_008338507.1|  PREDICTED: uncharacterized protein LOC103401...    269   5e-98    
ref|XP_002440770.1|  hypothetical protein SORBIDRAFT_09g006270          263   5e-98    
ref|XP_009364099.1|  PREDICTED: uncharacterized protein LOC103954016    269   5e-98    
ref|XP_008338505.1|  PREDICTED: uncharacterized protein LOC103401...    269   5e-98    
gb|KHG22911.1|  Casein kinase I                                         263   6e-98    
ref|XP_011019588.1|  PREDICTED: uncharacterized protein LOC105122...    263   6e-98    
ref|XP_011019579.1|  PREDICTED: casein kinase I homolog 1-like is...    263   6e-98    
gb|KJB07481.1|  hypothetical protein B456_001G026300                    264   6e-98    
gb|EMT25395.1|  Casein kinase I-2-like protein                          261   6e-98    
ref|XP_002304015.1|  kinase family protein                              266   6e-98    
gb|EMS55588.1|  Casein kinase I-like protein 2                          270   8e-98    
ref|XP_003569789.1|  PREDICTED: serine/threonine-protein kinase VRK1    260   8e-98    
ref|XP_007135639.1|  hypothetical protein PHAVU_010G145900g             264   9e-98    
emb|CDM84047.1|  unnamed protein product                                260   9e-98    
ref|XP_007137240.1|  hypothetical protein PHAVU_009G111300g             261   1e-97    
ref|NP_001169571.1|  hypothetical protein                               262   1e-97    
ref|XP_010098134.1|  Casein kinase I-2-like protein                     261   1e-97    
ref|NP_180147.2|  protein kinase family protein                         266   1e-97    
gb|AES58679.2|  casein kinase I-like protein                            265   1e-97    
ref|NP_973532.1|  protein kinase family protein                         266   1e-97    
ref|XP_010526089.1|  PREDICTED: casein kinase I-like                    266   1e-97    
ref|XP_008655737.1|  PREDICTED: uncharacterized protein LOC103634938    260   2e-97    
gb|EMS66552.1|  Casein kinase I-like protein 2                          259   2e-97    
tpg|DAA54810.1|  TPA: hypothetical protein ZEAMMB73_098757              260   2e-97    
gb|AAC42254.1|  unknown protein                                         266   2e-97    
ref|XP_008338530.1|  PREDICTED: casein kinase I homolog 2-like          268   2e-97    
ref|XP_010093160.1|  Casein kinase I                                    270   2e-97    
ref|XP_004302863.1|  PREDICTED: uncharacterized protein LOC101305860    261   2e-97    
ref|XP_002455001.1|  hypothetical protein SORBIDRAFT_03g002790          260   2e-97    
ref|XP_008226475.1|  PREDICTED: protein kinase 3                        263   3e-97    
dbj|BAK02283.1|  predicted protein                                      261   3e-97    
ref|XP_012069093.1|  PREDICTED: uncharacterized protein LOC105631...    265   3e-97    
gb|KDP40868.1|  hypothetical protein JCGZ_24867                         265   3e-97    
ref|NP_001141429.1|  uncharacterized protein LOC100273539               260   3e-97    
tpg|DAA54809.1|  TPA: hypothetical protein ZEAMMB73_098757              260   3e-97    
gb|ADI78885.1|  casein kinase I                                         267   3e-97    
ref|XP_009117039.1|  PREDICTED: casein kinase I                         266   3e-97    
ref|XP_009336928.1|  PREDICTED: uncharacterized protein LOC103929445    261   3e-97    
ref|XP_008673563.1|  PREDICTED: uncharacterized protein LOC103649...    258   3e-97    
tpg|DAA52911.1|  TPA: hypothetical protein ZEAMMB73_402791              258   3e-97    
gb|KJB70401.1|  hypothetical protein B456_011G072100                    266   3e-97    
emb|CDX76739.1|  BnaC08g33250D                                          266   3e-97    
ref|XP_008673564.1|  PREDICTED: casein kinase I isoform X2              258   3e-97    
ref|XP_008392669.1|  PREDICTED: uncharacterized protein LOC103454855    266   3e-97    
emb|CDY21505.1|  BnaC03g26920D                                          267   3e-97    
gb|EMT06030.1|  Casein kinase I-2-like protein                          267   4e-97    
ref|XP_009349728.1|  PREDICTED: uncharacterized protein LOC103941...    266   4e-97    
ref|XP_012069094.1|  PREDICTED: uncharacterized protein LOC105631...    264   4e-97    
ref|XP_008672449.1|  PREDICTED: uncharacterized protein LOC100273...    259   4e-97    
ref|XP_004968538.1|  PREDICTED: casein kinase I-like                    261   4e-97    
gb|KJB27133.1|  hypothetical protein B456_004G279600                    258   5e-97    
emb|CDY11509.1|  BnaA09g40750D                                          266   5e-97    
ref|XP_009349729.1|  PREDICTED: uncharacterized protein LOC103941...    265   5e-97    
ref|XP_003568762.1|  PREDICTED: uncharacterized protein LOC100825718    259   5e-97    
gb|ACO87665.1|  protein kinase                                          269   5e-97    
dbj|BAJ99119.1|  predicted protein                                      266   7e-97    
ref|XP_002880706.1|  kinase family protein                              267   8e-97    
ref|XP_002515975.1|  casein kinase, putative                            265   8e-97    
gb|EMT27276.1|  Casein kinase I-2-like protein                          259   9e-97    
dbj|BAJ99167.1|  predicted protein                                      262   9e-97    
ref|XP_008794114.1|  PREDICTED: uncharacterized protein LOC103710237    261   9e-97    
gb|KJB82881.1|  hypothetical protein B456_013G219500                    258   1e-96    
ref|XP_008386593.1|  PREDICTED: uncharacterized protein LOC103449090    261   1e-96    
ref|XP_008242613.1|  PREDICTED: uncharacterized protein LOC103340922    260   1e-96    
ref|XP_007203777.1|  hypothetical protein PRUPE_ppa002378mg             259   1e-96    
gb|KEH36077.1|  casein kinase I-like protein                            258   2e-96    
gb|KHG18897.1|  Casein kinase I                                         267   2e-96    
ref|XP_003577056.1|  PREDICTED: uncharacterized protein LOC100836999    267   2e-96    
dbj|BAJ94407.1|  predicted protein                                      263   2e-96    
emb|CDM82151.1|  unnamed protein product                                263   2e-96    
ref|XP_002882289.1|  hypothetical protein ARALYDRAFT_340491             251   4e-96    
gb|EMS55265.1|  Casein kinase I isoform alpha                           250   4e-96    
gb|EMT06466.1|  Casein kinase I isoform alpha                           250   4e-96    
ref|XP_004517304.1|  PREDICTED: uncharacterized protein LOC101495334    265   6e-96    
ref|XP_007014775.1|  Kinase family protein isoform 2                    269   6e-96    
ref|XP_004510300.1|  PREDICTED: uncharacterized protein LOC101511720    264   7e-96    
gb|KDO50862.1|  hypothetical protein CISIN_1g005947mg                   261   7e-96    
ref|XP_009347165.1|  PREDICTED: uncharacterized protein LOC103938...    256   7e-96    
ref|XP_009347166.1|  PREDICTED: uncharacterized protein LOC103938...    256   8e-96    
gb|EYU21509.1|  hypothetical protein MIMGU_mgv1a002137mg                259   8e-96    
ref|XP_006451129.1|  hypothetical protein CICLE_v10007666mg             261   9e-96    
ref|XP_011003700.1|  PREDICTED: uncharacterized protein LOC105110375    263   9e-96    
ref|XP_004253105.1|  PREDICTED: uncharacterized protein LOC101244359    263   1e-95    
ref|XP_002514324.1|  casein kinase, putative                            253   1e-95    
ref|XP_006342517.1|  PREDICTED: uncharacterized protein LOC102599332    262   2e-95    
ref|XP_006354169.1|  PREDICTED: casein kinase I isoform gamma-3-like    259   2e-95    
ref|XP_004228598.1|  PREDICTED: casein kinase I isoform gamma-3         259   2e-95    
ref|XP_009353558.1|  PREDICTED: uncharacterized protein LOC103944824    259   3e-95    
ref|XP_004251171.2|  PREDICTED: uncharacterized protein LOC101245026    258   4e-95    
ref|XP_006340257.1|  PREDICTED: uncharacterized protein LOC102583902    258   4e-95    
ref|XP_003592802.1|  Casein kinase-like protein                         267   5e-95    
ref|XP_008337442.1|  PREDICTED: uncharacterized protein LOC103400...    254   6e-95    
ref|XP_008337441.1|  PREDICTED: uncharacterized protein LOC103400...    253   6e-95    
ref|XP_004252842.1|  PREDICTED: casein kinase I-like                    257   6e-95    
ref|NP_001183608.1|  uncharacterized protein LOC100502202               290   7e-95    
ref|XP_006643875.1|  PREDICTED: casein kinase I homolog 2-like          259   8e-95    
gb|KJB54170.1|  hypothetical protein B456_009G024100                    246   1e-94    
ref|XP_007013209.1|  Kinase family protein isoform 5                    264   1e-94    
ref|XP_008380865.1|  PREDICTED: uncharacterized protein LOC103443751    259   2e-94    
ref|XP_005850218.1|  hypothetical protein CHLNCDRAFT_34546              256   2e-94    
ref|XP_007161527.1|  hypothetical protein PHAVU_001G076900g             258   2e-94    
ref|XP_002298239.1|  hypothetical protein POPTR_0001s18990g             261   4e-94    
gb|EEC70115.1|  hypothetical protein OsI_00774                          258   5e-94    
ref|XP_004497365.1|  PREDICTED: casein kinase I isoform delta-like      263   5e-94    
ref|NP_001042306.1|  Os01g0198200                                       258   6e-94    
gb|EEE54054.1|  hypothetical protein OsJ_00747                          258   6e-94    
dbj|BAD73223.1|  putative serine/threonine protein kinase               258   6e-94    
gb|KJB54173.1|  hypothetical protein B456_009G024100                    243   8e-94    
ref|XP_003057011.1|  Serine/Threonine protein kinase                    259   9e-94    
dbj|BAD73224.1|  putative serine/threonine protein kinase               257   9e-94    
gb|EMS54400.1|  Casein kinase I-like protein 2                          249   1e-93    
ref|XP_003565003.1|  PREDICTED: uncharacterized protein LOC100839189    264   1e-93    
gb|KJB46017.1|  hypothetical protein B456_007G343500                    233   5e-93    
ref|XP_002954481.1|  hypothetical protein VOLCADRAFT_76324              255   7e-93    
ref|XP_001701465.1|  MUT9-related serine/threonine protein kinase       255   8e-93    
gb|EPS63371.1|  hypothetical protein M569_11412                         251   1e-92    
ref|XP_002303307.2|  hypothetical protein POPTR_0003s04820g             257   1e-92    
ref|XP_003588428.1|  Casein kinase I isoform alpha                      246   4e-92    
gb|EMT12651.1|  Casein kinase I-2-like protein                          232   5e-92    
ref|XP_002502422.1|  predicted protein                                  254   5e-92    
ref|XP_005649643.1|  MUT9-related serine/threonine protein kinase       252   2e-91    
ref|XP_008655344.1|  PREDICTED: hypothetical protein isoform X2         249   3e-91    
ref|XP_009625624.1|  PREDICTED: casein kinase I isoform gamma-3-like    246   3e-91    
ref|XP_009781261.1|  PREDICTED: casein kinase I isoform gamma-3         246   3e-91    
ref|XP_008655345.1|  PREDICTED: hypothetical protein isoform X3         249   3e-91    
ref|XP_011013374.1|  PREDICTED: uncharacterized protein LOC105117...    255   7e-91    
ref|XP_011013373.1|  PREDICTED: uncharacterized protein LOC105117...    255   7e-91    
ref|XP_011013372.1|  PREDICTED: uncharacterized protein LOC105117...    255   1e-90    
ref|XP_001416335.1|  predicted protein                                  248   1e-90    
ref|XP_011013369.1|  PREDICTED: uncharacterized protein LOC105117...    255   1e-90    
ref|XP_003075213.1|  protein kinase family protein (ISS)                250   2e-90    
ref|NP_187043.1|  protein kinase-related protein                        246   2e-90    
emb|CEG01140.1|  Serine/threonine-protein kinase, active site           249   3e-90    
ref|XP_002884419.1|  hypothetical protein ARALYDRAFT_340552             250   7e-90    
ref|XP_010915572.1|  PREDICTED: uncharacterized protein LOC105040...    231   8e-90    
ref|XP_010915554.1|  PREDICTED: uncharacterized protein LOC105040...    231   9e-90    
ref|XP_010915562.1|  PREDICTED: uncharacterized protein LOC105040...    231   9e-90    
emb|CAN74986.1|  hypothetical protein VITISV_008771                     230   9e-90    
ref|XP_010915546.1|  PREDICTED: uncharacterized protein LOC105040...    231   1e-89    
ref|XP_007014776.1|  Kinase family protein isoform 3                    237   5e-89    
ref|XP_010088832.1|  Casein kinase I isoform alpha                      238   8e-89    
ref|XP_004963352.1|  PREDICTED: probable casein kinase I homolog ...    231   9e-88    
ref|XP_007514232.1|  predicted protein                                  244   9e-88    
ref|XP_008655343.1|  PREDICTED: hypothetical protein isoform X1         236   3e-87    
gb|KJB07477.1|  hypothetical protein B456_001G026300                    228   3e-87    
gb|AET01488.2|  casein kinase I-like protein                            232   4e-87    
gb|ABR25333.1|  protein kinase family protein                           269   5e-87    
gb|ADE77861.1|  unknown                                                 270   7e-87    
ref|XP_003627012.1|  Casein kinase-like protein                         231   7e-87    
gb|KJB54177.1|  hypothetical protein B456_009G024100                    213   7e-85    
ref|XP_002443446.1|  hypothetical protein SORBIDRAFT_08g019600          224   8e-85    
tpg|DAA56574.1|  TPA: hypothetical protein ZEAMMB73_926529              213   3e-84    
emb|CCW03272.1|  similar to Casein kinase I                             230   4e-84    
ref|XP_011396021.1|  Casein kinase I isoform delta-like protein         231   5e-84    
ref|XP_010690200.1|  PREDICTED: casein kinase I isoform gamma-2-like    240   8e-84    
tpg|DAA54811.1|  TPA: hypothetical protein ZEAMMB73_098757              259   1e-82    
ref|XP_004309533.2|  PREDICTED: casein kinase I isoform delta-A-like    236   2e-82    
gb|AFW85111.1|  hypothetical protein ZEAMMB73_338907                    216   3e-81    
gb|EPS62497.1|  hypothetical protein M569_12290                         219   6e-81    
gb|KDD72198.1|  hypothetical protein H632_c3713p0                       226   7e-81    
ref|XP_010229461.1|  PREDICTED: casein kinase I isoform alpha-like      218   7e-81    
ref|XP_006299519.1|  hypothetical protein CARUB_v10015691mg             229   3e-80    
gb|KFK37829.1|  hypothetical protein AALP_AA3G034600                    217   4e-79    
gb|KDD76924.1|  hypothetical protein H632_c65p1                         234   4e-77    
ref|XP_011400089.1|  Casein kinase I-like protein 2                     211   8e-76    
ref|XP_002958584.1|  histone kinase                                     215   3e-75    
ref|XP_001695320.1|  serine/threonine protein kinase, transcripti...    214   4e-75    
gb|KHG22741.1|  Casein kinase I isoform delta                           246   2e-72    
gb|AEO89321.1|  serine/threonine protein kinase                         200   3e-72    
gb|EMS61861.1|  Casein kinase I isoform delta-like protein              193   3e-71    
ref|XP_004245392.1|  PREDICTED: uncharacterized protein LOC101249392    213   3e-71    
ref|XP_005850945.1|  hypothetical protein CHLNCDRAFT_140695             234   8e-70    
ref|XP_006574072.1|  PREDICTED: LOW QUALITY PROTEIN: casein kinas...    203   6e-64    
ref|XP_010103948.1|  hypothetical protein L484_020200                   170   9e-64    
gb|KJB82581.1|  hypothetical protein B456_013G203000                    139   2e-63    
tpg|DAA35739.1|  TPA: putative homeodomain-like transcription fac...    223   1e-62    
ref|XP_010090279.1|  hypothetical protein L484_001310                   174   8e-62    
gb|AAP80674.1|  casein kinase-like protein                              203   1e-61    
gb|EMT25758.1|  Casein kinase I isoform delta-like protein              193   1e-60    
ref|XP_005648473.1|  kinase-like protein                                182   2e-60    
ref|XP_010109262.1|  hypothetical protein L484_014856                   160   2e-59    
ref|XP_008452134.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    200   2e-59    
gb|KJB54174.1|  hypothetical protein B456_009G024100                    129   1e-58    
gb|KCW87101.1|  hypothetical protein EUGRSUZ_B03631                     130   2e-58    
gb|EYU34156.1|  hypothetical protein MIMGU_mgv1a003255mg                168   1e-57    
gb|AIS72786.1|  casein kinase-like protein                              192   1e-57    
gb|KJB21849.1|  hypothetical protein B456_004G018000                    130   2e-57    



>ref|XP_009788026.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788027.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788028.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788029.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
Length=708

 Score =   305 bits (782),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 156/160 (98%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRR
Sbjct  609  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRR  668

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  669  KMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score =   142 bits (359),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 65/68 (96%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RLQQHV+KGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLS+VF
Sbjct  481  PMKQRYHYNVADSRLQQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSAVF  540

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  541  LHKDWIME  548


 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV +L   FL+  + I
Sbjct  488  YNVADSRLQQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSAVFLH-KDWI  546

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  273  ASI  265
             S+
Sbjct  604  TSM  606



>ref|XP_009615719.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615725.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615727.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615731.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
Length=708

 Score =   305 bits (782),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 156/160 (98%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRR
Sbjct  609  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRR  668

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  669  KMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score =   142 bits (359),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 65/68 (96%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RLQQHV+KGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLS+VF
Sbjct  481  PMKQRYHYNVADSRLQQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSAVF  540

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  541  LHKDWIME  548


 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV +L   FL+  + I
Sbjct  488  YNVADSRLQQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSAVFLH-KDWI  546

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  273  ASI  265
             S+
Sbjct  604  TSM  606



>ref|XP_011075041.1| PREDICTED: uncharacterized protein LOC105159627 [Sesamum indicum]
Length=705

 Score =   307 bits (787),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  546  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  605

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR
Sbjct  606  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  665

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  666  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705


 Score =   140 bits (353),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHVEKGNEDGLYISCVASAANLWALIMDAGTGF+SQVY+LS+VF
Sbjct  478  PMKQRYHYNVADSRLRQHVEKGNEDGLYISCVASAANLWALIMDAGTGFTSQVYELSAVF  537

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  538  LHKDWIME  545



>gb|EPS68531.1| hypothetical protein M569_06230 [Genlisea aurea]
Length=704

 Score =   307 bits (787),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/160 (98%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  545  QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  604

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAF+LSIPRR
Sbjct  605  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFVLSIPRR  664

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  665  KMMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  704


 Score =   138 bits (347),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHVEKGNEDGLYISCVASAA+LWALIMDAGTGF+SQVY+LS+VF
Sbjct  477  PMKQRYHYNVADSRLRQHVEKGNEDGLYISCVASAASLWALIMDAGTGFTSQVYELSAVF  536

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  537  LHKDWIME  544



>emb|CDP14324.1| unnamed protein product [Coffea canephora]
Length=709

 Score =   307 bits (787),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 158/160 (99%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  550  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  609

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR
Sbjct  610  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  669

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  670  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709


 Score =   137 bits (346),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KGNEDGLYISCVASA NLWALIMDAGTGFSSQVY+LS+VF
Sbjct  482  PMKQRYHYNVADSRLRQHVDKGNEDGLYISCVASATNLWALIMDAGTGFSSQVYELSAVF  541

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  542  LHKDWIME  549


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 68/122 (56%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  489  YNVADSRLRQHVDKGNEDGLYISCVASATNLWALIMDAGTGFSSQVYELSAVFLHKDWIM  548

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  549  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  605

Query  270  SI  265
            S+
Sbjct  606  SM  607



>ref|XP_009771625.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771626.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771627.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
Length=714

 Score =   305 bits (782),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 156/160 (98%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  555  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  614

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRR
Sbjct  615  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRR  674

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  675  KMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  714


 Score =   139 bits (351),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KGNEDGLYISCVASAANLWALIMDAGTGFSSQVY+LS+VF
Sbjct  487  PMKQRYHYNVADSRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAVF  546

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  547  LHKDWIME  554


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  494  YNVADSRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAVFLH-KDWI  552

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  553  MEQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  609

Query  273  ASI  265
             S+
Sbjct  610  TSM  612



>ref|XP_009621585.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621586.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621587.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
Length=714

 Score =   305 bits (782),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 156/160 (98%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  555  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  614

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRR
Sbjct  615  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRR  674

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  675  KMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  714


 Score =   139 bits (351),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KGNEDGLYISCVASAANLWALIMDAGTGFSSQVY+LS+VF
Sbjct  487  PMKQRYHYNVADSRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAVF  546

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  547  LHKDWIME  554


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  494  YNVADSRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAVFLH-KDWI  552

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  553  MEQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  609

Query  273  ASI  265
             S+
Sbjct  610  TSM  612



>gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Erythranthe guttata]
Length=706

 Score =   303 bits (775),  Expect(2) = 6e-115, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLV+MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWEKNYYISSIAGAANGSSLVIMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  606

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRIT+MAATADQ AFILSIPRR
Sbjct  607  AGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITAMAATADQGAFILSIPRR  666

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  667  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  706


 Score =   140 bits (352),  Expect(2) = 6e-115, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHVEKGNEDGLYISCVASA+NLWALIMDAGTGFSSQVY+LS+VF
Sbjct  479  PMKQRYHYNVADSRLRQHVEKGNEDGLYISCVASASNLWALIMDAGTGFSSQVYELSAVF  538

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  539  LHKDWIME  546


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V++S   + + K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  486  YNVADSRLRQHVEKGNEDGLYISCVASASNLWALIMDAGTGFSSQVYELSAVFLHKDWIM  545

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  546  EQWEKNYYISSIAGAANGSSLVI---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  602

Query  270  SI  265
            S+
Sbjct  603  SM  604



>ref|XP_004249304.1| PREDICTED: uncharacterized protein LOC101268442 [Solanum lycopersicum]
Length=709

 Score =   303 bits (777),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 155/160 (97%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  550  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  609

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAGY+EQVVELDFLYPSEGIHRRWE G+RITSMAATADQAAFILSIPRR
Sbjct  610  AGSRWGVVMSRNAGYAEQVVELDFLYPSEGIHRRWEGGFRITSMAATADQAAFILSIPRR  669

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  670  KMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709


 Score =   138 bits (347),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KGNEDGLYISCVASAANLWALIMDAGTGFSSQVY+LS+ F
Sbjct  482  PMKQRYHYNVADTRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAAF  541

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  542  LHKDWIME  549


 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V+++   + ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  489  YNVADTRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAAFLH-KDWI  547

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  548  MEQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  604

Query  273  ASI  265
             S+
Sbjct  605  TSM  607



>ref|XP_002525432.1| casein kinase, putative [Ricinus communis]
 gb|EEF36922.1| casein kinase, putative [Ricinus communis]
Length=705

 Score =   305 bits (780),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 155/160 (97%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYISSIAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  546  QWEKNFYISSIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  605

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+R
Sbjct  606  AGNRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKR  665

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  666  KMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705


 Score =   137 bits (344),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KGNEDGLYISCVASA NLWALIMDAGTGF+SQVY+LS+VF
Sbjct  478  PMKQRYHYNVADARLRQHVDKGNEDGLYISCVASATNLWALIMDAGTGFTSQVYELSAVF  537

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  538  LHKDWIME  545



>ref|XP_011078778.1| PREDICTED: uncharacterized protein LOC105162459 [Sesamum indicum]
Length=705

 Score =   303 bits (776),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 155/160 (97%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  546  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  605

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITSMAAT DQAAFILSIPRR
Sbjct  606  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATGDQAAFILSIPRR  665

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  666  KMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705


 Score =   138 bits (347),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGLYISCVASAANLWALIMDAGTGF+SQVY+LS+VF
Sbjct  478  PMKQRYHYNVADSRLCQHVEKGNEDGLYISCVASAANLWALIMDAGTGFNSQVYELSAVF  537

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  538  LHKDWIME  545



>ref|XP_004147533.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus]
 ref|XP_011653470.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus]
 gb|KGN53942.1| Casein kinase [Cucumis sativus]
Length=708

 Score =   304 bits (778),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 155/160 (97%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRIT MAATADQAAFILSIP+R
Sbjct  609  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITCMAATADQAAFILSIPKR  668

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  669  KLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score =   137 bits (345),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QH+EKGNEDGL ISCVASA+NLWALIMDAGTGFSSQVY+LSSVF
Sbjct  481  PMKQRYHYNVADSRLRQHIEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVF  540

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  541  LHKDWIME  548


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V++S   + I K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADSRLRQHIEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVFLH-KDWI  546

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  + I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNFYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  273  ASI  265
             S+
Sbjct  604  TSM  606



>ref|XP_008441978.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
 ref|XP_008441979.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
Length=708

 Score =   304 bits (778),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 155/160 (97%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRIT MAATADQAAFILSIP+R
Sbjct  609  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITCMAATADQAAFILSIPKR  668

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  669  KLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score =   137 bits (345),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QH+EKGNEDGL ISCVASA+NLWALIMDAGTGFSSQVY+LSSVF
Sbjct  481  PMKQRYHYNVADSRLRQHIEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVF  540

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  541  LHKDWIME  548


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V++S   + I K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADSRLRQHIEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVFLH-KDWI  546

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  + I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNFYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  273  ASI  265
             S+
Sbjct  604  TSM  606



>ref|XP_002325416.1| kinase family protein [Populus trichocarpa]
 gb|EEE99797.1| kinase family protein [Populus trichocarpa]
Length=720

 Score =   303 bits (776),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  561  QWEKNYYISSIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  620

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESG+RITSMAATADQAAFILSIP+R
Sbjct  621  AGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGFRITSMAATADQAAFILSIPKR  680

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  681  KMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  720


 Score =   138 bits (347),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHVEKGNEDGLYISCVAS+ NLWALIMDAGTGF+SQVY+LS+VF
Sbjct  493  PMKQRYHYNVADSRLRQHVEKGNEDGLYISCVASSTNLWALIMDAGTGFTSQVYELSTVF  552

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  553  LHKDWIME  560



>ref|XP_006351365.1| PREDICTED: uncharacterized protein LOC102603072 [Solanum tuberosum]
Length=709

 Score =   303 bits (775),  Expect(2) = 3e-114, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  550  QWEKNYYISSIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  609

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRNAGY+EQVVELDFLYPSEGIHRRWE G+RITSMAATADQAAFILSIPRR
Sbjct  610  AGNRWGVVMSRNAGYAEQVVELDFLYPSEGIHRRWEGGFRITSMAATADQAAFILSIPRR  669

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  670  KMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709


 Score =   138 bits (347),  Expect(2) = 3e-114, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KGNEDGLYISCVASAANLWALIMDAGTGFSSQVY+LS+ F
Sbjct  482  PMKQRYHYNVADTRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAAF  541

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  542  LHKDWIME  549


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V+++   + ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  489  YNVADTRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAAFLH-KDWI  547

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  548  MEQWEKNYYISSIAGATNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  604

Query  273  ASI  265
             S+
Sbjct  605  TSM  607



>ref|XP_012070457.1| PREDICTED: uncharacterized protein LOC105632633 [Jatropha curcas]
 gb|KDP39706.1| hypothetical protein JCGZ_02726 [Jatropha curcas]
Length=705

 Score =   301 bits (772),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA+NGSSLVVMSKGTP+TQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  546  QWEKNYYISSIAGASNGSSLVVMSKGTPFTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  605

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+R
Sbjct  606  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKR  665

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  666  KMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705


 Score =   137 bits (344),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KGNEDGLYISCVASA NLWALIMDAGTGF+SQVY+LS+VF
Sbjct  478  PMKQRYHYNVADARLRQHVDKGNEDGLYISCVASATNLWALIMDAGTGFTSQVYELSAVF  537

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  538  LHKDWIME  545



>ref|XP_006443418.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 ref|XP_006479105.1| PREDICTED: uncharacterized protein LOC102619111 isoform X2 [Citrus 
sinensis]
 gb|ESR56658.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 gb|KDO55047.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=704

 Score =   304 bits (778),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  545  QWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  604

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRR
Sbjct  605  AGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRR  664

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  665  KMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  704


 Score =   133 bits (335),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV+D RL+QHV+KGNEDGLYISCVASA+NLWALIMDAGTGF+ QVY+LS++F
Sbjct  477  PMKQRYHYNVSDARLRQHVDKGNEDGLYISCVASASNLWALIMDAGTGFTHQVYELSAIF  536

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  537  LHKDWIME  544



>ref|XP_007030718.1| Kinase family protein [Theobroma cacao]
 gb|EOY11220.1| Kinase family protein [Theobroma cacao]
Length=705

 Score =   300 bits (769),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA N SSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  546  QWEKNYYISSIAGANNASSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  605

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+R
Sbjct  606  AGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKR  665

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  666  KMMDETQETLRTSAFPSAHVKEKWAKNLYIASICYGRTVC  705


 Score =   136 bits (343),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QH++KGNEDGL+ISCVASAANLWALIMDAGTGF+ QVYDLS+VF
Sbjct  478  PMKQRYHYNVADSRLRQHIDKGNEDGLFISCVASAANLWALIMDAGTGFTCQVYDLSTVF  537

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  538  LHKDWIME  545



>ref|XP_006479104.1| PREDICTED: uncharacterized protein LOC102619111 isoform X1 [Citrus 
sinensis]
 gb|KDO55048.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=708

 Score =   304 bits (778),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRR
Sbjct  609  AGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRR  668

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  669  KMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score =   133 bits (334),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV+D RL+QHV+KGNEDGLYISCVASA+NLWALIMDAGTGF+ QVY+LS++F
Sbjct  481  PMKQRYHYNVSDARLRQHVDKGNEDGLYISCVASASNLWALIMDAGTGFTHQVYELSAIF  540

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  541  LHKDWIME  548



>ref|XP_011021493.1| PREDICTED: uncharacterized protein LOC105123555 [Populus euphratica]
Length=707

 Score =   303 bits (776),  Expect(2) = 4e-113, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  548  QWEKNYYISSIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  607

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESG+RITSMAATADQAAFILSIP+R
Sbjct  608  AGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGFRITSMAATADQAAFILSIPKR  667

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  668  KMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  707


 Score =   134 bits (336),  Expect(2) = 4e-113, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KGNEDGLYISCVAS+ NLWALIMDAGTGF+SQVY+LS+ F
Sbjct  480  PMKQRYHYNVADARLRQHVDKGNEDGLYISCVASSTNLWALIMDAGTGFTSQVYELSAFF  539

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  540  LHKDWIME  547



>ref|XP_006297091.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
 gb|EOA29989.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
Length=701

 Score =   297 bits (761),  Expect(2) = 5e-113, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  542  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  601

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+R
Sbjct  602  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKR  661

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  662  KITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701


 Score =   139 bits (350),  Expect(2) = 5e-113, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL+ISCVASAANLWA+IMDAGTGFSSQVY+LSSVF
Sbjct  474  PMKQRYHYNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVF  533

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  534  LHKDWIME  541


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  539

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  540  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  596

Query  273  ASI  265
             S+
Sbjct  597  TSM  599



>ref|XP_010485760.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485761.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485762.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
Length=701

 Score =   296 bits (759),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  542  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  601

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITSMAATADQAA ILSIP+R
Sbjct  602  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATADQAALILSIPKR  661

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  662  KITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701


 Score =   139 bits (351),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL+ISCVASAANLWA+IMDAGTGFSSQVY+LSSVF
Sbjct  474  PMKQRYHYNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVF  533

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  534  LHKDWIME  541


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  539

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  540  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  596

Query  273  ASI  265
             S+
Sbjct  597  TSM  599



>ref|XP_002884421.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60680.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=702

 Score =   297 bits (760),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  543  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  602

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+R
Sbjct  603  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKR  662

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  663  KITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  702


 Score =   139 bits (349),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL+ISCVASAANLWA+IMDAGTGFSSQVY+LSSVF
Sbjct  475  PMKQRYHYNVADSRLAQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVF  534

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  535  LHKDWIME  542


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  482  YNVADSRLAQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLHKDWIM  541

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  542  EQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  598

Query  270  SI  265
            S+
Sbjct  599  SM  600



>gb|KHG04306.1| Casein kinase I-like protein [Gossypium arboreum]
Length=706

 Score =   296 bits (758),  Expect(2) = 7e-113, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYK+SESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWEKNYYISSIAGATNGSSLVVMSKGTPYTQQSYKLSESFPFKWINKKWKEGFHVTSMTT  606

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGS WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAF+LSIP+R
Sbjct  607  AGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFVLSIPKR  666

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRTSAFPSTHVKEKW+KNLY+AS+CYGRTVC
Sbjct  667  KMMDETQETLRTSAFPSTHVKEKWAKNLYLASVCYGRTVC  706


 Score =   140 bits (352),  Expect(2) = 7e-113, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHVEKGNEDGL+ISCVASAANLWALIMDAGTGFSSQVY+LS+VF
Sbjct  479  PMKQRYHYNVADSRLRQHVEKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVF  538

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  539  LHKDWIME  546


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/130 (25%), Positives = 68/130 (52%), Gaps = 10/130 (8%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  486  YNVADSRLRQHVEKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  545

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  546  EQWEKNYYISSIAGATNGSSLVV---MSKGTPYTQQSYKLSESFPFKWINKKWKEGFHVT  602

Query  270  SI-----CYG  256
            S+     C+G
Sbjct  603  SMTTAGSCWG  612



>ref|XP_010463863.1| PREDICTED: uncharacterized protein LOC104744499 [Camelina sativa]
Length=701

 Score =   296 bits (758),  Expect(2) = 9e-113, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  542  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  601

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITSMAATADQAA ILSIP+R
Sbjct  602  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATADQAALILSIPKR  661

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  662  KITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701


 Score =   139 bits (350),  Expect(2) = 9e-113, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL+ISCVASAANLWA+IMDAGTGFSSQVY+LSSVF
Sbjct  474  PMKQRYHYNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVF  533

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  534  LHKDWIME  541


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  539

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  540  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  596

Query  273  ASI  265
             S+
Sbjct  597  TSM  599



>ref|XP_010516062.1| PREDICTED: uncharacterized protein LOC104791759 isoform X1 [Camelina 
sativa]
Length=700

 Score =   296 bits (758),  Expect(2) = 9e-113, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  541  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  600

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITSMAATADQAA ILSIP+R
Sbjct  601  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATADQAALILSIPKR  660

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  661  KITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  700


 Score =   139 bits (350),  Expect(2) = 9e-113, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL+ISCVASAANLWA+IMDAGTGFSSQVY+LSSVF
Sbjct  473  PMKQRYHYNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVF  532

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  533  LHKDWIME  540


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  480  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  538

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  539  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  595

Query  273  ASI  265
             S+
Sbjct  596  TSM  598



>ref|XP_010036218.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036219.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036220.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036222.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 gb|KCW47748.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47749.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47750.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
Length=702

 Score =   299 bits (765),  Expect(2) = 9e-113, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWE+N+YISSIAGA+NGSSLVVMSKGTPYTQQSYKVSE+FPFKWINKKWKEGFHVTSMTT
Sbjct  543  QWERNYYISSIAGASNGSSLVVMSKGTPYTQQSYKVSEAFPFKWINKKWKEGFHVTSMTT  602

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+R
Sbjct  603  AGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKR  662

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  663  KVMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  702


 Score =   136 bits (343),  Expect(2) = 9e-113, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL+ISCVAS++NLWALIMDAGTGFSSQVY+LS+VF
Sbjct  475  PMKQRYHYNVADTRLNQHVEKGNEDGLFISCVASSSNLWALIMDAGTGFSSQVYELSAVF  534

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  535  LHKDWIME  542


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/122 (24%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V+++   + + K  ++G  ++ + ++ + W ++M    G+S QV EL  ++  +  I 
Sbjct  482  YNVADTRLNQHVEKGNEDGLFISCVASSSNLWALIMDAGTGFSSQVYELSAVFLHKDWIM  541

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y I+S+A  ++ ++ ++     K    TQ++ + S AFP   + +KW +  ++ 
Sbjct  542  EQWERNYYISSIAGASNGSSLVV---MSKGTPYTQQSYKVSEAFPFKWINKKWKEGFHVT  598

Query  270  SI  265
            S+
Sbjct  599  SM  600



>ref|XP_006408240.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
 gb|ESQ49693.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
Length=701

 Score =   297 bits (761),  Expect(2) = 9e-113, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  542  QWEKNYYISSIAGSNNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  601

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+R
Sbjct  602  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKR  661

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  662  KISDETQETLRTSAFPSTHVKDKWAKNLYIASICYGRTVC  701


 Score =   138 bits (348),  Expect(2) = 9e-113, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV+D RL QHVEKGNEDGL+ISCVASAANLWALIMDAGTGFSSQVY+LS+VF
Sbjct  474  PMKQRYHYNVSDTRLHQHVEKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVF  533

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  534  LHKDWIME  541


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y VS++   + + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  481  YNVSDTRLHQHVEKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  540

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y I+S+A + + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  541  EQWEKNYYISSIAGSNNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  597

Query  270  SI  265
            S+
Sbjct  598  SM  599



>ref|XP_007204249.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
 gb|EMJ05448.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
Length=707

 Score =   301 bits (772),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  548  QWEKNFYISSIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  607

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG RWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+R
Sbjct  608  AGIRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITSMAATTDQAAFILSIPKR  667

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+MDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  668  KLMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  707


 Score =   134 bits (336),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV+KGNEDGL+IS VASAANLWALIMDAGTGFSSQVY+LS+VF
Sbjct  480  PMKQRYHYNVADTRLSQHVDKGNEDGLFISSVASAANLWALIMDAGTGFSSQVYELSTVF  539

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  540  LHKDWIME  547


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V+++   + ++K  ++G  ++S+ +A + W ++M    G+S QV EL   FL+  + I
Sbjct  487  YNVADTRLSQHVDKGNEDGLFISSVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  545

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  546  MEQWEKNFYISSIAGATNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  602

Query  273  ASI  265
             S+
Sbjct  603  TSM  605



>gb|KJB82579.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=706

 Score =   296 bits (758),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYK+SESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKLSESFPFKWINKKWKEGFHVTSMTT  606

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGS WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+R
Sbjct  607  AGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKR  666

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRTSAFPSTHVK+KW+KNLY+ASICYGRTVC
Sbjct  667  KMMDETQETLRTSAFPSTHVKDKWAKNLYLASICYGRTVC  706


 Score =   139 bits (349),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHVEKGNEDGL+ISCVASAANLWALIMDAGTGF+SQVY+LS+VF
Sbjct  479  PMKQRYHYNVADSRLRQHVEKGNEDGLFISCVASAANLWALIMDAGTGFTSQVYELSTVF  538

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  539  LHKDWIME  546



>gb|KJB82583.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=707

 Score =   296 bits (758),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYK+SESFPFKWINKKWKEGFHVTSMTT
Sbjct  548  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKLSESFPFKWINKKWKEGFHVTSMTT  607

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGS WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+R
Sbjct  608  AGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKR  667

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRTSAFPSTHVK+KW+KNLY+ASICYGRTVC
Sbjct  668  KMMDETQETLRTSAFPSTHVKDKWAKNLYLASICYGRTVC  707


 Score =   139 bits (350),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHVEKGNEDGL+ISCVASAANLWALIMDAGTGF+SQVY+LS+VF
Sbjct  480  PMKQRYHYNVADSRLRQHVEKGNEDGLFISCVASAANLWALIMDAGTGFTSQVYELSTVF  539

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  540  LHKDWIME  547



>ref|NP_187044.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAF05853.1|AC011698_4 putative casein kinase [Arabidopsis thaliana]
 gb|AEE74014.1| protein kinase family protein [Arabidopsis thaliana]
Length=701

 Score =   297 bits (761),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  542  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  601

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+R
Sbjct  602  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKR  661

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  662  KITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701


 Score =   137 bits (346),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL+ISCVAS+ANLWA+IMDAGTGFSSQVY+LSSVF
Sbjct  474  PMKQRYHYNVADLRLAQHVEKGNEDGLFISCVASSANLWAIIMDAGTGFSSQVYELSSVF  533

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  534  LHKDWIME  541



>emb|CDY42890.1| BnaC05g47610D [Brassica napus]
Length=700

 Score =   296 bits (758),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  541  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  600

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+R
Sbjct  601  AGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKR  660

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTH+KEKW+KNLYIASICYGRTVC
Sbjct  661  KLTDETQETLRTSAFPSTHIKEKWAKNLYIASICYGRTVC  700


 Score =   139 bits (349),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVA+ RL QHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVY+LS+VF
Sbjct  473  PMKQRYHYNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVF  532

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  533  LHKDWIME  540


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V+E+   + + K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  480  YNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  539

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  540  EQWEKNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  596

Query  270  SI  265
            S+
Sbjct  597  SM  598



>gb|KHG17118.1| Casein kinase I isoform delta [Gossypium arboreum]
 gb|KHG17119.1| Casein kinase I isoform delta [Gossypium arboreum]
Length=706

 Score =   296 bits (758),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWE+N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWERNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  606

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            A SRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+R
Sbjct  607  AASRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATVDQAAFILSIPKR  666

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  667  KTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  706


 Score =   138 bits (348),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL+ISCVASAANLWALIMDAGTGFSSQVY+LS+VF
Sbjct  479  PMKQRYHYNVADSRLHQHVEKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSAVF  538

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  539  LHKDWIME  546


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  486  YNVADSRLHQHVEKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSAVFLHKDWIM  545

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  546  EQWERNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  602

Query  270  SI  265
            S+
Sbjct  603  SM  604



>gb|KDO55049.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=537

 Score =   302 bits (773),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  378  QWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  437

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRR
Sbjct  438  AGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRR  497

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  498  KMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  537


 Score =   132 bits (333),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV+D RL+QHV+KGNEDGLYISCVASA+NLWALIMDAGTGF+ QVY+LS++F
Sbjct  310  PMKQRYHYNVSDARLRQHVDKGNEDGLYISCVASASNLWALIMDAGTGFTHQVYELSAIF  369

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  370  LHKDWIME  377



>emb|CDY29971.1| BnaC01g40370D [Brassica napus]
Length=703

 Score =   298 bits (762),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  544  QWEKNFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  603

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+R
Sbjct  604  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKR  663

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  664  KITDETQETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  703


 Score =   136 bits (343),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVA+ RLQ+HVEKG EDGL+ISCVASAANLWALIMDAGTGFSSQVY+LS+VF
Sbjct  476  PMKQRYHYNVAETRLQKHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVF  535

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  536  LHKDWIME  543


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V+E+   K + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  483  YNVAETRLQKHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  542

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  543  EQWEKNFYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  599

Query  270  SI  265
            S+
Sbjct  600  SM  601



>gb|AAM91528.1| putative casein kinase [Arabidopsis thaliana]
Length=303

 Score =   296 bits (758),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  144  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  203

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+R
Sbjct  204  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKR  263

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  264  KITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  303


 Score =   137 bits (346),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL+ISCVAS+ANLWA+IMDAGTGFSSQVY+LSSVF
Sbjct  76   PMKQRYHYNVADLRLAQHVEKGNEDGLFISCVASSANLWAIIMDAGTGFSSQVYELSSVF  135

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  136  LHKDWIME  143



>ref|XP_009130401.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130402.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130403.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
Length=695

 Score =   295 bits (755),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  536  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  595

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+R
Sbjct  596  AGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKR  655

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  656  KITDETQETLRTSAFPSTHVKDKWAKNLYIASICYGRTVC  695


 Score =   139 bits (350),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVA+ RL QHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVY+LS+VF
Sbjct  468  PMKQRYHYNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVF  527

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  528  LHKDWIME  535


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V+E+   + + K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  475  YNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  534

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  535  EQWEKNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  591

Query  270  SI  265
            S+
Sbjct  592  SM  593



>ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 isoform X1 [Glycine 
max]
 ref|XP_006598981.1| PREDICTED: uncharacterized protein LOC100801967 isoform X2 [Glycine 
max]
 gb|KHN46781.1| Casein kinase I like hhp1 [Glycine soja]
Length=709

 Score =   300 bits (768),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  550  QWEKNYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  609

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWE+GYRITSMAAT+DQAAFILSIP+R
Sbjct  610  AGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWENGYRITSMAATSDQAAFILSIPKR  669

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K++DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  670  KLLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  709


 Score =   134 bits (336),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KG EDGLYISCVASAANLWALIMDAGTGFSSQVY+LS  F
Sbjct  482  PMKQRYHYNVADTRLRQHVDKGIEDGLYISCVASAANLWALIMDAGTGFSSQVYELSPAF  541

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  542  LHKDWIME  549


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V+++   + ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  489  YNVADTRLRQHVDKGIEDGLYISCVASAANLWALIMDAGTGFSSQVYELSPAFLH-KDWI  547

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  548  MEQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  604

Query  273  ASI  265
             S+
Sbjct  605  TSM  607



>gb|KJB45108.1| hypothetical protein B456_007G289500 [Gossypium raimondii]
Length=706

 Score =   298 bits (764),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWE+N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWERNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  606

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+R
Sbjct  607  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATVDQAAFILSIPKR  666

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  667  KTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  706


 Score =   135 bits (340),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNED L+ISCVASAANLWALIMDAGTGF+SQVY+LS+VF
Sbjct  479  PMKQRYHYNVADSRLHQHVEKGNEDALFISCVASAANLWALIMDAGTGFTSQVYELSAVF  538

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  539  LHKDWIME  546



>ref|XP_010276388.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276389.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276390.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276391.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
Length=714

 Score =   297 bits (760),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 153/159 (96%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  555  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  614

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS AAT DQAAFILSIP+R
Sbjct  615  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSTAATHDQAAFILSIPKR  674

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV
Sbjct  675  KLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  713


 Score =   136 bits (343),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH++KGNEDGLYISCVASA NLWALIMDAGTGF SQVYDLS+VF
Sbjct  487  PMKQRYHYNVADSRLSQHIKKGNEDGLYISCVASAVNLWALIMDAGTGFCSQVYDLSAVF  546

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  547  LHKDWIME  554



>emb|CDY21155.1| BnaA01g33860D [Brassica napus]
Length=704

 Score =   297 bits (760),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  545  QWEKNFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  604

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+R
Sbjct  605  AGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKR  664

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  665  KITDETQETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  704


 Score =   136 bits (343),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVA+ RLQ+HVEKG EDGL+ISCVASAANLWALIMDAGTGFSSQVY+LS+VF
Sbjct  477  PMKQRYHYNVAETRLQKHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVF  536

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  537  LHKDWIME  544


 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V+E+   K + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  484  YNVAETRLQKHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  543

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  544  EQWEKNFYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  600

Query  270  SI  265
            S+
Sbjct  601  SM  602



>ref|XP_004288418.1| PREDICTED: uncharacterized protein LOC101290807 [Fragaria vesca 
subsp. vesca]
Length=692

 Score =   298 bits (764),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KNFYISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  533  QWDKNFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  592

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITSMAAT+DQAAFILSIP+R
Sbjct  593  AGNRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATSDQAAFILSIPKR  652

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+MDETQETLRTSAFPS+HVKEKWSKNLYIASIC+GRTVC
Sbjct  653  KLMDETQETLRTSAFPSSHVKEKWSKNLYIASICFGRTVC  692


 Score =   135 bits (339),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KGNEDGLYIS VASAANLWALIMDAGTGFSSQVY+LS+VF
Sbjct  465  PMKQRYHYNVADSRLRQHVDKGNEDGLYISSVASAANLWALIMDAGTGFSSQVYELSAVF  524

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  525  LHKDWIME  532


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V++S   + ++K  ++G +++S+ +A + W ++M    G+S QV EL   FL+  + I
Sbjct  472  YNVADSRLRQHVDKGNEDGLYISSVASAANLWALIMDAGTGFSSQVYELSAVFLH-KDWI  530

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +W+  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  531  MEQWDKNFYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  587

Query  273  ASI  265
             S+
Sbjct  588  TSM  590



>ref|XP_002281952.1| PREDICTED: uncharacterized protein LOC100267624 [Vitis vinifera]
 emb|CAN59733.1| hypothetical protein VITISV_003914 [Vitis vinifera]
Length=708

 Score =   298 bits (764),  Expect(2) = 6e-112, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GY++QVVELDFLYPSEGIHRRWE GYRITSMAAT DQAAFILSIP+R
Sbjct  609  AGSRWGVVMSRNSGYTDQVVELDFLYPSEGIHRRWECGYRITSMAATNDQAAFILSIPKR  668

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRTSAFPSTHVKEKWSKNLYIA+ICYGRTVC
Sbjct  669  KMMDETQETLRTSAFPSTHVKEKWSKNLYIAAICYGRTVC  708


 Score =   134 bits (337),  Expect(2) = 6e-112, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL+ISCVAS++NLWALIMDAGTG+SSQVY+LS+VF
Sbjct  481  PMKQRYHYNVADSRLPQHVEKGNEDGLHISCVASSSNLWALIMDAGTGYSSQVYELSAVF  540

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  541  LHKDWIME  548


 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V++S   + + K  ++G H++ + ++ + W ++M    GYS QV EL   FL+  + I
Sbjct  488  YNVADSRLPQHVEKGNEDGLHISCVASSSNLWALIMDAGTGYSSQVYELSAVFLH-KDWI  546

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  273  ASI  265
             S+
Sbjct  604  TSM  606



>ref|XP_010558720.1| PREDICTED: uncharacterized protein LOC104827271 isoform X2 [Tarenaya 
hassleriana]
Length=704

 Score =   298 bits (762),  Expect(2) = 7e-112, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  545  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  604

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE GYRITSMAATADQAAFILSIP+R
Sbjct  605  AGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWEGGYRITSMAATADQAAFILSIPKR  664

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  665  KMLDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  704


 Score =   134 bits (338),  Expect(2) = 7e-112, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL++SCVAS+ NLWALIMDAGTGF+SQVY+LSSVF
Sbjct  477  PMKQRYHYNVADLRLHQHVEKGNEDGLFLSCVASSTNLWALIMDAGTGFTSQVYELSSVF  536

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  537  LHKDWIME  544



>ref|XP_010558719.1| PREDICTED: uncharacterized protein LOC104827271 isoform X1 [Tarenaya 
hassleriana]
Length=703

 Score =   298 bits (762),  Expect(2) = 7e-112, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  544  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  603

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE GYRITSMAATADQAAFILSIP+R
Sbjct  604  AGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWEGGYRITSMAATADQAAFILSIPKR  663

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  664  KMLDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  703


 Score =   134 bits (338),  Expect(2) = 7e-112, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL++SCVAS+ NLWALIMDAGTGF+SQVY+LSSVF
Sbjct  476  PMKQRYHYNVADLRLHQHVEKGNEDGLFLSCVASSTNLWALIMDAGTGFTSQVYELSSVF  535

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  536  LHKDWIME  543



>ref|XP_008240478.1| PREDICTED: uncharacterized protein LOC103338977 [Prunus mume]
Length=707

 Score =   300 bits (767),  Expect(2) = 9e-112, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  548  QWEKNFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  607

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG RWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+R
Sbjct  608  AGIRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITSMAATTDQAAFILSIPKR  667

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+MDETQETLRTSAFPS+HVKEKWSKNLYIASIC+GRTVC
Sbjct  668  KLMDETQETLRTSAFPSSHVKEKWSKNLYIASICHGRTVC  707


 Score =   132 bits (333),  Expect(2) = 9e-112, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV+KGNEDGL+IS VASA+NLWALIMDAGTGFSSQVY+LS+VF
Sbjct  480  PMKQRYHYNVADTRLSQHVDKGNEDGLFISSVASASNLWALIMDAGTGFSSQVYELSTVF  539

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  540  LHKDWIME  547


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V+++   + ++K  ++G  ++S+ +A + W ++M    G+S QV EL   FL+  + I
Sbjct  487  YNVADTRLSQHVDKGNEDGLFISSVASASNLWALIMDAGTGFSSQVYELSTVFLH-KDWI  545

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  546  MEQWEKNFYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  602

Query  273  ASI  265
             S+
Sbjct  603  TSM  605



>gb|AAF00624.1|AC009540_1 unknown protein, 5' partial [Arabidopsis thaliana]
Length=494

 Score =   295 bits (755),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  335  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  394

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+R
Sbjct  395  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKR  454

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  455  KITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  494


 Score =   137 bits (344),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL+ISCVAS+ANLWA+IMDAGTGFSSQVY+LSSVF
Sbjct  267  PMKQRYHYNVADLRLAQHVEKGNEDGLFISCVASSANLWAIIMDAGTGFSSQVYELSSVF  326

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  327  LHKDWIME  334



>ref|XP_010908708.1| PREDICTED: uncharacterized protein LOC105035016 [Elaeis guineensis]
Length=718

 Score =   294 bits (753),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT MTT
Sbjct  559  QWEKNYYISAIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTCMTT  618

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+R
Sbjct  619  AGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWENGYRITSTAATPDQAAFILSIPKR  678

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  679  KLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTVC  718


 Score =   137 bits (346),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RLQQH+EKGNEDGL+ISCVAS+ANLWALIMDAGTGFSSQVY+LS +F
Sbjct  491  PMKQRYHYNVADARLQQHIEKGNEDGLFISCVASSANLWALIMDAGTGFSSQVYELSPMF  550

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  551  LHKDWIME  558



>emb|CBI29940.3| unnamed protein product [Vitis vinifera]
Length=593

 Score =   298 bits (762),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  434  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  493

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GY++QVVELDFLYPSEGIHRRWE GYRITSMAAT DQAAFILSIP+R
Sbjct  494  AGSRWGVVMSRNSGYTDQVVELDFLYPSEGIHRRWECGYRITSMAATNDQAAFILSIPKR  553

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRTSAFPSTHVKEKWSKNLYIA+ICYGRTVC
Sbjct  554  KMMDETQETLRTSAFPSTHVKEKWSKNLYIAAICYGRTVC  593


 Score =   134 bits (336),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL+ISCVAS++NLWALIMDAGTG+SSQVY+LS+VF
Sbjct  366  PMKQRYHYNVADSRLPQHVEKGNEDGLHISCVASSSNLWALIMDAGTGYSSQVYELSAVF  425

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  426  LHKDWIME  433


 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V++S   + + K  ++G H++ + ++ + W ++M    GYS QV EL  ++  +  I 
Sbjct  373  YNVADSRLPQHVEKGNEDGLHISCVASSSNLWALIMDAGTGYSSQVYELSAVFLHKDWIM  432

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  433  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  489

Query  270  SI  265
            S+
Sbjct  490  SM  491



>ref|XP_009102089.1| PREDICTED: uncharacterized protein LOC103828226 [Brassica rapa]
Length=704

 Score =   295 bits (755),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYISSIAGA NGSS VVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  545  QWEKNFYISSIAGANNGSSFVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  604

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+R
Sbjct  605  AGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKR  664

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  665  KITDETQETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  704


 Score =   136 bits (343),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVA+ RLQ+HVEKG EDGL+ISCVASAANLWALIMDAGTGFSSQVY+LS+VF
Sbjct  477  PMKQRYHYNVAETRLQKHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVF  536

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  537  LHKDWIME  544


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V+E+   K + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  484  YNVAETRLQKHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  543

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  + I+S+A   + ++F++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  544  EQWEKNFYISSIAGANNGSSFVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  600

Query  270  SI  265
            S+
Sbjct  601  SM  602



>gb|KJB80965.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=707

 Score =   296 bits (757),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  548  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  607

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSRN+G+S+QVVELDFLYPSEGIHRRWE+GYRITSMAAT DQAAFILSIP+R
Sbjct  608  SGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWENGYRITSMAATGDQAAFILSIPKR  667

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  668  KTMDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTVC  707


 Score =   135 bits (340),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KGNEDGL+ISCVASAANLWALIMDAGT FSSQVY+LS+VF
Sbjct  480  PMKQRYHYNVADSRLRQHVDKGNEDGLFISCVASAANLWALIMDAGTSFSSQVYELSTVF  539

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  540  LHKDWIME  547



>gb|KHG27523.1| hypothetical protein F383_15264 [Gossypium arboreum]
Length=706

 Score =   297 bits (761),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  606

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+R
Sbjct  607  SGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATGDQAAFILSIPKR  666

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  667  KTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  706


 Score =   134 bits (336),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KGNEDGL+ISCVAS+ANLWALIMDAGT FSSQVY+LS++F
Sbjct  479  PMKQRYHYNVADSRLRQHVDKGNEDGLFISCVASSANLWALIMDAGTSFSSQVYELSTIF  538

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  539  LHKDWIME  546



>gb|KJB80963.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80964.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80966.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=706

 Score =   296 bits (757),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  606

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSRN+G+S+QVVELDFLYPSEGIHRRWE+GYRITSMAAT DQAAFILSIP+R
Sbjct  607  SGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWENGYRITSMAATGDQAAFILSIPKR  666

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  667  KTMDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTVC  706


 Score =   135 bits (340),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KGNEDGL+ISCVASAANLWALIMDAGT FSSQVY+LS+VF
Sbjct  479  PMKQRYHYNVADSRLRQHVDKGNEDGLFISCVASAANLWALIMDAGTSFSSQVYELSTVF  538

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  539  LHKDWIME  546



>ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504885 isoform X1 [Cicer 
arietinum]
 ref|XP_004493153.1| PREDICTED: uncharacterized protein LOC101504885 isoform X2 [Cicer 
arietinum]
Length=708

 Score =   298 bits (764),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWE+ YRITSMAAT+DQAAFILSIP+R
Sbjct  609  AGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWENNYRITSMAATSDQAAFILSIPKR  668

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K++DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  669  KLLDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score =   132 bits (332),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KG EDGLYISCVAS+ANLWALIMDAGTGFSSQVY+LS  F
Sbjct  481  PMKQRYHYNVADNRLRQHVDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPAF  540

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  541  LHKDWIME  548


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V+++   + ++K  ++G +++ + ++ + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADNRLRQHVDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPAFLH-KDWI  546

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  273  ASI  265
             S+
Sbjct  604  TSM  606



>ref|XP_008805378.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
 ref|XP_008805379.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
Length=718

 Score =   293 bits (750),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT MTT
Sbjct  559  QWEKNYYISAIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTCMTT  618

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+R
Sbjct  619  AGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWENGYRITSTAATPDQAAFILSIPKR  678

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+MDETQETLRTSAFPS HVK+KW+KNLYIASICYGRTVC
Sbjct  679  KLMDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTVC  718


 Score =   137 bits (346),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RLQQH+EKGNEDGL+ISCVAS+ANLWALIMDAGTGFSSQVY+LS +F
Sbjct  491  PMKQRYHYNVADARLQQHIEKGNEDGLFISCVASSANLWALIMDAGTGFSSQVYELSPMF  550

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  551  LHKDWIME  558



>ref|XP_003624626.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES80844.1| casein kinase I-like protein [Medicago truncatula]
Length=708

 Score =   298 bits (763),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWE+ YRITSMAAT DQAAFILSIP+R
Sbjct  609  AGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWENNYRITSMAATNDQAAFILSIPKR  668

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K++DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  669  KLLDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score =   132 bits (332),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KG EDGLYISCVAS+ANLWALIMDAGTGFSSQVY+LS  F
Sbjct  481  PMKQRYHYNVADNRLRQHVDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPAF  540

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  541  LHKDWIME  548


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V+++   + ++K  ++G +++ + ++ + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADNRLRQHVDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPAFLH-KDWI  546

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  273  ASI  265
             S+
Sbjct  604  TSM  606



>ref|XP_009413883.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413884.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   295 bits (755),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAG  NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  555  QWEKNYYISAIAGTTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  614

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG RWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWESGYRITS AAT DQAAFILSIP+R
Sbjct  615  AGGRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWESGYRITSTAATPDQAAFILSIPKR  674

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  675  KLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTVC  714


 Score =   134 bits (338),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RLQQH+EKG EDGLYISCVAS+ANLWALIMDAGTGF SQVY+LS +F
Sbjct  487  PMKQRYHYNVADIRLQQHIEKGMEDGLYISCVASSANLWALIMDAGTGFCSQVYELSPIF  546

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  547  LHKDWIME  554



>emb|CDY50866.1| BnaA05g37270D [Brassica napus]
Length=798

 Score =   291 bits (744),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  540  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  599

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+R
Sbjct  600  AGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKR  659

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+ DETQETLRTSAFPSTHVK+KW+KNLYIASICYGRTV
Sbjct  660  KITDETQETLRTSAFPSTHVKDKWAKNLYIASICYGRTV  698


 Score =   138 bits (348),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVA+ RL QHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVY+LS+VF
Sbjct  472  PMKQRYHYNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVF  531

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  532  LHKDWIME  539


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V+E+   + + K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  479  YNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  538

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  539  EQWEKNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  595

Query  270  SI  265
            S+
Sbjct  596  SM  597



>ref|XP_010485763.1| PREDICTED: uncharacterized protein LOC104764028 isoform X2 [Camelina 
sativa]
Length=700

 Score =   290 bits (741),  Expect(2) = 7e-111, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 1/160 (1%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  542  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  601

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITSMAATADQAA ILSIP+R
Sbjct  602  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATADQAALILSIPKR  661

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTHVK KW+KNLYIASICYGRTVC
Sbjct  662  KITDETQETLRTSAFPSTHVK-KWAKNLYIASICYGRTVC  700


 Score =   139 bits (351),  Expect(2) = 7e-111, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL+ISCVASAANLWA+IMDAGTGFSSQVY+LSSVF
Sbjct  474  PMKQRYHYNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVF  533

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  534  LHKDWIME  541


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLHKDWIM  540

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  541  EQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  597

Query  270  SI  265
            S+
Sbjct  598  SM  599



>ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
 gb|ESW33931.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
Length=708

 Score =   298 bits (762),  Expect(2) = 8e-111, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  549  QWEKNYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  608

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYS+QVVE+DFLYPSEGIHRRWE+GYRITSMAAT+DQAAFILSIP+R
Sbjct  609  AGSRWGVVMSRNSGYSDQVVEIDFLYPSEGIHRRWENGYRITSMAATSDQAAFILSIPKR  668

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K++DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  669  KLLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  708


 Score =   131 bits (330),  Expect(2) = 8e-111, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHV+KG EDGLYISCVAS+ANLWALIMDAGTGFSSQVY+LS  F
Sbjct  481  PMKQRYHYNVADTRLRQHVDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSLAF  540

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  541  LHKDWIME  548


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/122 (23%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V+++   + ++K  ++G +++ + ++ + W ++M    G+S QV EL   +  +  I 
Sbjct  488  YNVADTRLRQHVDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSLAFLHKDWIM  547

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  548  EQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  604

Query  270  SI  265
            S+
Sbjct  605  SM  606



>ref|XP_010516137.1| PREDICTED: uncharacterized protein LOC104791759 isoform X2 [Camelina 
sativa]
 ref|XP_010516215.1| PREDICTED: uncharacterized protein LOC104791759 isoform X3 [Camelina 
sativa]
Length=699

 Score =   290 bits (741),  Expect(2) = 8e-111, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 1/160 (1%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  541  QWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  600

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITSMAATADQAA ILSIP+R
Sbjct  601  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATADQAALILSIPKR  660

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTSAFPSTHVK KW+KNLYIASICYGRTVC
Sbjct  661  KITDETQETLRTSAFPSTHVK-KWAKNLYIASICYGRTVC  699


 Score =   139 bits (350),  Expect(2) = 8e-111, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGL+ISCVASAANLWA+IMDAGTGFSSQVY+LSSVF
Sbjct  473  PMKQRYHYNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVF  532

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  533  LHKDWIME  540


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  480  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLHKDWIM  539

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  540  EQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  596

Query  270  SI  265
            S+
Sbjct  597  SM  598



>ref|XP_010672054.1| PREDICTED: uncharacterized protein LOC104888715 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=713

 Score =   295 bits (755),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYISSIAGA NG+SLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  554  QWEKNFYISSIAGATNGASLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  613

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            A SRWGVVMSRNAG+++QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAF+LSIP+R
Sbjct  614  AASRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWESGYRITSMAATPDQAAFVLSIPKR  673

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  674  KTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  713


 Score =   133 bits (334),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QH++KGNEDGLYISCVASA NLWALIMDAGTGFS QV++LS+VF
Sbjct  486  PMKQRYHYNVADARLKQHIDKGNEDGLYISCVASATNLWALIMDAGTGFSCQVWELSNVF  545

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  546  LHKDWIME  553



>ref|XP_006400366.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
 gb|ESQ41819.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
Length=695

 Score =   292 bits (747),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  536  QWEKNYYISSIAGADNGSSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  595

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+G+SEQVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+R
Sbjct  596  AGNRWGVVMSRNSGFSEQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKR  655

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  656  KMMDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  695


 Score =   135 bits (340),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV+KGNEDGL ISCVASAANLWALIMDAGTGF+SQVY+LS+VF
Sbjct  468  PMKQRYHYNVADSRLHQHVQKGNEDGLLISCVASAANLWALIMDAGTGFTSQVYELSTVF  527

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  528  LHKDWIME  535



>gb|AAO41895.1| putative casein kinase [Arabidopsis thaliana]
Length=307

 Score =   292 bits (747),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAG+ NG+SLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  148  QWEKNYYISSIAGSDNGNSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  207

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GYS+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+R
Sbjct  208  AGNRWGVVMSRNSGYSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKR  267

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  268  KMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  307


 Score =   135 bits (339),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV+KGNEDGL ISCVASAANLWALIMDAGTGF+SQVY+LS+VF
Sbjct  80   PMKQRYHYNVADSRLHQHVQKGNEDGLLISCVASAANLWALIMDAGTGFTSQVYELSTVF  139

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  140  LHKDWIME  147



>ref|NP_197320.1| protein kinase [Arabidopsis thaliana]
 dbj|BAB09477.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AED92517.1| protein kinase [Arabidopsis thaliana]
Length=691

 Score =   291 bits (746),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAG+ NG+SLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  532  QWEKNYYISSIAGSDNGNSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  591

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GYS+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+R
Sbjct  592  AGNRWGVVMSRNSGYSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKR  651

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  652  KMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  691


 Score =   135 bits (339),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV+KGNEDGL ISCVASAANLWALIMDAGTGF+SQVY+LS+VF
Sbjct  464  PMKQRYHYNVADSRLHQHVQKGNEDGLLISCVASAANLWALIMDAGTGFTSQVYELSTVF  523

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  524  LHKDWIME  531



>ref|XP_010492820.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
 ref|XP_010492821.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
Length=692

 Score =   291 bits (745),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAG+ NGSSLV+MSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  533  QWEKNYYISSIAGSDNGSSLVIMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  592

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GYS+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+R
Sbjct  593  AGNRWGVVMSRNSGYSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKR  652

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  653  KMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  692


 Score =   135 bits (340),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV+KGNEDGL ISCVASAANLWALIMDAGTGF+SQVY+LS+VF
Sbjct  465  PMKQRYHYNVADTRLHQHVQKGNEDGLLISCVASAANLWALIMDAGTGFTSQVYELSTVF  524

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  525  LHKDWIME  532



>ref|XP_010424160.1| PREDICTED: uncharacterized protein LOC104709208 [Camelina sativa]
Length=647

 Score =   290 bits (741),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAG+ NGSSLV+MSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  488  QWEKNYYISSIAGSDNGSSLVIMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  547

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+R
Sbjct  548  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKR  607

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  608  KMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  647


 Score =   135 bits (340),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV+KGNEDGL ISCVASAANLWALIMDAGTGF+SQVY+LS+VF
Sbjct  420  PMKQRYHYNVADTRLHQHVQKGNEDGLLISCVASAANLWALIMDAGTGFTSQVYELSTVF  479

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  480  LHKDWIME  487



>ref|XP_009418950.1| PREDICTED: uncharacterized protein LOC103999040 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=751

 Score =   292 bits (748),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS++AGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  592  QWEKNYYISAVAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  651

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWG+VMSRN+GYS+QVVELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+R
Sbjct  652  AGSRWGIVMSRNSGYSDQVVELDFLYPSEGIHRRWESGYRITSTAATPDQAAFILSVPKR  711

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+MDETQETLRTS FPS HVK+KW+KNLYIASICYGRTVC
Sbjct  712  KLMDETQETLRTSTFPSNHVKDKWAKNLYIASICYGRTVC  751


 Score =   132 bits (333),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RLQQH+ KG EDGLYISCVAS+ANLWALIMDAGTGFSSQVY+LS +F
Sbjct  524  PMKQRYHYNVADARLQQHIVKGMEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPMF  583

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  584  LHKDWIME  591



>ref|XP_010454044.1| PREDICTED: uncharacterized protein LOC104735873 [Camelina sativa]
Length=692

 Score =   290 bits (741),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAG+ NGSSLV+MSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  533  QWEKNYYISSIAGSDNGSSLVIMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  592

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+R
Sbjct  593  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKR  652

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  653  KMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  692


 Score =   135 bits (340),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV+KGNEDGL ISCVASAANLWALIMDAGTGF+SQVY+LS+VF
Sbjct  465  PMKQRYHYNVADTRLHQHVQKGNEDGLLISCVASAANLWALIMDAGTGFTSQVYELSTVF  524

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  525  LHKDWIME  532



>ref|XP_009418951.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418952.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=716

 Score =   292 bits (748),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS++AGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  557  QWEKNYYISAVAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  616

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWG+VMSRN+GYS+QVVELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+R
Sbjct  617  AGSRWGIVMSRNSGYSDQVVELDFLYPSEGIHRRWESGYRITSTAATPDQAAFILSVPKR  676

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+MDETQETLRTS FPS HVK+KW+KNLYIASICYGRTVC
Sbjct  677  KLMDETQETLRTSTFPSNHVKDKWAKNLYIASICYGRTVC  716


 Score =   132 bits (333),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RLQQH+ KG EDGLYISCVAS+ANLWALIMDAGTGFSSQVY+LS +F
Sbjct  489  PMKQRYHYNVADARLQQHIVKGMEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPMF  548

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  549  LHKDWIME  556



>gb|KJB46016.1| hypothetical protein B456_007G343500 [Gossypium raimondii]
Length=711

 Score =   288 bits (737),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI+S+AGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGF+VTSMTT
Sbjct  552  QWEKNYYITSVAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVTSMTT  611

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+R
Sbjct  612  AGTRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATVDQAAFILSIPKR  671

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  D+TQETLRT+AFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  672  KTTDDTQETLRTTAFPSTHVKEKWAKNLYIASICYGRTV  710


 Score =   136 bits (343),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV KGNEDGL+ISCVASAANLWALIMDAGTGFSSQVY+LS+VF
Sbjct  484  PMKQRYHYNVADLRLSQHVSKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVF  543

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  544  LHKDWIME  551


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  448
            Y V++    + ++K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  491  YNVADLRLSQHVSKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  550

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y ITS+A   + ++ ++     K    TQ++ + S +FP   + +KW +  Y+ 
Sbjct  551  EQWEKNYYITSVAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVT  607

Query  270  SI  265
            S+
Sbjct  608  SM  609



>emb|CDY38493.1| BnaA10g16650D [Brassica napus]
Length=690

 Score =   291 bits (744),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  531  QWEKNYYISSIAGADNGSSLVVMSKGTTYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  590

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+R
Sbjct  591  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKR  650

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRT+AFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  651  KMMDETQETLRTTAFPSTHVKEKWAKNLYIASVCYGRTVC  690


 Score =   133 bits (334),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVA+ RL QHV+KGNEDGL ISCVASAANLWALIMDAGTGF+SQVY+LS VF
Sbjct  463  PMKQRYHYNVAETRLSQHVQKGNEDGLLISCVASAANLWALIMDAGTGFTSQVYELSKVF  522

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  523  LHKDWIME  530



>emb|CDY25451.1| BnaC09g39660D [Brassica napus]
Length=690

 Score =   291 bits (744),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  531  QWEKNYYISSIAGADNGSSLVVMSKGTTYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  590

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+R
Sbjct  591  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKR  650

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRT+AFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  651  KMMDETQETLRTTAFPSTHVKEKWAKNLYIASVCYGRTVC  690


 Score =   133 bits (334),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVA+ RL QHV+KGNEDGL ISCVASAANLWALIMDAGTGF+SQVY+LS VF
Sbjct  463  PMKQRYHYNVAETRLSQHVQKGNEDGLLISCVASAANLWALIMDAGTGFTSQVYELSKVF  522

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  523  LHKDWIME  530



>dbj|BAJ93086.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=707

 Score =   288 bits (738),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  548  QWEKNFYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMGT  607

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRNAGYS+QVVELDFLYPSEG+HRRWESGYRITS A T DQAAFILSIP+R
Sbjct  608  AGNRWGVVMSRNAGYSDQVVELDFLYPSEGLHRRWESGYRITSSAGTPDQAAFILSIPKR  667

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K +DETQETLRTSAFPS HVKEKW+KNLYIASICYGRT C
Sbjct  668  KPLDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTAC  707


 Score =   134 bits (338),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGLYISCVAS+AN WALIMDAGTGF SQVY+LS +F
Sbjct  480  PMKQRYHYNVADSRLHQHIEKGNEDGLYISCVASSANFWALIMDAGTGFGSQVYELSQIF  539

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  540  LHKDWIME  547



>ref|XP_002873876.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50135.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=691

 Score =   289 bits (739),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFP+KWINKKWKE FHVTSMTT
Sbjct  532  QWEKNYYISSIAGADNGSSLVVMSKGTSYTQQSYKVSDSFPYKWINKKWKEDFHVTSMTT  591

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+R
Sbjct  592  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKR  651

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  652  KMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  691


 Score =   134 bits (338),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV+KGNEDGL ISCVASAANLWALIMDAGTGF+SQVY+LS+VF
Sbjct  464  PMKQRYHYNVADSRLHQHVQKGNEDGLLISCVASAANLWALIMDAGTGFNSQVYELSAVF  523

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  524  LHKDWIME  531



>ref|XP_009121003.1| PREDICTED: uncharacterized protein LOC103845859 [Brassica rapa]
Length=691

 Score =   290 bits (741),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FH+TSMTT
Sbjct  532  QWEKNYYISSIAGADNGSSLVVMSKGTTYTQQSYKVSDSFPFKWINKKWKEDFHLTSMTT  591

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+R
Sbjct  592  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKR  651

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRT+AFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  652  KMMDETQETLRTTAFPSTHVKEKWAKNLYIASVCYGRTVC  691


 Score =   133 bits (334),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVA+ RL QHV+KGNEDGL ISCVASAANLWALIMDAGTGF+SQVY+LS VF
Sbjct  464  PMKQRYHYNVAETRLSQHVQKGNEDGLLISCVASAANLWALIMDAGTGFTSQVYELSKVF  523

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  524  LHKDWIME  531



>ref|XP_010257690.1| PREDICTED: uncharacterized protein LOC104597684 [Nelumbo nucifera]
Length=708

 Score =   293 bits (749),  Expect(2) = 6e-109, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  549  QWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  608

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GYS+QVVELDFLYPSEGIH+RWESGYRITS AAT DQAAFILSIP+R
Sbjct  609  AGNRWGVVMSRNSGYSDQVVELDFLYPSEGIHKRWESGYRITSTAATVDQAAFILSIPKR  668

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV
Sbjct  669  KLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  707


 Score =   130 bits (326),  Expect(2) = 6e-109, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            P+KQRYHYNVAD RL QH+EKGN+DGLYISCVASA NLWALIMDAGT F SQVYDLS+VF
Sbjct  481  PIKQRYHYNVADSRLSQHIEKGNKDGLYISCVASALNLWALIMDAGTCFLSQVYDLSTVF  540

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  541  LHKDWIME  548



>ref|NP_001051531.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|AAO37965.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 gb|ABF99311.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13445.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|EAZ28883.1| hypothetical protein OsJ_12923 [Oryza sativa Japonica Group]
 dbj|BAH00578.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAN15567.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score =   290 bits (741),  Expect(2) = 7e-109, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  548  QWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  607

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+R
Sbjct  608  AGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAAFILSIPKR  667

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  668  KPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  707


 Score =   133 bits (334),  Expect(2) = 7e-109, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGLYISCV+S+AN WALIMDAGTGF SQVY+LS VF
Sbjct  480  PMKQRYHYNVADSRLHQHIEKGNEDGLYISCVSSSANFWALIMDAGTGFCSQVYELSQVF  539

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  540  LHKDWIME  547



>dbj|BAN15568.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score =   289 bits (740),  Expect(2) = 7e-109, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  548  QWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  607

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+R
Sbjct  608  AGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAAFILSIPKR  667

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  668  KPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  707


 Score =   133 bits (334),  Expect(2) = 7e-109, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGLYISCV+S+AN WALIMDAGTGF SQVY+LS VF
Sbjct  480  PMKQRYHYNVADSRLHQHIEKGNEDGLYISCVSSSANFWALIMDAGTGFCSQVYELSQVF  539

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  540  LHKDWIME  547



>gb|EAY92152.1| hypothetical protein OsI_13865 [Oryza sativa Indica Group]
Length=707

 Score =   289 bits (740),  Expect(2) = 8e-109, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  548  QWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  607

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+R
Sbjct  608  AGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAAFILSIPKR  667

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  668  KPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  707


 Score =   133 bits (334),  Expect(2) = 8e-109, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGLYISCV+S+AN WALIMDAGTGF SQVY+LS VF
Sbjct  480  PMKQRYHYNVADSRLHQHIEKGNEDGLYISCVSSSANFWALIMDAGTGFCSQVYELSQVF  539

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  540  LHKDWIME  547



>ref|XP_006287189.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
 gb|EOA20087.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
Length=692

 Score =   290 bits (742),  Expect(2) = 9e-109, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAG+ NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  533  QWEKNYYISSIAGSDNGSSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  592

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+R
Sbjct  593  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKR  652

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  653  KMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  692


 Score =   132 bits (332),  Expect(2) = 9e-109, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV+KGNEDGL ISCVAS+ANLWALIMDAGTGF+SQVY+LS VF
Sbjct  465  PMKQRYHYNVADLRLHQHVQKGNEDGLLISCVASSANLWALIMDAGTGFTSQVYELSMVF  524

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  525  LHKDWIME  532



>ref|XP_004955580.1| PREDICTED: uncharacterized protein LOC101773166 isoform X1 [Setaria 
italica]
 ref|XP_004955581.1| PREDICTED: uncharacterized protein LOC101773166 isoform X2 [Setaria 
italica]
 ref|XP_004955582.1| PREDICTED: uncharacterized protein LOC101773166 isoform X3 [Setaria 
italica]
Length=732

 Score =   285 bits (729),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEK++YI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  573  QWEKSYYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  632

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GYS QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILS+P+R
Sbjct  633  AGNRWGVVMSRNSGYSNQVVELDFLYPSEGIHRRWETGYRITSTAATNDQAAFILSMPKR  692

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  693  KPMDETQETLRTSAFPSGHVKEKWAKNLYIASICYGRTVC  732


 Score =   137 bits (344),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGLYISCVAS+ANLWALIMDAGTGF SQVY+LS VF
Sbjct  505  PMKQRYHYNVADSRLSQHIEKGNEDGLYISCVASSANLWALIMDAGTGFCSQVYELSPVF  564

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  565  LHKDWIME  572



>ref|XP_004955583.1| PREDICTED: uncharacterized protein LOC101773166 isoform X4 [Setaria 
italica]
Length=707

 Score =   285 bits (729),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEK++YI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  548  QWEKSYYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  607

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GYS QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILS+P+R
Sbjct  608  AGNRWGVVMSRNSGYSNQVVELDFLYPSEGIHRRWETGYRITSTAATNDQAAFILSMPKR  667

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  668  KPMDETQETLRTSAFPSGHVKEKWAKNLYIASICYGRTVC  707


 Score =   137 bits (344),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGLYISCVAS+ANLWALIMDAGTGF SQVY+LS VF
Sbjct  480  PMKQRYHYNVADSRLSQHIEKGNEDGLYISCVASSANLWALIMDAGTGFCSQVYELSPVF  539

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  540  LHKDWIME  547



>ref|XP_006657490.1| PREDICTED: uncharacterized protein LOC102719500 [Oryza brachyantha]
Length=702

 Score =   290 bits (741),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  726  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  547
            +QWEKNFYI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM 
Sbjct  542  DQWEKNFYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMA  601

Query  546  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPR  367
            TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+
Sbjct  602  TAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWETGYRITSTAATNDQAAFILSIPK  661

Query  366  RKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            RK +DETQETLRTSAFPS HVK+KW+KNLYIASIC+GRTVC
Sbjct  662  RKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICFGRTVC  702


 Score =   132 bits (331),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -3

Query  925  MKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVFL  746
            MKQRYHYNVAD RLQQH+EKGNEDGLYISCVAS+ANLWALIMDAGTGF SQV++LS VFL
Sbjct  476  MKQRYHYNVADNRLQQHIEKGNEDGLYISCVASSANLWALIMDAGTGFCSQVHELSPVFL  535

Query  745  HKDWIME  725
            HKDWIM+
Sbjct  536  HKDWIMD  542



>ref|XP_008655390.1| PREDICTED: uncharacterized protein LOC100502202 isoform X1 [Zea 
mays]
 gb|AFW84937.1| hypothetical protein ZEAMMB73_351651 [Zea mays]
Length=812

 Score =   290 bits (742),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSMTT
Sbjct  653  QWENNYYISAIAGAMNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMTT  712

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+R
Sbjct  713  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKR  772

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  773  KLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  811


 Score =   131 bits (330),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS+ANLWALIMDAGTGF+SQVY+LS +F
Sbjct  585  PMKQRYHYNVADARLHQHIEKGNEDGLFISSVASSANLWALIMDAGTGFTSQVYELSPIF  644

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  645  LHKDWIME  652



>ref|XP_010088042.1| Casein kinase I isoform delta [Morus notabilis]
 gb|EXB31261.1| Casein kinase I isoform delta [Morus notabilis]
Length=706

 Score =   302 bits (774),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 160/160 (100%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  606

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAGY+EQVVELDFLYPSEGIH+RWE+GYRITSMAATADQAAFILSIP+R
Sbjct  607  AGSRWGVVMSRNAGYAEQVVELDFLYPSEGIHKRWENGYRITSMAATADQAAFILSIPKR  666

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+MDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  667  KLMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  706


 Score =   119 bits (297),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  913  YHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVFLHKDW  734
            YHYNVAD RL+QHV+KGNEDGL+IS VASA NLWALIMDAGTGF+SQVY+LS+ FLHKDW
Sbjct  484  YHYNVADTRLRQHVDKGNEDGLFISSVASAGNLWALIMDAGTGFTSQVYELSTFFLHKDW  543

Query  733  IME  725
            IME
Sbjct  544  IME  546



>ref|NP_001058996.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAC83610.1| putative casein kinase 1, delta isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20910.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAG89932.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81591.1| hypothetical protein OsI_25061 [Oryza sativa Indica Group]
 gb|EEE66647.1| hypothetical protein OsJ_23261 [Oryza sativa Japonica Group]
Length=699

 Score =   290 bits (742),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -1

Query  726  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  547
            +QWEKNFYI++IAG+ANGSSLVVMSKGTPY+QQSYKVSESFPFKWINKKWKEGFHVTSM 
Sbjct  539  DQWEKNFYITAIAGSANGSSLVVMSKGTPYSQQSYKVSESFPFKWINKKWKEGFHVTSMA  598

Query  546  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPR  367
            TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS+AAT DQAAFILSIP+
Sbjct  599  TAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWETGYRITSIAATNDQAAFILSIPK  658

Query  366  RKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            RK +DETQETLRTSAFPS HVK+KW+KNLYIASIC+GRTVC
Sbjct  659  RKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICFGRTVC  699


 Score =   131 bits (329),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -3

Query  925  MKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVFL  746
            MKQRYHYNVAD RLQQH+EKGNEDGLYISCVAS+ANLWALIMDAGTGF SQV++LS VFL
Sbjct  473  MKQRYHYNVADNRLQQHIEKGNEDGLYISCVASSANLWALIMDAGTGFLSQVHELSPVFL  532

Query  745  HKDWIME  725
            HKDWIM+
Sbjct  533  HKDWIMD  539



>ref|XP_003569928.1| PREDICTED: uncharacterized protein LOC100845295 [Brachypodium 
distachyon]
Length=698

 Score =   290 bits (741),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWE ++YIS+IAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  539  QWENSYYISAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  598

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+R
Sbjct  599  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKR  658

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  659  KLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  697


 Score =   131 bits (330),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS+ANLWALIMDAGTGF+SQVY+LS +F
Sbjct  471  PMKQRYHYNVADARLHQHIEKGNEDGLFISSVASSANLWALIMDAGTGFTSQVYELSPIF  530

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  531  LHKDWIME  538



>ref|XP_006644782.1| PREDICTED: uncharacterized protein LOC102714869 [Oryza brachyantha]
Length=701

 Score =   289 bits (740),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  542  QWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  601

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+G+SEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+R
Sbjct  602  AGSRWGVVMSRNSGFSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKR  661

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+MDETQETLRTSAFPS HVK+KW+KNLYIASICYGRTV
Sbjct  662  KLMDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTV  700


 Score =   131 bits (329),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS+ANLWALIMDAGTGF+SQVY+LS +F
Sbjct  474  PMKQRYHYNVADARLHQHIEKGNEDGLFISSVASSANLWALIMDAGTGFTSQVYELSPIF  533

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  534  LHKDWIME  541



>gb|ABF99312.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=522

 Score =   288 bits (737),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  363  QWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  422

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+R
Sbjct  423  AGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAAFILSIPKR  482

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  483  KPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  522


 Score =   132 bits (333),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGLYISCV+S+AN WALIMDAGTGF SQVY+LS VF
Sbjct  295  PMKQRYHYNVADSRLHQHIEKGNEDGLYISCVSSSANFWALIMDAGTGFCSQVYELSQVF  354

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  355  LHKDWIME  362



>ref|XP_010228600.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
 ref|XP_010228605.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
Length=709

 Score =   288 bits (738),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  550  QWEKNFYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMGT  609

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRNAGYS+QVVELDFLYPSEG+HRRWE+GYRITS A T DQAAFILSIP+R
Sbjct  610  AGNRWGVVMSRNAGYSDQVVELDFLYPSEGLHRRWETGYRITSSAGTPDQAAFILSIPKR  669

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRT C
Sbjct  670  KPMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTAC  709


 Score =   132 bits (331),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGLYISCVAS+ N WA+IMDAGTGF SQVY+LS +F
Sbjct  482  PMKQRYHYNVADSRLHQHIEKGNEDGLYISCVASSQNFWAIIMDAGTGFGSQVYELSQIF  541

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  542  LHKDWIME  549



>dbj|BAJ90552.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96313.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score =   290 bits (743),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  535  QWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  594

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+R
Sbjct  595  AGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKR  654

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  655  KLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  693


 Score =   129 bits (325),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVA+ RL QH+EKGNEDGL+IS VAS+ANLWALIMDAGTGF+SQVY+LS +F
Sbjct  467  PMKQRYHYNVAEARLHQHIEKGNEDGLFISSVASSANLWALIMDAGTGFTSQVYELSPIF  526

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  527  LHKDWIME  534



>ref|XP_004970128.1| PREDICTED: uncharacterized protein LOC101772174 [Setaria italica]
Length=697

 Score =   289 bits (739),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSMTT
Sbjct  538  QWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMTT  597

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+R
Sbjct  598  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKR  657

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+MDETQETLRTSAFPS HVKEKW+KNLYIASIC+GRTV
Sbjct  658  KLMDETQETLRTSAFPSNHVKEKWAKNLYIASICFGRTV  696


 Score =   131 bits (329),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS+ANLWALIMDAGTGF+SQVY+LS +F
Sbjct  470  PMKQRYHYNVADARLHQHIEKGNEDGLFISSVASSANLWALIMDAGTGFTSQVYELSPIF  529

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  530  LHKDWIME  537



>ref|NP_001152463.1| ATP binding protein [Zea mays]
 gb|ACG47741.1| ATP binding protein [Zea mays]
Length=704

 Score =   285 bits (729),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEK++YI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  545  QWEKSYYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  604

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+G+S QVVELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+R
Sbjct  605  AGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESGYRITSTAATNDQAAFILSMPKR  664

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTSAFPS+HVKEKW+KNLYIASICYGRTVC
Sbjct  665  KPMDETQETLRTSAFPSSHVKEKWAKNLYIASICYGRTVC  704


 Score =   135 bits (339),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGN+DGLY+SCVAS+ANLWALIMDAGTGF SQVY+LS VF
Sbjct  477  PMKQRYHYNVADSRLSQHIEKGNDDGLYVSCVASSANLWALIMDAGTGFCSQVYELSPVF  536

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  537  LHKDWIME  544



>ref|XP_008651588.1| PREDICTED: ATP binding protein isoform X1 [Zea mays]
 gb|ACR36803.1| unknown [Zea mays]
 tpg|DAA59714.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA59715.1| TPA: ATP binding protein isoform 2 [Zea mays]
Length=704

 Score =   285 bits (729),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEK++YI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  545  QWEKSYYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  604

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+G+S QVVELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+R
Sbjct  605  AGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESGYRITSTAATNDQAAFILSMPKR  664

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTSAFPS+HVKEKW+KNLYIASICYGRTVC
Sbjct  665  KPMDETQETLRTSAFPSSHVKEKWAKNLYIASICYGRTVC  704


 Score =   135 bits (339),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGN+DGLY+SCVAS+ANLWALIMDAGTGF SQVY+LS VF
Sbjct  477  PMKQRYHYNVADSRLSQHIEKGNDDGLYVSCVASSANLWALIMDAGTGFCSQVYELSPVF  536

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  537  LHKDWIME  544



>ref|XP_003557523.1| PREDICTED: uncharacterized protein LOC100821235 [Brachypodium 
distachyon]
Length=702

 Score =   286 bits (732),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -1

Query  726  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  547
            +QWEK+FYI++IAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM 
Sbjct  542  DQWEKSFYITAIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMA  601

Query  546  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPR  367
            TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE GYRITS AAT DQAAFILS P+
Sbjct  602  TAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWEQGYRITSSAATIDQAAFILSKPK  661

Query  366  RKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            RK +DETQETLRTSAFPS HVK+KW+KNLYIASICYGRTVC
Sbjct  662  RKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTVC  702


 Score =   134 bits (336),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RLQQH+EKGNEDGLYISCVAS+ NLWALIMDAGTGF SQVY+LS  F
Sbjct  475  PMKQRYHYNVADNRLQQHIEKGNEDGLYISCVASSLNLWALIMDAGTGFGSQVYELSPAF  534

Query  748  LHKDWIME  725
            LHKDWIM+
Sbjct  535  LHKDWIMD  542



>ref|XP_010672056.1| PREDICTED: uncharacterized protein LOC104888715 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=711

 Score =   287 bits (734),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 154/160 (96%), Gaps = 2/160 (1%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYISSIAGA NG+SLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTT
Sbjct  554  QWEKNFYISSIAGATNGASLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTT  613

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            A SRWGVVMSRNAG+++QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAF+LSIP+R
Sbjct  614  AASRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWESGYRITSMAATPDQAAFVLSIPKR  673

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTSAFPSTH  EKW+KNLYIASICYGRTVC
Sbjct  674  KTMDETQETLRTSAFPSTH--EKWAKNLYIASICYGRTVC  711


 Score =   133 bits (334),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QH++KGNEDGLYISCVASA NLWALIMDAGTGFS QV++LS+VF
Sbjct  486  PMKQRYHYNVADARLKQHIDKGNEDGLYISCVASATNLWALIMDAGTGFSCQVWELSNVF  545

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  546  LHKDWIME  553



>ref|NP_001044393.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAB89852.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF06307.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAH00219.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55461.1| hypothetical protein OsJ_03624 [Oryza sativa Japonica Group]
Length=698

 Score =   290 bits (742),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  539  QWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  598

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+G+SEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+R
Sbjct  599  AGSRWGVVMSRNSGFSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKR  658

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  659  KLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  697


 Score =   129 bits (325),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGN+DGL+IS VAS+ANLWALIMDAGTGF+SQVY+LS +F
Sbjct  471  PMKQRYHYNVADARLHQHIEKGNDDGLFISSVASSANLWALIMDAGTGFTSQVYELSPIF  530

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  531  LHKDWIME  538



>gb|ADE75678.1| unknown [Picea sitchensis]
Length=260

 Score =   284 bits (727),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYIS+IAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWI+KKWKEGF+VTSMTT
Sbjct  101  QWEKNFYISAIAGATNGSSLVVMSKGTPYTQQSYKVSDSFPFKWISKKWKEGFYVTSMTT  160

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWE+GYRIT+ AAT DQAAFILS+P+R
Sbjct  161  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWENGYRITATAATCDQAAFILSVPKR  220

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+ DETQETLRTSAFPSTHVKEKWSKNLYIA++CYGRTV
Sbjct  221  KLTDETQETLRTSAFPSTHVKEKWSKNLYIAAVCYGRTV  259


 Score =   135 bits (340),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGLYISCVAS  NLWA+IMDAGTGF++QVYDLS+VF
Sbjct  33   PMKQRYHYNVADARLHQHVEKGNEDGLYISCVASCTNLWAIIMDAGTGFTNQVYDLSAVF  92

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  93   LHKDWIME  100



>emb|CDY51243.1| BnaA03g06950D [Brassica napus]
Length=684

 Score =   287 bits (734),  Expect(2) = 8e-108, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  525  QWEKNYYISSIAGSDNGSSLVVMSKGTTYSQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  584

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWE+GYRITSMAATADQAAFILSIP+R
Sbjct  585  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITSMAATADQAAFILSIPKR  644

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  645  KMVDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  684


 Score =   132 bits (331),  Expect(2) = 8e-108, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV + RL+QH++KGNEDGL ISCVASAANLWALIMDAGTGF+SQVY+LS VF
Sbjct  457  PMKQRYHYNVGETRLRQHIQKGNEDGLLISCVASAANLWALIMDAGTGFTSQVYELSPVF  516

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  517  LHKDWIME  524



>gb|EMS51431.1| Casein kinase I isoform beta [Triticum urartu]
Length=695

 Score =   281 bits (720),  Expect(2) = 9e-108, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  726  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  547
            +QWEK+FYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM 
Sbjct  535  DQWEKSFYITAIAGALNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMA  594

Query  546  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPR  367
            TAG+RWGVVMSRN+GYSEQ+VELDFLYPSEGIHRRWE GYRITS AAT DQAAFILS P+
Sbjct  595  TAGNRWGVVMSRNSGYSEQIVELDFLYPSEGIHRRWEHGYRITSSAATGDQAAFILSKPK  654

Query  366  RKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            RK +DETQETLRTSAFPS HVK+KW+KNLYIASICYGRTV
Sbjct  655  RKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTV  694


 Score =   137 bits (345),  Expect(2) = 9e-108, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RLQQH+EKGNEDGLYISCVAS+ANLWALIMDAGTGF SQVY+LS VF
Sbjct  468  PMKQRYHYNVADNRLQQHIEKGNEDGLYISCVASSANLWALIMDAGTGFGSQVYELSPVF  527

Query  748  LHKDWIME  725
            LHKDWIM+
Sbjct  528  LHKDWIMD  535



>ref|XP_009132256.1| PREDICTED: uncharacterized protein LOC103856881 [Brassica rapa]
Length=676

 Score =   287 bits (734),  Expect(2) = 9e-108, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  517  QWEKNYYISSIAGSDNGSSLVVMSKGTTYSQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  576

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWE+GYRITSMAATADQAAFILSIP+R
Sbjct  577  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITSMAATADQAAFILSIPKR  636

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  637  KMVDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  676


 Score =   132 bits (331),  Expect(2) = 9e-108, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV + RL+QH++KGNEDGL ISCVASAANLWALIMDAGTGF+SQVY+LS VF
Sbjct  449  PMKQRYHYNVGETRLRQHIQKGNEDGLLISCVASAANLWALIMDAGTGFTSQVYELSPVF  508

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  509  LHKDWIME  516



>emb|CDX70801.1| BnaC03g08850D [Brassica napus]
Length=684

 Score =   287 bits (734),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKWKE FHVTSMTT
Sbjct  525  QWEKNYYISSIAGSDNGSSLVVMSKGTTYSQQSYKVSDSFPFKWINKKWKEDFHVTSMTT  584

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWE+GYRITSMAATADQAAFILSIP+R
Sbjct  585  AGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITSMAATADQAAFILSIPKR  644

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            KM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  645  KMVDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  684


 Score =   131 bits (330),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV + RL QHV+KGNEDGL ISCVASAANLWALIMDAGTGF+SQVY+LS VF
Sbjct  457  PMKQRYHYNVGETRLHQHVQKGNEDGLLISCVASAANLWALIMDAGTGFTSQVYELSPVF  516

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  517  LHKDWIME  524



>gb|EYU39997.1| hypothetical protein MIMGU_mgv1a002328mg [Erythranthe guttata]
Length=687

 Score =   280 bits (715),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 155/161 (96%), Gaps = 1/161 (1%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS IAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWI+KKWKEGFHVTSMT+
Sbjct  527  QWEKNYYISCIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWISKKWKEGFHVTSMTS  586

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVE+DF+YPSEGIHRRWESGYRITSMAAT DQ+AF+LSIPRR
Sbjct  587  AGSRWGVVMSRNSGYSEQVVEVDFVYPSEGIHRRWESGYRITSMAATTDQSAFVLSIPRR  646

Query  363  K-MMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MMDE QETLRTSAFPS+HVK KWS+NLYIAS+C+G TVC
Sbjct  647  KLMMDEAQETLRTSAFPSSHVKAKWSRNLYIASMCHGPTVC  687


 Score =   138 bits (348),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGLYISCVASAANLWALIMDAGTGF+SQVY+LS+VF
Sbjct  459  PMKQRYHYNVADSRLCQHVEKGNEDGLYISCVASAANLWALIMDAGTGFTSQVYELSAVF  518

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  519  LHKDWIME  526



>gb|EEC71557.1| hypothetical protein OsI_03913 [Oryza sativa Indica Group]
Length=647

 Score =   290 bits (741),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  488  QWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  547

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+G+SEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+R
Sbjct  548  AGSRWGVVMSRNSGFSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKR  607

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  608  KLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  646


 Score =   128 bits (321),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGN+DGL+IS VAS+ NLWALIMDAGTGF+SQVY+LS +F
Sbjct  420  PMKQRYHYNVADARLHQHIEKGNDDGLFISSVASSTNLWALIMDAGTGFTSQVYELSPIF  479

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  480  LHKDWIME  487



>gb|ERN03898.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda]
Length=705

 Score =   282 bits (721),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NG SLVVMSKGTPY+QQSYKVS+SFPFKWINKKW+EGF+VTSMTT
Sbjct  546  QWEKNYYISSIAGANNGGSLVVMSKGTPYSQQSYKVSDSFPFKWINKKWREGFYVTSMTT  605

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +G+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWE+G+RITS AAT DQAAFILS+P+R
Sbjct  606  SGNRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWENGFRITSTAATVDQAAFILSVPKR  665

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            KM DETQETLRTSAFPSTHVKEKWSKNLYIAS+CYGRTV
Sbjct  666  KMSDETQETLRTSAFPSTHVKEKWSKNLYIASVCYGRTV  704


 Score =   135 bits (339),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGLYISC+AS+ NLWALIMDAGTGF+SQVY+LS++F
Sbjct  478  PMKQRYHYNVADSRLHQHVEKGNEDGLYISCIASSLNLWALIMDAGTGFTSQVYELSAIF  537

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  538  LHKDWIME  545



>ref|XP_006842223.2| PREDICTED: casein kinase I isoform delta [Amborella trichopoda]
Length=594

 Score =   281 bits (719),  Expect(2) = 8e-107, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NG SLVVMSKGTPY+QQSYKVS+SFPFKWINKKW+EGF+VTSMTT
Sbjct  435  QWEKNYYISSIAGANNGGSLVVMSKGTPYSQQSYKVSDSFPFKWINKKWREGFYVTSMTT  494

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +G+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWE+G+RITS AAT DQAAFILS+P+R
Sbjct  495  SGNRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWENGFRITSTAATVDQAAFILSVPKR  554

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            KM DETQETLRTSAFPSTHVKEKWSKNLYIAS+CYGRTV
Sbjct  555  KMSDETQETLRTSAFPSTHVKEKWSKNLYIASVCYGRTV  593


 Score =   134 bits (338),  Expect(2) = 8e-107, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGLYISC+AS+ NLWALIMDAGTGF+SQVY+LS++F
Sbjct  367  PMKQRYHYNVADSRLHQHVEKGNEDGLYISCIASSLNLWALIMDAGTGFTSQVYELSAIF  426

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  427  LHKDWIME  434



>ref|NP_001152101.1| LOC100285738 [Zea mays]
 ref|XP_008668149.1| PREDICTED: LOC100285738 isoform X1 [Zea mays]
 gb|ACG45775.1| ATP binding protein [Zea mays]
 tpg|DAA42572.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA42573.1| TPA: ATP binding protein isoform 2 [Zea mays]
 tpg|DAA42574.1| TPA: ATP binding protein isoform 3 [Zea mays]
Length=704

 Score =   284 bits (726),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEK++YI++IAG++NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  545  QWEKSYYITAIAGSSNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  604

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+G+S QVVELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+R
Sbjct  605  AGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESGYRITSTAATNDQAAFILSMPKR  664

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTSAFPS+HVKEKW+KNLYIASIC+GRTVC
Sbjct  665  KPMDETQETLRTSAFPSSHVKEKWAKNLYIASICFGRTVC  704


 Score =   131 bits (330),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGN+DGLYIS VAS+ANLWALIMDAGTGF SQVY+LS VF
Sbjct  477  PMKQRYHYNVADSRLSQHIEKGNDDGLYISSVASSANLWALIMDAGTGFCSQVYELSPVF  536

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  537  LHKDWIME  544



>gb|ACN36158.1| unknown [Zea mays]
Length=704

 Score =   284 bits (726),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEK++YI++IAG++NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  545  QWEKSYYITAIAGSSNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  604

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+G+S QVVELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+R
Sbjct  605  AGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESGYRITSTAATNDQAAFILSMPKR  664

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTSAFPS+HVKEKW+KNLYIASIC+GRTVC
Sbjct  665  KPMDETQETLRTSAFPSSHVKEKWAKNLYIASICFGRTVC  704


 Score =   131 bits (330),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGN+DGLYIS VAS+ANLWALIMDAGTGF SQVY+LS VF
Sbjct  477  PMKQRYHYNVADSRLSQHIEKGNDDGLYISSVASSANLWALIMDAGTGFCSQVYELSPVF  536

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  537  LHKDWIME  544



>ref|XP_009366444.1| PREDICTED: uncharacterized protein LOC103956210 [Pyrus x bretschneideri]
Length=707

 Score =   299 bits (766),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWE NFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT
Sbjct  548  QWENNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  607

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRNAG+S+QVVELDF+YPSEGIHRRWESGYRITSMAATADQAAFILSIP+R
Sbjct  608  AGNRWGVVMSRNAGFSDQVVELDFVYPSEGIHRRWESGYRITSMAATADQAAFILSIPKR  667

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+MDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  668  KLMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  707


 Score =   115 bits (288),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV+KGNEDGLYIS VAS+++LWALIMDAGT F++QVY+LS+VF
Sbjct  480  PMKQRYHYNVADSRLHQHVDKGNEDGLYISSVASSSSLWALIMDAGTCFTAQVYELSTVF  539

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  540  LHKDWIME  547



>ref|XP_002466312.1| hypothetical protein SORBIDRAFT_01g005460 [Sorghum bicolor]
 gb|EER93310.1| hypothetical protein SORBIDRAFT_01g005460 [Sorghum bicolor]
Length=707

 Score =   283 bits (724),  Expect(2) = 5e-106, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI++IAGA NGSSL+VMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  548  QWEKNYYITAIAGATNGSSLIVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  607

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGV++SRNAGYS QVVELDFLYPSEGIHRRWE+GYRITS+AAT DQAAFILSIP+R
Sbjct  608  AGNRWGVIVSRNAGYSTQVVELDFLYPSEGIHRRWETGYRITSIAATPDQAAFILSIPKR  667

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQE LRTSAFPS+HVKEKW KNLYI+S+CYGRTVC
Sbjct  668  KPMDETQEILRTSAFPSSHVKEKWVKNLYISSVCYGRTVC  707


 Score =   129 bits (325),  Expect(2) = 5e-106, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGN+DGLYISCVAS+AN WA+IMDAGTGF SQVYDLS VF
Sbjct  480  PMKQRYHYNVADSRLHQHIEKGNQDGLYISCVASSANFWAVIMDAGTGFCSQVYDLSQVF  539

Query  748  LHKDWIME  725
            LHK+WI E
Sbjct  540  LHKEWITE  547



>emb|CDY02641.1| BnaC02g07940D [Brassica napus]
Length=686

 Score =   283 bits (723),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFP+KWINKKWKE FHVTSMTT
Sbjct  527  QWDKNYYISSIAGSDNGSSLVVMSKGTSYSQQSYKVSDSFPYKWINKKWKEDFHVTSMTT  586

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGV+MSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+R
Sbjct  587  AGNRWGVIMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKR  646

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  647  KLNDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  686


 Score =   128 bits (322),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV D RL  HV+KGNEDGL ISCVAS+ANLWALIMDAGTGF+SQVY+LS+VF
Sbjct  459  PMKQRYHYNVGDSRLDSHVQKGNEDGLLISCVASSANLWALIMDAGTGFTSQVYELSTVF  518

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  519  LHKEWIME  526



>emb|CDY53253.1| BnaA02g04010D [Brassica napus]
Length=762

 Score =   283 bits (723),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFP+KWINKKWKE FHVTSMTT
Sbjct  603  QWDKNYYISSIAGSDNGSSLVVMSKGTSYSQQSYKVSDSFPYKWINKKWKEDFHVTSMTT  662

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGV+MSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+R
Sbjct  663  AGNRWGVIMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKR  722

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  723  KLNDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  762


 Score =   127 bits (318),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV D RL  HV+KGNEDGL ISCVAS+ NLWALIMDAGTGF+SQVY+LS+VF
Sbjct  535  PMKQRYHYNVGDSRLDSHVQKGNEDGLLISCVASSVNLWALIMDAGTGFTSQVYELSTVF  594

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  595  LHKEWIME  602



>gb|EMT21659.1| Casein kinase I-RAG8-like protein [Aegilops tauschii]
Length=640

 Score =   275 bits (703),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  726  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  547
            +QWEK+FYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM 
Sbjct  480  DQWEKSFYITAIAGALNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMA  539

Query  546  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPR  367
            TAG+RWGVVMSRN+GYS Q+VELDFLYPSEGIH RWE GYRITS AAT DQAAFILS P+
Sbjct  540  TAGNRWGVVMSRNSGYSGQIVELDFLYPSEGIHWRWEHGYRITSSAATGDQAAFILSKPK  599

Query  366  RKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            RK +DETQETLRTSAFPS HVK+KW+KNLYIASICYGRTV
Sbjct  600  RKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTV  639


 Score =   135 bits (339),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RLQQH+EKGNEDGLYISCVAS+ANLWALIMDAGTGF SQV++LS VF
Sbjct  413  PMKQRYHYNVADNRLQQHIEKGNEDGLYISCVASSANLWALIMDAGTGFGSQVHELSPVF  472

Query  748  LHKDWIME  725
            LHKDWIM+
Sbjct  473  LHKDWIMD  480



>ref|XP_009126244.1| PREDICTED: uncharacterized protein LOC103851164 [Brassica rapa]
Length=684

 Score =   281 bits (720),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFP+KWINKKWKE FHVTSMTT
Sbjct  525  QWDKNYYISSIAGSDNGSSLVVMSKGTSYSQQSYKVSDSFPYKWINKKWKEDFHVTSMTT  584

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGV+MSRN+G+S+QVVELDFLYPS+GIHRRWE+GYRITSMAATADQAAFILSIP+R
Sbjct  585  AGNRWGVIMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITSMAATADQAAFILSIPKR  644

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  645  KLNDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  684


 Score =   127 bits (318),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV D RL  HV+KGNEDGL ISCVAS+ NLWALIMDAGTGF+SQVY+LS+VF
Sbjct  457  PMKQRYHYNVGDSRLDSHVQKGNEDGLLISCVASSVNLWALIMDAGTGFTSQVYELSTVF  516

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  517  LHKEWIME  524



>ref|XP_008797930.1| PREDICTED: uncharacterized protein LOC103712966 isoform X3 [Phoenix 
dactylifera]
Length=728

 Score =   277 bits (708),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  569  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  628

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+R
Sbjct  629  SGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKR  688

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  689  RPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  727


 Score =   131 bits (329),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+GNEDGL ISCVAS +NLWALIMDAGTGF+SQVY+LSS+F
Sbjct  501  PMKQRYHYNVADSRLAQHVERGNEDGLLISCVASCSNLWALIMDAGTGFTSQVYELSSLF  560

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  561  LHKEWIME  568



>ref|XP_008797915.1| PREDICTED: uncharacterized protein LOC103712966 isoform X1 [Phoenix 
dactylifera]
Length=732

 Score =   277 bits (708),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  573  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  632

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+R
Sbjct  633  SGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKR  692

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  693  RPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  731


 Score =   131 bits (329),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+GNEDGL ISCVAS +NLWALIMDAGTGF+SQVY+LSS+F
Sbjct  505  PMKQRYHYNVADSRLAQHVERGNEDGLLISCVASCSNLWALIMDAGTGFTSQVYELSSLF  564

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  565  LHKEWIME  572



>ref|XP_008797939.1| PREDICTED: uncharacterized protein LOC103712966 isoform X4 [Phoenix 
dactylifera]
Length=727

 Score =   277 bits (708),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  568  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  627

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+R
Sbjct  628  SGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKR  687

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  688  RPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  726


 Score =   131 bits (329),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+GNEDGL ISCVAS +NLWALIMDAGTGF+SQVY+LSS+F
Sbjct  500  PMKQRYHYNVADSRLAQHVERGNEDGLLISCVASCSNLWALIMDAGTGFTSQVYELSSLF  559

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  560  LHKEWIME  567



>ref|XP_008797922.1| PREDICTED: uncharacterized protein LOC103712966 isoform X2 [Phoenix 
dactylifera]
Length=731

 Score =   277 bits (708),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  572  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  631

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+R
Sbjct  632  SGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKR  691

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  692  RPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  730


 Score =   131 bits (329),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+GNEDGL ISCVAS +NLWALIMDAGTGF+SQVY+LSS+F
Sbjct  504  PMKQRYHYNVADSRLAQHVERGNEDGLLISCVASCSNLWALIMDAGTGFTSQVYELSSLF  563

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  564  LHKEWIME  571



>ref|XP_004981469.1| PREDICTED: uncharacterized protein LOC101783890 isoform X1 [Setaria 
italica]
 ref|XP_004981470.1| PREDICTED: uncharacterized protein LOC101783890 isoform X2 [Setaria 
italica]
 ref|XP_004981471.1| PREDICTED: uncharacterized protein LOC101783890 isoform X3 [Setaria 
italica]
 ref|XP_004981472.1| PREDICTED: uncharacterized protein LOC101783890 isoform X4 [Setaria 
italica]
 ref|XP_004981473.1| PREDICTED: uncharacterized protein LOC101783890 isoform X5 [Setaria 
italica]
Length=706

 Score =   283 bits (724),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM T
Sbjct  547  QWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMAT  606

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GY+ QVVELDFLYPSEGIH RWE+GYRITS AAT DQAAFILSIP+R
Sbjct  607  AGNRWGVVMSRNSGYATQVVELDFLYPSEGIHHRWETGYRITSTAATPDQAAFILSIPKR  666

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K MDETQETLRTSAFPS HVKEKW KNLYI+SICYGRTVC
Sbjct  667  KPMDETQETLRTSAFPSNHVKEKWVKNLYISSICYGRTVC  706


 Score =   124 bits (311),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGN+DGLYIS VAS+AN WALIMDAGTGF SQVY+LS +F
Sbjct  479  PMKQRYHYNVADSRLHQHIEKGNQDGLYISSVASSANFWALIMDAGTGFCSQVYELSQMF  538

Query  748  LHKDWIME  725
            LHK+WI E
Sbjct  539  LHKEWITE  546



>ref|XP_010936995.1| PREDICTED: casein kinase I isoform gamma-1-like isoform X1 [Elaeis 
guineensis]
Length=601

 Score =   278 bits (710),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  442  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  501

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+R
Sbjct  502  SGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKR  561

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPS HVK+KW+KNLY+AS+CYGRTV
Sbjct  562  KPGDETQETLRTSAFPSAHVKDKWAKNLYLASVCYGRTV  600


 Score =   128 bits (322),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+GNEDGL ISCVAS +NLWALIMDAGTGF+SQVY+LS +F
Sbjct  374  PMKQRYHYNVADSRLAQHVERGNEDGLLISCVASCSNLWALIMDAGTGFTSQVYELSPLF  433

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  434  LHKEWIME  441



>ref|XP_010936996.1| PREDICTED: casein kinase I isoform gamma-1-like isoform X2 [Elaeis 
guineensis]
Length=600

 Score =   278 bits (710),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  441  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  500

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+R
Sbjct  501  SGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKR  560

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPS HVK+KW+KNLY+AS+CYGRTV
Sbjct  561  KPGDETQETLRTSAFPSAHVKDKWAKNLYLASVCYGRTV  599


 Score =   128 bits (322),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+GNEDGL ISCVAS +NLWALIMDAGTGF+SQVY+LS +F
Sbjct  373  PMKQRYHYNVADSRLAQHVERGNEDGLLISCVASCSNLWALIMDAGTGFTSQVYELSPLF  432

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  433  LHKEWIME  440



>ref|XP_008787870.1| PREDICTED: uncharacterized protein LOC103705792 [Phoenix dactylifera]
Length=730

 Score =   275 bits (702),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN++ISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  571  QWEKNYFISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  630

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS+AAT DQAA ILS+P+R
Sbjct  631  SGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSVAATWDQAALILSVPKR  690

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  691  KPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  729


 Score =   130 bits (326),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD R+ QHVE+GNEDGL ISCVAS +NLWALIMDAGTGF+SQVY+LS +F
Sbjct  503  PMKQRYHYNVADARVAQHVERGNEDGLLISCVASCSNLWALIMDAGTGFTSQVYELSPLF  562

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  563  LHKDWIME  570



>ref|XP_006651899.1| PREDICTED: uncharacterized protein LOC102717146 [Oryza brachyantha]
Length=726

 Score =   278 bits (710),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  726  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  547
            +QWE+N+YI++IAGA NGSSLVVMSK T YTQQSYKVSESFP+KWINKKWKEGFHVTSM 
Sbjct  566  DQWEQNYYITAIAGANNGSSLVVMSKETSYTQQSYKVSESFPYKWINKKWKEGFHVTSMA  625

Query  546  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPR  367
            TAG+RWGVVMSRN GYS QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFIL++P+
Sbjct  626  TAGNRWGVVMSRNTGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAAFILTMPK  685

Query  366  RKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            RK +DETQETLRTS+FPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  686  RKPVDETQETLRTSSFPSTHVKEKWSKNLYIASICYGRTVC  726


 Score =   126 bits (316),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGLYIS V+S+AN WALIMDAGTGF SQVY+LS VF
Sbjct  499  PMKQRYHYNVADSRLHQHIEKGNEDGLYISSVSSSANFWALIMDAGTGFRSQVYELSQVF  558

Query  748  LHKDWIME  725
            LHK+WIM+
Sbjct  559  LHKNWIMD  566



>ref|XP_010939945.1| PREDICTED: uncharacterized protein LOC105058653 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939946.1| PREDICTED: uncharacterized protein LOC105058653 isoform X1 [Elaeis 
guineensis]
Length=729

 Score =   274 bits (700),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN++ISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  570  QWEKNYFISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  629

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS+AAT DQAA ILS+P+R
Sbjct  630  SGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSVAATWDQAALILSVPKR  689

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  690  KPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  728


 Score =   129 bits (325),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD R+ QHVE+GNEDGL ISCVAS +NLWALIMDAGTGF+SQVY+LS +F
Sbjct  502  PMKQRYHYNVADARVAQHVERGNEDGLLISCVASCSNLWALIMDAGTGFTSQVYELSPLF  561

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  562  LHKDWIME  569



>ref|XP_010939947.1| PREDICTED: uncharacterized protein LOC105058653 isoform X2 [Elaeis 
guineensis]
Length=725

 Score =   274 bits (700),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN++ISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  566  QWEKNYFISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  625

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS+AAT DQAA ILS+P+R
Sbjct  626  SGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSVAATWDQAALILSVPKR  685

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  686  KPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  724


 Score =   129 bits (325),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD R+ QHVE+GNEDGL ISCVAS +NLWALIMDAGTGF+SQVY+LS +F
Sbjct  498  PMKQRYHYNVADARVAQHVERGNEDGLLISCVASCSNLWALIMDAGTGFTSQVYELSPLF  557

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  558  LHKDWIME  565



>ref|XP_009382978.1| PREDICTED: uncharacterized protein LOC103970784 [Musa acuminata 
subsp. malaccensis]
Length=721

 Score =   276 bits (706),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI+S+AG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  562  QWEKNYYITSLAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWKEGFHVTSMAT  621

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITSM AT DQAA ILS+P+R
Sbjct  622  AGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSMGATWDQAALILSVPKR  681

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPS HVK+KW+KNLY+ASICYGRTV
Sbjct  682  KPGDETQETLRTSAFPSAHVKDKWAKNLYLASICYGRTV  720


 Score =   127 bits (319),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+GNEDGL ISCVAS +NLWA+IMDAGTGF+SQVY+LS  F
Sbjct  494  PMKQRYHYNVADARLAQHIERGNEDGLLISCVASCSNLWAIIMDAGTGFTSQVYELSPFF  553

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  554  LHKEWIME  561


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 64/123 (52%), Gaps = 5/123 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIH  448
            Y V+++   + I +  ++G  ++ + +  + W ++M    G++ QV EL  F    E I 
Sbjct  501  YNVADARLAQHIERGNEDGLLISCVASCSNLWAIIMDAGTGFTSQVYELSPFFLHKEWIM  560

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y ITS+A + + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  561  EQWEKNYYITSLAGSNNGSSLVVM---SKGTQYTQQSYKVSESFPFKWINKKWKEGFHVT  617

Query  270  SIC  262
            S+ 
Sbjct  618  SMA  620



>ref|XP_009404157.1| PREDICTED: uncharacterized protein LOC103987553 [Musa acuminata 
subsp. malaccensis]
Length=725

 Score =   275 bits (703),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  726  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  547
            +QWEKN+YI+S+AGA NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKWKEGFHVTSM 
Sbjct  565  DQWEKNYYITSLAGANNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWKEGFHVTSMA  624

Query  546  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPR  367
            TAG+RWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW+ GYRITSMAAT DQAA ILS+P+
Sbjct  625  TAGTRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGYRITSMAATWDQAALILSVPK  684

Query  366  RKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            RK  DETQETLRTS+FPS HVK+KW+KNLY+ASICYGRTV
Sbjct  685  RKPGDETQETLRTSSFPSAHVKDKWAKNLYLASICYGRTV  724


 Score =   127 bits (318),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+GNEDGL ISCVAS  NLWALIMDAGTGF+SQVY+LS  F
Sbjct  498  PMKQRYHYNVADARLAQHVERGNEDGLLISCVASCTNLWALIMDAGTGFTSQVYELSPFF  557

Query  748  LHKDWIME  725
            LHK+WIM+
Sbjct  558  LHKEWIMD  565



>ref|XP_010534909.1| PREDICTED: serine/threonine-protein kinase STE20-like [Tarenaya 
hassleriana]
Length=703

 Score =   278 bits (710),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT +TQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  544  QWEKNYYISSIAGANNGSSLVVMSKGTQFTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  603

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR
Sbjct  604  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRR  663

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+CYGRTV
Sbjct  664  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLCYGRTV  702


 Score =   124 bits (310),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCVAS +NLWALIMDAGTGF+SQVY+LS VF
Sbjct  476  PMKQRYHYNVADIRLAQHIERGIADGLLISCVASCSNLWALIMDAGTGFTSQVYELSPVF  535

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  536  LHKEWIME  543



>ref|XP_010542444.1| PREDICTED: serine/threonine-protein kinase STE20-like [Tarenaya 
hassleriana]
Length=703

 Score =   277 bits (709),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT +TQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  544  QWEKNYYISSIAGANNGSSLVVMSKGTQFTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  603

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIH+RW+SG+RITS AAT DQAA ILSIPRR
Sbjct  604  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHKRWDSGFRITSTAATTDQAALILSIPRR  663

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+CYGRTV
Sbjct  664  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLCYGRTV  702


 Score =   124 bits (310),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCVAS +NLWALIMDAGTGF+SQVY+LS VF
Sbjct  476  PMKQRYHYNVADIRLAQHIERGIADGLLISCVASCSNLWALIMDAGTGFTSQVYELSPVF  535

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  536  LHKEWIME  543



>ref|XP_001770883.1| predicted protein [Physcomitrella patens]
 gb|EDQ64213.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   273 bits (699),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYIS+IAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  444  QWEKNFYISAIAGANNGSSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWREGFYVTSMAT  503

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRR
Sbjct  504  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRR  563

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  564  KPADETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  602


 Score =   127 bits (320),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGLYIS VAS  NLWALIMDAGTGF++QVY+LS VF
Sbjct  376  PMKQRYHYNVADSRLTQHVEKGNEDGLYISSVASCTNLWALIMDAGTGFTAQVYELSHVF  435

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  436  LHKEWIME  443



>ref|XP_010552201.1| PREDICTED: serine/threonine-protein kinase ste20-like [Tarenaya 
hassleriana]
Length=702

 Score =   281 bits (718),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAG+ NGSSLVVMSKGT +TQQSYKVS+SFPFKWINKKWKEGFHVTSM T
Sbjct  543  QWEKNYYISSIAGSNNGSSLVVMSKGTQFTQQSYKVSDSFPFKWINKKWKEGFHVTSMAT  602

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRW SGYRITS AATADQ A +LSIPRR
Sbjct  603  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWNSGYRITSTAATADQTALVLSIPRR  662

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+ASICYGRTV
Sbjct  663  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASICYGRTV  701


 Score =   120 bits (301),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKG  DGL ISCVAS +NL ALIMDAGTGF+SQVY+LS VF
Sbjct  475  PMKQRYHYNVADIRLAQHIEKGIADGLLISCVASCSNLCALIMDAGTGFTSQVYELSPVF  534

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  535  LHKEWIME  542



>ref|XP_001764211.1| predicted protein [Physcomitrella patens]
 gb|EDQ71052.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   273 bits (698),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYIS+IAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  444  QWEKNFYISAIAGANNGSSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWREGFYVTSMAT  503

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRR
Sbjct  504  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRR  563

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  564  KPADETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  602


 Score =   127 bits (320),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGLYIS VAS  NLWALIMDAGTGF++QVY+LS VF
Sbjct  376  PMKQRYHYNVADSRLTQHVEKGNEDGLYISSVASCTNLWALIMDAGTGFTAQVYELSHVF  435

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  436  LHKEWIME  443



>ref|XP_010257513.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
 ref|XP_010257516.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
 ref|XP_010257517.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
Length=726

 Score =   272 bits (696),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  567  QWEKNYYISSIAGATNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  626

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAA ILS+P+R
Sbjct  627  AGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAALILSVPKR  686

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTS FPSTHVKEKW+KNLY+AS+CYGRTV
Sbjct  687  KPGDETQETLRTSQFPSTHVKEKWAKNLYLASLCYGRTV  725


 Score =   128 bits (321),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+GN+DGL ISCVAS +NLWALIMDAGTGFSSQVY+LS  F
Sbjct  499  PMKQRYHYNVADARLAQHVERGNDDGLMISCVASCSNLWALIMDAGTGFSSQVYELSPYF  558

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  559  LHKEWIME  566



>ref|XP_009413490.1| PREDICTED: uncharacterized protein LOC103994778 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413491.1| PREDICTED: uncharacterized protein LOC103994778 [Musa acuminata 
subsp. malaccensis]
Length=717

 Score =   275 bits (703),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  726  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  547
            +QWEKN+YI+S+AG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKWKEGFHVTSM 
Sbjct  557  DQWEKNYYITSLAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWKEGFHVTSMA  616

Query  546  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPR  367
            TAGSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT M AT DQAA ILS+P+
Sbjct  617  TAGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITCMGATWDQAALILSVPK  676

Query  366  RKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            RK  DETQETLRTSAFPS HVK+KW+KNLY+ASICYGRTV
Sbjct  677  RKPCDETQETLRTSAFPSAHVKDKWAKNLYLASICYGRTV  716


 Score =   125 bits (313),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH++KGNEDGL ISCVAS++NLWALIMDAGTGF+SQ+Y+LS  F
Sbjct  490  PMKQRYHYNVADARLAQHIDKGNEDGLLISCVASSSNLWALIMDAGTGFTSQIYELSPFF  549

Query  748  LHKDWIME  725
            LHK+W+M+
Sbjct  550  LHKEWVMD  557


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/122 (24%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIH  448
            Y V+++   + I+K  ++G  ++ + ++ + W ++M    G++ Q+ EL  F    E + 
Sbjct  497  YNVADARLAQHIDKGNEDGLLISCVASSSNLWALIMDAGTGFTSQIYELSPFFLHKEWVM  556

Query  447  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  271
             +WE  Y ITS+A + + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  557  DQWEKNYYITSLAGSNNGSSLVVM---SKGTQYTQQSYKVSESFPFKWINKKWKEGFHVT  613

Query  270  SI  265
            S+
Sbjct  614  SM  615



>ref|XP_009395056.1| PREDICTED: uncharacterized protein LOC103980386 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=680

 Score =   270 bits (691),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISS+AGA NGSSLVVMSKGTPY QQSYKVSESFPFKWINKKW+EGF+VT+M T
Sbjct  521  QWEKNYYISSLAGADNGSSLVVMSKGTPYAQQSYKVSESFPFKWINKKWREGFYVTAMAT  580

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RW VVMSRNAG+ EQVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRR
Sbjct  581  AGNRWAVVMSRNAGFLEQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRR  640

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K +DETQETLRTSAFPS HVKEKW+KNLY+AS+CYGRTV
Sbjct  641  KPVDETQETLRTSAFPSQHVKEKWAKNLYLASVCYGRTV  679


 Score =   129 bits (323),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH EKGNEDGL+ISCV+S++NLWALIMDAGTGFS+QVY+LS+ F
Sbjct  453  PMKQRYHYNVADIRLAQHTEKGNEDGLFISCVSSSSNLWALIMDAGTGFSAQVYELSASF  512

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  513  LHKEWIME  520



>ref|XP_010249770.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
 ref|XP_010249771.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
 ref|XP_010249772.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
 ref|XP_010249773.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
Length=706

 Score =   267 bits (683),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KN+YISS+AGA NGS++VVMSKGTPYTQQSYKVS+ FPFKWINKKW EGF VT M T
Sbjct  547  QWDKNYYISSVAGATNGSAVVVMSKGTPYTQQSYKVSDVFPFKWINKKWNEGFFVTCMAT  606

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGS+WG+VMSRNAG+S QVVELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS P+R
Sbjct  607  AGSKWGIVMSRNAGFSNQVVELDFLYPSEGIHRRWESGYRITSAAATTDQAAFILSTPKR  666

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  D TQETLRTSAFPS HVK+KWSKNLYIASICYGRTV
Sbjct  667  KSPDVTQETLRTSAFPSNHVKDKWSKNLYIASICYGRTV  705


 Score =   132 bits (331),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV D RL QHVEKG EDGLY+SC+AS+ANLWA+IMDAGTGF+SQVYDLS +F
Sbjct  479  PMKQRYHYNVMDSRLCQHVEKGKEDGLYVSCIASSANLWAIIMDAGTGFTSQVYDLSPIF  538

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  539  LHKDWIME  546



>ref|XP_009395055.1| PREDICTED: uncharacterized protein LOC103980386 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=684

 Score =   270 bits (691),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISS+AGA NGSSLVVMSKGTPY QQSYKVSESFPFKWINKKW+EGF+VT+M T
Sbjct  525  QWEKNYYISSLAGADNGSSLVVMSKGTPYAQQSYKVSESFPFKWINKKWREGFYVTAMAT  584

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RW VVMSRNAG+ EQVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRR
Sbjct  585  AGNRWAVVMSRNAGFLEQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRR  644

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K +DETQETLRTSAFPS HVKEKW+KNLY+AS+CYGRTV
Sbjct  645  KPVDETQETLRTSAFPSQHVKEKWAKNLYLASVCYGRTV  683


 Score =   129 bits (323),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH EKGNEDGL+ISCV+S++NLWALIMDAGTGFS+QVY+LS+ F
Sbjct  457  PMKQRYHYNVADIRLAQHTEKGNEDGLFISCVSSSSNLWALIMDAGTGFSAQVYELSASF  516

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  517  LHKEWIME  524



>ref|XP_007024284.1| Casein kinase I protein isoform 1 [Theobroma cacao]
 gb|EOY26906.1| Casein kinase I protein isoform 1 [Theobroma cacao]
Length=727

 Score =   274 bits (701),  Expect(2) = 8e-102, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NG SLVVMS+GT Y+QQSYKVSESFPFKWINKKWKEGFHVTSM T
Sbjct  568  QWEKNYYISAIAGATNGFSLVVMSRGTQYSQQSYKVSESFPFKWINKKWKEGFHVTSMAT  627

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSR AG+S+QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRR
Sbjct  628  SGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDCGYRITATAATWDQAAFVLSVPRR  687

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K MDETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  688  KPMDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  726


 Score =   124 bits (312),  Expect(2) = 8e-102, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS  NLWALIMDAGTGFSSQVY+LS  F
Sbjct  500  PMKQRYHYNVADGRLAQHIEKGNEDGLFISSVASCQNLWALIMDAGTGFSSQVYELSPHF  559

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  560  LHKEWIME  567



>ref|XP_010656334.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656335.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656336.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
Length=700

 Score =   272 bits (696),  Expect(2) = 9e-102, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KNFYI+S+AGA+NG++LVVMSKGTPY QQSYKVS+ FPFKWINKKWKEGF VTSMTT
Sbjct  541  QWDKNFYITSVAGASNGNALVVMSKGTPYNQQSYKVSDVFPFKWINKKWKEGFFVTSMTT  600

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWG+VMSRNAG+S QVVELDFLYPSEGIHRRWESGYRITS AATADQAAFILS  +R
Sbjct  601  AGSRWGIVMSRNAGFSNQVVELDFLYPSEGIHRRWESGYRITSTAATADQAAFILSTSKR  660

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +  D TQETLRTSAFP THVK+KWSKNLYIASICYGRTV
Sbjct  661  RTQDVTQETLRTSAFPCTHVKDKWSKNLYIASICYGRTV  699


 Score =   126 bits (317),  Expect(2) = 9e-102, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -3

Query  925  MKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVFL  746
            MKQRYHYNV D RL QHVEKG EDGLYISCVAS+ NLWA+IMDAGTGF+SQVY+LS++FL
Sbjct  474  MKQRYHYNVMDSRLHQHVEKGREDGLYISCVASSTNLWAIIMDAGTGFTSQVYELSTIFL  533

Query  745  HKDWIME  725
            HK+WIME
Sbjct  534  HKEWIME  540



>ref|XP_008445007.1| PREDICTED: uncharacterized protein LOC103488176 [Cucumis melo]
Length=699

 Score =   269 bits (687),  Expect(2) = 9e-102, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  540  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  599

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG RW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRR
Sbjct  600  AGGRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATLDQAAFVLSVPRR  659

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  660  KPADETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  698


 Score =   130 bits (326),  Expect(2) = 9e-102, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+ISCVAS +NLWALIMDAGTGFS+QVY+LS  F
Sbjct  472  PMKQRYHYNVADMRLSQHIEKGNEDGLFISCVASCSNLWALIMDAGTGFSAQVYELSPYF  531

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  532  LHKEWIME  539



>ref|XP_012076668.1| PREDICTED: uncharacterized protein LOC105637701 isoform X1 [Jatropha 
curcas]
Length=666

 Score =   275 bits (702),  Expect(2) = 9e-102, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KN+YI+S+AG ANGS+LVVMSKGTPYTQQSYKVS+ FPFKWINKKWKEGF VTSMTT
Sbjct  507  QWDKNYYITSVAGTANGSALVVMSKGTPYTQQSYKVSDVFPFKWINKKWKEGFSVTSMTT  566

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGS+WG+VMSRNAGY  QVVELDFLYPSEGIHRRWESGYRITS AATADQAAFILS P+R
Sbjct  567  AGSKWGIVMSRNAGYPNQVVELDFLYPSEGIHRRWESGYRITSTAATADQAAFILSAPKR  626

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  D  QETLRTSAFPSTHVK+KWSKNLYIASICYGRTV
Sbjct  627  KSSDVAQETLRTSAFPSTHVKDKWSKNLYIASICYGRTV  665


 Score =   124 bits (311),  Expect(2) = 9e-102, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -3

Query  925  MKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVFL  746
            MKQRYHYNV D R+ QHVEKG EDGLYISCVAS+ANLWA+IMDAGTGF+SQV++LS +FL
Sbjct  440  MKQRYHYNVMDSRIDQHVEKGREDGLYISCVASSANLWAIIMDAGTGFTSQVHELSPIFL  499

Query  745  HKDWIME  725
            HK+WIME
Sbjct  500  HKEWIME  506


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V +S   + + K  ++G +++ + ++ + W ++M    G++ QV EL   FL+  E I
Sbjct  446  YNVMDSRIDQHVEKGREDGLYISCVASSANLWAIIMDAGTGFTSQVHELSPIFLH-KEWI  504

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +W+  Y ITS+A TA+ +A ++     K    TQ++ + S  FP   + +KW +   +
Sbjct  505  MEQWDKNYYITSVAGTANGSALVV---MSKGTPYTQQSYKVSDVFPFKWINKKWKEGFSV  561

Query  273  ASI  265
             S+
Sbjct  562  TSM  564



>ref|XP_012076669.1| PREDICTED: uncharacterized protein LOC105637701 isoform X2 [Jatropha 
curcas]
 gb|KDP33655.1| hypothetical protein JCGZ_07226 [Jatropha curcas]
Length=664

 Score =   275 bits (702),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KN+YI+S+AG ANGS+LVVMSKGTPYTQQSYKVS+ FPFKWINKKWKEGF VTSMTT
Sbjct  505  QWDKNYYITSVAGTANGSALVVMSKGTPYTQQSYKVSDVFPFKWINKKWKEGFSVTSMTT  564

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGS+WG+VMSRNAGY  QVVELDFLYPSEGIHRRWESGYRITS AATADQAAFILS P+R
Sbjct  565  AGSKWGIVMSRNAGYPNQVVELDFLYPSEGIHRRWESGYRITSTAATADQAAFILSAPKR  624

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  D  QETLRTSAFPSTHVK+KWSKNLYIASICYGRTV
Sbjct  625  KSSDVAQETLRTSAFPSTHVKDKWSKNLYIASICYGRTV  663


 Score =   124 bits (311),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -3

Query  925  MKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVFL  746
            MKQRYHYNV D R+ QHVEKG EDGLYISCVAS+ANLWA+IMDAGTGF+SQV++LS +FL
Sbjct  438  MKQRYHYNVMDSRIDQHVEKGREDGLYISCVASSANLWAIIMDAGTGFTSQVHELSPIFL  497

Query  745  HKDWIME  725
            HK+WIME
Sbjct  498  HKEWIME  504


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V +S   + + K  ++G +++ + ++ + W ++M    G++ QV EL   FL+  E I
Sbjct  444  YNVMDSRIDQHVEKGREDGLYISCVASSANLWAIIMDAGTGFTSQVHELSPIFLH-KEWI  502

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +W+  Y ITS+A TA+ +A ++     K    TQ++ + S  FP   + +KW +   +
Sbjct  503  MEQWDKNYYITSVAGTANGSALVV---MSKGTPYTQQSYKVSDVFPFKWINKKWKEGFSV  559

Query  273  ASI  265
             S+
Sbjct  560  TSM  562



>ref|XP_002960894.1| hypothetical protein SELMODRAFT_139482 [Selaginella moellendorffii]
 gb|EFJ38433.1| hypothetical protein SELMODRAFT_139482 [Selaginella moellendorffii]
Length=596

 Score =   272 bits (696),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYIS+IAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  437  QWEKNFYISAIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWREGFYVTSMAT  496

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRNAG+++QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRR
Sbjct  497  AGTRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDCGYRITATAATWDQAAFVLSVPRR  556

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  557  KPADETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  595


 Score =   126 bits (316),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -3

Query  925  MKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVFL  746
            MKQRYHYNVAD RL QHVEKGNEDGLYIS VAS +NLWALIMDAGTGF SQVY+LS+VFL
Sbjct  370  MKQRYHYNVADSRLAQHVEKGNEDGLYISSVASCSNLWALIMDAGTGFQSQVYELSNVFL  429

Query  745  HKDWIME  725
            HK+WIME
Sbjct  430  HKEWIME  436



>ref|XP_002967119.1| hypothetical protein SELMODRAFT_144765 [Selaginella moellendorffii]
 gb|EFJ31718.1| hypothetical protein SELMODRAFT_144765 [Selaginella moellendorffii]
Length=596

 Score =   272 bits (696),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYIS+IAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  437  QWEKNFYISAIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWREGFYVTSMAT  496

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRNAG+++QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRR
Sbjct  497  AGTRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDCGYRITATAATWDQAAFVLSVPRR  556

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  557  KPADETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  595


 Score =   126 bits (316),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -3

Query  925  MKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVFL  746
            MKQRYHYNVAD RL QHVEKGNEDGLYIS VAS +NLWALIMDAGTGF SQVY+LS+VFL
Sbjct  370  MKQRYHYNVADSRLAQHVEKGNEDGLYISSVASCSNLWALIMDAGTGFQSQVYELSNVFL  429

Query  745  HKDWIME  725
            HK+WIME
Sbjct  430  HKEWIME  436



>emb|CBI28086.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   272 bits (696),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KNFYI+S+AGA+NG++LVVMSKGTPY QQSYKVS+ FPFKWINKKWKEGF VTSMTT
Sbjct  470  QWDKNFYITSVAGASNGNALVVMSKGTPYNQQSYKVSDVFPFKWINKKWKEGFFVTSMTT  529

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWG+VMSRNAG+S QVVELDFLYPSEGIHRRWESGYRITS AATADQAAFILS  +R
Sbjct  530  AGSRWGIVMSRNAGFSNQVVELDFLYPSEGIHRRWESGYRITSTAATADQAAFILSTSKR  589

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +  D TQETLRTSAFP THVK+KWSKNLYIASICYGRTV
Sbjct  590  RTQDVTQETLRTSAFPCTHVKDKWSKNLYIASICYGRTV  628


 Score =   126 bits (316),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -3

Query  925  MKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVFL  746
            MKQRYHYNV D RL QHVEKG EDGLYISCVAS+ NLWA+IMDAGTGF+SQVY+LS++FL
Sbjct  403  MKQRYHYNVMDSRLHQHVEKGREDGLYISCVASSTNLWAIIMDAGTGFTSQVYELSTIFL  462

Query  745  HKDWIME  725
            HK+WIME
Sbjct  463  HKEWIME  469



>gb|KJB82582.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=696

 Score =   258 bits (660),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYK+SESFPFKWINKKWKEGFHVTSMTT
Sbjct  547  QWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKLSESFPFKWINKKWKEGFHVTSMTT  606

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGS WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+R
Sbjct  607  AGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKR  666

Query  363  KMMDETQETLRTSAFPSTHVK  301
            KMMDETQETLRTSAFPSTHVK
Sbjct  667  KMMDETQETLRTSAFPSTHVK  687


 Score =   139 bits (350),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QHVEKGNEDGL+ISCVASAANLWALIMDAGTGF+SQVY+LS+VF
Sbjct  479  PMKQRYHYNVADSRLRQHVEKGNEDGLFISCVASAANLWALIMDAGTGFTSQVYELSTVF  538

Query  748  LHKDWIME  725
            LHKDWIME
Sbjct  539  LHKDWIME  546



>ref|XP_011649731.1| PREDICTED: uncharacterized protein LOC101218249 [Cucumis sativus]
 gb|KGN62809.1| hypothetical protein Csa_2G373520 [Cucumis sativus]
Length=699

 Score =   268 bits (684),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  540  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  599

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG RW +VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRR
Sbjct  600  AGGRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATLDQAAFVLSVPRR  659

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  660  KPADETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  698


 Score =   130 bits (326),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+ISCVAS +NLWALIMDAGTGFS+QVY+LS  F
Sbjct  472  PMKQRYHYNVADMRLSQHIEKGNEDGLFISCVASCSNLWALIMDAGTGFSAQVYELSPYF  531

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  532  LHKEWIME  539



>ref|XP_006445886.1| hypothetical protein CICLE_v10014444mg [Citrus clementina]
 ref|XP_006492686.1| PREDICTED: uncharacterized protein LOC102618306 [Citrus sinensis]
 gb|ESR59126.1| hypothetical protein CICLE_v10014444mg [Citrus clementina]
 gb|KDO62936.1| hypothetical protein CISIN_1g048600mg [Citrus sinensis]
Length=707

 Score =   275 bits (702),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  548  QWEKNYYISSIAGATNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  607

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+SEQVVELDFLYPSEGIHRRW+ GYRITS AAT DQAA ILS+PRR
Sbjct  608  AGSRWGVVMSRNAGFSEQVVELDFLYPSEGIHRRWDGGYRITSTAATCDQAALILSVPRR  667

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  668  KPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  706


 Score =   122 bits (307),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCVAS +NLWALIMDAGTGF+SQVY+LS  F
Sbjct  480  PMKQRYHYNVADARLAQHIERGMADGLLISCVASCSNLWALIMDAGTGFTSQVYELSPFF  539

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  540  LHKEWIME  547



>gb|KHF98002.1| hypothetical protein F383_12939 [Gossypium arboreum]
Length=668

 Score =   288 bits (737),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI+S+AGA N SSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGF+VTSMTT
Sbjct  509  QWEKNYYITSVAGANNESSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVTSMTT  568

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+R
Sbjct  569  AGTRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATVDQAAFILSIPKR  628

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  D+TQETLRT+AFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  629  KTTDDTQETLRTTAFPSTHVKEKWAKNLYIASICYGRTV  667


 Score =   109 bits (272),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 54/68 (79%), Gaps = 11/68 (16%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV KGNEDGL+ISCVASAANLWALIMDAGTGFSSQ        
Sbjct  452  PMKQRYHYNVADLRLSQHVSKGNEDGLFISCVASAANLWALIMDAGTGFSSQ--------  503

Query  748  LHKDWIME  725
               DWIME
Sbjct  504  ---DWIME  508



>ref|XP_006407187.1| hypothetical protein EUTSA_v10020172mg [Eutrema salsugineum]
 gb|ESQ48640.1| hypothetical protein EUTSA_v10020172mg [Eutrema salsugineum]
Length=703

 Score =   275 bits (702),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKEGFHVTSM T
Sbjct  544  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWKEGFHVTSMAT  603

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR
Sbjct  604  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRR  663

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  664  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  702


 Score =   122 bits (305),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  476  PMKQRYHYNVADIRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  535

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  536  LHKEWIME  543



>ref|XP_008367866.1| PREDICTED: casein kinase I [Malus domestica]
Length=540

 Score =   269 bits (688),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KN+YIS IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGFHVT+M T
Sbjct  381  QWDKNYYISXIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFHVTAMAT  440

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRR
Sbjct  441  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRR  500

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+ DETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  501  KLADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  539


 Score =   127 bits (318),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS++NLWALIMDAGTGFS+QVY+LSS F
Sbjct  313  PMKQRYHYNVADVRLSQHIEKGNEDGLFISSVASSSNLWALIMDAGTGFSAQVYELSSYF  372

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  373  LHKEWIME  380



>ref|XP_009406168.1| PREDICTED: uncharacterized protein LOC103989128 [Musa acuminata 
subsp. malaccensis]
Length=685

 Score =   271 bits (692),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  726  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  547
            +QW+KN+YI+++AGA N SSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VT+M 
Sbjct  525  DQWDKNYYITALAGANNVSSLVVMSKGTQYVQQSYKVSESFPFKWINKKWREGFYVTAMA  584

Query  546  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPR  367
            TAG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PR
Sbjct  585  TAGTRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGYRITATAATMDQAAFVLSVPR  644

Query  366  RKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            RK  DETQETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  645  RKPTDETQETLRTSAFPSQHVKEKWAKNLYIASVCYGRTV  684


 Score =   125 bits (314),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+ISCVAS +NLWALIMDAGT F+SQVY+LS  F
Sbjct  458  PMKQRYHYNVADIRLAQHIEKGNEDGLFISCVASCSNLWALIMDAGTNFTSQVYELSPNF  517

Query  748  LHKDWIME  725
            LHK+WIM+
Sbjct  518  LHKEWIMD  525



>gb|KJB56821.1| hypothetical protein B456_009G137100 [Gossypium raimondii]
Length=719

 Score =   272 bits (696),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NG SLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  560  QWEKNYYISAIAGATNGGSLVVMSKGTSYLQQSYKVSESFPFKWINKKWREGFHVTSMAT  619

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRR
Sbjct  620  SGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRR  679

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  680  RPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  718


 Score =   124 bits (310),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL++S VAS  NLWALIMDAGTGFS+QVY+LS  F
Sbjct  492  PMKQRYHYNVADGRLAQHIEKGNEDGLFVSSVASCQNLWALIMDAGTGFSAQVYELSPYF  551

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  552  LHKEWIME  559



>ref|XP_010249522.1| PREDICTED: uncharacterized protein LOC104592067 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score =   270 bits (691),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  534  QWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMAT  593

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSR+AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRR
Sbjct  594  AGSRWGVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRR  653

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVK+KW+KNLYIAS+CYGRTV
Sbjct  654  KPADETQETLRTSAFPSTHVKDKWAKNLYIASVCYGRTV  692


 Score =   125 bits (315),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS +NLWALIMDAGTGF++QVY+LS  F
Sbjct  466  PMKQRYHYNVADARLAQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFTAQVYELSPCF  525

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  526  LHKEWIME  533



>gb|KHG14825.1| hypothetical protein F383_08945 [Gossypium arboreum]
Length=719

 Score =   271 bits (693),  Expect(2) = 7e-101, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NG SLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  560  QWEKNYYISAIAGATNGGSLVVMSKGTSYLQQSYKVSESFPFKWINKKWREGFHVTSMAT  619

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSR AG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQAAF+LS+PRR
Sbjct  620  SGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQAAFVLSVPRR  679

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  680  RPTDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  718


 Score =   124 bits (312),  Expect(2) = 7e-101, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS  NLWALIMDAGTGFS+QVY+LS  F
Sbjct  492  PMKQRYHYNVADGRLAQHIEKGNEDGLFISSVASCQNLWALIMDAGTGFSAQVYELSPYF  551

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  552  LHKEWIME  559



>gb|KHN24964.1| Casein kinase I isoform alpha [Glycine soja]
Length=708

 Score =   273 bits (699),  Expect(2) = 7e-101, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  549  QWEKNYYITSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  608

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILSIPRR
Sbjct  609  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSIPRR  668

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            +  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  669  RPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  708


 Score =   122 bits (306),  Expect(2) = 7e-101, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+G  DGL ISCVAS +NLWALIMDAGTGFSSQVY LS  F
Sbjct  481  PMKQRYHYNVADARLAQHVERGIADGLLISCVASCSNLWALIMDAGTGFSSQVYKLSPFF  540

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  541  LHKEWIME  548



>ref|XP_010249521.1| PREDICTED: uncharacterized protein LOC104592067 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score =   270 bits (691),  Expect(2) = 7e-101, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  538  QWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMAT  597

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSR+AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRR
Sbjct  598  AGSRWGVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRR  657

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVK+KW+KNLYIAS+CYGRTV
Sbjct  658  KPADETQETLRTSAFPSTHVKDKWAKNLYIASVCYGRTV  696


 Score =   125 bits (315),  Expect(2) = 7e-101, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS +NLWALIMDAGTGF++QVY+LS  F
Sbjct  470  PMKQRYHYNVADARLAQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFTAQVYELSPCF  529

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  530  LHKEWIME  537



>ref|XP_003552750.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
 gb|KHN12581.1| Casein kinase I isoform alpha [Glycine soja]
Length=672

 Score =   273 bits (698),  Expect(2) = 9e-101, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  513  QWEKNYYITSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  572

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILSIPRR
Sbjct  573  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSIPRR  632

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            +  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  633  RPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  672


 Score =   122 bits (306),  Expect(2) = 9e-101, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+G  DGL ISCVAS +NLWALIMDAGTGFSSQVY LS  F
Sbjct  445  PMKQRYHYNVADARLAQHVERGIADGLLISCVASCSNLWALIMDAGTGFSSQVYKLSPFF  504

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  505  LHKEWIME  512



>ref|XP_003532324.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
Length=672

 Score =   273 bits (698),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  513  QWEKNYYITSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  572

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILSIPRR
Sbjct  573  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSIPRR  632

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            +  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  633  RPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  672


 Score =   122 bits (306),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+G  DGL ISCVAS +NLWALIMDAGTGFSSQVY LS  F
Sbjct  445  PMKQRYHYNVADARLAQHVERGIADGLLISCVASCSNLWALIMDAGTGFSSQVYKLSPFF  504

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  505  LHKEWIME  512



>ref|XP_007139114.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
 gb|ESW11108.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
Length=675

 Score =   273 bits (697),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  516  QWEKNFYITSIAGANNGSSLVVMSKGTHYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  575

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GY++QV+ELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILSIPRR
Sbjct  576  AGSRWGVVMSRNSGYTDQVIELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSIPRR  635

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            +  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  636  RPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  675


 Score =   122 bits (306),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+G  DGL ISCVAS +NLWALIMDAGTGFSSQVY LS  F
Sbjct  448  PMKQRYHYNVADARLAQHVERGIADGLLISCVASCSNLWALIMDAGTGFSSQVYKLSPFF  507

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  508  LHKEWIME  515



>ref|XP_003536792.1| PREDICTED: uncharacterized protein LOC100783819 [Glycine max]
Length=672

 Score =   275 bits (704),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KNFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  513  QWDKNFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMAT  572

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQ+A ILSIPRR
Sbjct  573  AGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSALILSIPRR  632

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTS FPSTHVK+KWSKNLY+A +CYGRTVC
Sbjct  633  KLSDETQETLRTSQFPSTHVKDKWSKNLYLACLCYGRTVC  672


 Score =   119 bits (299),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV+D RL+QHVE+G  DGL ISCV+S  NLWALIMDAGTGF++QVY LS+ F
Sbjct  445  PMKQRYHYNVSDARLEQHVERGVADGLLISCVSSCCNLWALIMDAGTGFTAQVYKLSTFF  504

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  505  LHKEWIME  512



>ref|XP_002882838.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59097.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   273 bits (699),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  544  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  603

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR
Sbjct  604  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRR  663

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  664  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  702


 Score =   121 bits (304),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  476  PMKQRYHYNVADIRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  535

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  536  LHKEWIME  543



>ref|XP_006297084.1| hypothetical protein CARUB_v10013087mg [Capsella rubella]
 gb|EOA29982.1| hypothetical protein CARUB_v10013087mg [Capsella rubella]
Length=704

 Score =   273 bits (698),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  545  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  604

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR
Sbjct  605  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRR  664

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  665  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  703


 Score =   121 bits (304),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  477  PMKQRYHYNVADIRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  536

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  537  LHKEWIME  544



>ref|XP_010465212.1| PREDICTED: uncharacterized protein LOC104745616 [Camelina sativa]
Length=714

 Score =   273 bits (699),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  555  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  614

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR
Sbjct  615  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRR  674

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  675  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  713


 Score =   121 bits (304),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  487  PMKQRYHYNVADIRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  546

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  547  LHKEWIME  554



>gb|KFK38714.1| hypothetical protein AALP_AA3G150500 [Arabis alpina]
Length=700

 Score =   273 bits (699),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  541  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  600

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR
Sbjct  601  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRR  660

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  661  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  699


 Score =   121 bits (304),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  473  PMKQRYHYNVADIRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  532

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  533  LHKEWIME  540



>gb|KHN27094.1| Casein kinase I [Glycine soja]
Length=657

 Score =   275 bits (703),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KNFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  498  QWDKNFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMAT  557

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQ+A ILSIPRR
Sbjct  558  AGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSALILSIPRR  617

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTS FP THVKEKWSKNLY+A +CYGRTVC
Sbjct  618  KLSDETQETLRTSQFPGTHVKEKWSKNLYLACLCYGRTVC  657


 Score =   119 bits (299),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV+D RL+QHVE+G  DGL ISCV+S  NLWALIMDAGTGF++QVY LS+ F
Sbjct  430  PMKQRYHYNVSDARLEQHVERGVADGLLISCVSSCCNLWALIMDAGTGFTAQVYKLSTFF  489

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  490  LHKEWIME  497



>ref|XP_002272679.2| PREDICTED: serine/threonine-protein kinase STE20 [Vitis vinifera]
Length=695

 Score =   267 bits (682),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VT+M T
Sbjct  536  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFYVTAMAT  595

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQAAF+LS+PRR
Sbjct  596  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQAAFVLSVPRR  655

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  656  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  694


 Score =   127 bits (320),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGLYIS VAS +NLWALIMDAGTGFS+QVY+LS  F
Sbjct  468  PMKQRYHYNVADVRLPQHVEKGNEDGLYISSVASCSNLWALIMDAGTGFSAQVYELSPYF  527

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  528  LHKEWIME  535



>ref|XP_010500960.1| PREDICTED: uncharacterized protein LOC104778257 isoform X1 [Camelina 
sativa]
Length=711

 Score =   273 bits (698),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  552  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  611

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR
Sbjct  612  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRR  671

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  672  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  710


 Score =   121 bits (304),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  484  PMKQRYHYNVADIRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  543

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  544  LHKEWIME  551



>ref|XP_010915404.1| PREDICTED: uncharacterized protein LOC105040538 [Elaeis guineensis]
Length=683

 Score =   271 bits (693),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M T
Sbjct  524  QWEKNYYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMAT  583

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW VVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRR
Sbjct  584  AGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRR  643

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPS HVKEKWSKNLYIASICYGRTV
Sbjct  644  KPADETQETLRTSAFPSQHVKEKWSKNLYIASICYGRTV  682


 Score =   123 bits (309),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS  NLWALIMDAGTG+++QVY+LS  F
Sbjct  456  PMKQRYHYNVADARLAQHIEKGNEDGLFISSVASCTNLWALIMDAGTGYTAQVYELSPCF  515

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  516  LHKEWIME  523



>ref|XP_002516524.1| casein kinase, putative [Ricinus communis]
 gb|EEF45865.1| casein kinase, putative [Ricinus communis]
Length=671

 Score =   269 bits (688),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  512  QWEKNFYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  571

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRR
Sbjct  572  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRR  631

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  632  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  670


 Score =   125 bits (313),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS +NLWALIMDAGTGF++QVY+LS  F
Sbjct  444  PMKQRYHYNVADMRLSQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFTAQVYELSPYF  503

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  504  LHKEWIME  511



>ref|XP_009367436.1| PREDICTED: uncharacterized protein LOC103957076 [Pyrus x bretschneideri]
Length=677

 Score =   266 bits (681),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGFHVT+M T
Sbjct  518  QWDKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFHVTAMAT  577

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            A SRW +VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRR
Sbjct  578  ARSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRR  637

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+ DETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  638  KLADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  676


 Score =   127 bits (320),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS++NLWALIMDAGTGFS+QVY+LSS F
Sbjct  450  PMKQRYHYNVADVRLSQHIEKGNEDGLFISSVASSSNLWALIMDAGTGFSAQVYELSSYF  509

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  510  LHKEWIME  517



>ref|XP_003556554.1| PREDICTED: uncharacterized protein LOC100807373 [Glycine max]
Length=669

 Score =   275 bits (702),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KNFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  510  QWDKNFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMAT  569

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQ+A ILSIPRR
Sbjct  570  AGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSALILSIPRR  629

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTS FP THVKEKWSKNLY+A +CYGRTVC
Sbjct  630  KLSDETQETLRTSQFPGTHVKEKWSKNLYLACLCYGRTVC  669


 Score =   119 bits (299),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV+D RL+QHVE+G  DGL ISCV+S  NLWALIMDAGTGF++QVY LS+ F
Sbjct  442  PMKQRYHYNVSDARLEQHVERGVADGLLISCVSSCCNLWALIMDAGTGFTAQVYKLSTFF  501

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  502  LHKEWIME  509



>ref|XP_008352012.1| PREDICTED: uncharacterized protein LOC103415457 [Malus domestica]
Length=677

 Score =   270 bits (691),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVT+M T
Sbjct  518  QWDKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFHVTAMAT  577

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+SEQVVELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRR
Sbjct  578  AGSRWAIVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRR  637

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  638  KPADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  676


 Score =   124 bits (310),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL IS VAS +NLWALIMDAGTGFS+QVY+LS  F
Sbjct  450  PMKQRYHYNVADVRLXQHIEKGNEDGLXISSVASCSNLWALIMDAGTGFSAQVYELSPYF  509

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  510  LHKEWIME  517



>ref|XP_010243375.1| PREDICTED: uncharacterized protein LOC104587456 [Nelumbo nucifera]
 ref|XP_010243376.1| PREDICTED: uncharacterized protein LOC104587456 [Nelumbo nucifera]
 ref|XP_010243377.1| PREDICTED: uncharacterized protein LOC104587456 [Nelumbo nucifera]
Length=728

 Score =   269 bits (688),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAG+ NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  569  QWEKNYYISSIAGSTNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  628

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+++QVVELDFLYPSEGIHRRW++GYRIT  AAT DQAA ILS+P+R
Sbjct  629  AGSRWGVVMSRNAGFNDQVVELDFLYPSEGIHRRWDNGYRITCAAATWDQAALILSVPKR  688

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTV
Sbjct  689  KPSDETQETLRTSQFPSTHVKEKWSKNLYLACVCYGRTV  727


 Score =   125 bits (313),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV+D RL+QHV++GNEDGL ISCVAS +NLWALIMDAGTG++SQVY+LS  F
Sbjct  501  PMKQRYHYNVSDTRLRQHVDRGNEDGLLISCVASCSNLWALIMDAGTGYTSQVYELSPYF  560

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  561  LHKEWIME  568



>ref|XP_010487127.1| PREDICTED: serine/threonine-protein kinase STE20-like [Camelina 
sativa]
Length=717

 Score =   273 bits (697),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  558  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  617

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR
Sbjct  618  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRR  677

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  678  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  716


 Score =   121 bits (304),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  490  PMKQRYHYNVADIRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  549

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  550  LHKEWIME  557



>ref|XP_009135319.1| PREDICTED: uncharacterized protein LOC103859531 [Brassica rapa]
Length=676

 Score =   270 bits (691),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  517  QWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  576

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQ A ILSIPRR
Sbjct  577  AGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQTALILSIPRR  636

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  637  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  675


 Score =   123 bits (309),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  449  PMKQRYHYNVADTRLAQHIERGTADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  508

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  509  LHKEWIME  516



>ref|XP_006476018.1| PREDICTED: uncharacterized protein LOC102627154 isoform X1 [Citrus 
sinensis]
Length=697

 Score =   268 bits (684),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  538  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  597

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRR
Sbjct  598  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRR  657

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  658  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  696


 Score =   126 bits (316),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS +NLWALIMDAGTGFS+QVY+LS  F
Sbjct  470  PMKQRYHYNVADARLSQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFSAQVYELSPYF  529

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  530  LHKEWIME  537



>ref|XP_006450715.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
 ref|XP_006450716.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
 gb|ESR63955.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
 gb|ESR63956.1| hypothetical protein CICLE_v10007635mg [Citrus clementina]
Length=697

 Score =   268 bits (684),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  538  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  597

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRR
Sbjct  598  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRR  657

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  658  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  696


 Score =   126 bits (316),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS +NLWALIMDAGTGFS+QVY+LS  F
Sbjct  470  PMKQRYHYNVADARLSQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFSAQVYELSPYF  529

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  530  LHKEWIME  537



>emb|CDY51730.1| BnaA01g37130D [Brassica napus]
Length=684

 Score =   273 bits (697),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  525  QWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  584

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G+RITS AAT DQAA ILSIPRR
Sbjct  585  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGFRITSTAATTDQAALILSIPRR  644

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  645  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  683


 Score =   121 bits (303),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  457  PMKQRYHYNVADIRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  516

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  517  LHKEWIME  524



>gb|KDO79859.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79860.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79861.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79862.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
 gb|KDO79863.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
Length=697

 Score =   268 bits (684),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  538  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  597

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRR
Sbjct  598  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRR  657

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  658  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  696


 Score =   126 bits (316),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS +NLWALIMDAGTGFS+QVY+LS  F
Sbjct  470  PMKQRYHYNVADARLSQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFSAQVYELSPYF  529

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  530  LHKEWIME  537



>gb|KHN37292.1| Casein kinase I [Glycine soja]
Length=590

 Score =   275 bits (702),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KNFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  431  QWDKNFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMAT  490

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQ+A ILSIPRR
Sbjct  491  AGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSALILSIPRR  550

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            K+ DETQETLRTS FPSTHVK+KWSKNLY+A +CYGRTVC
Sbjct  551  KLSDETQETLRTSQFPSTHVKDKWSKNLYLACLCYGRTVC  590


 Score =   119 bits (298),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV+D RL+QHVE+G  DGL ISCV+S  NLWALIMDAGTGF++QVY LS+ F
Sbjct  363  PMKQRYHYNVSDARLEQHVERGVADGLLISCVSSCCNLWALIMDAGTGFTAQVYKLSTFF  422

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  423  LHKEWIME  430



>ref|XP_009146466.1| PREDICTED: uncharacterized protein LOC103870106 [Brassica rapa]
Length=689

 Score =   272 bits (696),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  530  QWEKNYYISSIAGAANGSSLVVMSKGTQYSQQSYKVSDSFPFKWINKKWREGFHVTSMAT  589

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ GYRITS AAT DQAA ILSIPRR
Sbjct  590  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGYRITSTAATTDQAALILSIPRR  649

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            ++ DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  650  RLADETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  688


 Score =   121 bits (304),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  462  PMKQRYHYNVADSRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  521

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  522  LHKEWIME  529



>emb|CDX75726.1| BnaC03g38090D [Brassica napus]
Length=652

 Score =   272 bits (695),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  493  QWEKNYYISSIAGATNGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  552

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR
Sbjct  553  AGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRR  612

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  613  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  651


 Score =   122 bits (305),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  425  PMKQRYHYNVADTRLAQHIERGTADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  484

Query  748  LHKDWIME  725
            LHK+WI+E
Sbjct  485  LHKEWILE  492



>ref|XP_011626734.1| PREDICTED: uncharacterized protein LOC18443407 isoform X2 [Amborella 
trichopoda]
Length=699

 Score =   270 bits (689),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS++FPFKWINKKW+EGF VTSM T
Sbjct  540  QWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDTFPFKWINKKWREGFFVTSMAT  599

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+++QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PR+
Sbjct  600  AGSRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRK  659

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  660  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  698


 Score =   124 bits (310),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS  NLWALIMDAGTGF++Q Y+LS+ F
Sbjct  472  PMKQRYHYNVADGRLAQHIEKGNEDGLFISSVASCTNLWALIMDAGTGFTAQAYELSNCF  531

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  532  LHKEWIME  539



>ref|XP_010915613.1| PREDICTED: uncharacterized protein LOC105040627 isoform X6 [Elaeis 
guineensis]
Length=682

 Score =   266 bits (679),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  523  QWEKNYYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMAT  582

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW VVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+P+R
Sbjct  583  AGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPKR  642

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +  DETQETLRTSAFPS HVK+KW+KNLYIAS+CYGRTV
Sbjct  643  RPADETQETLRTSAFPSQHVKDKWAKNLYIASVCYGRTV  681


 Score =   127 bits (320),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+ISCVAS  NLWALIMDAGTGF++QVY+LS  F
Sbjct  455  PMKQRYHYNVADGRLAQHIEKGNEDGLFISCVASCTNLWALIMDAGTGFTAQVYELSPNF  514

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  515  LHKEWIME  522



>ref|XP_002283957.2| PREDICTED: uncharacterized protein LOC100253221 [Vitis vinifera]
Length=704

 Score =   271 bits (692),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  545  QWEKNFYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMAT  604

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSR AG+SEQVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAF+LS+PRR
Sbjct  605  SGSRWGVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFVLSVPRR  664

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K +DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  665  KPVDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  703


 Score =   122 bits (307),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH++KGNEDGL+IS VAS  NLWALIMDAGTGF++QVY+LS  F
Sbjct  477  PMKQRYHYNVADARLAQHIDKGNEDGLFISSVASCQNLWALIMDAGTGFTAQVYELSPYF  536

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  537  LHKEWIME  544



>ref|XP_006853659.1| PREDICTED: uncharacterized protein LOC18443407 isoform X1 [Amborella 
trichopoda]
 ref|XP_011626733.1| PREDICTED: uncharacterized protein LOC18443407 isoform X1 [Amborella 
trichopoda]
 gb|ERN15126.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda]
Length=703

 Score =   270 bits (689),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS++FPFKWINKKW+EGF VTSM T
Sbjct  544  QWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDTFPFKWINKKWREGFFVTSMAT  603

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+++QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PR+
Sbjct  604  AGSRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRK  663

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  664  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  702


 Score =   124 bits (310),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS  NLWALIMDAGTGF++Q Y+LS+ F
Sbjct  476  PMKQRYHYNVADGRLAQHIEKGNEDGLFISSVASCTNLWALIMDAGTGFTAQAYELSNCF  535

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  536  LHKEWIME  543



>gb|KJB21848.1| hypothetical protein B456_004G018000 [Gossypium raimondii]
Length=704

 Score =   272 bits (695),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  726  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  547
            +QWEKN+YISSIAG+ +G+SLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSMT
Sbjct  544  DQWEKNYYISSIAGSNSGNSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFYVTSMT  603

Query  546  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPR  367
            TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAA ILSIP+
Sbjct  604  TAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATLDQAALILSIPK  663

Query  366  RKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            RK  DETQETLRTS FPS HVKEKW+KNLY+A +CYGRTV
Sbjct  664  RKPGDETQETLRTSQFPSIHVKEKWAKNLYLACLCYGRTV  703


 Score =   121 bits (304),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKG  DGL ISCVAS  NLWALIMDAGTGF+SQVY+LS  F
Sbjct  477  PMKQRYHYNVADARLAQHVEKGIADGLLISCVASCTNLWALIMDAGTGFTSQVYELSPSF  536

Query  748  LHKDWIME  725
            LHK+WIM+
Sbjct  537  LHKEWIMD  544



>emb|CDX82524.1| BnaA03g32970D [Brassica napus]
Length=654

 Score =   270 bits (690),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  495  QWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  554

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQ A ILSIPRR
Sbjct  555  AGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQTALILSIPRR  614

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  615  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  653


 Score =   123 bits (308),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  427  PMKQRYHYNVADTRLAQHIERGTADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  486

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  487  LHKEWIME  494



>ref|XP_010915579.1| PREDICTED: uncharacterized protein LOC105040627 isoform X5 [Elaeis 
guineensis]
 ref|XP_010915587.1| PREDICTED: uncharacterized protein LOC105040627 isoform X5 [Elaeis 
guineensis]
 ref|XP_010915595.1| PREDICTED: uncharacterized protein LOC105040627 isoform X5 [Elaeis 
guineensis]
 ref|XP_010915604.1| PREDICTED: uncharacterized protein LOC105040627 isoform X5 [Elaeis 
guineensis]
Length=686

 Score =   266 bits (679),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  527  QWEKNYYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMAT  586

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW VVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+P+R
Sbjct  587  AGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPKR  646

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +  DETQETLRTSAFPS HVK+KW+KNLYIAS+CYGRTV
Sbjct  647  RPADETQETLRTSAFPSQHVKDKWAKNLYIASVCYGRTV  685


 Score =   127 bits (320),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+ISCVAS  NLWALIMDAGTGF++QVY+LS  F
Sbjct  459  PMKQRYHYNVADGRLAQHIEKGNEDGLFISCVASCTNLWALIMDAGTGFTAQVYELSPNF  518

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  519  LHKEWIME  526



>ref|XP_010267169.1| PREDICTED: uncharacterized protein LOC104604501 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score =   269 bits (688),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  534  QWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMAT  593

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW VVMSR+AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRR
Sbjct  594  AGSRWAVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRR  653

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  654  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  692


 Score =   124 bits (310),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH++KGN+DGL+IS VAS +NLWALIMDAGTGF SQVY+LSS F
Sbjct  466  PMKQRYHYNVADARLAQHIDKGNQDGLFISSVASCSNLWALIMDAGTGFVSQVYELSSFF  525

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  526  LHKEWIME  533



>emb|CAN77676.1| hypothetical protein VITISV_013722 [Vitis vinifera]
Length=710

 Score =   271 bits (692),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  551  QWEKNFYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMAT  610

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSR AG+SEQVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAF+LS+PRR
Sbjct  611  SGSRWGVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFVLSVPRR  670

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K +DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  671  KPVDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  709


 Score =   122 bits (307),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH++KGNEDGL+IS VAS  NLWALIMDAGTGF++QVY+LS  F
Sbjct  483  PMKQRYHYNVADARLAQHIDKGNEDGLFISSVASCQNLWALIMDAGTGFTAQVYELSPYF  542

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  543  LHKEWIME  550



>emb|CBI20566.3| unnamed protein product [Vitis vinifera]
Length=604

 Score =   266 bits (680),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VT+M T
Sbjct  445  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFYVTAMAT  504

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQAAF+LS+PRR
Sbjct  505  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQAAFVLSVPRR  564

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  565  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  603


 Score =   127 bits (318),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKGNEDGLYIS VAS +NLWALIMDAGTGFS+QVY+LS  F
Sbjct  377  PMKQRYHYNVADVRLPQHVEKGNEDGLYISSVASCSNLWALIMDAGTGFSAQVYELSPYF  436

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  437  LHKEWIME  444



>ref|XP_008462429.1| PREDICTED: uncharacterized protein LOC103500783 [Cucumis melo]
 ref|XP_008462430.1| PREDICTED: uncharacterized protein LOC103500783 [Cucumis melo]
 ref|XP_008462431.1| PREDICTED: uncharacterized protein LOC103500783 [Cucumis melo]
 ref|XP_008462432.1| PREDICTED: uncharacterized protein LOC103500783 [Cucumis melo]
Length=720

 Score =   268 bits (684),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI+++AG  NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  561  QWEKNYYITAVAGVINGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  620

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSR +G+S+QVVELDFLYPSEGIHRRW+ GYRIT+ AAT+DQAAF+LS+PRR
Sbjct  621  SGSRWGVVMSRGSGFSDQVVELDFLYPSEGIHRRWDCGYRITATAATSDQAAFVLSVPRR  680

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW KNLYIAS+CYGRTV
Sbjct  681  KPADETQETLRTSAFPSTHVKEKWGKNLYIASVCYGRTV  719


 Score =   125 bits (314),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS  NLWALIMDAGTGFSSQVY+LS  F
Sbjct  493  PMKQRYHYNVADARLAQHIEKGNEDGLFISSVASCQNLWALIMDAGTGFSSQVYELSPHF  552

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  553  LHKEWIME  560



>emb|CDY55141.1| BnaC01g44810D [Brassica napus]
Length=632

 Score =   272 bits (695),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  473  QWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  532

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G+RITS AAT DQAA ILSIPRR
Sbjct  533  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGFRITSTAATTDQAALILSIPRR  592

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  593  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  631


 Score =   121 bits (303),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  405  PMKQRYHYNVADIRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  464

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  465  LHKEWIME  472



>ref|XP_010267167.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267168.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score =   269 bits (688),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  538  QWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMAT  597

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW VVMSR+AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRR
Sbjct  598  AGSRWAVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRR  657

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  658  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  696


 Score =   124 bits (310),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH++KGN+DGL+IS VAS +NLWALIMDAGTGF SQVY+LSS F
Sbjct  470  PMKQRYHYNVADARLAQHIDKGNQDGLFISSVASCSNLWALIMDAGTGFVSQVYELSSFF  529

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  530  LHKEWIME  537



>gb|KDO79864.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
Length=512

 Score =   267 bits (683),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  353  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  412

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRR
Sbjct  413  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRR  472

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  473  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  511


 Score =   125 bits (315),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS +NLWALIMDAGTGFS+QVY+LS  F
Sbjct  285  PMKQRYHYNVADARLSQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFSAQVYELSPYF  344

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  345  LHKEWIME  352



>emb|CDX97505.1| BnaA05g25740D [Brassica napus]
Length=653

 Score =   271 bits (694),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  494  QWEKNYYISSIAGATNGSSLVVMSKGTQYSQQSYKVSDSFPFKWINKKWREGFHVTSMAT  553

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ GYRITS AAT DQAA ILSIPRR
Sbjct  554  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGYRITSTAATTDQAALILSIPRR  613

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            ++ DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  614  RLADETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  652


 Score =   121 bits (304),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  426  PMKQRYHYNVADSRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  485

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  486  LHKEWIME  493



>ref|XP_008220112.1| PREDICTED: uncharacterized protein LOC103320244 [Prunus mume]
Length=685

 Score =   266 bits (679),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KN+YIS+IAG +NGSSLVVMSKGT + QQSYKVSESFPFKWINKKW+EGF+VT+M T
Sbjct  526  QWDKNYYISAIAGTSNGSSLVVMSKGTQFLQQSYKVSESFPFKWINKKWREGFYVTAMAT  585

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+ G+RITS AAT DQAAF+LS+PRR
Sbjct  586  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDHGFRITSTAATWDQAAFVLSVPRR  645

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  646  KLADETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  684


 Score =   127 bits (319),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS +NLWALIMDAGTGFSSQVY+LS  F
Sbjct  458  PMKQRYHYNVADVRLSQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFSSQVYELSPYF  517

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  518  LHKEWIME  525



>ref|NP_187977.1| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAB01914.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AAL85021.1| putative casein kinase [Arabidopsis thaliana]
 gb|AAM51279.1| putative casein kinase [Arabidopsis thaliana]
 gb|AEE75390.1| protein kinase family protein [Arabidopsis thaliana]
Length=703

 Score =   272 bits (695),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA+NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  544  QWEKNYYISSIAGASNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  603

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR
Sbjct  604  AGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRR  663

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  664  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  702


 Score =   120 bits (302),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF+ QVY+LS VF
Sbjct  476  PMKQRYHYNVADIRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTHQVYELSPVF  535

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  536  LHKEWIME  543



>ref|XP_002283346.1| PREDICTED: uncharacterized protein LOC100263956 [Vitis vinifera]
Length=714

 Score =   271 bits (692),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWE+NFYISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  555  QWERNFYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  614

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQ+A ILS+P+R
Sbjct  615  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQSALILSVPKR  674

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  675  KPGDETQETLRTSQFPSTHVKEKWAKNLYLACVCYGRTV  713


 Score =   122 bits (305),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV++GN DGL ISCVAS +NLWALIMDAGTGF+ QVY+LS  F
Sbjct  487  PMKQRYHYNVADGRLAQHVDRGNADGLLISCVASCSNLWALIMDAGTGFTHQVYELSPFF  546

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  547  LHKEWIME  554



>ref|XP_009787105.1| PREDICTED: uncharacterized protein LOC104235125 [Nicotiana sylvestris]
 ref|XP_009787106.1| PREDICTED: uncharacterized protein LOC104235125 [Nicotiana sylvestris]
Length=710

 Score =   266 bits (679),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLV+MSKGT Y QQSYKVSESFPFKWINKKWKEGF+VT+M T
Sbjct  551  QWEKNYYISAIAGANNGSSLVIMSKGTQYLQQSYKVSESFPFKWINKKWKEGFYVTAMAT  610

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRITS AAT DQAA +LS+PRR
Sbjct  611  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDAGYRITSTAATWDQAALVLSVPRR  670

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLY+AS+CYGRTV
Sbjct  671  KPADETQETLRTSAFPSTHVKEKWAKNLYLASVCYGRTV  709


 Score =   127 bits (318),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS +NLWALIMDAGTGFS+QVY+LS +F
Sbjct  483  PMKQRYHYNVADMRLAQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFSAQVYELSPLF  542

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  543  LHKEWIME  550



>ref|XP_008791563.1| PREDICTED: uncharacterized protein LOC103708420 [Phoenix dactylifera]
Length=683

 Score =   269 bits (687),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M T
Sbjct  524  QWEKNFYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMAT  583

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RW VVMSRNAG+S+QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRR
Sbjct  584  AGTRWAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGYRITATAATWDQAAFVLSVPRR  643

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  644  KPADETQETLRTSAFPSQHVKEKWAKNLYIASICYGRTV  682


 Score =   123 bits (309),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS  NLWALIMDAGTG+++QVY+LS  F
Sbjct  456  PMKQRYHYNVADARLAQHIEKGNEDGLFISSVASCTNLWALIMDAGTGYTAQVYELSPCF  515

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  516  LHKEWIME  523



>ref|XP_008804602.1| PREDICTED: uncharacterized protein LOC103717844 isoform X2 [Phoenix 
dactylifera]
Length=682

 Score =   265 bits (677),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  523  QWEKNYYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTAMAT  582

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW VVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQAAF+LS+PRR
Sbjct  583  AGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQAAFVLSVPRR  642

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +  DETQETLRTSAFPS HVK+KW+KNLYIAS+CYGRTV
Sbjct  643  RPADETQETLRTSAFPSQHVKDKWAKNLYIASVCYGRTV  681


 Score =   127 bits (320),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+ISCVAS  NLWALIMDAGTGF++QVY+LS  F
Sbjct  455  PMKQRYHYNVADGRLAQHIEKGNEDGLFISCVASCTNLWALIMDAGTGFTAQVYELSPNF  514

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  515  LHKEWIME  522



>ref|XP_007225173.1| hypothetical protein PRUPE_ppa002269mg [Prunus persica]
 gb|EMJ26372.1| hypothetical protein PRUPE_ppa002269mg [Prunus persica]
Length=693

 Score =   265 bits (678),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KN+YIS+IAG +NGSSLVVMSKGT + QQSYKVSESFPFKWINKKW+EGF+VT+M T
Sbjct  534  QWDKNYYISAIAGTSNGSSLVVMSKGTQFLQQSYKVSESFPFKWINKKWREGFYVTAMAT  593

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+ G+RITS AAT DQAAF+LS+PRR
Sbjct  594  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDHGFRITSTAATWDQAAFVLSVPRR  653

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  654  KLADETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  692


 Score =   127 bits (319),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS +NLWALIMDAGTGFSSQVY+LS  F
Sbjct  466  PMKQRYHYNVADVRLSQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFSSQVYELSPYF  525

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  526  LHKEWIME  533



>ref|XP_010500967.1| PREDICTED: uncharacterized protein LOC104778257 isoform X2 [Camelina 
sativa]
Length=390

 Score =   271 bits (693),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  231  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  290

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR
Sbjct  291  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRR  350

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  351  RLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  389


 Score =   121 bits (303),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  163  PMKQRYHYNVADIRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  222

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  223  LHKEWIME  230



>ref|XP_008804601.1| PREDICTED: uncharacterized protein LOC103717844 isoform X1 [Phoenix 
dactylifera]
Length=686

 Score =   265 bits (677),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  527  QWEKNYYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTAMAT  586

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW VVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQAAF+LS+PRR
Sbjct  587  AGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQAAFVLSVPRR  646

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +  DETQETLRTSAFPS HVK+KW+KNLYIAS+CYGRTV
Sbjct  647  RPADETQETLRTSAFPSQHVKDKWAKNLYIASVCYGRTV  685


 Score =   127 bits (320),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+ISCVAS  NLWALIMDAGTGF++QVY+LS  F
Sbjct  459  PMKQRYHYNVADGRLAQHIEKGNEDGLFISCVASCTNLWALIMDAGTGFTAQVYELSPNF  518

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  519  LHKEWIME  526



>ref|XP_012077385.1| PREDICTED: uncharacterized protein LOC105638219 [Jatropha curcas]
 gb|KDP34168.1| hypothetical protein JCGZ_07739 [Jatropha curcas]
Length=681

 Score =   266 bits (680),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSS+VVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  522  QWEKNYYISAIAGANNGSSVVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  581

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRR
Sbjct  582  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRR  641

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  642  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  680


 Score =   126 bits (316),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS +NLWALIMDAGTGFS+QVY+LS  F
Sbjct  454  PMKQRYHYNVADMRLSQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFSAQVYELSPYF  513

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  514  LHKEWIME  521



>ref|XP_009117581.1| PREDICTED: uncharacterized protein LOC103842673 [Brassica rapa]
Length=683

 Score =   271 bits (693),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  524  QWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  583

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G+RITS AAT DQAA ILSIPRR
Sbjct  584  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGFRITSTAATTDQAALILSIPRR  643

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +++D+TQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  644  RLVDKTQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  682


 Score =   121 bits (304),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  456  PMKQRYHYNVADIRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  515

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  516  LHKEWIME  523



>ref|XP_011081763.1| PREDICTED: uncharacterized protein LOC105164726 [Sesamum indicum]
 ref|XP_011081764.1| PREDICTED: uncharacterized protein LOC105164726 [Sesamum indicum]
 ref|XP_011081765.1| PREDICTED: uncharacterized protein LOC105164726 [Sesamum indicum]
 ref|XP_011081766.1| PREDICTED: uncharacterized protein LOC105164726 [Sesamum indicum]
 ref|XP_011081767.1| PREDICTED: uncharacterized protein LOC105164726 [Sesamum indicum]
 ref|XP_011081768.1| PREDICTED: uncharacterized protein LOC105164726 [Sesamum indicum]
Length=605

 Score =   265 bits (678),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VT+M T
Sbjct  446  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFYVTAMAT  505

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RW +VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRR
Sbjct  506  AGTRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDAGYRITSTAATWDQAAFVLSVPRR  565

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  566  KPSDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  604


 Score =   127 bits (318),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGN+DGL+ISCVAS +NLWALIMDAGTGFS QVY+LS  F
Sbjct  378  PMKQRYHYNVADVRLPQHIEKGNDDGLFISCVASCSNLWALIMDAGTGFSDQVYELSPYF  437

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  438  LHKEWIME  445



>ref|XP_010047289.1| PREDICTED: uncharacterized protein LOC104436263 [Eucalyptus grandis]
 gb|KCW79164.1| hypothetical protein EUGRSUZ_C00608 [Eucalyptus grandis]
Length=605

 Score =   268 bits (684),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI+++AGA+NGSSLVVMSKGTPY QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  446  QWEKNYYITAVAGASNGSSLVVMSKGTPYLQQSYKVSDSFPFKWINKKWREGFYVTSMAT  505

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RW V+MSR AG+++QVVELDFLYPSEGIHRRW+ GYRITS AAT DQ+A ILSIPRR
Sbjct  506  AGTRWAVIMSRGAGFTDQVVELDFLYPSEGIHRRWDCGYRITSTAATLDQSALILSIPRR  565

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  566  KPTDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  604


 Score =   124 bits (312),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH++KGNEDGL+IS VAS +NLWALIMDAGTGFS QVY+LSS F
Sbjct  378  PMKQRYHYNVADIRLSQHIDKGNEDGLFISSVASCSNLWALIMDAGTGFSDQVYELSSYF  437

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  438  LHKEWIME  445


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V++    + I+K  ++G  ++S+ +  + W ++M    G+S+QV EL   FL+  E I
Sbjct  385  YNVADIRLSQHIDKGNEDGLFISSVASCSNLWALIMDAGTGFSDQVYELSSYFLH-KEWI  443

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  274
              +WE  Y IT++A  ++ ++ ++     K     Q++ + S +FP   + +KW +  Y+
Sbjct  444  MEQWEKNYYITAVAGASNGSSLVV---MSKGTPYLQQSYKVSDSFPFKWINKKWREGFYV  500

Query  273  ASI  265
             S+
Sbjct  501  TSM  503



>emb|CAN69523.1| hypothetical protein VITISV_040873 [Vitis vinifera]
Length=670

 Score =   270 bits (691),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWE+NFYISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  511  QWERNFYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  570

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQ+A ILS+P+R
Sbjct  571  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQSALILSVPKR  630

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  631  KPGDETQETLRTSQFPSTHVKEKWAKNLYLACVCYGRTV  669


 Score =   122 bits (305),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV++GN DGL ISCVAS +NLWALIMDAGTGF+ QVY+LS  F
Sbjct  443  PMKQRYHYNVADGRLAQHVDRGNADGLLISCVASCSNLWALIMDAGTGFTHQVYELSPFF  502

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  503  LHKEWIME  510



>ref|XP_008378069.1| PREDICTED: uncharacterized protein LOC103441148 [Malus domestica]
Length=683

 Score =   268 bits (685),  Expect(2) = 9e-100, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVT+M T
Sbjct  524  QWDKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFHVTAMAT  583

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+S QVVELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRR
Sbjct  584  AGSRWAIVMSRGAGFSXQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRR  643

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  644  KPADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  682


 Score =   124 bits (311),  Expect(2) = 9e-100, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL IS VAS +NLWALIMDAGTGFS+QVY+LS  F
Sbjct  456  PMKQRYHYNVADVRLXQHIEKGNEDGLXISSVASCSNLWALIMDAGTGFSAQVYELSPYF  515

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  516  LHKEWIME  523



>ref|XP_006849555.1| PREDICTED: uncharacterized protein LOC18439325 [Amborella trichopoda]
 ref|XP_011625277.1| PREDICTED: uncharacterized protein LOC18439325 [Amborella trichopoda]
 gb|ERN11136.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda]
Length=707

 Score =   273 bits (699),  Expect(2) = 9e-100, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWE+N+YIS+I GA NGSSLVVMSKGT YTQQSYKVS++FPFKWINKKW+EGFHVTSM T
Sbjct  548  QWERNYYISAIGGANNGSSLVVMSKGTQYTQQSYKVSDTFPFKWINKKWREGFHVTSMAT  607

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAA ILS+P+R
Sbjct  608  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATFDQAALILSVPKR  667

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPS+HVKEKWSKNLY+ASICYGRTV
Sbjct  668  KPGDETQETLRTSAFPSSHVKEKWSKNLYLASICYGRTV  706


 Score =   119 bits (297),  Expect(2) = 9e-100, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV++G  DGL ISCVAS +NLWAL+MDAGTGF+SQVYDLS  F
Sbjct  480  PMKQRYHYNVADARLAQHVDRGIVDGLLISCVASCSNLWALVMDAGTGFTSQVYDLSPYF  539

Query  748  LHKDWIME  725
            L+K+WIME
Sbjct  540  LNKEWIME  547



>ref|XP_010924661.1| PREDICTED: uncharacterized protein LOC105047439 isoform X2 [Elaeis 
guineensis]
Length=682

 Score =   266 bits (681),  Expect(2) = 9e-100, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI+++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  523  QWEKNYYITALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTAMAT  582

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW VVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRR
Sbjct  583  AGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRR  642

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            + +DETQETLRTSAFPS HVK+KW+KNLYIAS+CYGRTV
Sbjct  643  RPVDETQETLRTSAFPSQHVKDKWAKNLYIASVCYGRTV  681


 Score =   125 bits (315),  Expect(2) = 9e-100, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL  H+EKGNEDGL+ISCVAS  NLWALIMDAGTGF++QVY+LS  F
Sbjct  455  PMKQRYHYNVADGRLAPHIEKGNEDGLFISCVASCTNLWALIMDAGTGFTAQVYELSPNF  514

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  515  LHKEWIME  522



>ref|XP_010668618.1| PREDICTED: uncharacterized protein LOC104885660 [Beta vulgaris 
subsp. vulgaris]
Length=731

 Score =   267 bits (682),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGAANGSSLVVMSKGT Y QQSYKVS++FPFKWINKKW+EGF+VTSM T
Sbjct  572  QWEKNYYISAIAGAANGSSLVVMSKGTQYLQQSYKVSDAFPFKWINKKWREGFYVTSMAT  631

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW VVMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQ+A +LSIPRR
Sbjct  632  AGSRWAVVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATFDQSALVLSIPRR  691

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  692  KPTDETQETLRTSAFPSTHVKEKWDKNLYIASICYGRTV  730


 Score =   125 bits (313),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGLYIS VAS +NLWALIMDAGTGF++QVY+LS  F
Sbjct  504  PMKQRYHYNVADIRLSQHIEKGNEDGLYISSVASCSNLWALIMDAGTGFTAQVYELSPHF  563

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  564  LHKEWIME  571



>ref|XP_010924659.1| PREDICTED: uncharacterized protein LOC105047439 isoform X1 [Elaeis 
guineensis]
Length=686

 Score =   266 bits (681),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI+++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  527  QWEKNYYITALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTAMAT  586

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW VVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRR
Sbjct  587  AGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRR  646

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            + +DETQETLRTSAFPS HVK+KW+KNLYIAS+CYGRTV
Sbjct  647  RPVDETQETLRTSAFPSQHVKDKWAKNLYIASVCYGRTV  685


 Score =   125 bits (314),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL  H+EKGNEDGL+ISCVAS  NLWALIMDAGTGF++QVY+LS  F
Sbjct  459  PMKQRYHYNVADGRLAPHIEKGNEDGLFISCVASCTNLWALIMDAGTGFTAQVYELSPNF  518

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  519  LHKEWIME  526



>ref|XP_010033842.1| PREDICTED: uncharacterized protein LOC104423081 [Eucalyptus grandis]
 ref|XP_010033843.1| PREDICTED: uncharacterized protein LOC104423081 [Eucalyptus grandis]
 gb|KCW53681.1| hypothetical protein EUGRSUZ_J02945 [Eucalyptus grandis]
Length=709

 Score =   270 bits (689),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+I G+ NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKWKEGF+VTSM T
Sbjct  550  QWEKNYYISAIGGSTNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWKEGFYVTSMGT  609

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+SEQVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LSIPRR
Sbjct  610  AGSRWAIVMSRGAGFSEQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSIPRR  669

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTV
Sbjct  670  KPTDETQETLRTSAFPSTHVKEKWAKNLYLASICYGRTV  708


 Score =   122 bits (306),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH++KGNEDGL+IS VAS  NLWALIMDAGTGF+SQV++ SS F
Sbjct  482  PMKQRYHYNVADNRLSQHIDKGNEDGLFISSVASCQNLWALIMDAGTGFTSQVHEFSSYF  541

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  542  LHKEWIME  549



>emb|CBI16476.3| unnamed protein product [Vitis vinifera]
Length=603

 Score =   270 bits (690),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWE+NFYISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  444  QWERNFYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  503

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQ+A ILS+P+R
Sbjct  504  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQSALILSVPKR  563

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  564  KPGDETQETLRTSQFPSTHVKEKWAKNLYLACVCYGRTV  602


 Score =   122 bits (305),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHV++GN DGL ISCVAS +NLWALIMDAGTGF+ QVY+LS  F
Sbjct  376  PMKQRYHYNVADGRLAQHVDRGNADGLLISCVASCSNLWALIMDAGTGFTHQVYELSPFF  435

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  436  LHKEWIME  443



>emb|CBI36074.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   269 bits (688),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKNFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  447  QWEKNFYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMAT  506

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSR AG+SEQVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAF+LS+PRR
Sbjct  507  SGSRWGVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFVLSVPRR  566

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K +DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  567  KPVDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  605


 Score =   122 bits (306),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH++KGNEDGL+IS VAS  NLWALIMDAGTGF++QVY+LS  F
Sbjct  379  PMKQRYHYNVADARLAQHIDKGNEDGLFISSVASCQNLWALIMDAGTGFTAQVYELSPYF  438

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  439  LHKEWIME  446



>ref|XP_007014774.1| Casein kinase I protein isoform 1 [Theobroma cacao]
 gb|EOY32393.1| Casein kinase I protein isoform 1 [Theobroma cacao]
Length=891

 Score =   272 bits (695),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  726  NQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMT  547
            +QWEKN+YIS+IAG+++GSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM 
Sbjct  731  DQWEKNYYISAIAGSSSGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFYVTSMA  790

Query  546  TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPR  367
            TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS AAT+DQAA ILSIP+
Sbjct  791  TAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATSDQAALILSIPK  850

Query  366  RKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  851  RKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  890


 Score =   119 bits (299),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVEKG  DGL ISCVAS  NLWALIMDAGTGF+ QVY+LS  F
Sbjct  664  PMKQRYHYNVADARLAQHVEKGMADGLLISCVASCTNLWALIMDAGTGFTHQVYELSPSF  723

Query  748  LHKDWIME  725
            LHK+WIM+
Sbjct  724  LHKEWIMD  731



>gb|KJB54779.1| hypothetical protein B456_009G048800 [Gossypium raimondii]
 gb|KJB54780.1| hypothetical protein B456_009G048800 [Gossypium raimondii]
 gb|KJB54781.1| hypothetical protein B456_009G048800 [Gossypium raimondii]
Length=598

 Score =   263 bits (671),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  439  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  498

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR A +S+QVVELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRR
Sbjct  499  AGSRWAIVMSRGAPFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRR  558

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  559  KPTDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  597


 Score =   128 bits (322),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+ISCVAS +NLWALIMDAGTGF++QVY+LS+ F
Sbjct  371  PMKQRYHYNVADVRLPQHIEKGNEDGLFISCVASCSNLWALIMDAGTGFTAQVYELSAYF  430

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  431  LHKEWIME  438



>ref|XP_008804603.1| PREDICTED: negative regulator of sexual conjugation and meiosis-like 
isoform X3 [Phoenix dactylifera]
Length=524

 Score =   264 bits (675),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  365  QWEKNYYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTAMAT  424

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW VVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQAAF+LS+PRR
Sbjct  425  AGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQAAFVLSVPRR  484

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            +  DETQETLRTSAFPS HVK+KW+KNLYIAS+CYGRTV
Sbjct  485  RPADETQETLRTSAFPSQHVKDKWAKNLYIASVCYGRTV  523


 Score =   127 bits (318),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+ISCVAS  NLWALIMDAGTGF++QVY+LS  F
Sbjct  297  PMKQRYHYNVADGRLAQHIEKGNEDGLFISCVASCTNLWALIMDAGTGFTAQVYELSPNF  356

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  357  LHKEWIME  364



>ref|XP_009592153.1| PREDICTED: uncharacterized protein LOC104089043 [Nicotiana tomentosiformis]
Length=713

 Score =   264 bits (675),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLV+MSKGT Y QQSYKVSESFPFKWINKKWKEGF+VT+M T
Sbjct  554  QWEKNYYISAIAGANNGSSLVIMSKGTQYLQQSYKVSESFPFKWINKKWKEGFYVTAMAT  613

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RW +VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRITS AAT DQAA +LS+PRR
Sbjct  614  AGNRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDAGYRITSTAATWDQAALVLSVPRR  673

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLY+AS+CYGRTV
Sbjct  674  KPADETQETLRTSAFPSTHVKEKWAKNLYLASVCYGRTV  712


 Score =   127 bits (318),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS +NLWALIMDAGTGFS+QVY+LS +F
Sbjct  486  PMKQRYHYNVADMRLAQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFSAQVYELSPLF  545

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  546  LHKEWIME  553



>gb|ADE76410.1| unknown [Picea sitchensis]
Length=444

 Score =   266 bits (681),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEK++YI++IAGA +GSSLVVMSKGTPYTQQSYKVS+ FPFKWINKKWKEGF+VTSM+T
Sbjct  285  QWEKSYYITAIAGANSGSSLVVMSKGTPYTQQSYKVSDFFPFKWINKKWKEGFYVTSMST  344

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            A SRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ G+RIT+ AAT DQAAFILS+P+R
Sbjct  345  AASRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGFRITATAATWDQAAFILSVPKR  404

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLY+A++CYGRTV
Sbjct  405  KPGDETQETLRTSAFPSTHVKEKWAKNLYLAAVCYGRTV  443


 Score =   124 bits (312),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS +NLWALIMDAGTGF++QVY+LS  F
Sbjct  217  PMKQRYHYNVADSRLAQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFTAQVYELSQSF  276

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  277  LHKEWIME  284



>gb|KFK32550.1| hypothetical protein AALP_AA6G257400 [Arabis alpina]
Length=673

 Score =   270 bits (691),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI+++AGA NGSS VVMSKGTPY QQSYKVS+SFPFKWINKKWKEGF+VTSM T
Sbjct  514  QWEKNYYITAVAGANNGSSFVVMSKGTPYLQQSYKVSDSFPFKWINKKWKEGFYVTSMAT  573

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGS+WG+VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRITS+AAT DQAA +LS+PRR
Sbjct  574  AGSKWGIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITSVAATCDQAALVLSVPRR  633

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYI+S+CYGRTV
Sbjct  634  KPSDETQETLRTSAFPSTHVKEKWAKNLYISSMCYGRTV  672


 Score =   120 bits (301),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL+QH+EKGNEDGL+IS VAS +NLWALIMDAGTG S+QVY LS  F
Sbjct  446  PMKQRYHYNVADTRLEQHIEKGNEDGLFISSVASCSNLWALIMDAGTGCSAQVYQLSLSF  505

Query  748  LHKDWIME  725
             HK+WIME
Sbjct  506  FHKEWIME  513



>emb|CDY23629.1| BnaC05g39650D [Brassica napus]
Length=525

 Score =   270 bits (690),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  366  QWEKNYYISSIAGATNGSSLVVMSKGTQYSQQSYKVSDSFPFKWINKKWREGFHVTSMAT  425

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ GYRITS AAT DQAA ILSIPRR
Sbjct  426  AGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGYRITSTAATTDQAALILSIPRR  485

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            ++ DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  486  RLADETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  524


 Score =   121 bits (303),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+E+G  DGL ISCV+S +NLWALIMDAGTGF++QVY+LS VF
Sbjct  298  PMKQRYHYNVADSRLAQHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVF  357

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  358  LHKEWIME  365



>ref|XP_004141661.1| PREDICTED: uncharacterized protein LOC101213589 isoform X2 [Cucumis 
sativus]
Length=716

 Score =   266 bits (680),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
             WEKN+YI+++AG  NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  557  HWEKNYYITAVAGVVNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  616

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSR +G+S+QVVELDFLYPSEGIHRRW+ GYRIT+ AAT+DQAAF+LS+PRR
Sbjct  617  SGSRWGVVMSRGSGFSDQVVELDFLYPSEGIHRRWDCGYRITATAATSDQAAFVLSVPRR  676

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  677  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  715


 Score =   125 bits (313),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS  NLWALIMDAGTGFS+QVY+LS  F
Sbjct  489  PMKQRYHYNVADARLAQHIEKGNEDGLFISSVASCQNLWALIMDAGTGFSTQVYELSPNF  548

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  549  LHKEWIME  556



>ref|XP_010472590.1| PREDICTED: uncharacterized protein LOC104752211 [Camelina sativa]
Length=676

 Score =   266 bits (681),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI+++AGA+NGSS VVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  517  QWEKNYYITAVAGASNGSSFVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMAT  576

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGS+WG+VMSR A +S+QVVELDFLYPSEGIHRRWE+GYRITS+AAT DQAAF+LS+PRR
Sbjct  577  AGSKWGIVMSRGACFSDQVVELDFLYPSEGIHRRWENGYRITSVAATWDQAAFVLSVPRR  636

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  637  KLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  675


 Score =   124 bits (312),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS ANLWALIMDAGTGF+ QVY LS  F
Sbjct  449  PMKQRYHYNVADERLAQHIEKGNEDGLFISSVASCANLWALIMDAGTGFTDQVYQLSPSF  508

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  509  LHKEWIME  516



>gb|KJB54778.1| hypothetical protein B456_009G048800 [Gossypium raimondii]
Length=574

 Score =   262 bits (670),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  415  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  474

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR A +S+QVVELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRR
Sbjct  475  AGSRWAIVMSRGAPFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRR  534

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  535  KPTDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  573


 Score =   128 bits (322),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+ISCVAS +NLWALIMDAGTGF++QVY+LS+ F
Sbjct  347  PMKQRYHYNVADVRLPQHIEKGNEDGLFISCVASCSNLWALIMDAGTGFTAQVYELSAYF  406

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  407  LHKEWIME  414



>ref|XP_011659678.1| PREDICTED: uncharacterized protein LOC101213589 isoform X1 [Cucumis 
sativus]
 ref|XP_011659679.1| PREDICTED: uncharacterized protein LOC101213589 isoform X1 [Cucumis 
sativus]
 ref|XP_011659680.1| PREDICTED: uncharacterized protein LOC101213589 isoform X1 [Cucumis 
sativus]
 ref|XP_011659681.1| PREDICTED: uncharacterized protein LOC101213589 isoform X1 [Cucumis 
sativus]
 gb|KGN45587.1| hypothetical protein Csa_7G452910 [Cucumis sativus]
Length=720

 Score =   266 bits (680),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
             WEKN+YI+++AG  NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  561  HWEKNYYITAVAGVVNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  620

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSR +G+S+QVVELDFLYPSEGIHRRW+ GYRIT+ AAT+DQAAF+LS+PRR
Sbjct  621  SGSRWGVVMSRGSGFSDQVVELDFLYPSEGIHRRWDCGYRITATAATSDQAAFVLSVPRR  680

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  681  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  719


 Score =   124 bits (312),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS  NLWALIMDAGTGFS+QVY+LS  F
Sbjct  493  PMKQRYHYNVADARLAQHIEKGNEDGLFISSVASCQNLWALIMDAGTGFSTQVYELSPNF  552

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  553  LHKEWIME  560



>emb|CDP08183.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   266 bits (679),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VT+M T
Sbjct  565  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFYVTAMAT  624

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AG+RW +VMSR AG+++QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQAAF+LS+PRR
Sbjct  625  AGTRWAIVMSRGAGFADQVVELDFLYPSEGIHRRWDAGYRITATAATWDQAAFVLSVPRR  684

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  685  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  723


 Score =   125 bits (314),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS +NLWALIMDAGTGF++QVY+LS  F
Sbjct  497  PMKQRYHYNVADMRLSQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFTAQVYELSPYF  556

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  557  LHKEWIME  564



>ref|XP_006426889.1| hypothetical protein CICLE_v10025028mg [Citrus clementina]
 gb|ESR40129.1| hypothetical protein CICLE_v10025028mg [Citrus clementina]
 gb|KDO51768.1| hypothetical protein CISIN_1g005221mg [Citrus sinensis]
Length=708

 Score =   266 bits (679),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS++FPFKWINKKW+EGF+VT+M T
Sbjct  549  QWEKNYYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDAFPFKWINKKWREGFYVTAMAT  608

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRR
Sbjct  609  SGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRR  668

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  669  KPADETQETLRTSAFPSAHVKEKWAKNLYIASVCYGRTV  707


 Score =   125 bits (313),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS  NLWALIMDAGTGFS+QVY+LS  F
Sbjct  481  PMKQRYHYNVADARLAQHIEKGNEDGLFISSVASCQNLWALIMDAGTGFSAQVYELSPYF  540

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  541  LHKEWIME  548



>ref|XP_009416478.1| PREDICTED: uncharacterized protein LOC103997068 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416479.1| PREDICTED: uncharacterized protein LOC103997068 [Musa acuminata 
subsp. malaccensis]
Length=686

 Score =   265 bits (678),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KN+YI+++AG  +GSSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VT+M T
Sbjct  527  QWDKNYYITALAGTNSGSSLVVMSKGTQYVQQSYKVSESFPFKWINKKWREGFYVTTMAT  586

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+ +QVVELDFLYPSEGIHRRW+ G+RIT+ AAT DQAA +LS+PRR
Sbjct  587  AGSRWGVVMSRNAGFLDQVVELDFLYPSEGIHRRWDGGFRITATAATLDQAALVLSVPRR  646

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  647  KPADETQETLRTSAFPSQHVKEKWAKNLYIASVCYGRTV  685


 Score =   125 bits (314),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNED L+ISCVAS +NLWA+IMDAGTGF+SQVY++S  F
Sbjct  459  PMKQRYHYNVADVRLAQHIEKGNEDSLFISCVASCSNLWAIIMDAGTGFTSQVYEMSPNF  518

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  519  LHKEWIME  526



>ref|XP_006583050.1| PREDICTED: uncharacterized protein LOC100800869 [Glycine max]
Length=723

 Score =   266 bits (681),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
             WEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  564  HWEKNYYISAIAGAVNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMAT  623

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSR AG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQAAF+LS+PRR
Sbjct  624  SGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHKRWDCGYRITATAATWDQAAFVLSVPRR  683

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K +DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  684  KPLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  722


 Score =   124 bits (311),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV+D RL QH+EKGNEDGLYIS VAS  NLWALIMDAGTGF++QVY+LS  F
Sbjct  496  PMKQRYHYNVSDTRLSQHIEKGNEDGLYISGVASCQNLWALIMDAGTGFTAQVYELSPFF  555

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  556  LHKEWIME  563



>ref|XP_003523751.1| PREDICTED: uncharacterized protein LOC100779382 isoform X1 [Glycine 
max]
 ref|XP_006578236.1| PREDICTED: uncharacterized protein LOC100779382 isoform X2 [Glycine 
max]
 ref|XP_006578237.1| PREDICTED: uncharacterized protein LOC100779382 isoform X3 [Glycine 
max]
 ref|XP_006578238.1| PREDICTED: uncharacterized protein LOC100779382 isoform X4 [Glycine 
max]
Length=710

 Score =   268 bits (685),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAG  NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  551  QWEKNYYISAIAGVNNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  610

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRR
Sbjct  611  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRR  670

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFP THVKEKW+KNLYIASICYGRTV
Sbjct  671  KPADETQETLRTSAFPGTHVKEKWAKNLYIASICYGRTV  709


 Score =   122 bits (307),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH++KGNEDGL+IS VAS +NLWALIMDAGTGF++QVY+LS  F
Sbjct  483  PMKQRYHYNVADVRLAQHIDKGNEDGLFISSVASCSNLWALIMDAGTGFTAQVYELSPHF  542

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  543  LHKEWIME  550



>ref|XP_010044967.1| PREDICTED: uncharacterized protein LOC104433796 isoform X2 [Eucalyptus 
grandis]
 gb|KCW87100.1| hypothetical protein EUGRSUZ_B03631 [Eucalyptus grandis]
Length=705

 Score =   267 bits (682),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISS+AG  NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  546  QWEKNYYISSVAGCNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMAT  605

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWG+VMSRNAG+S+QVVELDF+YPSEGIHRRW+SGYRITS AAT DQ+A +LSIP+R
Sbjct  606  AGSRWGIVMSRNAGFSDQVVELDFMYPSEGIHRRWDSGYRITSTAATWDQSALVLSIPKR  665

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTS FPS HVKEKW+KNLY+A +C+GRTV
Sbjct  666  KPGDETQETLRTSQFPSVHVKEKWAKNLYLACLCHGRTV  704


 Score =   124 bits (310),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+G  DGL ISCVAS++NLWALIMDAGTGFSSQVY+LS  F
Sbjct  478  PMKQRYHYNVADARLGQHVERGIADGLLISCVASSSNLWALIMDAGTGFSSQVYELSPFF  537

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  538  LHKEWIME  545



>ref|XP_006465683.1| PREDICTED: uncharacterized protein LOC102607770 [Citrus sinensis]
Length=708

 Score =   266 bits (679),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS++FPFKWINKKW+EGF+VT+M T
Sbjct  549  QWEKNYYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDAFPFKWINKKWREGFYVTAMAT  608

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRR
Sbjct  609  SGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRR  668

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  669  KPADETQETLRTSAFPSAHVKEKWAKNLYIASVCYGRTV  707


 Score =   125 bits (313),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS  NLWALIMDAGTGFS+QVY+LS  F
Sbjct  481  PMKQRYHYNVADARLAQHIEKGNEDGLFISSVASCQNLWALIMDAGTGFSAQVYELSPYF  540

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  541  LHKEWIME  548


 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/123 (24%), Positives = 65/123 (53%), Gaps = 5/123 (4%)
 Frame = -1

Query  624  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  451
            Y V+++   + I K  ++G  ++S+ +  + W ++M    G+S QV EL   FL+  E I
Sbjct  488  YNVADARLAQHIEKGNEDGLFISSVASCQNLWALIMDAGTGFSAQVYELSPYFLH-KEWI  546

Query  450  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIA  271
              +WE  Y I+++A   + ++ ++     + + ++ +   + AFP   + +KW +  Y+ 
Sbjct  547  MEQWEKNYYISAIAGATNGSSLVVMSKGTQYLQQSYKV--SDAFPFKWINKKWREGFYVT  604

Query  270  SIC  262
            ++ 
Sbjct  605  AMA  607



>ref|XP_010044966.1| PREDICTED: uncharacterized protein LOC104433796 isoform X1 [Eucalyptus 
grandis]
 gb|KCW87099.1| hypothetical protein EUGRSUZ_B03631 [Eucalyptus grandis]
Length=708

 Score =   266 bits (681),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISS+AG  NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  549  QWEKNYYISSVAGCNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMAT  608

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWG+VMSRNAG+S+QVVELDF+YPSEGIHRRW+SGYRITS AAT DQ+A +LSIP+R
Sbjct  609  AGSRWGIVMSRNAGFSDQVVELDFMYPSEGIHRRWDSGYRITSTAATWDQSALVLSIPKR  668

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTS FPS HVKEKW+KNLY+A +C+GRTV
Sbjct  669  KPGDETQETLRTSQFPSVHVKEKWAKNLYLACLCHGRTV  707


 Score =   124 bits (310),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+G  DGL ISCVAS++NLWALIMDAGTGFSSQVY+LS  F
Sbjct  481  PMKQRYHYNVADARLGQHVERGIADGLLISCVASSSNLWALIMDAGTGFSSQVYELSPFF  540

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  541  LHKEWIME  548



>ref|XP_003531651.1| PREDICTED: uncharacterized protein LOC100799630 [Glycine max]
 gb|KHN05338.1| Casein kinase I isoform delta-like [Glycine soja]
Length=711

 Score =   265 bits (678),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
             WEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  552  HWEKNYYISAIAGAVNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  611

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSR AG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQAAF+LS+PRR
Sbjct  612  SGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHKRWDCGYRITATAATWDQAAFVLSVPRR  671

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K +DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  672  KPLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  710


 Score =   125 bits (313),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV+D RL QH+EKGNEDGLYIS VAS  NLWALIMDAGTGF++QVY+LS  F
Sbjct  484  PMKQRYHYNVSDTRLSQHIEKGNEDGLYISSVASCQNLWALIMDAGTGFTAQVYELSPFF  543

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  544  LHKEWIME  551



>ref|XP_004491691.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Cicer arietinum]
Length=667

 Score =   270 bits (691),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI+SIAG  NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  508  QWEKNYYITSIAGVTNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  567

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILS PRR
Sbjct  568  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSKPRR  627

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            +  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  628  RPADETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  667


 Score =   120 bits (300),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+G  DGL ISCVAS +NLWALIMDAGTGF++QVY LS  F
Sbjct  440  PMKQRYHYNVADGRLAQHVERGIADGLLISCVASCSNLWALIMDAGTGFTNQVYKLSPFF  499

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  500  LHKEWIME  507



>ref|XP_004291170.1| PREDICTED: uncharacterized protein LOC101299149 [Fragaria vesca 
subsp. vesca]
Length=649

 Score =   262 bits (670),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QW+KN+YIS+IAGA NGSSLVVMSKGT + QQSYKVSESFPFKWINKKW+EGF VT+M T
Sbjct  490  QWDKNYYISAIAGANNGSSLVVMSKGTSFLQQSYKVSESFPFKWINKKWREGFFVTAMAT  549

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+ GYRITS AAT DQAA +LS+PRR
Sbjct  550  AGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDGGYRITSTAATWDQAALVLSVPRR  609

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  610  KPADETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  648


 Score =   128 bits (321),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGLYIS VAS +NLWALIMDAGTGFSSQVY+LS  F
Sbjct  422  PMKQRYHYNVADVRLPQHIEKGNEDGLYISSVASCSNLWALIMDAGTGFSSQVYELSPYF  481

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  482  LHKEWIME  489



>ref|XP_007208054.1| hypothetical protein PRUPE_ppa002206mg [Prunus persica]
 gb|EMJ09253.1| hypothetical protein PRUPE_ppa002206mg [Prunus persica]
Length=701

 Score =   269 bits (688),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  542  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  601

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+P+R
Sbjct  602  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITSTAATWDQAALILSVPKR  661

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  662  KPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  700


 Score =   121 bits (303),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+G +DGL ISCV+S +NLWALIMDAGTGF++QVY+LS  F
Sbjct  474  PMKQRYHYNVADARLAQHVERGIQDGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPFF  533

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  534  LHKEWIME  541



>gb|KHN39248.1| Casein kinase I isoform delta-like, partial [Glycine soja]
Length=661

 Score =   266 bits (680),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
             WEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  502  HWEKNYYISAIAGAVNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMAT  561

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            +GSRWGVVMSR AG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQAAF+LS+PRR
Sbjct  562  SGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHKRWDCGYRITATAATWDQAAFVLSVPRR  621

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K +DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  622  KPLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  660


 Score =   124 bits (310),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNV+D RL QH+EKGNEDGLYIS VAS  NLWALIMDAGTGF++QVY+LS  F
Sbjct  434  PMKQRYHYNVSDTRLSQHIEKGNEDGLYISGVASCQNLWALIMDAGTGFTAQVYELSPFF  493

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  494  LHKEWIME  501



>ref|XP_004294964.1| PREDICTED: uncharacterized protein LOC101294343 [Fragaria vesca 
subsp. vesca]
Length=731

 Score =   269 bits (688),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM T
Sbjct  572  QWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMAT  631

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+P+R
Sbjct  632  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITSTAATWDQAALILSVPKR  691

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  692  KPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  730


 Score =   120 bits (302),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+G  DGL ISCV+S +NLWALIMDAGTGFS+QVY+LS  F
Sbjct  504  PMKQRYHYNVADARLAQHVERGIADGLLISCVSSCSNLWALIMDAGTGFSNQVYELSPFF  563

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  564  LHKEWIME  571



>gb|KHG03332.1| hypothetical protein F383_28165 [Gossypium arboreum]
Length=706

 Score =   265 bits (678),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M T
Sbjct  547  QWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMAT  606

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRW +VMSR A +S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LSIPRR
Sbjct  607  AGSRWAIVMSRGAPFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSIPRR  666

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  667  KPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  705


 Score =   125 bits (313),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS +NLWALIMDAGTGF++QVY+LS  F
Sbjct  479  PMKQRYHYNVADVRLPQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFTAQVYELSPYF  538

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  539  LHKEWIME  546



>ref|XP_010472589.1| PREDICTED: uncharacterized protein LOC104752210 [Camelina sativa]
Length=257

 Score =   266 bits (679),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI+++AGA+NGSS VVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T
Sbjct  98   QWEKNYYITAVAGASNGSSFVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMAT  157

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGS+WG+VMSR A +S+QVVELDFLYPSEGIHRRWE+GYRITS+AAT DQAAF+LS+PRR
Sbjct  158  AGSKWGIVMSRGACFSDQVVELDFLYPSEGIHRRWENGYRITSVAATWDQAAFVLSVPRR  217

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  247
            K+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  218  KLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  256


 Score =   124 bits (311),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QH+EKGNEDGL+IS VAS ANLWALIMDAGTGF+ QVY LS  F
Sbjct  30   PMKQRYHYNVADERLAQHIEKGNEDGLFISSVASCANLWALIMDAGTGFTDQVYQLSPSF  89

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  90   LHKEWIME  97



>ref|XP_003621013.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES77231.1| casein kinase I-like protein [Medicago truncatula]
Length=599

 Score =   270 bits (691),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  723  QWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT  544
            QWEKN+YI+SIAG  NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM T
Sbjct  440  QWEKNYYITSIAGVTNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMAT  499

Query  543  AGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRR  364
            AGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILS PRR
Sbjct  500  AGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSKPRR  559

Query  363  KMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  244
            +  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  560  RPADETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  599


 Score =   119 bits (299),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -3

Query  928  PMKQRYHYNVADXRLQQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSSVF  749
            PMKQRYHYNVAD RL QHVE+G  DGL ISCVAS +NLWALIMDAGTGF++QVY LS  F
Sbjct  372  PMKQRYHYNVADGRLAQHVERGIADGLLISCVASCSNLWALIMDAGTGFTNQVYKLSPFF  431

Query  748  LHKDWIME  725
            LHK+WIME
Sbjct  432  LHKEWIME  439



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2200264392382