BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9798

Length=1262
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN35900.1|  Vacuolar protein sorting-associated protein 16 like     501   3e-169   Glycine soja [wild soybean]
gb|AFK37940.1|  unknown                                                 488   1e-167   Lotus japonicus
gb|KDO51889.1|  hypothetical protein CISIN_1g003205mg                   488   1e-166   Citrus sinensis [apfelsine]
ref|XP_007048986.1|  Vacuoleless1 (VCL1) isoform 2                      500   3e-166   
ref|XP_003551927.1|  PREDICTED: vacuolar protein sorting-associat...    499   1e-165   
ref|XP_011082899.1|  PREDICTED: protein VACUOLELESS1                    497   7e-165   Sesamum indicum [beniseed]
ref|XP_003532091.1|  PREDICTED: vacuolar protein sorting-associat...    496   2e-164   Glycine max [soybeans]
gb|KJB10618.1|  hypothetical protein B456_001G211500                    496   2e-164   Gossypium raimondii
gb|EYU33990.1|  hypothetical protein MIMGU_mgv1a001320mg                496   2e-164   Erythranthe guttata [common monkey flower]
gb|KDO51888.1|  hypothetical protein CISIN_1g003205mg                   488   2e-164   Citrus sinensis [apfelsine]
ref|XP_002526647.1|  vacuolar protein sorting vps16, putative           494   1e-163   Ricinus communis
gb|KJB10616.1|  hypothetical protein B456_001G211500                    494   2e-163   Gossypium raimondii
ref|XP_009790374.1|  PREDICTED: protein VACUOLELESS1                    492   5e-163   Nicotiana sylvestris
ref|XP_002283428.1|  PREDICTED: protein VACUOLELESS1                    491   9e-163   Vitis vinifera
ref|XP_009625096.1|  PREDICTED: protein VACUOLELESS1                    491   1e-162   Nicotiana tomentosiformis
ref|XP_010053830.1|  PREDICTED: protein VACUOLELESS1                    490   4e-162   Eucalyptus grandis [rose gum]
ref|XP_011026233.1|  PREDICTED: protein VACUOLELESS1-like isoform X2    481   4e-162   Populus euphratica
ref|XP_007048985.1|  Vacuoleless1 (VCL1) isoform 1                      490   6e-162   
ref|XP_011044765.1|  PREDICTED: protein VACUOLELESS1-like               488   1e-161   Populus euphratica
gb|KDO51887.1|  hypothetical protein CISIN_1g003205mg                   488   2e-161   Citrus sinensis [apfelsine]
ref|XP_004499978.1|  PREDICTED: vacuolar protein sorting-associat...    488   2e-161   Cicer arietinum [garbanzo]
gb|KEH16900.1|  vacuolar protein sorting-associated-like protein        488   4e-161   Medicago truncatula
gb|AES70033.2|  vacuolar protein sorting-associated-like protein        487   5e-161   Medicago truncatula
ref|XP_002306748.1|  MANGLED family protein                             487   5e-161   
ref|XP_004243213.1|  PREDICTED: protein VACUOLELESS1                    486   2e-160   Solanum lycopersicum
ref|XP_006348963.1|  PREDICTED: vacuolar protein sorting-associat...    486   2e-160   
ref|XP_007146219.1|  hypothetical protein PHAVU_006G022400g             486   2e-160   Phaseolus vulgaris [French bean]
ref|XP_006437140.1|  hypothetical protein CICLE_v10030701mg             485   3e-160   Citrus clementina [clementine]
ref|XP_010271337.1|  PREDICTED: protein VACUOLELESS1 isoform X1         483   2e-159   Nelumbo nucifera [Indian lotus]
gb|KHG27227.1|  Vacuolar sorting-associated protein 16                  481   3e-159   Gossypium arboreum [tree cotton]
ref|XP_007048987.1|  Vacuoleless1 (VCL1) isoform 3                      481   4e-159   
ref|XP_008229565.1|  PREDICTED: protein VACUOLELESS1                    482   5e-159   Prunus mume [ume]
ref|XP_007214933.1|  hypothetical protein PRUPE_ppa001364mg             481   1e-158   Prunus persica
ref|XP_012088184.1|  PREDICTED: protein VACUOLELESS1 isoform X2         480   2e-158   Jatropha curcas
ref|XP_003599782.1|  Vacuolar protein sorting-associated protein-...    481   2e-158   
ref|XP_012088183.1|  PREDICTED: protein VACUOLELESS1 isoform X1         480   3e-158   Jatropha curcas
ref|XP_011026232.1|  PREDICTED: protein VACUOLELESS1-like isoform X1    479   6e-158   Populus euphratica
ref|XP_002302135.2|  MANGLED family protein                             476   7e-157   
ref|XP_009377216.1|  PREDICTED: LOW QUALITY PROTEIN: protein VACU...    475   1e-156   Pyrus x bretschneideri [bai li]
ref|XP_008342344.1|  PREDICTED: protein VACUOLELESS1                    475   3e-156   Malus domestica [apple tree]
ref|XP_004144632.1|  PREDICTED: protein VACUOLELESS1                    472   3e-155   Cucumis sativus [cucumbers]
ref|XP_008465445.1|  PREDICTED: protein VACUOLELESS1                    470   2e-154   Cucumis melo [Oriental melon]
ref|XP_010557595.1|  PREDICTED: protein VACUOLELESS1                    471   2e-154   Tarenaya hassleriana [spider flower]
emb|CDP06151.1|  unnamed protein product                                469   7e-154   Coffea canephora [robusta coffee]
ref|XP_010681470.1|  PREDICTED: protein VACUOLELESS1                    465   2e-152   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010087860.1|  Vacuolar protein sorting-associated protein ...    462   3e-151   Morus notabilis
ref|XP_008811095.1|  PREDICTED: protein VACUOLELESS1                    461   6e-151   Phoenix dactylifera
ref|XP_009416537.1|  PREDICTED: protein VACUOLELESS1                    459   3e-150   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010918871.1|  PREDICTED: protein VACUOLELESS1                    458   9e-150   Elaeis guineensis
ref|XP_006854657.1|  PREDICTED: protein VACUOLELESS1                    429   2e-138   Amborella trichopoda
gb|KJB10617.1|  hypothetical protein B456_001G211500                    427   3e-138   Gossypium raimondii
ref|XP_004303883.1|  PREDICTED: protein VACUOLELESS1 isoform X2         420   5e-135   Fragaria vesca subsp. vesca
ref|XP_002881559.1|  hypothetical protein ARALYDRAFT_321506             416   2e-133   Arabidopsis lyrata subsp. lyrata
ref|NP_565879.1|  vacuoleless1                                          416   4e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505412.1|  PREDICTED: protein VACUOLELESS1-like               414   9e-133   Camelina sativa [gold-of-pleasure]
ref|XP_002883710.1|  predicted protein                                  408   9e-133   
ref|XP_006296131.1|  hypothetical protein CARUB_v10025283mg             414   2e-132   Capsella rubella
ref|XP_010517084.1|  PREDICTED: protein VACUOLELESS1-like               413   4e-132   Camelina sativa [gold-of-pleasure]
ref|XP_010509236.1|  PREDICTED: protein VACUOLELESS1                    413   4e-132   Camelina sativa [gold-of-pleasure]
dbj|BAJ33734.1|  unnamed protein product                                412   4e-132   Eutrema halophilum
ref|XP_009133226.1|  PREDICTED: protein VACUOLELESS1                    412   5e-132   Brassica rapa
emb|CDY14496.1|  BnaC03g20990D                                          412   6e-132   Brassica napus [oilseed rape]
ref|XP_006411003.1|  hypothetical protein EUTSA_v10016232mg             412   9e-132   Eutrema salsugineum [saltwater cress]
emb|CDY07756.1|  BnaA03g17550D                                          411   2e-131   Brassica napus [oilseed rape]
ref|XP_008656726.1|  PREDICTED: protein VACUOLELESS1                    407   9e-130   Zea mays [maize]
ref|XP_002456108.1|  hypothetical protein SORBIDRAFT_03g030590          405   2e-129   
gb|EEE55144.1|  hypothetical protein OsJ_02938                          406   4e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011467591.1|  PREDICTED: protein VACUOLELESS1 isoform X1         403   6e-128   Fragaria vesca subsp. vesca
ref|XP_006646183.1|  PREDICTED: vacuolar protein sorting-associat...    400   1e-127   Oryza brachyantha
dbj|BAD95263.1|  hypothetical protein                                   383   4e-127   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19612.1|  AT2G38020                                              385   3e-125   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB90498.1|  vacuolar protein sorting-associated protein VPS1...    394   9e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010232114.1|  PREDICTED: protein VACUOLELESS1                    394   2e-124   Brachypodium distachyon [annual false brome]
ref|XP_004969467.1|  PREDICTED: vacuolar protein sorting-associat...    388   2e-122   Setaria italica
dbj|BAJ97322.1|  predicted protein                                      388   3e-122   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001078020.1|  vacuoleless1                                       385   1e-121   Arabidopsis thaliana [mouse-ear cress]
gb|KJB10619.1|  hypothetical protein B456_001G211500                    371   7e-117   Gossypium raimondii
gb|EMS54442.1|  Vacuolar protein sorting-associated protein 16-li...    349   7e-113   Triticum urartu
ref|XP_001777594.1|  predicted protein                                  339   5e-104   
ref|XP_002974680.1|  hypothetical protein SELMODRAFT_101752             335   2e-102   
ref|XP_002963395.1|  hypothetical protein SELMODRAFT_80688              332   2e-101   
gb|KCW89755.1|  hypothetical protein EUGRSUZ_A02017                     296   1e-88    Eucalyptus grandis [rose gum]
ref|XP_006387719.1|  hypothetical protein POPTR_0647s00230g             275   7e-87    
gb|EPS57825.1|  hypothetical protein M569_16992                         246   4e-76    Genlisea aurea
gb|AFW83495.1|  hypothetical protein ZEAMMB73_843554                    232   2e-70    
ref|XP_009774600.1|  PREDICTED: protein VACUOLELESS1-like isoform X2    209   2e-61    Nicotiana sylvestris
ref|XP_009774599.1|  PREDICTED: protein VACUOLELESS1-like isoform X1    208   5e-61    Nicotiana sylvestris
gb|KJB10620.1|  hypothetical protein B456_001G211500                    218   5e-60    Gossypium raimondii
ref|XP_010271338.1|  PREDICTED: protein VACUOLELESS1 isoform X2         214   1e-58    
gb|KDO51890.1|  hypothetical protein CISIN_1g003205mg                   207   5e-56    Citrus sinensis [apfelsine]
gb|AFW83494.1|  hypothetical protein ZEAMMB73_114694                    182   4e-47    
ref|XP_005650736.1|  vacuolar protein sorting-associated protein 16     166   5e-41    Coccomyxa subellipsoidea C-169
dbj|GAN01171.1|  vacuolar protein sorting vps16 protein                 163   3e-40    Mucor ambiguus
gb|EPB85961.1|  hypothetical protein HMPREF1544_07293                   160   1e-39    Mucor circinelloides f. circinelloides 1006PhL
emb|CEP18375.1|  hypothetical protein                                   160   4e-39    Parasitella parasitica
emb|CEG71651.1|  hypothetical protein RMATCC62417_07353                 159   6e-39    Rhizopus microsporus
ref|XP_002678979.1|  predicted protein                                  154   7e-37    Naegleria gruberi strain NEG-M
emb|CDH59927.1|  vacuolar protein sorting vps16                         152   2e-36    Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS07252.1|  hypothetical protein LRAMOSA01201                      151   3e-36    Lichtheimia ramosa
gb|ERZ97236.1|  hypothetical protein GLOINDRAFT_334475                  148   4e-35    
emb|CEG84393.1|  hypothetical protein RMATCC62417_18202                 137   5e-34    Rhizopus microsporus
gb|KIM91586.1|  hypothetical protein PILCRDRAFT_133551                  144   1e-33    Piloderma croceum F 1598
gb|KDQ31847.1|  hypothetical protein PLEOSDRAFT_48878                   143   2e-33    Pleurotus ostreatus PC15
ref|XP_004340672.1|  vacuolar protein sorting 16, putative              142   5e-33    Acanthamoeba castellanii str. Neff
ref|XP_004367009.1|  hypothetical protein DFA_07142                     142   6e-33    Cavenderia fasciculata
gb|KIP07308.1|  hypothetical protein PHLGIDRAFT_426170                  140   2e-32    Phlebiopsis gigantea 11061_1 CR5-6
emb|CEI87038.1|  hypothetical protein RMCBS344292_01458                 138   6e-32    Rhizopus microsporus
ref|XP_009550055.1|  hypothetical protein HETIRDRAFT_325388             139   7e-32    Heterobasidion irregulare TC 32-1
gb|EIE83259.1|  hypothetical protein RO3G_07964                         137   1e-31    Rhizopus delemar RA 99-880
ref|XP_007301979.1|  vacuolar assembling/sorting protein VPS16          137   2e-31    Stereum hirsutum FP-91666 SS1
ref|XP_004345413.1|  vacuolar assembling/sorting protein VPS16          137   2e-31    Capsaspora owczarzaki ATCC 30864
gb|EPS95124.1|  hypothetical protein FOMPIDRAFT_1043679                 137   3e-31    Fomitopsis pinicola FP-58527 SS1
ref|XP_007850547.1|  vacuolar protein sorting vps16                     136   6e-31    
ref|XP_002591465.1|  hypothetical protein BRAFLDRAFT_105238             136   6e-31    Branchiostoma floridae
gb|EMD35361.1|  hypothetical protein CERSUDRAFT_66538                   136   7e-31    Gelatoporia subvermispora B
ref|XP_003030158.1|  hypothetical protein SCHCODRAFT_69044              135   7e-31    Schizophyllum commune H4-8
ref|XP_002598771.1|  hypothetical protein BRAFLDRAFT_212848             134   2e-30    Branchiostoma floridae
gb|KIK56666.1|  hypothetical protein GYMLUDRAFT_230051                  134   3e-30    Gymnopus luxurians FD-317 M1
ref|XP_646623.2|  hypothetical protein DDB_G0270754                     133   6e-30    Dictyostelium discoideum AX4
gb|KIK00029.1|  hypothetical protein K443DRAFT_101182                   132   8e-30    Laccaria amethystina LaAM-08-1
gb|KFH65750.1|  hypothetical protein MVEG_07854                         132   9e-30    Mortierella verticillata NRRL 6337
ref|XP_007869321.1|  vacuolar assembling/sorting protein VPS16          132   1e-29    Gloeophyllum trabeum ATCC 11539
emb|CCX31232.1|  Similar to Probable vacuolar protein sorting-ass...    131   2e-29    Pyronema omphalodes CBS 100304
ref|XP_007393336.1|  hypothetical protein PHACADRAFT_193129             130   3e-29    Phanerochaete carnosa HHB-10118-sp
gb|KDR80313.1|  hypothetical protein GALMADRAFT_62817                   130   4e-29    Galerina marginata CBS 339.88
emb|CCL98206.1|  predicted protein                                      130   7e-29    Fibroporia radiculosa
gb|KIK92586.1|  hypothetical protein PAXRUDRAFT_146989                  130   7e-29    Paxillus rubicundulus Ve08.2h10
ref|XP_003287306.1|  hypothetical protein DICPUDRAFT_32286              129   1e-28    Dictyostelium purpureum
ref|XP_006272323.1|  PREDICTED: vacuolar protein sorting-associat...    129   1e-28    Alligator mississippiensis
gb|KII87631.1|  hypothetical protein PLICRDRAFT_111626                  129   1e-28    Plicaturopsis crispa FD-325 SS-3
emb|CCA70355.1|  related to vacuolar protein sorting VACUOLELESS1       129   1e-28    Serendipita indica DSM 11827
ref|XP_002837491.1|  hypothetical protein                               129   2e-28    Tuber melanosporum Mel28
ref|XP_007270430.1|  vacuolar protein sorting-associated protein 16     129   2e-28    Fomitiporia mediterranea MF3/22
gb|KIY47376.1|  vacuolar protein sorting-associated protein 16          128   2e-28    Fistulina hepatica ATCC 64428
dbj|GAM26637.1|  hypothetical protein SAMD00019534_098120               128   2e-28    Acytostelium subglobosum LB1
ref|XP_008121385.1|  PREDICTED: vacuolar protein sorting-associat...    128   2e-28    
ref|XP_007384243.1|  vacuolar assembling/sorting protein VPS16          127   4e-28    Punctularia strigosozonata HHB-11173 SS5
gb|KIJ59378.1|  hypothetical protein HYDPIDRAFT_118596                  127   4e-28    Hydnomerulius pinastri MD-312
gb|EFA85317.1|  hypothetical protein PPL_02318                          127   5e-28    Heterostelium album PN500
ref|XP_009098195.1|  PREDICTED: vacuolar protein sorting-associat...    127   6e-28    
ref|XP_011117417.1|  hypothetical protein AOL_s00004g466                127   7e-28    Arthrobotrys oligospora ATCC 24927
gb|KIM67291.1|  hypothetical protein SCLCIDRAFT_179253                  126   8e-28    Scleroderma citrinum Foug A
ref|XP_001881053.1|  vacuolar assembling/sorting protein VPS16          126   9e-28    Laccaria bicolor S238N-H82
gb|KJA15614.1|  hypothetical protein HYPSUDRAFT_1068261                 126   1e-27    Hypholoma sublateritium FD-334 SS-4
gb|KIJ15884.1|  hypothetical protein PAXINDRAFT_168867                  126   1e-27    Paxillus involutus ATCC 200175
gb|AAH03944.1|  Vps16 protein                                           122   1e-27    Mus musculus [mouse]
ref|XP_011238156.1|  PREDICTED: vacuolar protein sorting-associat...    123   2e-27    
ref|XP_005518015.1|  PREDICTED: vacuolar protein sorting-associat...    125   2e-27    Pseudopodoces humilis [Tibetan ground-jay]
emb|CDO74588.1|  hypothetical protein BN946_scf184583.g15               125   2e-27    Trametes cinnabarina
ref|XP_008042309.1|  vacuolar protein sorting-associated protein 16     125   2e-27    Trametes versicolor FP-101664 SS1
ref|XP_008495020.1|  PREDICTED: vacuolar protein sorting-associat...    125   2e-27    Calypte anna
ref|XP_011598543.1|  PREDICTED: vacuolar protein sorting-associat...    125   2e-27    Aquila chrysaetos canadensis
gb|EWC48561.1|  hypothetical protein DRE_01783                          125   2e-27    Drechslerella stenobrocha 248
gb|KIK32973.1|  hypothetical protein CY34DRAFT_813942                   125   2e-27    Suillus luteus UH-Slu-Lm8-n1
ref|XP_003134377.1|  PREDICTED: vacuolar protein sorting-associat...    124   2e-27    
ref|XP_007371512.1|  vacuolar protein sorting-associated protein 16     125   3e-27    Dichomitus squalens LYAD-421 SS1
ref|XP_011598541.1|  PREDICTED: vacuolar protein sorting-associat...    125   3e-27    Aquila chrysaetos canadensis
ref|XP_003134376.1|  PREDICTED: vacuolar protein sorting-associat...    124   3e-27    Sus scrofa [pigs]
ref|XP_011598542.1|  PREDICTED: vacuolar protein sorting-associat...    124   3e-27    Aquila chrysaetos canadensis
ref|XP_010726024.1|  PREDICTED: vacuolar protein sorting-associat...    125   4e-27    Meleagris gallopavo [common turkey]
ref|XP_005239614.1|  PREDICTED: vacuolar protein sorting-associat...    124   4e-27    
ref|XP_005435468.1|  PREDICTED: vacuolar protein sorting-associat...    124   4e-27    
ref|XP_007331990.1|  hypothetical protein AGABI1DRAFT_77347             124   5e-27    Agaricus bisporus var. burnettii JB137-S8
ref|XP_007898277.1|  PREDICTED: vacuolar protein sorting-associat...    124   5e-27    Callorhinchus milii [Australian ghost shark]
ref|XP_006463395.1|  hypothetical protein AGABI2DRAFT_208148            124   5e-27    Agaricus bisporus var. bisporus H97
gb|KIM47049.1|  hypothetical protein M413DRAFT_440594                   124   5e-27    Hebeloma cylindrosporum h7
ref|XP_001832533.2|  vacuolar protein sorting 16 isoform 1              124   5e-27    Coprinopsis cinerea okayama7#130
emb|CCJ28605.1|  unnamed protein product                                124   6e-27    Pneumocystis jirovecii
ref|NP_001258079.1|  vacuolar protein sorting-associated protein ...    124   7e-27    Gallus gallus [bantam]
ref|XP_009883933.1|  PREDICTED: vacuolar protein sorting-associat...    123   1e-26    Charadrius vociferus
ref|XP_011112781.1|  hypothetical protein H072_7007                     122   1e-26    
ref|XP_003488666.1|  PREDICTED: vacuolar protein sorting-associat...    122   2e-26    
ref|XP_007771096.1|  vacuolar assembling sorting protein VPS16          122   2e-26    Coniophora puteana RWD-64-598 SS2
gb|KIK24542.1|  hypothetical protein PISMIDRAFT_645755                  122   2e-26    Pisolithus microcarpus 441
ref|XP_007248949.1|  PREDICTED: vacuolar protein sorting-associat...    122   3e-26    
dbj|BAB64892.1|  Vps16                                                  122   3e-26    Mus musculus [mouse]
sp|Q920Q4.3|VPS16_MOUSE  RecName: Full=Vacuolar protein sorting-a...    122   3e-26    Mus musculus [mouse]
dbj|BAC33966.1|  unnamed protein product                                122   3e-26    Mus musculus [mouse]
ref|NP_085036.3|  vacuolar protein sorting-associated protein 16 ...    122   3e-26    Mus musculus [mouse]
gb|KDQ19047.1|  hypothetical protein BOTBODRAFT_28535                   122   3e-26    Botryobasidium botryosum FD-172 SS1
gb|AAH25626.1|  Vacuolar protein sorting 16 (yeast)                     122   3e-26    synthetic construct
ref|XP_010862318.1|  PREDICTED: vacuolar protein sorting-associat...    121   3e-26    Esox lucius
ref|XP_003394905.1|  PREDICTED: vacuolar protein sorting-associat...    121   3e-26    
gb|KIY70700.1|  vacuolar assembling/sorting protein VPS16               121   3e-26    Cylindrobasidium torrendii FP15055 ss-10
gb|EMS22549.1|  vacuolar protein sorting VPS16                          122   4e-26    Rhodotorula toruloides NP11
ref|XP_005278471.1|  PREDICTED: vacuolar protein sorting-associat...    121   6e-26    
ref|XP_010566769.1|  PREDICTED: vacuolar protein sorting-associat...    120   7e-26    Haliaeetus leucocephalus
gb|KFP03155.1|  Vacuolar protein sorting-associated protein 16          120   7e-26    Calypte anna
ref|XP_005365673.1|  PREDICTED: vacuolar protein sorting-associat...    120   8e-26    
ref|XP_005365672.1|  PREDICTED: vacuolar protein sorting-associat...    120   1e-25    Microtus ochrogaster [prairie voles]
gb|ELU17286.1|  hypothetical protein CAPTEDRAFT_168734                  120   1e-25    Capitella teleta
ref|XP_005839798.1|  hypothetical protein GUITHDRAFT_161084             119   1e-25    Guillardia theta CCMP2712
gb|KIO15844.1|  hypothetical protein M407DRAFT_235273                   117   1e-25    Tulasnella calospora MUT 4182
ref|XP_005463829.1|  PREDICTED: vacuolar protein sorting-associat...    119   1e-25    
ref|XP_003458681.1|  PREDICTED: vacuolar protein sorting-associat...    119   2e-25    Oreochromis niloticus
ref|XP_007313955.1|  hypothetical protein SERLADRAFT_365727             119   2e-25    Serpula lacrymans var. lacrymans S7.9
ref|XP_009052918.1|  hypothetical protein LOTGIDRAFT_115951             119   2e-25    Lottia gigantea
ref|XP_006500493.1|  PREDICTED: vacuolar protein sorting-associat...    119   2e-25    Mus musculus [mouse]
gb|KDR24089.1|  Vacuolar protein sorting-associated protein 16-li...    119   2e-25    Zootermopsis nevadensis
ref|XP_007922652.1|  hypothetical protein MYCFIDRAFT_60175              119   2e-25    Pseudocercospora fijiensis CIRAD86
gb|KGL93811.1|  Vacuolar protein sorting-associated protein 16          118   3e-25    Charadrius vociferus
ref|XP_007873551.1|  hypothetical protein, variant                      118   3e-25    
ref|XP_008852713.1|  PREDICTED: vacuolar protein sorting-associat...    119   3e-25    Nannospalax galili
gb|KDQ58687.1|  hypothetical protein JAAARDRAFT_57575                   119   3e-25    Jaapia argillacea MUCL 33604
ref|XP_007873550.1|  hypothetical protein PNEG_01594                    118   3e-25    Pneumocystis murina B123
gb|KIL59455.1|  hypothetical protein M378DRAFT_85025                    118   4e-25    Amanita muscaria Koide BX008
ref|NP_001091659.1|  vacuolar protein sorting-associated protein ...    118   4e-25    Danio rerio [leopard danio]
ref|XP_005735067.1|  PREDICTED: vacuolar protein sorting-associat...    118   4e-25    Pundamilia nyererei
ref|XP_005735066.1|  PREDICTED: vacuolar protein sorting-associat...    118   4e-25    Pundamilia nyererei
ref|XP_005735068.1|  PREDICTED: vacuolar protein sorting-associat...    117   4e-25    
ref|XP_005951516.1|  PREDICTED: vacuolar protein sorting-associat...    118   4e-25    Haplochromis burtoni
ref|XP_004575656.1|  PREDICTED: vacuolar protein sorting-associat...    118   4e-25    Maylandia zebra
ref|XP_005951517.1|  PREDICTED: vacuolar protein sorting-associat...    117   4e-25    
ref|XP_005951515.1|  PREDICTED: vacuolar protein sorting-associat...    118   5e-25    Haplochromis burtoni
ref|XP_006636484.1|  PREDICTED: vacuolar protein sorting-associat...    117   7e-25    Lepisosteus oculatus
gb|KIO05251.1|  hypothetical protein M404DRAFT_141113                   117   8e-25    Pisolithus tinctorius Marx 270
ref|XP_007351763.1|  vacuolar protein sorting-associated protein 16     117   1e-24    
ref|XP_009462172.1|  PREDICTED: vacuolar protein sorting-associat...    117   1e-24    Nipponia nippon
ref|XP_499728.1|  YALI0A03553p                                          116   1e-24    Yarrowia lipolytica CLIB122
ref|XP_006038082.1|  PREDICTED: vacuolar protein sorting-associat...    116   1e-24    
ref|XP_001641101.1|  predicted protein                                  116   2e-24    Nematostella vectensis
ref|XP_011864427.1|  PREDICTED: vacuolar protein sorting-associat...    116   2e-24    Vollenhovia emeryi
ref|XP_006617477.1|  PREDICTED: vacuolar protein sorting-associat...    115   2e-24    Apis dorsata [rock honeybee]
ref|XP_006567258.1|  PREDICTED: vacuolar protein sorting-associat...    115   2e-24    Apis mellifera [bee]
ref|XP_006617476.1|  PREDICTED: vacuolar protein sorting-associat...    115   2e-24    Apis dorsata [rock honeybee]
dbj|GAA99834.1|  hypothetical protein E5Q_06537                         116   2e-24    Mixia osmundae IAM 14324
ref|XP_002110165.1|  hypothetical protein TRIADDRAFT_20725              115   2e-24    Trichoplax adhaerens
ref|XP_006567257.1|  PREDICTED: vacuolar protein sorting-associat...    115   2e-24    
ref|XP_006617475.1|  PREDICTED: vacuolar protein sorting-associat...    115   2e-24    Apis dorsata [rock honeybee]
ref|XP_392642.2|  PREDICTED: vacuolar protein sorting-associated ...    115   2e-24    Apis mellifera [bee]
ref|XP_011420366.1|  PREDICTED: vacuolar protein sorting-associat...    115   4e-24    Crassostrea gigas
ref|XP_011420359.1|  PREDICTED: vacuolar protein sorting-associat...    115   4e-24    Crassostrea gigas
ref|XP_004930556.1|  PREDICTED: vacuolar protein sorting-associat...    115   5e-24    Bombyx mori [silk moth]
ref|XP_005431022.1|  PREDICTED: vacuolar protein sorting-associat...    114   6e-24    
ref|XP_011056171.1|  PREDICTED: vacuolar protein sorting-associat...    114   8e-24    Acromyrmex echinatior
ref|XP_012060505.1|  PREDICTED: vacuolar protein sorting-associat...    114   8e-24    Atta cephalotes
gb|EPY49689.1|  HOPS complex subunit Vps16                              114   9e-24    Schizosaccharomyces cryophilus OY26
ref|XP_011699104.1|  PREDICTED: vacuolar protein sorting-associat...    114   1e-23    Wasmannia auropunctata
ref|XP_003690002.1|  PREDICTED: vacuolar protein sorting-associat...    114   1e-23    Apis florea [dwarf honeybee]
gb|AAH64406.1|  VPS16 protein                                           109   1e-23    Homo sapiens [man]
ref|XP_001943896.1|  PREDICTED: vacuolar protein sorting-associat...    113   2e-23    Acyrthosiphon pisum
gb|EGU11808.1|  Vacuolar assembling/sorting protein VPS16               113   2e-23    Rhodotorula toruloides ATCC 204091
gb|EPX74952.1|  HOPS complex subunit Vps16                              113   2e-23    Schizosaccharomyces octosporus yFS286
gb|EAX10565.1|  hCG2039972, isoform CRA_b                               109   2e-23    Homo sapiens [man]
ref|XP_011644142.1|  PREDICTED: vacuolar protein sorting-associat...    113   2e-23    Pogonomyrmex barbatus
gb|AAI26432.1|  VPS16 protein                                           109   2e-23    Homo sapiens [man]
gb|EJU02203.1|  vacuolar protein sorting-associated protein 16          112   2e-23    Dacryopinax primogenitus
ref|XP_011173487.1|  PREDICTED: vacuolar protein sorting-associat...    112   3e-23    Solenopsis invicta [imported red fire ant]
gb|ERL93903.1|  hypothetical protein D910_11189                         112   3e-23    Dendroctonus ponderosae
ref|XP_007674604.1|  hypothetical protein BAUCODRAFT_66530              112   3e-23    Baudoinia panamericana UAMH 10762
ref|XP_008200104.1|  PREDICTED: vacuolar protein sorting-associat...    112   4e-23    Tribolium castaneum [rust-red flour beetle]
gb|AAH21291.2|  VPS16 protein                                           109   4e-23    Homo sapiens [man]
gb|EFA13302.1|  hypothetical protein TcasGA2_TC001384                   112   4e-23    
gb|ENN73877.1|  hypothetical protein YQE_09530                          112   4e-23    Dendroctonus ponderosae
gb|KFQ96045.1|  Vacuolar protein sorting-associated protein 16          112   4e-23    Nipponia nippon
ref|XP_002621281.1|  vacuolar protein sorting vps16                     112   4e-23    Blastomyces gilchristii SLH14081
gb|EQL37787.1|  hypothetical protein BDFG_00836                         112   5e-23    Blastomyces dermatitidis ATCC 26199
gb|ENN73876.1|  hypothetical protein YQE_09530                          112   5e-23    Dendroctonus ponderosae
ref|XP_005320597.1|  PREDICTED: vacuolar protein sorting-associat...    111   5e-23    
ref|XP_005320596.1|  PREDICTED: vacuolar protein sorting-associat...    111   6e-23    Ictidomys tridecemlineatus
ref|XP_011251370.1|  PREDICTED: vacuolar protein sorting-associat...    111   7e-23    Camponotus floridanus
gb|KFO20539.1|  Vacuolar protein sorting-associated protein 16 li...    110   8e-23    Fukomys damarensis [Damara mole rat]
gb|KDN52476.1|  hypothetical protein K437DRAFT_214166                   111   8e-23    Tilletiaria anomala UBC 951
ref|XP_004585724.1|  PREDICTED: vacuolar protein sorting-associat...    110   9e-23    Ochotona princeps [southern American pika]
ref|XP_005812181.1|  PREDICTED: vacuolar protein sorting-associat...    110   9e-23    
ref|XP_011500724.1|  PREDICTED: vacuolar protein sorting-associat...    111   9e-23    Ceratosolen solmsi marchali
ref|XP_004585723.1|  PREDICTED: vacuolar protein sorting-associat...    111   9e-23    Ochotona princeps [southern American pika]
ref|XP_005812180.1|  PREDICTED: vacuolar protein sorting-associat...    110   1e-22    Xiphophorus maculatus
ref|XP_003706213.1|  PREDICTED: vacuolar protein sorting-associat...    110   1e-22    Megachile rotundata
gb|EFW19425.1|  vacuolar protein sorting vps16                          110   1e-22    Coccidioides posadasii str. Silveira
ref|XP_781126.3|  PREDICTED: vacuolar protein sorting-associated ...    110   1e-22    Strongylocentrotus purpuratus [purple urchin]
gb|KDE08398.1|  hypothetical protein MVLG_01434                         110   1e-22    Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_004661527.1|  PREDICTED: vacuolar protein sorting-associat...    110   1e-22    Jaculus jaculus
ref|XP_004661526.1|  PREDICTED: vacuolar protein sorting-associat...    110   1e-22    Jaculus jaculus
ref|XP_003067206.1|  Vps16 family protein                               110   1e-22    Coccidioides posadasii C735 delta SOWgp
dbj|GAM90669.1|  hypothetical protein ANO11243_087140                   110   1e-22    fungal sp. No.11243
gb|EER38773.1|  vacuolar sorting protein                                110   1e-22    Histoplasma capsulatum H143
ref|XP_011673487.1|  PREDICTED: vacuolar protein sorting-associat...    110   1e-22    Strongylocentrotus purpuratus [purple urchin]
ref|XP_007540621.1|  PREDICTED: vacuolar protein sorting-associat...    110   1e-22    Poecilia formosa
ref|XP_004210014.1|  PREDICTED: vacuolar protein sorting-associat...    105   1e-22    
ref|XP_008434411.1|  PREDICTED: vacuolar protein sorting-associat...    110   1e-22    
gb|EHB04285.1|  Vacuolar protein sorting-associated protein 16-li...    110   1e-22    
gb|EEH15770.1|  hypothetical protein PABG_05857                         110   1e-22    
ref|XP_010609328.1|  PREDICTED: vacuolar protein sorting-associat...    110   1e-22    
ref|XP_005380824.1|  PREDICTED: vacuolar protein sorting-associat...    110   2e-22    
ref|XP_010609327.1|  PREDICTED: vacuolar protein sorting-associat...    110   2e-22    
gb|AAH73959.1|  VPS16 protein                                           109   2e-22    
ref|XP_005380823.1|  PREDICTED: vacuolar protein sorting-associat...    110   2e-22    
ref|XP_005006664.1|  PREDICTED: vacuolar protein sorting-associat...    110   2e-22    
gb|EKG16533.1|  Vps16                                                   110   2e-22    
gb|EEH09936.1|  vacuolar sorting-associated protein                     110   2e-22    
ref|XP_003476673.1|  PREDICTED: vacuolar protein sorting-associat...    110   2e-22    
gb|EGC44404.1|  vacuolar sorting-associated protein                     110   2e-22    
ref|XP_003476674.1|  PREDICTED: vacuolar protein sorting-associat...    109   2e-22    
ref|XP_008568869.1|  PREDICTED: vacuolar protein sorting-associat...    109   2e-22    
ref|XP_004886773.1|  PREDICTED: vacuolar protein sorting-associat...    109   2e-22    
ref|XP_005604575.1|  PREDICTED: vacuolar protein sorting-associat...    109   2e-22    
ref|XP_008568870.1|  PREDICTED: vacuolar protein sorting-associat...    109   2e-22    
ref|XP_007876459.1|  hypothetical protein PFL1_00766                    110   2e-22    
gb|EHH65496.1|  Vacuolar protein sorting-associated protein 16-li...    109   2e-22    
ref|XP_004084634.2|  PREDICTED: vacuolar protein sorting-associat...    109   2e-22    
ref|XP_008568868.1|  PREDICTED: vacuolar protein sorting-associat...    109   3e-22    
ref|NP_001004976.1|  vacuolar protein sorting 16 homolog                109   3e-22    
ref|XP_006164053.1|  PREDICTED: vacuolar protein sorting-associat...    109   3e-22    
ref|XP_001239640.1|  hypothetical protein CIMG_09261                    109   3e-22    
gb|AAH12422.1|  VPS16 protein                                           107   3e-22    
ref|XP_004886769.1|  PREDICTED: vacuolar protein sorting-associat...    109   3e-22    
ref|XP_001496814.1|  PREDICTED: vacuolar protein sorting-associat...    109   3e-22    
ref|XP_008525819.1|  PREDICTED: vacuolar protein sorting-associat...    109   3e-22    
ref|XP_011550625.1|  PREDICTED: vacuolar protein sorting-associat...    109   3e-22    
ref|XP_010762126.1|  hypothetical protein PADG_06891                    109   3e-22    
ref|XP_003941102.1|  PREDICTED: vacuolar protein sorting-associat...    109   3e-22    
ref|XP_002806793.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...    109   4e-22    
gb|EAS28057.3|  vacuolar protein sorting vps16                          109   4e-22    
ref|XP_007465456.1|  PREDICTED: vacuolar protein sorting-associat...    108   4e-22    
ref|XP_003639898.1|  PREDICTED: vacuolar protein sorting-associat...    108   4e-22    
emb|CAD39063.1|  hypothetical protein                                   108   4e-22    
ref|XP_007958199.1|  PREDICTED: vacuolar protein sorting-associat...    108   4e-22    
gb|KJX98317.1|  hypothetical protein TI39_contig418g00006               109   4e-22    
ref|XP_004285369.1|  PREDICTED: vacuolar protein sorting-associat...    108   4e-22    
ref|XP_003639899.1|  PREDICTED: vacuolar protein sorting-associat...    108   5e-22    
ref|XP_005894002.1|  PREDICTED: vacuolar protein sorting-associat...    108   5e-22    
ref|XP_007465455.1|  PREDICTED: vacuolar protein sorting-associat...    108   5e-22    
ref|XP_008046183.1|  PREDICTED: vacuolar protein sorting-associat...    108   5e-22    
ref|XP_007195891.1|  PREDICTED: vacuolar protein sorting-associat...    108   5e-22    
gb|EPQ13004.1|  Vacuolar protein sorting-associated protein 16 li...    108   5e-22    
ref|XP_004433875.1|  PREDICTED: vacuolar protein sorting-associat...    108   5e-22    
ref|XP_004285368.1|  PREDICTED: vacuolar protein sorting-associat...    108   5e-22    
ref|XP_011798727.1|  PREDICTED: vacuolar protein sorting-associat...    108   5e-22    
ref|XP_007958197.1|  PREDICTED: vacuolar protein sorting-associat...    108   5e-22    
ref|XP_004433876.1|  PREDICTED: vacuolar protein sorting-associat...    108   5e-22    
gb|EME47796.1|  hypothetical protein DOTSEDRAFT_78000                   108   5e-22    
ref|XP_005874819.1|  PREDICTED: vacuolar protein sorting-associat...    108   5e-22    
ref|XP_008139241.1|  PREDICTED: vacuolar protein sorting-associat...    108   5e-22    
ref|XP_006096450.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...    108   5e-22    
ref|NP_536338.1|  vacuolar protein sorting-associated protein 16 ...    108   5e-22    
ref|XP_005688276.1|  PREDICTED: vacuolar protein sorting-associat...    108   5e-22    
ref|XP_007195890.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_006894253.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_007195888.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_010377297.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_005568560.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_004061764.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_009214732.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_007073325.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_008139240.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_004061763.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_011798726.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|NP_001253119.1|  vacuolar protein sorting-associated protein ...    108   6e-22    
ref|XP_007195886.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|NP_001015522.1|  vacuolar protein sorting-associated protein ...    108   6e-22    
ref|XP_005894001.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_009434988.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
tpg|DAA23165.1|  TPA: vacuolar protein sorting-associated protein...    108   6e-22    
ref|XP_004772965.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|NP_072097.2|  vacuolar protein sorting-associated protein 16 ...    108   6e-22    
ref|XP_010834814.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_007195887.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_003905036.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_004014428.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_011390572.1|  hypothetical protein UMAG_11636                    108   6e-22    
ref|XP_003855617.1|  hypothetical protein MYCGRDRAFT_68201              108   6e-22    
ref|XP_008017290.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
gb|EEH40515.2|  vacuolar protein sorting-associated protein             108   6e-22    
ref|XP_006894252.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_011279227.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_003788108.1|  PREDICTED: vacuolar protein sorting-associat...    108   6e-22    
ref|XP_004383068.1|  PREDICTED: vacuolar protein sorting-associat...    108   7e-22    
ref|XP_009434986.1|  PREDICTED: vacuolar protein sorting-associat...    108   7e-22    
ref|XP_003788109.1|  PREDICTED: vacuolar protein sorting-associat...    108   7e-22    
ref|XP_008558295.1|  PREDICTED: vacuolar protein sorting-associat...    108   7e-22    
ref|XP_005974817.1|  PREDICTED: vacuolar protein sorting-associat...    108   7e-22    
ref|XP_005688275.1|  PREDICTED: vacuolar protein sorting-associat...    108   7e-22    
ref|XP_006042778.1|  PREDICTED: vacuolar protein sorting-associat...    108   7e-22    
ref|XP_007539587.1|  PREDICTED: vacuolar protein sorting-associat...    108   7e-22    
ref|XP_004398209.1|  PREDICTED: vacuolar protein sorting-associat...    108   7e-22    
dbj|GAK67926.1|  vacuolar assembling/sorting protein VPS16              108   7e-22    
ref|XP_004772964.1|  PREDICTED: vacuolar protein sorting-associat...    108   7e-22    
ref|XP_004383066.1|  PREDICTED: vacuolar protein sorting-associat...    108   7e-22    
gb|EFB15467.1|  hypothetical protein PANDA_007366                       108   8e-22    
ref|XP_002918844.2|  PREDICTED: vacuolar protein sorting-associat...    108   8e-22    
dbj|GAC75011.1|  predicted metalloprotease with chaperone activity      108   8e-22    
ref|XP_006042780.1|  PREDICTED: vacuolar protein sorting-associat...    107   8e-22    
dbj|BAB71013.1|  unnamed protein product                                107   8e-22    
ref|XP_008017280.1|  PREDICTED: vacuolar protein sorting-associat...    108   8e-22    
ref|XP_002710925.2|  PREDICTED: vacuolar protein sorting-associat...    108   8e-22    
ref|XP_004398208.1|  PREDICTED: vacuolar protein sorting-associat...    108   8e-22    
ref|XP_006042777.1|  PREDICTED: vacuolar protein sorting-associat...    108   9e-22    
ref|XP_004317401.1|  PREDICTED: vacuolar protein sorting-associat...    107   9e-22    
ref|XP_006187202.1|  PREDICTED: vacuolar protein sorting-associat...    108   9e-22    
ref|XP_006732343.1|  PREDICTED: vacuolar protein sorting-associat...    107   9e-22    
ref|XP_007539586.1|  PREDICTED: vacuolar protein sorting-associat...    107   9e-22    
ref|XP_006732342.1|  PREDICTED: vacuolar protein sorting-associat...    107   9e-22    
gb|EKD04193.1|  vacuole organization and biogenesis-related protein     105   1e-21    
ref|XP_004317400.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
ref|XP_006207386.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
ref|XP_003411664.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...    107   1e-21    
ref|XP_010971080.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
ref|XP_007636110.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
ref|XP_006758181.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
gb|ETS65113.1|  hypothetical protein PaG_00571                          107   1e-21    
ref|XP_010971081.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
ref|XP_006874900.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
ref|XP_006874899.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
gb|ELK04019.1|  Vacuolar protein sorting-associated protein 16 li...    107   1e-21    
gb|ELK34510.1|  Vacuolar protein sorting-associated protein 16 li...    107   1e-21    
ref|XP_005068684.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
ref|XP_004697935.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
ref|XP_006207385.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
gb|EPY79196.1|  vacuolar protein sorting-associated protein 16 is...    107   1e-21    
ref|XP_005068683.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
ref|XP_004697934.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
gb|AAG34678.1|AF308801_1  vacuolar protein sorting protein 16           107   1e-21    
gb|ERE69810.1|  putative vacuolar protein sorting-associated prot...    107   1e-21    
ref|XP_011367811.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
ref|XP_006921721.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
ref|XP_003966794.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
ref|XP_003499087.1|  PREDICTED: vacuolar protein sorting-associat...    107   1e-21    
ref|XP_006984591.1|  PREDICTED: vacuolar protein sorting-associat...    107   2e-21    
dbj|GAC99770.1|  hypothetical protein PHSY_007373                       107   2e-21    
ref|XP_004634302.1|  PREDICTED: vacuolar protein sorting-associat...    107   2e-21    
ref|XP_011305829.1|  PREDICTED: vacuolar protein sorting-associat...    107   2e-21    
ref|XP_007127204.1|  PREDICTED: vacuolar protein sorting-associat...    107   2e-21    
gb|EMR87211.1|  putative vacuolar protein sorting-associated protein    107   2e-21    
ref|XP_004634301.1|  PREDICTED: vacuolar protein sorting-associat...    107   2e-21    
ref|XP_001559341.1|  hypothetical protein BC1G_02005                    107   2e-21    
emb|CCD43976.1|  similar to vacuolar protein sorting vps16              107   2e-21    
ref|XP_001598431.1|  hypothetical protein SS1G_00520                    106   2e-21    
ref|XP_007588153.1|  putative vacuolar protein sorting vps16 protein    106   2e-21    
ref|XP_006959833.1|  hypothetical protein WALSEDRAFT_61128              106   3e-21    
ref|XP_001660915.1|  AAEL010559-PA                                      106   3e-21    
ref|XP_006010586.1|  PREDICTED: vacuolar protein sorting-associat...    105   4e-21    
ref|XP_009231696.1|  PREDICTED: vacuolar protein sorting-associat...    105   4e-21    
gb|EZA48287.1|  Vacuolar protein sorting-associated protein 16-li...    105   4e-21    
ref|NP_593444.1|  HOPS complex subunit Vps16 (predicted)                105   4e-21    
ref|XP_003774363.1|  PREDICTED: vacuolar protein sorting-associat...    105   5e-21    
ref|XP_009231695.1|  PREDICTED: vacuolar protein sorting-associat...    105   5e-21    
ref|XP_011348407.1|  PREDICTED: vacuolar protein sorting-associat...    105   5e-21    
ref|NP_001005541.1|  vacuolar protein sorting-associated protein ...    105   5e-21    
gb|EMF15307.1|  vacuolar protein sorting-associated protein             105   6e-21    
ref|XP_007004384.1|  hypothetical protein TREMEDRAFT_71557              105   6e-21    
emb|CBQ68702.1|  related to vacuolar protein sorting 16                 105   7e-21    
ref|NP_001153367.1|  vacuolar protein sorting 16 homolog A              105   9e-21    
gb|EFX02190.1|  vacuolar protein sorting                                104   1e-20    
ref|XP_007497007.1|  PREDICTED: vacuolar protein sorting-associat...    104   1e-20    
gb|ABC94505.1|  hypothetical protein                                  97.8    1e-20    
ref|XP_011500721.1|  PREDICTED: vacuolar protein sorting-associat...  99.8    1e-20    
gb|ETN68096.1|  vacuolar protein sorting vps16                          104   1e-20    
ref|XP_002567389.1|  Pc21g03250                                         104   1e-20    
ref|XP_004687406.1|  PREDICTED: vacuolar protein sorting-associat...    103   2e-20    
ref|XP_004687407.1|  PREDICTED: vacuolar protein sorting-associat...    103   2e-20    
ref|XP_007785089.1|  hypothetical protein W97_09035                     103   2e-20    
ref|XP_002795864.1|  vacuolar protein sorting-associated protein        103   2e-20    
gb|KIW03814.1|  hypothetical protein PV09_05114                         103   2e-20    
ref|XP_008323608.1|  PREDICTED: vacuolar protein sorting-associat...    103   2e-20    
ref|XP_009565616.1|  PREDICTED: vacuolar protein sorting-associat...    103   2e-20    
ref|XP_006682562.1|  hypothetical protein BATDEDRAFT_14644              103   2e-20    
gb|KFQ73920.1|  Vacuolar protein sorting-associated protein 16          103   3e-20    
ref|XP_010284296.1|  PREDICTED: vacuolar protein sorting-associat...    103   3e-20    
ref|XP_004611016.1|  PREDICTED: vacuolar protein sorting-associat...    103   3e-20    
ref|XP_004611017.1|  PREDICTED: vacuolar protein sorting-associat...    102   4e-20    
ref|XP_004469198.1|  PREDICTED: vacuolar protein sorting-associat...    102   4e-20    
ref|XP_008701652.1|  PREDICTED: vacuolar protein sorting-associat...    102   4e-20    
ref|XP_008469959.1|  PREDICTED: vacuolar protein sorting-associat...    102   5e-20    
pdb|4KMO|B  Chain B, Crystal Structure Of The Vps33-vps16 Hops Su...  99.8    5e-20    
ref|XP_776977.1|  hypothetical protein CNBB5050                         102   6e-20    
gb|EGD96647.1|  vacuolar protein sorting vps16                          102   6e-20    
gb|EZF35996.1|  hypothetical protein H101_00471                         102   6e-20    
gb|KDB28142.1|  hypothetical protein H109_00087                         102   7e-20    
ref|XP_569075.1|  vacuole organization and biogenesis-related pro...    102   7e-20    
gb|KIR83430.1|  vacuolar protein sorting-associated protein             102   8e-20    
ref|XP_003300566.1|  hypothetical protein PTT_11835                     102   8e-20    
ref|XP_009908341.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...    102   9e-20    
ref|XP_007440032.1|  PREDICTED: vacuolar protein sorting-associat...    102   9e-20    
emb|CCF48914.1|  related to vacuolar protein sorting 16                 102   9e-20    
gb|KIW59851.1|  hypothetical protein PV05_00117                         101   1e-19    
dbj|GAA90716.1|  vacuolar protein sorting vps16                         101   1e-19    
gb|KFV71981.1|  Vacuolar protein sorting-associated protein 16          101   1e-19    
ref|XP_001401136.1|  vacuolar protein sorting vps16                     101   1e-19    
ref|XP_010747877.1|  PREDICTED: vacuolar protein sorting-associat...    101   1e-19    
gb|KIY31247.1|  vacuolar protein sorting-associated protein             101   1e-19    
ref|XP_009670569.1|  PREDICTED: vacuolar protein sorting-associat...    101   1e-19    
ref|XP_001936289.1|  vacuolar protein sorting-associated protein        101   1e-19    
gb|KGO60206.1|  Vps16, N-terminal                                       101   1e-19    
gb|EHA27921.1|  hypothetical protein ASPNIDRAFT_53870                   101   1e-19    
gb|KJJ28202.1|  Vps16 N-terminal                                        101   2e-19    
ref|XP_002072009.1|  GK22550                                            101   2e-19    
gb|EYE92957.1|  vacuolar protein sorting-associated protein 16          101   2e-19    
gb|KGB80280.1|  vacuolar assembling/sorting protein VPS16               100   2e-19    
ref|XP_003170422.1|  vacuolar protein sorting-associated protein        100   2e-19    
ref|XP_011154335.1|  PREDICTED: vacuolar protein sorting-associat...    100   2e-19    
ref|XP_001842734.1|  vacuolar protein sorting vps16                     100   2e-19    
gb|KIR76852.1|  vacuolar protein sorting-associated protein             100   2e-19    
ref|XP_003655439.1|  hypothetical protein THITE_2119126                 100   2e-19    
ref|XP_003192484.1|  vacuole organization and biogenesis-related ...    100   2e-19    
gb|KJE01407.1|  vacuolar protein sorting-associated protein             100   2e-19    
gb|KIR50703.1|  vacuolar protein sorting-associated protein             100   2e-19    
emb|CDM31032.1|  Probable transposable element                          100   3e-19    
gb|KFV61198.1|  Vacuolar protein sorting-associated protein 16          100   3e-19    
gb|KIR45019.1|  vacuolar protein sorting-associated protein             100   3e-19    



>gb|KHN35900.1| Vacuolar protein sorting-associated protein 16 like [Glycine 
soja]
Length=613

 Score =   501 bits (1289),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 253/278 (91%), Positives = 267/278 (96%), Gaps = 0/278 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FGTIQ+RPL RDLFI+YAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  335   LVYLVLFHIWQKRQPLEFFGTIQARPLARDLFITYARFYKHEFLKDFFLSTGQLQDVAFL  394

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL+EKAHGLFAETKEH FESKAAEEHAKLLRIQHE
Sbjct  395   LWKESWELGKNPMASKGSPLHGPRIKLIEKAHGLFAETKEHTFESKAAEEHAKLLRIQHE  454

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEVTTKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATI+DW 
Sbjct  455   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIKDWV  514

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEK+PPIGY+PFVEAC+EA++KGEA+KYIPKLADPRERAE+YA IGMAKEAADA
Sbjct  515   ALEKFSKEKKPPIGYRPFVEACIEADEKGEAIKYIPKLADPRERAESYARIGMAKEAADA  574

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  427
             ASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG
Sbjct  575   ASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQG  612



>gb|AFK37940.1| unknown [Lotus japonicus]
Length=375

 Score =   488 bits (1256),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 248/280 (89%), Positives = 262/280 (94%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FGTIQ+R L R+LF++YAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  96    LVYLVLFHIWQKRQPLEFFGTIQARALARELFVTYARCYKHEFLKDFFLSTGQLQDVAFL  155

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW L KNPMASKGSPLHGPRIKL+EKA  LFAETKEH FESKAAEEHAKLLRIQHE
Sbjct  156   LWKESWALGKNPMASKGSPLHGPRIKLIEKAQNLFAETKEHTFESKAAEEHAKLLRIQHE  215

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEVTTKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATI+DW 
Sbjct  216   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAATKVKTEFKVSEKRWYWLKVFALATIKDWV  275

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEK+PPIGY+PFVEAC+EA +KGEA+KYIPKLADPRERAE+YA IGMAKEAADA
Sbjct  276   ALEKFSKEKKPPIGYRPFVEACIEANEKGEAIKYIPKLADPRERAESYARIGMAKEAADA  335

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKLTFSQNAAA+SIFDTLRDRL+F G S
Sbjct  336   ASQAKDGELLGRLKLTFSQNAAASSIFDTLRDRLSFPGAS  375



>gb|KDO51889.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=449

 Score =   488 bits (1256),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 247/280 (88%), Positives = 261/280 (93%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRPALE FG IQ+RPL  DLF  YAR YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  170   LVYLVIFHIWQKRPALEFFGMIQTRPLACDLFTVYARCYKHEFLKDFFLSTGQLQEVAFL  229

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMAS GS LHGPRIK +EKAH LF+ETKEH FESKAAEEHAKLLRIQHE
Sbjct  230   LWKESWELGKNPMASNGSALHGPRIKRIEKAHSLFSETKEHTFESKAAEEHAKLLRIQHE  289

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALAT RDWD
Sbjct  290   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWD  349

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALE+FSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKEAADA
Sbjct  350   ALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKEAADA  409

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  410   ASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGVS  449



>ref|XP_007048986.1| Vacuoleless1 (VCL1) isoform 2 [Theobroma cacao]
 gb|EOX93143.1| Vacuoleless1 (VCL1) isoform 2 [Theobroma cacao]
Length=844

 Score =   500 bits (1288),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 253/280 (90%), Positives = 268/280 (96%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRP LE FG IQ+RPLPRDLFISYAR YKHEFLKDFFLSTGQLQ+VA+L
Sbjct  565   LVYLVLFHIWQKRPPLEFFGMIQARPLPRDLFISYARCYKHEFLKDFFLSTGQLQEVAYL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMA+KGSPLHGPRIKL+EKA  LF+ETKEH FESKAAEEHAKLLRIQHE
Sbjct  625   LWKESWELGKNPMATKGSPLHGPRIKLIEKAQHLFSETKEHTFESKAAEEHAKLLRIQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDWD
Sbjct  685   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWD  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKLADPRERAEAYA IGMAKEAADA
Sbjct  745   ALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLADPRERAEAYARIGMAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKLTF+QNAAA+S+FDTLRDRL+FQG S
Sbjct  805   ASQAKDGELLGRLKLTFAQNAAASSLFDTLRDRLSFQGVS  844



>ref|XP_003551927.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Glycine max]
Length=843

 Score =   499 bits (1284),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 253/278 (91%), Positives = 267/278 (96%), Gaps = 0/278 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FGTIQ+RPL RDLFI+YAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  565   LVYLVLFHIWQKRQPLEFFGTIQARPLARDLFITYARFYKHEFLKDFFLSTGQLQDVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL+EKAHGLFAETKEH FESKAAEEHAKLLRIQHE
Sbjct  625   LWKESWELGKNPMASKGSPLHGPRIKLIEKAHGLFAETKEHTFESKAAEEHAKLLRIQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEVTTKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATI+DW 
Sbjct  685   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIKDWV  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEK+PPIGY+PFVEAC+EA++KGEA+KYIPKLADPRERAE+YA IGMAKEAADA
Sbjct  745   ALEKFSKEKKPPIGYRPFVEACIEADEKGEAIKYIPKLADPRERAESYARIGMAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  427
             ASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG
Sbjct  805   ASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQG  842



>ref|XP_011082899.1| PREDICTED: protein VACUOLELESS1 [Sesamum indicum]
Length=840

 Score =   497 bits (1279),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 252/280 (90%), Positives = 267/280 (95%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             L+YLVL HIW+KR  LE F TIQ+RPL RDLF++YAR YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  561   LMYLVLFHIWRKRAPLEFFSTIQARPLARDLFVTYARSYKHEFLKDFFLSTGQLQEVAFL  620

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWELA+NPMASKGSPLHGPRIKL+EKAH LF ETKEH+FESKAAEEHAKLLRIQHE
Sbjct  621   LWKESWELARNPMASKGSPLHGPRIKLIEKAHNLFTETKEHMFESKAAEEHAKLLRIQHE  680

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD
Sbjct  681   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  740

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEACV+A +K +ALKYIPKLADPRERAEAYA IGMAKEAADA
Sbjct  741   ALEKFSKEKRPPIGYRPFVEACVDAGEKDQALKYIPKLADPRERAEAYAKIGMAKEAADA  800

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKLTF+QNAAAASIFDTLRDRL+FQG S
Sbjct  801   ASQAKDGELLGRLKLTFAQNAAAASIFDTLRDRLSFQGVS  840



>ref|XP_003532091.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Glycine max]
Length=843

 Score =   496 bits (1277),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 251/278 (90%), Positives = 268/278 (96%), Gaps = 0/278 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FGTIQ+RPL RDLF++YAR+YKHEFLKDFFLSTGQLQDVAFL
Sbjct  565   LVYLVLFHIWQKRQPLEFFGTIQARPLARDLFVTYARIYKHEFLKDFFLSTGQLQDVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL+EKAHGLFAETKEH FESKAAEEHAKLLRIQHE
Sbjct  625   LWKESWELGKNPMASKGSPLHGPRIKLIEKAHGLFAETKEHTFESKAAEEHAKLLRIQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEVTTKQAIFVDSSISDTIRTCIVLGN+RAA KVKTEFKVSEKRWYWLKVFALATI+DW 
Sbjct  685   LEVTTKQAIFVDSSISDTIRTCIVLGNNRAAMKVKTEFKVSEKRWYWLKVFALATIKDWV  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEK+PPIGY+PFVEAC+EA++KGEA+KYIPKLADPRERAE+YA IGMAKEAADA
Sbjct  745   ALEKFSKEKKPPIGYRPFVEACIEADEKGEAIKYIPKLADPRERAESYARIGMAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  427
             ASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG
Sbjct  805   ASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQG  842



>gb|KJB10618.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=844

 Score =   496 bits (1277),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 253/280 (90%), Positives = 267/280 (95%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRP LE FG IQ+RPLPRDLFISYAR YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  565   LVYLVLFHIWQKRPPLEFFGMIQARPLPRDLFISYARCYKHEFLKDFFLSTGQLQEVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL++KA  LFAETKEH FESKAAEEHAKLLRIQHE
Sbjct  625   LWKESWELGKNPMASKGSPLHGPRIKLIDKAQHLFAETKEHTFESKAAEEHAKLLRIQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDW+
Sbjct  685   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWE  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKLAD RERAEAYA IGMAKEAADA
Sbjct  745   ALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLADLRERAEAYARIGMAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKLTF+QNAAA+S+FDTLRDRL+FQG S
Sbjct  805   ASQAKDGELLGRLKLTFAQNAAASSLFDTLRDRLSFQGVS  844



>gb|EYU33990.1| hypothetical protein MIMGU_mgv1a001320mg [Erythranthe guttata]
Length=840

 Score =   496 bits (1277),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 250/280 (89%), Positives = 265/280 (95%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIW K+  LE FG IQ+RPL RDLF++YAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  561   LVYLVLFHIWHKKAPLEFFGMIQARPLARDLFVTYARCYKHEFLKDFFLSTGQLQDVAFL  620

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWELAKNPMASKG+PLHGPRIKLVEKAH LF ETKEH++ESKAAEEHAKLLRIQHE
Sbjct  621   LWKESWELAKNPMASKGTPLHGPRIKLVEKAHNLFTETKEHIYESKAAEEHAKLLRIQHE  680

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVK EFKVSEKRWYWLKVFALATIRDWD
Sbjct  681   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKVEFKVSEKRWYWLKVFALATIRDWD  740

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEACV+A +K EALKYIPKLADPRE+AEAYA IGMAKEAADA
Sbjct  741   ALEKFSKEKRPPIGYRPFVEACVDAGEKDEALKYIPKLADPREKAEAYARIGMAKEAADA  800

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKL+F+QNAAA+SIFDTLRDRL+FQG S
Sbjct  801   ASQAKDGELLGRLKLSFAQNAAASSIFDTLRDRLSFQGVS  840



>gb|KDO51888.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=618

 Score =   488 bits (1257),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 247/280 (88%), Positives = 261/280 (93%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRPALE FG IQ+RPL  DLF  YAR YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  339   LVYLVIFHIWQKRPALEFFGMIQTRPLACDLFTVYARCYKHEFLKDFFLSTGQLQEVAFL  398

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMAS GS LHGPRIK +EKAH LF+ETKEH FESKAAEEHAKLLRIQHE
Sbjct  399   LWKESWELGKNPMASNGSALHGPRIKRIEKAHSLFSETKEHTFESKAAEEHAKLLRIQHE  458

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALAT RDWD
Sbjct  459   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWD  518

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALE+FSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKEAADA
Sbjct  519   ALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKEAADA  578

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  579   ASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGVS  618



>ref|XP_002526647.1| vacuolar protein sorting vps16, putative [Ricinus communis]
 gb|EEF35735.1| vacuolar protein sorting vps16, putative [Ricinus communis]
Length=851

 Score =   494 bits (1272),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 249/279 (89%), Positives = 264/279 (95%), Gaps = 0/279 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRPALE FGTIQ+RPL  DLF++YA  YKHEFLKDFFLSTGQLQDVAFL
Sbjct  573   LVYLVLFHIWQKRPALEFFGTIQARPLAHDLFVTYAWCYKHEFLKDFFLSTGQLQDVAFL  632

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL+EKA  LF ETKEH FESKAAEEHAKLLRIQHE
Sbjct  633   LWKESWELGKNPMASKGSPLHGPRIKLIEKAQNLFLETKEHAFESKAAEEHAKLLRIQHE  692

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDWD
Sbjct  693   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAIKVKTEFKVSEKRWYWLKVFALATIRDWD  752

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEAC++A++KGEALKYIPKLADPRERAEAYA +GMAKEAADA
Sbjct  753   ALEKFSKEKRPPIGYRPFVEACIDADEKGEALKYIPKLADPRERAEAYARVGMAKEAADA  812

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  424
             ASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG 
Sbjct  813   ASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGV  851



>gb|KJB10616.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=888

 Score =   494 bits (1273),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 252/278 (91%), Positives = 266/278 (96%), Gaps = 0/278 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRP LE FG IQ+RPLPRDLFISYAR YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  565   LVYLVLFHIWQKRPPLEFFGMIQARPLPRDLFISYARCYKHEFLKDFFLSTGQLQEVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL++KA  LFAETKEH FESKAAEEHAKLLRIQHE
Sbjct  625   LWKESWELGKNPMASKGSPLHGPRIKLIDKAQHLFAETKEHTFESKAAEEHAKLLRIQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDW+
Sbjct  685   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWE  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKLAD RERAEAYA IGMAKEAADA
Sbjct  745   ALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLADLRERAEAYARIGMAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  427
             ASQAKDGELLGRLKLTF+QNAAA+S+FDTLRDRL+FQG
Sbjct  805   ASQAKDGELLGRLKLTFAQNAAASSLFDTLRDRLSFQG  842



>ref|XP_009790374.1| PREDICTED: protein VACUOLELESS1 [Nicotiana sylvestris]
Length=843

 Score =   492 bits (1267),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 250/280 (89%), Positives = 266/280 (95%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRPALE FGTIQ+RPL RDLF++YAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  564   LVYLVLFHIWQKRPALEFFGTIQARPLARDLFVNYARHYKHEFLKDFFLSTGQLQDVAFL  623

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL+KNPMASKGSPLHGPRIKL+EK+  LFAETKE+VFESKAAEEHAKLLR+QHE
Sbjct  624   LWKESWELSKNPMASKGSPLHGPRIKLIEKSQHLFAETKEYVFESKAAEEHAKLLRMQHE  683

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEVTTKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDWD
Sbjct  684   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAAAKVKTEFKVSEKRWYWLKVFALATIRDWD  743

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAEAYA +GMAKEAADA
Sbjct  744   ALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLTDPRERAEAYARVGMAKEAADA  803

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKD ELLGRLK TF+QNAAA+SIFDTLRDRL+F   S
Sbjct  804   ASQAKDNELLGRLKQTFAQNAAASSIFDTLRDRLSFPSVS  843



>ref|XP_002283428.1| PREDICTED: protein VACUOLELESS1 [Vitis vinifera]
 emb|CBI22093.3| unnamed protein product [Vitis vinifera]
Length=838

 Score =   491 bits (1265),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 248/274 (91%), Positives = 262/274 (96%), Gaps = 0/274 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRPALE FG IQ+RPL RDLFI+YAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  562   LVYLVLFHIWQKRPALEYFGMIQARPLARDLFITYARCYKHEFLKDFFLSTGQLQDVAFL  621

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIK++EKA  LF+ETKEH FESKAAEEHAKL+RIQHE
Sbjct  622   LWKESWELGKNPMASKGSPLHGPRIKIIEKAQSLFSETKEHTFESKAAEEHAKLIRIQHE  681

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEVTTKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDWD
Sbjct  682   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWD  741

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEAC++A++KGEALKYIPKL DPRERAE+YA IGMAKEAADA
Sbjct  742   ALEKFSKEKRPPIGYRPFVEACIDADEKGEALKYIPKLTDPRERAESYARIGMAKEAADA  801

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRL  439
             ASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL
Sbjct  802   ASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRL  835



>ref|XP_009625096.1| PREDICTED: protein VACUOLELESS1 [Nicotiana tomentosiformis]
Length=843

 Score =   491 bits (1265),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 250/280 (89%), Positives = 266/280 (95%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRPALE FGTIQ+RPL RDLF++YAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  564   LVYLVLFHIWQKRPALEFFGTIQARPLARDLFVNYARHYKHEFLKDFFLSTGQLQDVAFL  623

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWK+SWEL+KNPMASKGSPLHGPRIKL+EK+  LFAETKE+VFESKAAEEHAKLLR+QHE
Sbjct  624   LWKDSWELSKNPMASKGSPLHGPRIKLIEKSQHLFAETKEYVFESKAAEEHAKLLRMQHE  683

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEVTTKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDWD
Sbjct  684   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAAAKVKTEFKVSEKRWYWLKVFALATIRDWD  743

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKEAADA
Sbjct  744   ALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLTDPRERAEAYARIGMAKEAADA  803

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKD ELLGRLK TF+QNAAA+SIFDTLRDRL+F   S
Sbjct  804   ASQAKDNELLGRLKQTFAQNAAASSIFDTLRDRLSFPSVS  843



>ref|XP_010053830.1| PREDICTED: protein VACUOLELESS1 [Eucalyptus grandis]
Length=843

 Score =   490 bits (1261),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 250/274 (91%), Positives = 262/274 (96%), Gaps = 0/274 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FG IQ++PL RDLFI+Y+R YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  567   LVYLVLFHIWQKRQPLEFFGMIQAKPLARDLFITYSRCYKHEFLKDFFLSTGQLQEVAFL  626

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL+EKAHGLFAETKEH FESKAAEEHAKLLRIQHE
Sbjct  627   LWKESWELGKNPMASKGSPLHGPRIKLIEKAHGLFAETKEHNFESKAAEEHAKLLRIQHE  686

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEVTTKQ IFVDSSISDTIRTCIVLGNHRAA KV+TEFKVSEKRWYWLKVFALATIRDWD
Sbjct  687   LEVTTKQPIFVDSSISDTIRTCIVLGNHRAAMKVRTEFKVSEKRWYWLKVFALATIRDWD  746

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKLADPRERAEAYA IGMAKEAADA
Sbjct  747   ALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLADPRERAEAYARIGMAKEAADA  806

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRL  439
             ASQAKDGELLGRLKLTFSQNAAA+SIFDTLRDRL
Sbjct  807   ASQAKDGELLGRLKLTFSQNAAASSIFDTLRDRL  840



>ref|XP_011026233.1| PREDICTED: protein VACUOLELESS1-like isoform X2 [Populus euphratica]
Length=575

 Score =   481 bits (1238),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 244/280 (87%), Positives = 261/280 (93%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQK  ALE FGTIQ+R L RDLFI+YAR YKHEFLKDFFLSTGQLQ+VA L
Sbjct  296   LVYLVLFHIWQKSSALEFFGTIQARALARDLFIAYARYYKHEFLKDFFLSTGQLQEVALL  355

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWE+ KN MASKGSPLHGPR+KL+EKAH LFAETKEH FESKAAEEHAKLLRIQHE
Sbjct  356   LWKESWEIGKNSMASKGSPLHGPRLKLIEKAHDLFAETKEHNFESKAAEEHAKLLRIQHE  415

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQ IFVDSSISDTIRTCI LGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDWD
Sbjct  416   LEVSTKQPIFVDSSISDTIRTCIALGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWD  475

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP G++PFVEAC++A++KGEALKYIPKLADPRERAEAYA IGMAKEAADA
Sbjct  476   ALEKFSKEKRPPNGFRPFVEACIDADEKGEALKYIPKLADPRERAEAYARIGMAKEAADA  535

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG S
Sbjct  536   ASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGVS  575



>ref|XP_007048985.1| Vacuoleless1 (VCL1) isoform 1 [Theobroma cacao]
 gb|EOX93142.1| Vacuoleless1 (VCL1) isoform 1 [Theobroma cacao]
Length=874

 Score =   490 bits (1262),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 253/294 (86%), Positives = 268/294 (91%), Gaps = 14/294 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRP LE FG IQ+RPLPRDLFISYAR YKHEFLKDFFLSTGQLQ+VA+L
Sbjct  581   LVYLVLFHIWQKRPPLEFFGMIQARPLPRDLFISYARCYKHEFLKDFFLSTGQLQEVAYL  640

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR----  913
             LWKESWEL KNPMA+KGSPLHGPRIKL+EKA  LF+ETKEH FESKAAEEHAKLLR    
Sbjct  641   LWKESWELGKNPMATKGSPLHGPRIKLIEKAQHLFSETKEHTFESKAAEEHAKLLRYKYL  700

Query  912   ----------IQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWY  763
                       IQHELEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWY
Sbjct  701   KITRSVAVPRIQHELEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWY  760

Query  762   WLKVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAE  583
             WLKVFALATIRDWDALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKLADPRERAE
Sbjct  761   WLKVFALATIRDWDALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLADPRERAE  820

Query  582   AYAGIGMakeaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             AYA IGMAKEAADAASQAKDGELLGRLKLTF+QNAAA+S+FDTLRDRL+FQG S
Sbjct  821   AYARIGMAKEAADAASQAKDGELLGRLKLTFAQNAAASSLFDTLRDRLSFQGVS  874



>ref|XP_011044765.1| PREDICTED: protein VACUOLELESS1-like [Populus euphratica]
Length=844

 Score =   488 bits (1257),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 244/280 (87%), Positives = 263/280 (94%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRPALE FGTIQ+RPL RDLFI+YAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  565   LVYLVLFHIWQKRPALEFFGTIQARPLARDLFIAYARCYKHEFLKDFFLSTGQLQDVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWK+SWEL KNPM SKGSPLHGPRIKL+EKAH LF+ETKEH FESKAAEEHAKLLRIQHE
Sbjct  625   LWKDSWELGKNPMGSKGSPLHGPRIKLIEKAHNLFSETKEHTFESKAAEEHAKLLRIQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQ IFVDSSISDTIRTCI LGNHRAA +VKTEFKVSEKRWYWLKVFAL TIRDW+
Sbjct  685   LEVSTKQPIFVDSSISDTIRTCIALGNHRAAMRVKTEFKVSEKRWYWLKVFALVTIRDWE  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP+G++PFVEAC++ ++K EALKYIPKLADPRERAEAYA IGMAKEAADA
Sbjct  745   ALEKFSKEKRPPMGFRPFVEACIDVDEKAEALKYIPKLADPRERAEAYARIGMAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG S
Sbjct  805   ASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGVS  844



>gb|KDO51887.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=839

 Score =   488 bits (1257),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 247/280 (88%), Positives = 261/280 (93%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRPALE FG IQ+RPL  DLF  YAR YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  560   LVYLVIFHIWQKRPALEFFGMIQTRPLACDLFTVYARCYKHEFLKDFFLSTGQLQEVAFL  619

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMAS GS LHGPRIK +EKAH LF+ETKEH FESKAAEEHAKLLRIQHE
Sbjct  620   LWKESWELGKNPMASNGSALHGPRIKRIEKAHSLFSETKEHTFESKAAEEHAKLLRIQHE  679

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALAT RDWD
Sbjct  680   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWD  739

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALE+FSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKEAADA
Sbjct  740   ALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKEAADA  799

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  800   ASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGVS  839



>ref|XP_004499978.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Cicer arietinum]
Length=850

 Score =   488 bits (1257),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 247/280 (88%), Positives = 264/280 (94%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FGTIQ+RPL RDLFI+YAR YKHEFLKDFFL+TGQLQDVAFL
Sbjct  571   LVYLVLFHIWQKRQPLEFFGTIQARPLARDLFITYARCYKHEFLKDFFLTTGQLQDVAFL  630

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL+EKA  LFAETKEH FESKAAEEHAKLLR+QHE
Sbjct  631   LWKESWELEKNPMASKGSPLHGPRIKLIEKAQNLFAETKEHTFESKAAEEHAKLLRLQHE  690

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
              EVTTKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATI+DW 
Sbjct  691   FEVTTKQAIFVDSSISDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALATIKDWA  750

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEK+PPIGY+PFVEAC+EA++KGEA+KYIPKLADPRE+AE+YA IGMAKEAADA
Sbjct  751   ALEKFSKEKKPPIGYRPFVEACIEADEKGEAIKYIPKLADPREKAESYARIGMAKEAADA  810

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKLTF+QNA A+SIFDTLRDRL+FQG S
Sbjct  811   ASQAKDGELLGRLKLTFAQNAGASSIFDTLRDRLSFQGAS  850



>gb|KEH16900.1| vacuolar protein sorting-associated-like protein [Medicago truncatula]
Length=850

 Score =   488 bits (1255),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 247/280 (88%), Positives = 265/280 (95%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FGTIQ+R L RDLFI+YAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  571   LVYLVLFHIWQKRQPLEFFGTIQARQLARDLFITYARCYKHEFLKDFFLSTGQLQDVAFL  630

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL+EKA  LFAETKEH FESKAAEEHAKLLR+QHE
Sbjct  631   LWKESWELEKNPMASKGSPLHGPRIKLIEKAQNLFAETKEHTFESKAAEEHAKLLRLQHE  690

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEVTTKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATI+DW 
Sbjct  691   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALATIKDWA  750

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEK+PPIGY+PFVEAC+EA++KGEA+KYIPKLADPRE+AE+YA IGMAKEAADA
Sbjct  751   ALEKFSKEKKPPIGYRPFVEACIEADEKGEAIKYIPKLADPREKAESYARIGMAKEAADA  810

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             A+Q+KDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  811   AAQSKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGAS  850



>gb|AES70033.2| vacuolar protein sorting-associated-like protein [Medicago truncatula]
Length=850

 Score =   487 bits (1254),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 247/280 (88%), Positives = 265/280 (95%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FGTIQ+R L RDLFI+YAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  571   LVYLVLFHIWQKRQPLEFFGTIQARQLARDLFITYARCYKHEFLKDFFLSTGQLQDVAFL  630

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL+EKA  LFAETKEH FESKAAEEHAKLLR+QHE
Sbjct  631   LWKESWELEKNPMASKGSPLHGPRIKLIEKAQNLFAETKEHTFESKAAEEHAKLLRLQHE  690

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEVTTKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATI+DW 
Sbjct  691   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALATIKDWA  750

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEK+PPIGY+PFVEAC+EA++KGEA+KYIPKLADPRE+AE+YA IGMAKEAADA
Sbjct  751   ALEKFSKEKKPPIGYRPFVEACIEADEKGEAIKYIPKLADPREKAESYARIGMAKEAADA  810

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             A+Q+KDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  811   AAQSKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGAS  850



>ref|XP_002306748.1| MANGLED family protein [Populus trichocarpa]
 gb|EEE93744.1| MANGLED family protein [Populus trichocarpa]
Length=844

 Score =   487 bits (1254),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 244/280 (87%), Positives = 262/280 (94%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRPALE FGTIQSRPL RDLFI+YAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  565   LVYLVLFHIWQKRPALEFFGTIQSRPLARDLFIAYARCYKHEFLKDFFLSTGQLQDVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWK+SWEL KNPM SKGSPLHGPRIKL+EKAH LF+ETKEH FESKAAEEHAKLLRIQHE
Sbjct  625   LWKDSWELGKNPMGSKGSPLHGPRIKLIEKAHNLFSETKEHTFESKAAEEHAKLLRIQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQ IFVDSSISDTIRTCI LGNHRAA +VKTEFKVSEKRWYWLKV AL TIRDW+
Sbjct  685   LEVSTKQPIFVDSSISDTIRTCIALGNHRAAMRVKTEFKVSEKRWYWLKVLALVTIRDWE  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP+G++PFVEAC++ ++K EALKYIPKLADPRERAEAYA IGMAKEAADA
Sbjct  745   ALEKFSKEKRPPMGFRPFVEACIDVDEKAEALKYIPKLADPRERAEAYARIGMAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG S
Sbjct  805   ASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGVS  844



>ref|XP_004243213.1| PREDICTED: protein VACUOLELESS1 [Solanum lycopersicum]
Length=843

 Score =   486 bits (1250),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 244/280 (87%), Positives = 261/280 (93%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRPAL+ FGTIQ+RPL RDLF++YAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  564   LVYLVLFHIWQKRPALDFFGTIQARPLARDLFVNYARHYKHEFLKDFFLSTGQLQDVAFL  623

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL+KNPMASKGSPLHGPR+KL+EK   LF ETKE+ FESKAAEEHAKLLRIQHE
Sbjct  624   LWKESWELSKNPMASKGSPLHGPRVKLIEKVQHLFVETKENFFESKAAEEHAKLLRIQHE  683

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             +EV TKQAIF+DSSISDTIRTCIVLGNHR AN+VKTEFKVSEKRWYWLKVFALATIRDWD
Sbjct  684   IEVNTKQAIFMDSSISDTIRTCIVLGNHRGANRVKTEFKVSEKRWYWLKVFALATIRDWD  743

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEACV+A +KGEALKYIPKL DPRERAEAYA IGMAKEAADA
Sbjct  744   ALEKFSKEKRPPIGYRPFVEACVDANEKGEALKYIPKLTDPRERAEAYARIGMAKEAADA  803

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             A+QAKD ELLGRLK TFSQNAAA+SIFDTLRDRL+F   S
Sbjct  804   ATQAKDNELLGRLKQTFSQNAAASSIFDTLRDRLSFPSVS  843



>ref|XP_006348963.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Solanum tuberosum]
Length=844

 Score =   486 bits (1250),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 249/281 (89%), Positives = 263/281 (94%), Gaps = 1/281 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRPALE FGTIQ+RPL RDLF++YAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  564   LVYLVLFHIWQKRPALEFFGTIQARPLARDLFVNYARHYKHEFLKDFFLSTGQLQDVAFL  623

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL+KNPMASKGSPLHGPRIKL+EKA  LF ETKE+ FESKAAEEHAKLLR+QHE
Sbjct  624   LWKESWELSKNPMASKGSPLHGPRIKLIEKAQHLFVETKEYAFESKAAEEHAKLLRMQHE  683

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKV-SEKRWYWLKVFALATIRDW  724
              EVTTKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKV SEKRWYWLKVFALATIRDW
Sbjct  684   FEVTTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVLSEKRWYWLKVFALATIRDW  743

Query  723   DALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaad  544
             DALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKEAAD
Sbjct  744   DALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLTDPRERAEAYARIGMAKEAAD  803

Query  543   aasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             AA+QAKD ELLGRLK TFSQNAAA+SIFDTLRDRL+F   S
Sbjct  804   AATQAKDNELLGRLKQTFSQNAAASSIFDTLRDRLSFPSVS  844



>ref|XP_007146219.1| hypothetical protein PHAVU_006G022400g [Phaseolus vulgaris]
 gb|ESW18213.1| hypothetical protein PHAVU_006G022400g [Phaseolus vulgaris]
Length=843

 Score =   486 bits (1250),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 245/278 (88%), Positives = 265/278 (95%), Gaps = 0/278 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FGTIQ+RPL RDLF++YAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  565   LVYLVLFHIWQKRQPLEFFGTIQARPLARDLFVTYARFYKHEFLKDFFLSTGQLQDVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL+EKA  LFAETKEH+FESKAAEEHAKLLRIQHE
Sbjct  625   LWKESWELGKNPMASKGSPLHGPRIKLIEKAQSLFAETKEHIFESKAAEEHAKLLRIQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEVTTKQAIFVDSSI+DTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATI+DW 
Sbjct  685   LEVTTKQAIFVDSSINDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALATIKDWV  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEK+PP+G++PFVEAC+EA++K EA+KYIPKLADPRERAE+YA IG+AKEAADA
Sbjct  745   ALEKFSKEKKPPMGFRPFVEACIEADEKAEAIKYIPKLADPRERAESYARIGLAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  427
             ASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG
Sbjct  805   ASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQG  842



>ref|XP_006437140.1| hypothetical protein CICLE_v10030701mg [Citrus clementina]
 ref|XP_006484899.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Citrus sinensis]
 gb|ESR50380.1| hypothetical protein CICLE_v10030701mg [Citrus clementina]
Length=839

 Score =   485 bits (1248),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 246/280 (88%), Positives = 260/280 (93%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRPALE FG IQ+R L  DLF  YAR YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  560   LVYLVIFHIWQKRPALEFFGMIQTRSLACDLFTVYARCYKHEFLKDFFLSTGQLQEVAFL  619

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMAS GS LHGPRIK +EKAH LF+ETKEH FESKAAEEHAKLLRIQHE
Sbjct  620   LWKESWELGKNPMASNGSALHGPRIKRIEKAHSLFSETKEHTFESKAAEEHAKLLRIQHE  679

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALAT RDWD
Sbjct  680   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWD  739

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALE+FSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAEAYA IGMAKEAADA
Sbjct  740   ALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKEAADA  799

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  800   ASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGVS  839



>ref|XP_010271337.1| PREDICTED: protein VACUOLELESS1 isoform X1 [Nelumbo nucifera]
Length=841

 Score =   483 bits (1243),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 241/280 (86%), Positives = 261/280 (93%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             L+YLVL HIWQKRP LE FG +Q+RPL RDLFISYAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  562   LIYLVLFHIWQKRPPLEFFGMVQARPLGRDLFISYARCYKHEFLKDFFLSTGQLQDVAFL  621

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIK++EKA  LF+ETKEH FE+KAAEEHAKLLR+QHE
Sbjct  622   LWKESWELVKNPMASKGSPLHGPRIKIIEKAQNLFSETKEHAFEAKAAEEHAKLLRMQHE  681

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEVTTKQAIFVDSS++DTIRTCIVLGNHRAA KV+TEFKVSEKRWYWLKVFAL T RDWD
Sbjct  682   LEVTTKQAIFVDSSVNDTIRTCIVLGNHRAAMKVRTEFKVSEKRWYWLKVFALVTTRDWD  741

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP GYKPFVEACV+A +K EA+KYIPKLADPRE+AEAYA +GMAKEAADA
Sbjct  742   ALEKFSKEKRPPTGYKPFVEACVDAGEKDEAIKYIPKLADPREKAEAYARLGMAKEAADA  801

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQ+KD ELLG+LKLTF+QNAAA+SIFDTLRDRLTFQG S
Sbjct  802   ASQSKDNELLGKLKLTFAQNAAASSIFDTLRDRLTFQGGS  841



>gb|KHG27227.1| Vacuolar sorting-associated protein 16 [Gossypium arboreum]
Length=789

 Score =   481 bits (1237),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 252/307 (82%), Positives = 267/307 (87%), Gaps = 27/307 (9%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARL----------------------  1147
             LVYLVL HIWQKRP LE FG IQ+RPLPRDLFISYAR                       
Sbjct  483   LVYLVLFHIWQKRPPLEFFGMIQARPLPRDLFISYARCLLWFWWPSSYYGHLFDNGGQNE  542

Query  1146  -----YKHEFLKDFFLSTGQLQDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHG  982
                  YKHEFLKDFFLSTGQLQ+VAFLLWKESWEL KNPMASKGSPLHGPRIKL++KA  
Sbjct  543   AFIKCYKHEFLKDFFLSTGQLQEVAFLLWKESWELGKNPMASKGSPLHGPRIKLIDKAQH  602

Query  981   LFAETKEHVFESKAAEEHAKLLRIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANK  802
             LFAETKEH FESKAAEEHAKLLRIQHELEV+TKQAIFVDSSISDTIRTCIVLGNHRAA K
Sbjct  603   LFAETKEHTFESKAAEEHAKLLRIQHELEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMK  662

Query  801   VKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALK  622
             VKTEFKVSEKRWYWLKVFALATIRDW+ALEKFSKEKRPPIGY+PFVEAC++A++KGEALK
Sbjct  663   VKTEFKVSEKRWYWLKVFALATIRDWEALEKFSKEKRPPIGYRPFVEACIDADEKGEALK  722

Query  621   YIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDR  442
             YIPKLAD RERAEAYA IGMAKEAADAASQAKDGELLGRLKLTF+QNAAA+S+FDTLRDR
Sbjct  723   YIPKLADLRERAEAYARIGMAKEAADAASQAKDGELLGRLKLTFAQNAAASSLFDTLRDR  782

Query  441   LTFQGTS  421
             L+FQG S
Sbjct  783   LSFQGVS  789



>ref|XP_007048987.1| Vacuoleless1 (VCL1) isoform 3 [Theobroma cacao]
 gb|EOX93144.1| Vacuoleless1 (VCL1) isoform 3 [Theobroma cacao]
Length=809

 Score =   481 bits (1238),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 244/270 (90%), Positives = 259/270 (96%), Gaps = 0/270 (0%)
 Frame = -3

Query  1230  QKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFLLWKESWELAK  1051
             QKRP LE FG IQ+RPLPRDLFISYAR YKHEFLKDFFLSTGQLQ+VA+LLWKESWEL K
Sbjct  540   QKRPPLEFFGMIQARPLPRDLFISYARCYKHEFLKDFFLSTGQLQEVAYLLWKESWELGK  599

Query  1050  NPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHELEVTTKQAIF  871
             NPMA+KGSPLHGPRIKL+EKA  LF+ETKEH FESKAAEEHAKLLRIQHELEV+TKQAIF
Sbjct  600   NPMATKGSPLHGPRIKLIEKAQHLFSETKEHTFESKAAEEHAKLLRIQHELEVSTKQAIF  659

Query  870   VDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKR  691
             VDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKR
Sbjct  660   VDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKR  719

Query  690   PPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELL  511
             PPIGY+PFVEACV+A++KGEALKYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELL
Sbjct  720   PPIGYRPFVEACVDADEKGEALKYIPKLADPRERAEAYARIGMAKEAADAASQAKDGELL  779

Query  510   GRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             GRLKLTF+QNAAA+S+FDTLRDRL+FQG S
Sbjct  780   GRLKLTFAQNAAASSLFDTLRDRLSFQGVS  809



>ref|XP_008229565.1| PREDICTED: protein VACUOLELESS1 [Prunus mume]
Length=841

 Score =   482 bits (1240),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 245/280 (88%), Positives = 261/280 (93%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FG IQ+R L RDLFI YAR YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  562   LVYLVLFHIWQKRQPLEFFGMIQARALARDLFIIYARCYKHEFLKDFFLSTGQLQEVAFL  621

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMAS+GSPLHGPRIK++EKA  LF ETKE+ FE+KAAEEHAKLLR+QH+
Sbjct  622   LWKESWELGKNPMASRGSPLHGPRIKIIEKAQNLFLETKEYTFEAKAAEEHAKLLRMQHD  681

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDWD
Sbjct  682   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWD  741

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
              LEKFSKEKRPPIGY+PFVEACVEA++KGEALKYIPKL DPRERAE+YA IGMAKEAADA
Sbjct  742   VLEKFSKEKRPPIGYRPFVEACVEADEKGEALKYIPKLTDPRERAESYARIGMAKEAADA  801

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKLTFSQNAAA+SIFDTLRDRL+FQG S
Sbjct  802   ASQAKDGELLGRLKLTFSQNAAASSIFDTLRDRLSFQGVS  841



>ref|XP_007214933.1| hypothetical protein PRUPE_ppa001364mg [Prunus persica]
 gb|EMJ16132.1| hypothetical protein PRUPE_ppa001364mg [Prunus persica]
Length=844

 Score =   481 bits (1238),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 244/280 (87%), Positives = 262/280 (94%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIW+KR  LE FG IQ+R L RDLFI YAR YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  565   LVYLVLFHIWRKRQPLEFFGMIQARALARDLFIIYARCYKHEFLKDFFLSTGQLQEVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMAS+GSPLHGPRIK++EKA  LF ETKE+ FE+KAAEEHAKLLR+QH+
Sbjct  625   LWKESWELGKNPMASRGSPLHGPRIKIIEKAQNLFLETKEYTFEAKAAEEHAKLLRMQHD  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDWD
Sbjct  685   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWD  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEAC+EA++KGEALKYIPKL DPRERAE+YA IGMAKEAADA
Sbjct  745   ALEKFSKEKRPPIGYRPFVEACIEADEKGEALKYIPKLTDPRERAESYARIGMAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKLTFSQNAAA+SIFDTLRDRL+FQG S
Sbjct  805   ASQAKDGELLGRLKLTFSQNAAASSIFDTLRDRLSFQGVS  844



>ref|XP_012088184.1| PREDICTED: protein VACUOLELESS1 isoform X2 [Jatropha curcas]
Length=844

 Score =   480 bits (1236),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 242/280 (86%), Positives = 260/280 (93%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIW K+PALE FGTIQ+RP+ RDLFI YAR YKHEFLKD+FLSTGQLQDVAF+
Sbjct  565   LVYLVLFHIWLKKPALEFFGTIQARPIARDLFIIYARSYKHEFLKDYFLSTGQLQDVAFI  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL+EKA  LF ETKEH FE+KAAEEHAKLLRIQHE
Sbjct  625   LWKESWELGKNPMASKGSPLHGPRIKLIEKAQNLFLETKEHTFEAKAAEEHAKLLRIQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQ IFVDSSISDTIRTCI +GNHRAA KVKTEFKVSEKRWYWLKVF LAT RDWD
Sbjct  685   LEVSTKQPIFVDSSISDTIRTCIAMGNHRAAMKVKTEFKVSEKRWYWLKVFGLATKRDWD  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEAC++A++K EALKYIPKLADPRERAEAYA IGMAKEAADA
Sbjct  745   ALEKFSKEKRPPIGYRPFVEACIDADEKSEALKYIPKLADPRERAEAYARIGMAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG S
Sbjct  805   ASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGVS  844



>ref|XP_003599782.1| Vacuolar protein sorting-associated protein-like protein [Medicago 
truncatula]
Length=856

 Score =   481 bits (1237),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 247/286 (86%), Positives = 265/286 (93%), Gaps = 6/286 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQK------RPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQL  1099
             LVYLVL HIWQK      R  LE FGTIQ+R L RDLFI+YAR YKHEFLKDFFLSTGQL
Sbjct  571   LVYLVLFHIWQKVLDSGKRQPLEFFGTIQARQLARDLFITYARCYKHEFLKDFFLSTGQL  630

Query  1098  QDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKL  919
             QDVAFLLWKESWEL KNPMASKGSPLHGPRIKL+EKA  LFAETKEH FESKAAEEHAKL
Sbjct  631   QDVAFLLWKESWELEKNPMASKGSPLHGPRIKLIEKAQNLFAETKEHTFESKAAEEHAKL  690

Query  918   LRIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALA  739
             LR+QHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALA
Sbjct  691   LRLQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALA  750

Query  738   TIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMa  559
             TI+DW ALEKFSKEK+PPIGY+PFVEAC+EA++KGEA+KYIPKLADPRE+AE+YA IGMA
Sbjct  751   TIKDWAALEKFSKEKKPPIGYRPFVEACIEADEKGEAIKYIPKLADPREKAESYARIGMA  810

Query  558   keaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             KEAADAA+Q+KDGELLGRLKLTF+QNAAA+SIFDTLRDRL+FQG S
Sbjct  811   KEAADAAAQSKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGAS  856



>ref|XP_012088183.1| PREDICTED: protein VACUOLELESS1 isoform X1 [Jatropha curcas]
 gb|KDP24238.1| hypothetical protein JCGZ_26643 [Jatropha curcas]
Length=847

 Score =   480 bits (1236),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 242/280 (86%), Positives = 260/280 (93%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIW K+PALE FGTIQ+RP+ RDLFI YAR YKHEFLKD+FLSTGQLQDVAF+
Sbjct  568   LVYLVLFHIWLKKPALEFFGTIQARPIARDLFIIYARSYKHEFLKDYFLSTGQLQDVAFI  627

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL+EKA  LF ETKEH FE+KAAEEHAKLLRIQHE
Sbjct  628   LWKESWELGKNPMASKGSPLHGPRIKLIEKAQNLFLETKEHTFEAKAAEEHAKLLRIQHE  687

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQ IFVDSSISDTIRTCI +GNHRAA KVKTEFKVSEKRWYWLKVF LAT RDWD
Sbjct  688   LEVSTKQPIFVDSSISDTIRTCIAMGNHRAAMKVKTEFKVSEKRWYWLKVFGLATKRDWD  747

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEAC++A++K EALKYIPKLADPRERAEAYA IGMAKEAADA
Sbjct  748   ALEKFSKEKRPPIGYRPFVEACIDADEKSEALKYIPKLADPRERAEAYARIGMAKEAADA  807

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG S
Sbjct  808   ASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGVS  847



>ref|XP_011026232.1| PREDICTED: protein VACUOLELESS1-like isoform X1 [Populus euphratica]
Length=844

 Score =   479 bits (1233),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 244/280 (87%), Positives = 261/280 (93%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQK  ALE FGTIQ+R L RDLFI+YAR YKHEFLKDFFLSTGQLQ+VA L
Sbjct  565   LVYLVLFHIWQKSSALEFFGTIQARALARDLFIAYARYYKHEFLKDFFLSTGQLQEVALL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWE+ KN MASKGSPLHGPR+KL+EKAH LFAETKEH FESKAAEEHAKLLRIQHE
Sbjct  625   LWKESWEIGKNSMASKGSPLHGPRLKLIEKAHDLFAETKEHNFESKAAEEHAKLLRIQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQ IFVDSSISDTIRTCI LGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDWD
Sbjct  685   LEVSTKQPIFVDSSISDTIRTCIALGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWD  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP G++PFVEAC++A++KGEALKYIPKLADPRERAEAYA IGMAKEAADA
Sbjct  745   ALEKFSKEKRPPNGFRPFVEACIDADEKGEALKYIPKLADPRERAEAYARIGMAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG S
Sbjct  805   ASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGVS  844



>ref|XP_002302135.2| MANGLED family protein [Populus trichocarpa]
 gb|EEE81408.2| MANGLED family protein [Populus trichocarpa]
Length=844

 Score =   476 bits (1226),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 243/280 (87%), Positives = 260/280 (93%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQK  ALE FGTIQ+R L RDLFI+YAR YKHEFLKDFFLSTGQLQ+VA L
Sbjct  565   LVYLVLFHIWQKSSALEFFGTIQARALARDLFIAYARYYKHEFLKDFFLSTGQLQEVALL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWE+ KN MASKGSPLHGPRIKL+EKAH LF+ETKEH FESKAAEEHAKLLRIQHE
Sbjct  625   LWKESWEIGKNSMASKGSPLHGPRIKLIEKAHDLFSETKEHNFESKAAEEHAKLLRIQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQ IF+DSSISDTIRTCI LGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDWD
Sbjct  685   LEVSTKQPIFLDSSISDTIRTCIALGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWD  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP G++PFVEAC++A +KGEALKYIPKLADPRERAEAYA IGMAKEAADA
Sbjct  745   ALEKFSKEKRPPNGFRPFVEACIDAAEKGEALKYIPKLADPRERAEAYARIGMAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKL+F+QN AA+SIFDTLRDRL+FQG S
Sbjct  805   ASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLSFQGVS  844



>ref|XP_009377216.1| PREDICTED: LOW QUALITY PROTEIN: protein VACUOLELESS1 [Pyrus x 
bretschneideri]
Length=831

 Score =   475 bits (1223),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 241/275 (88%), Positives = 257/275 (93%), Gaps = 0/275 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FG IQ+R L RDLFI YAR YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  556   LVYLVLFHIWQKRQPLEFFGMIQARALARDLFIIYARCYKHEFLKDFFLSTGQLQEVAFL  615

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWE+ KNPMAS+GSPLHGPRIKL+EKAH LF ETKE+ FESKAAEEHAKL+R+QHE
Sbjct  616   LWKESWEIGKNPMASRGSPLHGPRIKLIEKAHNLFVETKEYTFESKAAEEHAKLIRMQHE  675

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDWD
Sbjct  676   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWD  735

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAE+YA IGMAKEAADA
Sbjct  736   ALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLTDPRERAESYARIGMAKEAADA  795

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLT  436
             ASQAKDGELLGRLK+TFSQNAAA+SIFDTLRDR  
Sbjct  796   ASQAKDGELLGRLKMTFSQNAAASSIFDTLRDRFV  830



>ref|XP_008342344.1| PREDICTED: protein VACUOLELESS1 [Malus domestica]
Length=840

 Score =   475 bits (1222),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 241/275 (88%), Positives = 257/275 (93%), Gaps = 0/275 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FG IQ+R L RDLFI YAR YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  565   LVYLVLFHIWQKRQPLEFFGMIQARALARDLFIIYARCYKHEFLKDFFLSTGQLQEVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWE+ KNPMAS+GSPLHGPRIKL+EKAH LF ETKE+ FESKAAEEHAKL+R+QHE
Sbjct  625   LWKESWEIGKNPMASRGSPLHGPRIKLIEKAHNLFVETKEYTFESKAAEEHAKLIRMQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDWD
Sbjct  685   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWD  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKL DPRERAE+YA IGMAKEAADA
Sbjct  745   ALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLTDPRERAESYARIGMAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLT  436
             ASQAKDGELLGRLK+TFSQNAAA+SIFDTLRDR  
Sbjct  805   ASQAKDGELLGRLKMTFSQNAAASSIFDTLRDRFV  839



>ref|XP_004144632.1| PREDICTED: protein VACUOLELESS1 [Cucumis sativus]
 gb|KGN54934.1| hypothetical protein Csa_4G608100 [Cucumis sativus]
Length=844

 Score =   472 bits (1215),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 242/280 (86%), Positives = 258/280 (92%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FG IQ+R   RDLFI+YAR YKHEFLKDFFLSTGQL +VAFL
Sbjct  565   LVYLVLFHIWQKRQPLEFFGMIQARTQARDLFITYARCYKHEFLKDFFLSTGQLNEVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLH PR KL+EKAH LFAETKEH+FESKAAEEHAKLL+IQH+
Sbjct  625   LWKESWELGKNPMASKGSPLHSPRTKLIEKAHSLFAETKEHIFESKAAEEHAKLLKIQHD  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSI+DTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALAT RDW 
Sbjct  685   LEVSTKQAIFVDSSINDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALATTRDWV  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALE FSKEKRPPIGYKPFVEACVEA++K EA+KYIPKLADPRERAEAYA IGMAKEAADA
Sbjct  745   ALETFSKEKRPPIGYKPFVEACVEADEKAEAVKYIPKLADPRERAEAYARIGMAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKLTF+QN+AA+SIFDTLRDRL+F G S
Sbjct  805   ASQAKDGELLGRLKLTFAQNSAASSIFDTLRDRLSFPGVS  844



>ref|XP_008465445.1| PREDICTED: protein VACUOLELESS1 [Cucumis melo]
 ref|XP_008465446.1| PREDICTED: protein VACUOLELESS1 [Cucumis melo]
Length=844

 Score =   470 bits (1209),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 242/280 (86%), Positives = 257/280 (92%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FG IQ+R   RDLFI+YAR YKHEFLKDFFLSTGQL +VAFL
Sbjct  565   LVYLVLFHIWQKRQPLEFFGMIQARTQARDLFITYARCYKHEFLKDFFLSTGQLNEVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLH PR KL++KAH LFAETKEH FESKAAEEHAKLL+IQHE
Sbjct  625   LWKESWELGKNPMASKGSPLHIPRTKLIDKAHSLFAETKEHTFESKAAEEHAKLLKIQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSI+DTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALAT RDW 
Sbjct  685   LEVSTKQAIFVDSSINDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALATTRDWV  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALE FSKEKRPPIGYKPFVEACVEA++K EA+KYIPKLADPRERAEAYA IGMAKEAADA
Sbjct  745   ALETFSKEKRPPIGYKPFVEACVEADEKAEAVKYIPKLADPRERAEAYARIGMAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLKLTF+QN+AA+SIFDTLRDRL+F G S
Sbjct  805   ASQAKDGELLGRLKLTFAQNSAASSIFDTLRDRLSFPGVS  844



>ref|XP_010557595.1| PREDICTED: protein VACUOLELESS1 [Tarenaya hassleriana]
Length=861

 Score =   471 bits (1211),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 240/280 (86%), Positives = 258/280 (92%), Gaps = 2/280 (1%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRP LE F  IQ R + RDLFI+YAR +KHEFLKDFFLSTG+L DVAFL
Sbjct  584   LVYLVVFHIWQKRPPLEFFSMIQGRHMARDLFITYARCHKHEFLKDFFLSTGKLHDVAFL  643

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPL GPRIKL+EKAH LFAETKEH FESKAAEEHAKLLRIQHE
Sbjct  644   LWKESWELGKNPMASKGSPLQGPRIKLIEKAHSLFAETKEHTFESKAAEEHAKLLRIQHE  703

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDW+
Sbjct  704   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAVKVKTEFKVSEKRWYWLKVFALATIRDWE  763

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEAC++A++K EALKYIPKL+DPRERAEAYA IGMAKEAADA
Sbjct  764   ALEKFSKEKRPPIGYRPFVEACIDADEKAEALKYIPKLSDPRERAEAYARIGMAKEAADA  823

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLK+TFSQNA+  SIFDTL  R++FQG S
Sbjct  824   ASQAKDGELLGRLKMTFSQNASTTSIFDTL--RMSFQGMS  861



>emb|CDP06151.1| unnamed protein product [Coffea canephora]
Length=840

 Score =   469 bits (1206),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 236/280 (84%), Positives = 257/280 (92%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQK P +E   TI +R L RDLFI YAR YKHEFLK+FF+STG++QD AFL
Sbjct  561   LVYLVLFHIWQKGPTMEFHRTIHARSLARDLFICYARCYKHEFLKNFFISTGEIQDAAFL  620

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             +WKESWELAKNPMAS+GSPL GPRIK++E    LF+ET+EHVFESKAAEEHAKLLR+Q E
Sbjct  621   MWKESWELAKNPMASRGSPLQGPRIKVIENVQKLFSETREHVFESKAAEEHAKLLRMQQE  680

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEVTTKQ IFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDWD
Sbjct  681   LEVTTKQPIFVDSSISDTIRTCIVLGNHRAALKVKTEFKVSEKRWYWLKVFALATIRDWD  740

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPPIGY+PFVEAC++A++KGEALKYIPKL+DPRERAEAYA IGMAKEAADA
Sbjct  741   ALEKFSKEKRPPIGYRPFVEACIDADEKGEALKYIPKLSDPRERAEAYARIGMAKEAADA  800

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKD ELLGRLKLTFSQNAAA+SIFDTLRDRL+FQG S
Sbjct  801   ASQAKDNELLGRLKLTFSQNAAASSIFDTLRDRLSFQGVS  840



>ref|XP_010681470.1| PREDICTED: protein VACUOLELESS1 [Beta vulgaris subsp. vulgaris]
Length=844

 Score =   465 bits (1196),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 233/274 (85%), Positives = 255/274 (93%), Gaps = 0/274 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY VL HIW KRPALE FGTIQ++PLPRDLFI Y+R Y HEFLKDFFLS GQLQ+VAFL
Sbjct  568   LVYFVLFHIWHKRPALEFFGTIQAKPLPRDLFIVYSRCYNHEFLKDFFLSAGQLQEVAFL  627

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW+L+KNPMASKG+PLHGPRIKL+EKA  LFAETKEH+FESKAAEEHAKLLR+QHE
Sbjct  628   LWKESWDLSKNPMASKGTPLHGPRIKLIEKARDLFAETKEHIFESKAAEEHAKLLRMQHE  687

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVK EFKVSEKRWYWLKVFALATIRDW+
Sbjct  688   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKNEFKVSEKRWYWLKVFALATIRDWE  747

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEK+PPIGYKPFVEAC++A+++ EALKYIPKL DP ERAEAYA IGMAKEAADA
Sbjct  748   ALEKFSKEKKPPIGYKPFVEACIDADERNEALKYIPKLTDPGERAEAYARIGMAKEAADA  807

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRL  439
             ASQAKD ELLGRL+L+FSQN AA SIFDT+R+RL
Sbjct  808   ASQAKDSELLGRLRLSFSQNTAATSIFDTIRERL  841



>ref|XP_010087860.1| Vacuolar protein sorting-associated protein 16-like protein [Morus 
notabilis]
 gb|EXB30296.1| Vacuolar protein sorting-associated protein 16-like protein [Morus 
notabilis]
Length=842

 Score =   462 bits (1188),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 236/280 (84%), Positives = 256/280 (91%), Gaps = 2/280 (1%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FG IQ+R L RDLFI YAR YK EFLKD+FLSTGQLQ+VAFL
Sbjct  565   LVYLVLFHIWQKRQPLEFFGMIQARTLARDLFIVYARCYKQEFLKDYFLSTGQLQEVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW+L +NPMASKGSPL GPRIKL+EK   LF+ETKEH FESKAAEEH+KLLR+QHE
Sbjct  625   LWKESWDLGQNPMASKGSPLLGPRIKLIEKVQNLFSETKEHTFESKAAEEHSKLLRMQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFAL+TIRDWD
Sbjct  685   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALSTIRDWD  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFS+EKRPPIG++PFVEAC+EA++KGEALKYIPKL DPRERAE+YA IGMAKEAADA
Sbjct  745   ALEKFSREKRPPIGFRPFVEACIEADEKGEALKYIPKLTDPRERAESYARIGMAKEAADA  804

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELLGRLK TFSQNAAA+SIFDTLR   +FQG S
Sbjct  805   ASQAKDGELLGRLKSTFSQNAAASSIFDTLRS--SFQGVS  842



>ref|XP_008811095.1| PREDICTED: protein VACUOLELESS1 [Phoenix dactylifera]
Length=844

 Score =   461 bits (1186),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 235/280 (84%), Positives = 258/280 (92%), Gaps = 1/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQK+PAL+ FGTI +RPL RDLFI+YAR YKHEFLKDFFLSTG+LQDVAFL
Sbjct  564   LVYLVLFHIWQKKPALDFFGTINARPLARDLFIAYARFYKHEFLKDFFLSTGRLQDVAFL  623

Query  1080  LWKESWELAKNPMASKG-SPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQH  904
             L KESW L KNPMASKG SPLHGPRI+L+E+A  LF+ETKEH FESKAAEEHAKLLR+QH
Sbjct  624   LLKESWHLEKNPMASKGGSPLHGPRIRLIEQAQKLFSETKEHTFESKAAEEHAKLLRLQH  683

Query  903   ELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDW  724
             ELEV+TKQAIFV SSISDTIRTCIVLGNHRAA +V+ EFKVSEKRWYWLK FALAT+RDW
Sbjct  684   ELEVSTKQAIFVGSSISDTIRTCIVLGNHRAAMRVRAEFKVSEKRWYWLKAFALATVRDW  743

Query  723   DALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaad  544
             DALEKFSKEKRPP GYKPFVEAC++A++K EALKYIPKLA+PRER+EAYA IGMAKEAAD
Sbjct  744   DALEKFSKEKRPPGGYKPFVEACIDADEKAEALKYIPKLAEPRERSEAYARIGMAKEAAD  803

Query  543   aasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  424
             AASQAKDGEL GRLKLT +QNAAA+SIFDTLRDRL+FQG 
Sbjct  804   AASQAKDGELFGRLKLTLAQNAAASSIFDTLRDRLSFQGV  843



>ref|XP_009416537.1| PREDICTED: protein VACUOLELESS1 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   459 bits (1182),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 231/279 (83%), Positives = 257/279 (92%), Gaps = 0/279 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQK+PAL+ FGTI +RPL RDLFISY+R YKHEFLKDFFLSTG+LQDVAFL
Sbjct  563   LVYLVLFHIWQKKPALDFFGTINARPLARDLFISYSRYYKHEFLKDFFLSTGRLQDVAFL  622

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             L KESW+L KNPMASKGSPLHGPRI+L+E+   LF+ETKEH FESKAAEEHAKLLR+QH+
Sbjct  623   LLKESWKLEKNPMASKGSPLHGPRIRLIEQTQKLFSETKEHNFESKAAEEHAKLLRLQHD  682

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHR A +V+TEFKVSEKRWYWLK FALAT+RDWD
Sbjct  683   LEVSTKQAIFVDSSISDTIRTCIVLGNHREAMRVRTEFKVSEKRWYWLKAFALATVRDWD  742

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP GYKPFVEAC++A++K EA+KYIPKL +PRER+EAYA IGMAKEAADA
Sbjct  743   ALEKFSKEKRPPGGYKPFVEACIDADEKAEAIKYIPKLTEPRERSEAYARIGMAKEAADA  802

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  424
             ASQAKD EL GRLKLT +QNAAA+SIFDTLRDRL+FQG 
Sbjct  803   ASQAKDSELFGRLKLTLAQNAAASSIFDTLRDRLSFQGV  841



>ref|XP_010918871.1| PREDICTED: protein VACUOLELESS1 [Elaeis guineensis]
Length=846

 Score =   458 bits (1178),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 234/280 (84%), Positives = 257/280 (92%), Gaps = 1/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQK+PAL+ FGTI +RPL RDLFI+YAR YKHEFLKDFFLSTG+LQDVAFL
Sbjct  566   LVYLVLFHIWQKKPALDFFGTINARPLARDLFITYARFYKHEFLKDFFLSTGRLQDVAFL  625

Query  1080  LWKESWELAKNPMASKG-SPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQH  904
             L KESW+L KNPMASKG SPLHGPRI+L+E+A  LF+ETKEH FESKAAEEHAKLLR+QH
Sbjct  626   LLKESWDLEKNPMASKGGSPLHGPRIRLIEQAQKLFSETKEHTFESKAAEEHAKLLRLQH  685

Query  903   ELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDW  724
             ELEV+TKQAIFV SSISDTIRTCIVLGNHRAA +V+ EFKVSEKRWYWLK FALAT+RDW
Sbjct  686   ELEVSTKQAIFVGSSISDTIRTCIVLGNHRAAMRVRAEFKVSEKRWYWLKAFALATVRDW  745

Query  723   DALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaad  544
             DALEKFSKEKRPP GYKPFVEAC++A +K EALKYIPKLA+PRER+EAYA IGMAKEAAD
Sbjct  746   DALEKFSKEKRPPGGYKPFVEACIDANEKAEALKYIPKLAEPRERSEAYARIGMAKEAAD  805

Query  543   aasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  424
             AASQAKD EL GRLKLT +QNAAA+SIFDTLRDRL+FQG 
Sbjct  806   AASQAKDSELFGRLKLTLAQNAAASSIFDTLRDRLSFQGV  845



>ref|XP_006854657.1| PREDICTED: protein VACUOLELESS1 [Amborella trichopoda]
 gb|ERN16124.1| hypothetical protein AMTR_s00030p00200210 [Amborella trichopoda]
Length=855

 Score =   429 bits (1104),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 218/280 (78%), Positives = 242/280 (86%), Gaps = 0/280 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYL+L H W K+  LE FG IQ +PL RDLFISYAR YKHEFLKDF+LS G L D+AFL
Sbjct  576   LVYLILFHSWPKKSPLEFFGMIQMKPLARDLFISYARCYKHEFLKDFYLSAGMLHDLAFL  635

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LW+ESWE  KNP+ASKGSP+HGPRIKLVE+AH LF+ETKEH FESKAAEEHAKLLR+QHE
Sbjct  636   LWRESWEQGKNPLASKGSPIHGPRIKLVEQAHNLFSETKEHAFESKAAEEHAKLLRVQHE  695

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TK+ +FVDSS+SDTIRTCI LG  +AA KV+ EFKV EKRWYWLK+ ALA   DWD
Sbjct  696   LEVSTKRPLFVDSSVSDTIRTCITLGYEQAAAKVRAEFKVPEKRWYWLKLLALAAKGDWD  755

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
              LEKFSKEKRPPIGYKPFVEAC++A+ KGEALKYIPKL DPRE+AE YA IGMAKEAADA
Sbjct  756   GLEKFSKEKRPPIGYKPFVEACIDADAKGEALKYIPKLTDPREKAEFYARIGMAKEAADA  815

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             ASQAKDGELL RLK TFSQNAAA +IFDTLRDRL+ QG S
Sbjct  816   ASQAKDGELLIRLKQTFSQNAAATAIFDTLRDRLSLQGVS  855



>gb|KJB10617.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=795

 Score =   427 bits (1097),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 205/227 (90%), Positives = 215/227 (95%), Gaps = 0/227 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRP LE FG IQ+RPLPRDLFISYAR YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  565   LVYLVLFHIWQKRPPLEFFGMIQARPLPRDLFISYARCYKHEFLKDFFLSTGQLQEVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL++KA  LFAETKEH FESKAAEEHAKLLRIQHE
Sbjct  625   LWKESWELGKNPMASKGSPLHGPRIKLIDKAQHLFAETKEHTFESKAAEEHAKLLRIQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDW+
Sbjct  685   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWE  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEA  580
             ALEKFSKEKRPPIGY+PFVEACV+A++KGEALKYIPKLAD RERAE 
Sbjct  745   ALEKFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLADLRERAEV  791



>ref|XP_004303883.1| PREDICTED: protein VACUOLELESS1 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=857

 Score =   420 bits (1080),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 216/290 (74%), Positives = 240/290 (83%), Gaps = 16/290 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  L  F  I  +PL RDLF+ YAR Y HEFLKDFFLS GQLQ+VAFL
Sbjct  565   LVYLVLFHIWQKREPLAFFKMIHPKPLARDLFVIYARCYNHEFLKDFFLSAGQLQEVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLF----------------AETKEHVFE  949
             +WKESWEL KNPMAS+GSPLH PRIKL+++   LF                 + K+  FE
Sbjct  625   VWKESWELGKNPMASRGSPLHNPRIKLIDQTKSLFEGANKDKESNSLFGEANKDKDFTFE  684

Query  948   SKAAEEHAKLLRIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKR  769
             SKAAEEH+KLLR QH LEV+TKQAIFVDSSISDTIRTCIVLGNH+AA KVKT+FKVSEKR
Sbjct  685   SKAAEEHSKLLRAQHGLEVSTKQAIFVDSSISDTIRTCIVLGNHKAAMKVKTDFKVSEKR  744

Query  768   WYWLKVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRER  589
             WYWLK FALAT+RDWD LEKFSKEKRPPIG++PFVEAC+EA++KGEALKYIPKL DPRER
Sbjct  745   WYWLKAFALATVRDWDTLEKFSKEKRPPIGFRPFVEACIEADEKGEALKYIPKLTDPRER  804

Query  588   AEAYAGIGMakeaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRL  439
             AEAY  IGMAKEAADAASQA DGELLGRL+ TFSQN AA+SIFDT+RD+L
Sbjct  805   AEAYGRIGMAKEAADAASQANDGELLGRLRSTFSQNPAASSIFDTIRDKL  854



>ref|XP_002881559.1| hypothetical protein ARALYDRAFT_321506 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57818.1| hypothetical protein ARALYDRAFT_321506 [Arabidopsis lyrata subsp. 
lyrata]
Length=858

 Score =   416 bits (1069),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 215/281 (77%), Positives = 244/281 (87%), Gaps = 7/281 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRP LE F  IQ R L RDLF++YAR +KHEFLKDFFLSTGQ+ +VAFL
Sbjct  584   LVYLVIFHIWQKRPPLEFFAMIQGRVLARDLFVAYARCHKHEFLKDFFLSTGQIHEVAFL  643

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW++ KNPMASKGSPLHGPRIKL+EKA  LF++TKEH FESKAAEEHAKLL+IQHE
Sbjct  644   LWKESWDMGKNPMASKGSPLHGPRIKLIEKARNLFSQTKEHTFESKAAEEHAKLLKIQHE  703

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE +TKQAIFVDSSI+DTIRTCIVLGN+RAA KVKTEFKVS+KRWYWLK FALATI+DW 
Sbjct  704   LEASTKQAIFVDSSINDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYWLKAFALATIKDWA  763

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADA
Sbjct  764   ALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADA  823

Query  540   asqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             A+QA D GELL R + TF QNA    IFDTL  ++ FQG S
Sbjct  824   AAQANDGGELLERFRKTFVQNA----IFDTL--KMPFQGAS  858



>ref|NP_565879.1| vacuoleless1 [Arabidopsis thaliana]
 sp|Q93VQ0.1|VCL1_ARATH RecName: Full=Protein VACUOLELESS1; AltName: Full=Vacuolar protein 
sorting-associated protein 16 homolog [Arabidopsis thaliana]
 gb|AAK43713.1|AF359240_1 VCL1 [Arabidopsis thaliana]
 gb|AAK82510.1| At2g38020/T8P21.7 [Arabidopsis thaliana]
 gb|AAM98105.1| At2g38020/T8P21.7 [Arabidopsis thaliana]
 gb|AEC09479.1| vacuoleless1 [Arabidopsis thaliana]
Length=858

 Score =   416 bits (1068),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 214/281 (76%), Positives = 242/281 (86%), Gaps = 7/281 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRP LE F  IQ R L RDLF++YAR +KHEFLKDFFLSTGQ+ +VAFL
Sbjct  584   LVYLVIFHIWQKRPPLEFFAMIQGRVLARDLFVAYARCHKHEFLKDFFLSTGQIHEVAFL  643

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW++ KNPMASKGSPLHGPRIKL+EKA  LF++TKEH FESKAAEEHAKLL+IQHE
Sbjct  644   LWKESWDMGKNPMASKGSPLHGPRIKLIEKARNLFSQTKEHTFESKAAEEHAKLLKIQHE  703

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE +TKQAIFVDSSI+DTIRTCIVLGN+RAA KVKTEFKVS+KRWYWLK FALATI+DW 
Sbjct  704   LEASTKQAIFVDSSINDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYWLKAFALATIKDWA  763

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAAD 
Sbjct  764   ALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADC  823

Query  540   asqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             A+QA D GELL R + TF QNA    IFDTL   + FQG S
Sbjct  824   AAQANDGGELLERFRKTFVQNA----IFDTL--LMPFQGAS  858



>ref|XP_010505412.1| PREDICTED: protein VACUOLELESS1-like [Camelina sativa]
Length=858

 Score =   414 bits (1065),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 215/281 (77%), Positives = 247/281 (88%), Gaps = 7/281 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             L+YLV+ HIWQKRP LE F  IQ R L RDLF++YAR +KHEFLKDFFLSTGQ+ +VAFL
Sbjct  584   LIYLVIFHIWQKRPPLEFFAMIQGRVLARDLFVAYARCHKHEFLKDFFLSTGQIHEVAFL  643

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW++ KNPMASKGSPL+GPRIKL+EKA  LF++TKEH FESKAAEEHAKLL+IQHE
Sbjct  644   LWKESWDMGKNPMASKGSPLYGPRIKLIEKARNLFSQTKEHTFESKAAEEHAKLLKIQHE  703

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSI+DTIRTCIVLGN+RAA KVKTEFKVS+KRWY+LK FALATI+DW 
Sbjct  704   LEVSTKQAIFVDSSINDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYFLKAFALATIKDWA  763

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADA
Sbjct  764   ALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADA  823

Query  540   asqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             A+QA D GELL R + TFSQNA    IFDTL  ++ FQGTS
Sbjct  824   AAQANDGGELLERFRKTFSQNA----IFDTL--KIPFQGTS  858



>ref|XP_002883710.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59969.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=636

 Score =   408 bits (1048),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 211/281 (75%), Positives = 238/281 (85%), Gaps = 7/281 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRP LE F  IQ R L RDLF++YAR +KHEFLKDFFLSTG +  VAFL
Sbjct  362   LVYLVIFHIWQKRPPLEFFAMIQGRVLARDLFVAYARCHKHEFLKDFFLSTGLIHVVAFL  421

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW++  NPMASKGSPLHGPRIKL+EKA  LF++TKEH FESKAAEEHAKLL+IQHE
Sbjct  422   LWKESWDMGINPMASKGSPLHGPRIKLIEKARNLFSQTKEHTFESKAAEEHAKLLKIQHE  481

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE  TKQAIFVDSSI+DTIRTCIVLGN+RAA KVKTEFKVS+KRWYWLK FALA I+DW 
Sbjct  482   LEACTKQAIFVDSSINDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYWLKAFALARIKDWA  541

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAAD 
Sbjct  542   ALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADC  601

Query  540   asqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             A+QA D GELL R + TF QNA    IFDTL  ++ FQG S
Sbjct  602   AAQANDGGELLERFRKTFVQNA----IFDTL--KMPFQGAS  636



>ref|XP_006296131.1| hypothetical protein CARUB_v10025283mg [Capsella rubella]
 gb|EOA29029.1| hypothetical protein CARUB_v10025283mg [Capsella rubella]
Length=858

 Score =   414 bits (1063),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 214/281 (76%), Positives = 244/281 (87%), Gaps = 7/281 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRP LE F  IQ R L RDLF++Y+R YKHEFLKDFFLSTGQ+ +VAFL
Sbjct  584   LVYLVIFHIWQKRPPLEFFAMIQGRVLARDLFVAYSRCYKHEFLKDFFLSTGQIHEVAFL  643

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW++ KNPMASKGSPL+GPRIKL+EKA  LF++ KEH FESKAAEEHAKLL+IQHE
Sbjct  644   LWKESWDMGKNPMASKGSPLYGPRIKLIEKARNLFSQAKEHTFESKAAEEHAKLLKIQHE  703

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE +TKQAIFVDSSI+DTIRTCIVLGN+RAA KVKTEFKVS+KRWYWLK FALATI+DW 
Sbjct  704   LEASTKQAIFVDSSINDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYWLKAFALATIKDWA  763

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADA
Sbjct  764   ALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADA  823

Query  540   asqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             A+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  824   AAQANDGGELLERFRKTFSQNA----IFDTL--KMPFQGAS  858



>ref|XP_010517084.1| PREDICTED: protein VACUOLELESS1-like [Camelina sativa]
Length=858

 Score =   413 bits (1061),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 214/281 (76%), Positives = 246/281 (88%), Gaps = 7/281 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             L+YLV+ HIWQKRP LE F  IQ R L RDLF++YAR +KHEFLKDFFLSTGQ+ +VAFL
Sbjct  584   LIYLVIFHIWQKRPPLEFFAMIQGRVLARDLFVAYARCHKHEFLKDFFLSTGQIHEVAFL  643

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW++ KNPMASKGSPL+GPRIKL+EKA  LF++TKEH FESKAAEEHAKLL+IQHE
Sbjct  644   LWKESWDMGKNPMASKGSPLYGPRIKLIEKARNLFSQTKEHTFESKAAEEHAKLLKIQHE  703

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSI+DTIRTCIVLGN+RAA KVKTEFKVS+KRWY+LK FALATI+DW 
Sbjct  704   LEVSTKQAIFVDSSINDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYFLKAFALATIKDWA  763

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADA
Sbjct  764   ALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADA  823

Query  540   asqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             A+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  824   AAQANDGGELLERFRKTFSQNA----IFDTL--KMPFQGAS  858



>ref|XP_010509236.1| PREDICTED: protein VACUOLELESS1 [Camelina sativa]
Length=858

 Score =   413 bits (1061),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 214/281 (76%), Positives = 246/281 (88%), Gaps = 7/281 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             L+YLV+ HIWQKRP LE F  IQ R L RDLF++YAR +KHEFLKDFFLSTGQ+ +VAFL
Sbjct  584   LIYLVIFHIWQKRPPLEFFAMIQGRVLARDLFVAYARCHKHEFLKDFFLSTGQIHEVAFL  643

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW++ KNPMASKGSPL+GPRIKL+EKA  LF++TKEH FESKAAEEHAKLL+IQHE
Sbjct  644   LWKESWDMGKNPMASKGSPLYGPRIKLIEKARNLFSQTKEHTFESKAAEEHAKLLKIQHE  703

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSI+DTIRTCIVLGN+RAA KVKTEFKVS+KRWY+LK FALATI+DW 
Sbjct  704   LEVSTKQAIFVDSSINDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYFLKAFALATIKDWA  763

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADA
Sbjct  764   ALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADA  823

Query  540   asqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             A+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  824   AAQANDGGELLERFRKTFSQNA----IFDTL--KIPFQGAS  858



>dbj|BAJ33734.1| unnamed protein product [Thellungiella halophila]
Length=833

 Score =   412 bits (1059),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 214/281 (76%), Positives = 244/281 (87%), Gaps = 7/281 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRP LE F  IQ R L RDLF++YAR +KHEFLKDFFLSTGQ+ +VAFL
Sbjct  559   LVYLVIFHIWQKRPPLEFFAMIQGRVLARDLFVAYARCHKHEFLKDFFLSTGQIHEVAFL  618

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW++ KNPMASKGSPLHGPRIKL+EKA  LF++TKEH FESKAAEEHAKLLRIQHE
Sbjct  619   LWKESWDMGKNPMASKGSPLHGPRIKLIEKASNLFSQTKEHTFESKAAEEHAKLLRIQHE  678

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE +TKQAIFVDSSI+DTIRTCIVL N+RAA KVK+EFKVS+KRWY+LK FALATI+DW+
Sbjct  679   LEASTKQAIFVDSSINDTIRTCIVLRNNRAAAKVKSEFKVSDKRWYFLKAFALATIKDWE  738

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADA
Sbjct  739   ALEKFSKEKRPPTGFRPFVEACIDADEKAEALKYIPKLSDLGERGEAYARIGMAKEAADA  798

Query  540   asqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             A+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  799   AAQANDGGELLERFRKTFSQNA----IFDTL--KMPFQGVS  833



>ref|XP_009133226.1| PREDICTED: protein VACUOLELESS1 [Brassica rapa]
Length=858

 Score =   412 bits (1060),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 214/281 (76%), Positives = 243/281 (86%), Gaps = 7/281 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRP LE F  IQ R L RDLF++YAR +K EFLKDFFLSTGQ+ +VAFL
Sbjct  584   LVYLVIFHIWQKRPPLEFFAMIQGRILARDLFVAYARCHKQEFLKDFFLSTGQIHEVAFL  643

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW++ KNPMASKGSPLHGPRIKL+EKA  LF++TKEH FESKAAEEHAKLLRIQHE
Sbjct  644   LWKESWDMGKNPMASKGSPLHGPRIKLIEKASNLFSQTKEHTFESKAAEEHAKLLRIQHE  703

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE +TKQAIFVDSSI+DTIRTCIVL N+RAA KVK+EFKVS+KRWYWLK FALATI+DW+
Sbjct  704   LEASTKQAIFVDSSINDTIRTCIVLRNNRAAAKVKSEFKVSDKRWYWLKTFALATIKDWE  763

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADA
Sbjct  764   ALEKFSKEKRPPTGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADA  823

Query  540   asqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             A+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  824   AAQANDGGELLERFRKTFSQNA----IFDTL--KMPFQGVS  858



>emb|CDY14496.1| BnaC03g20990D [Brassica napus]
Length=858

 Score =   412 bits (1059),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 214/281 (76%), Positives = 243/281 (86%), Gaps = 7/281 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRP LE F  IQ R L RDLF++YAR +K EFLKDFFLSTGQ+ +VAFL
Sbjct  584   LVYLVIFHIWQKRPPLEFFAMIQGRVLARDLFVAYARCHKQEFLKDFFLSTGQIHEVAFL  643

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW++ KNPMASKGSPLHGPRIKL+EKA  LF++TKEH FESKAAEEHAKLLRIQHE
Sbjct  644   LWKESWDMGKNPMASKGSPLHGPRIKLMEKASNLFSQTKEHTFESKAAEEHAKLLRIQHE  703

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE +TKQAIFVDSSI+DTIRTCIVL N+RAA KVK+EFKVS+KRWYWLK FALATI+DW+
Sbjct  704   LEASTKQAIFVDSSINDTIRTCIVLRNNRAAAKVKSEFKVSDKRWYWLKTFALATIKDWE  763

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADA
Sbjct  764   ALEKFSKEKRPPTGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADA  823

Query  540   asqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             A+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  824   AAQANDGGELLERFRKTFSQNA----IFDTL--KMPFQGVS  858



>ref|XP_006411003.1| hypothetical protein EUTSA_v10016232mg [Eutrema salsugineum]
 gb|ESQ52456.1| hypothetical protein EUTSA_v10016232mg [Eutrema salsugineum]
Length=858

 Score =   412 bits (1059),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 214/281 (76%), Positives = 244/281 (87%), Gaps = 7/281 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRP LE F  IQ R L RDLF++YAR +KHEFLKDFFLSTGQ+ +VAFL
Sbjct  584   LVYLVIFHIWQKRPPLEFFAMIQGRVLARDLFVAYARCHKHEFLKDFFLSTGQIHEVAFL  643

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW++ KNPMASKGSPLHGPRIKL+EKA  LF++TKEH FESKAAEEHAKLLRIQHE
Sbjct  644   LWKESWDMGKNPMASKGSPLHGPRIKLIEKASNLFSQTKEHTFESKAAEEHAKLLRIQHE  703

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE +TKQAIFVDSSI+DTIRTCIVL N+RAA KVK+EFKVS+KRWY+LK FALATI+DW+
Sbjct  704   LEASTKQAIFVDSSINDTIRTCIVLRNNRAAAKVKSEFKVSDKRWYFLKAFALATIKDWE  763

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADA
Sbjct  764   ALEKFSKEKRPPTGFRPFVEACIDADEKAEALKYIPKLSDLGERGEAYARIGMAKEAADA  823

Query  540   asqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             A+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  824   AAQANDGGELLERFRKTFSQNA----IFDTL--KMPFQGVS  858



>emb|CDY07756.1| BnaA03g17550D [Brassica napus]
Length=858

 Score =   411 bits (1056),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 213/281 (76%), Positives = 242/281 (86%), Gaps = 7/281 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRP LE F  IQ R L RDLF++YAR +K EFLKDFFLSTGQ+ +VAFL
Sbjct  584   LVYLVIFHIWQKRPPLEFFAMIQGRVLARDLFVAYARCHKQEFLKDFFLSTGQIHEVAFL  643

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW++ KNPMASKGSPLHGPRIKL+EKA  LF++TKEH FE KAAEEHAKLLRIQHE
Sbjct  644   LWKESWDMGKNPMASKGSPLHGPRIKLIEKASNLFSQTKEHTFEVKAAEEHAKLLRIQHE  703

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE +TKQAIFVDSSI+DTIRTCIVL N+RAA KVK+EFKVS+KRWYWLK FALATI+DW+
Sbjct  704   LEASTKQAIFVDSSINDTIRTCIVLRNNRAAAKVKSEFKVSDKRWYWLKTFALATIKDWE  763

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKEKRPP G++PFVEAC++A++K EALKYIPKL+D  ER EAYA IGMAKEAADA
Sbjct  764   ALEKFSKEKRPPTGFRPFVEACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADA  823

Query  540   asqakD-GELLGRLKLTFSQNAAAASIFDTLRDRLTFQGTS  421
             A+QA D GELL R + TFSQNA    IFDTL  ++ FQG S
Sbjct  824   AAQANDGGELLERFRKTFSQNA----IFDTL--KMPFQGVS  858



>ref|XP_008656726.1| PREDICTED: protein VACUOLELESS1 [Zea mays]
Length=877

 Score =   407 bits (1046),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 210/284 (74%), Positives = 243/284 (86%), Gaps = 6/284 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQK-----RPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVYLVL HIWQK     +  L+ FG I +RP+ RDLF++YAR  KHE LKDFFLSTG+LQ
Sbjct  592   LVYLVLFHIWQKVAVEKKAPLDFFGVINARPVARDLFMAYARHSKHEELKDFFLSTGRLQ  651

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             D AFLL KESWEL KNPMASKGSPLHGP+++L+E+AH LFAETKEHVFESKA+EEHAKLL
Sbjct  652   DAAFLLLKESWELEKNPMASKGSPLHGPQVRLIEQAHRLFAETKEHVFESKASEEHAKLL  711

Query  915   RIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
             R QHELEV+TKQ IFV SS+SDTI+TCI +GN RAA +VK+EFKV +KRWYWLK  ALAT
Sbjct  712   RSQHELEVSTKQPIFVGSSVSDTIKTCIAMGNERAALRVKSEFKVPDKRWYWLKTCALAT  771

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  556
             + +WD LEKFS+EKRPP GYKPFVEAC++A  K EA+KYIPKL DPRER+EAYA +GMAK
Sbjct  772   VGNWDGLEKFSREKRPPGGYKPFVEACIDAGQKNEAVKYIPKLTDPRERSEAYARMGMAK  831

Query  555   eaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  427
             EA DAASQAKD  EL GRLK+T +Q++AAASIFDTLRDRL+FQG
Sbjct  832   EAQDAASQAKDSDELFGRLKITLAQSSAAASIFDTLRDRLSFQG  875



>ref|XP_002456108.1| hypothetical protein SORBIDRAFT_03g030590 [Sorghum bicolor]
 gb|EES01228.1| hypothetical protein SORBIDRAFT_03g030590 [Sorghum bicolor]
Length=825

 Score =   405 bits (1040),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 210/284 (74%), Positives = 244/284 (86%), Gaps = 6/284 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQK-----RPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVYLVL HIWQK     +  L+ FG I +RP+ RDLF++YAR  KHE LKDFFLSTG+LQ
Sbjct  540   LVYLVLFHIWQKVAVEKKAPLDFFGVINARPVARDLFMAYARHSKHEDLKDFFLSTGRLQ  599

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             D AFLL KES EL KNPMASKGSPLHGP+++L+E+AH LFAETKEHVFESKA+EEHAKLL
Sbjct  600   DAAFLLLKESRELDKNPMASKGSPLHGPQVRLIEQAHRLFAETKEHVFESKASEEHAKLL  659

Query  915   RIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
             R QHELEV+TKQ IFV SS+SDTI+TCI +GN RAA KVK+EFKV +KRWYWLK  ALAT
Sbjct  660   RSQHELEVSTKQPIFVGSSVSDTIKTCIAMGNERAALKVKSEFKVPDKRWYWLKTCALAT  719

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  556
             + +WDALEKFS+EKRPP GYKPFVEAC++A  K EA+KYIPKLADPRER+EAYA +GMA+
Sbjct  720   VGNWDALEKFSREKRPPGGYKPFVEACIDAGQKNEAVKYIPKLADPRERSEAYARMGMAR  779

Query  555   eaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  427
             EA +AASQAKD  EL GRLK+T +Q++AAASIFDTLRDRL+FQG
Sbjct  780   EAEEAASQAKDSDELFGRLKITLAQSSAAASIFDTLRDRLSFQG  823



>gb|EEE55144.1| hypothetical protein OsJ_02938 [Oryza sativa Japonica Group]
Length=988

 Score =   406 bits (1043),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 215/285 (75%), Positives = 242/285 (85%), Gaps = 6/285 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQK-----RPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVYLVL HIWQK        L+ FG I +RPL RDLF++YAR  KHE LKDFFLSTG+LQ
Sbjct  703   LVYLVLFHIWQKVAVEKSAPLDFFGVINARPLARDLFMAYARHSKHEALKDFFLSTGRLQ  762

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             D AFLL KES EL +NPMASKGSPLHGP+++L+E+AH LFAETKEHVFESKA+EEHAKLL
Sbjct  763   DAAFLLLKESRELERNPMASKGSPLHGPQVRLIEQAHRLFAETKEHVFESKASEEHAKLL  822

Query  915   RIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
             R QHELEV+TKQAIFV SS+SDTI+TCI +GN RAA KVK+EFKV +KRWYWLK  ALAT
Sbjct  823   RSQHELEVSTKQAIFVGSSVSDTIKTCIAMGNERAALKVKSEFKVPDKRWYWLKSCALAT  882

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  556
             + +WDALEKFSKE+RPP GYKPFVEAC++A  K EALKYIPKL DPRER+EAYA I MAK
Sbjct  883   VGNWDALEKFSKERRPPGGYKPFVEACIDAGQKTEALKYIPKLTDPRERSEAYARIKMAK  942

Query  555   eaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  424
             EAA+AASQ KD  EL GRLKLT +QN AAASIFDTLRDRL+FQGT
Sbjct  943   EAAEAASQVKDSDELFGRLKLTLAQNTAAASIFDTLRDRLSFQGT  987



>ref|XP_011467591.1| PREDICTED: protein VACUOLELESS1 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=891

 Score =   403 bits (1035),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 216/324 (67%), Positives = 240/324 (74%), Gaps = 50/324 (15%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQ-----  1096
             LVYLVL HIWQKR  L  F  I  +PL RDLF+ YAR Y HEFLKDFFLS GQLQ     
Sbjct  565   LVYLVLFHIWQKREPLAFFKMIHPKPLARDLFVIYARCYNHEFLKDFFLSAGQLQVGVSW  624

Query  1095  -----------------------------DVAFLLWKESWELAKNPMASKGSPLHGPRIK  1003
                                          +VAFL+WKESWEL KNPMAS+GSPLH PRIK
Sbjct  625   LLVLCIHSMHEWNTKESNAVKLSYEEWVTEVAFLVWKESWELGKNPMASRGSPLHNPRIK  684

Query  1002  LVEKAHGLF----------------AETKEHVFESKAAEEHAKLLRIQHELEVTTKQAIF  871
             L+++   LF                 + K+  FESKAAEEH+KLLR QH LEV+TKQAIF
Sbjct  685   LIDQTKSLFEGANKDKESNSLFGEANKDKDFTFESKAAEEHSKLLRAQHGLEVSTKQAIF  744

Query  870   VDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKR  691
             VDSSISDTIRTCIVLGNH+AA KVKT+FKVSEKRWYWLK FALAT+RDWD LEKFSKEKR
Sbjct  745   VDSSISDTIRTCIVLGNHKAAMKVKTDFKVSEKRWYWLKAFALATVRDWDTLEKFSKEKR  804

Query  690   PPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELL  511
             PPIG++PFVEAC+EA++KGEALKYIPKL DPRERAEAY  IGMAKEAADAASQA DGELL
Sbjct  805   PPIGFRPFVEACIEADEKGEALKYIPKLTDPRERAEAYGRIGMAKEAADAASQANDGELL  864

Query  510   GRLKLTFSQNAAAASIFDTLRDRL  439
             GRL+ TFSQN AA+SIFDT+RD+L
Sbjct  865   GRLRSTFSQNPAASSIFDTIRDKL  888



>ref|XP_006646183.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog, 
partial [Oryza brachyantha]
Length=825

 Score =   400 bits (1028),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 212/285 (74%), Positives = 242/285 (85%), Gaps = 6/285 (2%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPA-----LELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVYLVL HIWQK        L+ FG I +RPL RDLFI+YAR  KHE LKDFFLSTG+LQ
Sbjct  540   LVYLVLFHIWQKVAVEKGAPLDFFGLINARPLARDLFIAYARHSKHEALKDFFLSTGKLQ  599

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             DVAFL+ KES EL +NPMASKGSPLHGP+++L+++A  LFA+TKE+VFESKA+EEHAKLL
Sbjct  600   DVAFLILKESRELERNPMASKGSPLHGPQVRLIDQARKLFADTKENVFESKASEEHAKLL  659

Query  915   RIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
             R QHELEV+TKQAIFV SS+SDTI+TCI +GN RAA KVKT+FKV +KRWYWLK  ALAT
Sbjct  660   RSQHELEVSTKQAIFVGSSVSDTIKTCIAMGNERAALKVKTDFKVPDKRWYWLKSCALAT  719

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  556
             + +WDALEKFSKEKRPP GYKPFVEAC++A  K EA+KYIPKL DPRER+EAYA I MAK
Sbjct  720   VGNWDALEKFSKEKRPPGGYKPFVEACIDAGQKTEAVKYIPKLTDPRERSEAYARIKMAK  779

Query  555   eaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  424
             EAA+AASQ KD  EL GRLKLT +QN AAASIFDTLRDRL+FQGT
Sbjct  780   EAAEAASQVKDSDELFGRLKLTLAQNTAAASIFDTLRDRLSFQGT  824



>dbj|BAD95263.1| hypothetical protein [Arabidopsis thaliana]
Length=346

 Score =   383 bits (984),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 179/226 (79%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRP LE F  IQ R L RDLF++YAR +KHEFLKDFFLSTGQ+ +VAFL
Sbjct  96    LVYLVIFHIWQKRPPLEFFAMIQGRVLARDLFVAYARCHKHEFLKDFFLSTGQIHEVAFL  155

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW++ KNPMASKGSPLHGPRIKL+EKA  LF++TKEH FESKAAEEHAKLL+IQHE
Sbjct  156   LWKESWDMGKNPMASKGSPLHGPRIKLIEKARNLFSQTKEHTFESKAAEEHAKLLKIQHE  215

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE +TKQAIFVDSSI+DTIRTCIVLGN+RAA KVKTEFKVS+KRWYWLK FALATI+DW 
Sbjct  216   LEASTKQAIFVDSSINDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYWLKAFALATIKDWA  275

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAE  583
             ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER E
Sbjct  276   ALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGE  321



>dbj|BAH19612.1| AT2G38020 [Arabidopsis thaliana]
Length=526

 Score =   385 bits (988),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/226 (79%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRP LE F  IQ R L RDLF++YAR +KHEFLKDFFLSTGQ+ +VAFL
Sbjct  276   LVYLVIFHIWQKRPPLEFFAMIQGRVLARDLFVAYARCHKHEFLKDFFLSTGQIHEVAFL  335

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW++ KNPMASKGSPLHGPRIKL+EKA  LF++TKEH FESKAAEEHAKLL+IQHE
Sbjct  336   LWKESWDMGKNPMASKGSPLHGPRIKLIEKARNLFSQTKEHTFESKAAEEHAKLLKIQHE  395

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE +TKQAIFVDSSI+DTIRTCIVLGN+RAA KVKTEFKVS+KRWYWLK FALATI+DW 
Sbjct  396   LEASTKQAIFVDSSINDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYWLKAFALATIKDWA  455

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAE  583
             ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER E
Sbjct  456   ALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGE  501



>dbj|BAB90498.1| vacuolar protein sorting-associated protein VPS16-like [Oryza 
sativa Japonica Group]
Length=892

 Score =   394 bits (1013),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 215/303 (71%), Positives = 242/303 (80%), Gaps = 24/303 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQK-----RPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTG---  1105
             LVYLVL HIWQK        L+ FG I +RPL RDLF++YAR  KHE LKDFFLSTG   
Sbjct  589   LVYLVLFHIWQKVAVEKSAPLDFFGVINARPLARDLFMAYARHSKHEALKDFFLSTGRLQ  648

Query  1104  ---------------QLQDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAE  970
                            +LQD AFLL KES EL +NPMASKGSPLHGP+++L+E+AH LFAE
Sbjct  649   LVISPSMSYFLNYREKLQDAAFLLLKESRELERNPMASKGSPLHGPQVRLIEQAHRLFAE  708

Query  969   TKEHVFESKAAEEHAKLLRIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTE  790
             TKEHVFESKA+EEHAKLLR QHELEV+TKQAIFV SS+SDTI+TCI +GN RAA KVK+E
Sbjct  709   TKEHVFESKASEEHAKLLRSQHELEVSTKQAIFVGSSVSDTIKTCIAMGNERAALKVKSE  768

Query  789   FKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPK  610
             FKV +KRWYWLK  ALAT+ +WDALEKFSKE+RPP GYKPFVEAC++A  K EALKYIPK
Sbjct  769   FKVPDKRWYWLKSCALATVGNWDALEKFSKERRPPGGYKPFVEACIDAGQKTEALKYIPK  828

Query  609   LADPRERAEAYAGIGMakeaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTF  433
             L DPRER+EAYA I MAKEAA+AASQ KD  EL GRLKLT +QN AAASIFDTLRDRL+F
Sbjct  829   LTDPRERSEAYARIKMAKEAAEAASQVKDSDELFGRLKLTLAQNTAAASIFDTLRDRLSF  888

Query  432   QGT  424
             QGT
Sbjct  889   QGT  891



>ref|XP_010232114.1| PREDICTED: protein VACUOLELESS1 [Brachypodium distachyon]
Length=877

 Score =   394 bits (1011),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 208/287 (72%), Positives = 241/287 (84%), Gaps = 8/287 (3%)
 Frame = -3

Query  1260  LVYLVLLHIWQK-----RPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVYLVL HIWQK        L+ FG I +RPL RDLF++YAR  KHE LKDFFLSTG+LQ
Sbjct  590   LVYLVLFHIWQKVAVEKNAPLDFFGVINARPLARDLFMAYARHSKHEALKDFFLSTGRLQ  649

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             D AFLL KES EL K P+ASKGSPLHGP+++LVE+AH LFAETKEH+FESK+AEEHAKLL
Sbjct  650   DAAFLLLKESRELEKIPVASKGSPLHGPQVRLVEQAHRLFAETKEHIFESKSAEEHAKLL  709

Query  915   RIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
             R+QH+LEV+TKQAIFV SS+SDTI+TCI +GN RAA KVK+EFKV +KRWYWLK  ALAT
Sbjct  710   RVQHQLEVSTKQAIFVGSSVSDTIKTCIAMGNERAAVKVKSEFKVPDKRWYWLKSCALAT  769

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  556
             + +WDALE FSKE++PP G+KPFVEAC++A  K EALKY+PKL DP ER+EAYA + M K
Sbjct  770   VGNWDALETFSKERKPPGGFKPFVEACIDAGKKTEALKYVPKLTDPGERSEAYARLKMDK  829

Query  555   eaadaasqakDG-ELLGRLKLTFSQ--NAAAASIFDTLRDRLTFQGT  424
             EAA+AASQAKDG EL GRLKLT +Q  N AAASIFDTLRDRL+FQGT
Sbjct  830   EAAEAASQAKDGDELFGRLKLTLAQNTNTAAASIFDTLRDRLSFQGT  876



>ref|XP_004969467.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Setaria italica]
Length=874

 Score =   388 bits (997),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 208/285 (73%), Positives = 240/285 (84%), Gaps = 8/285 (3%)
 Frame = -3

Query  1260  LVYLVLLHIWQK-----RPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVYLVL HIWQK     +  L+ FG I +RP+ RDLFI+YAR  KHE LKDFFLSTG+LQ
Sbjct  591   LVYLVLFHIWQKVAIEKKAHLDFFGVINARPVARDLFIAYARHSKHEDLKDFFLSTGRLQ  650

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             D AFL+ KES EL KNPMASKGS  H  +++ +E+AH LFAETKEHVFESKA+EEHAKLL
Sbjct  651   DAAFLMLKESSELEKNPMASKGS--HLQQVRPIEQAHRLFAETKEHVFESKASEEHAKLL  708

Query  915   RIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
             R QHELEV+TKQAIF+ SS+SDTI+TCI +GN RAA KVK+EFKV +KRWYWLK  ALAT
Sbjct  709   RSQHELEVSTKQAIFMGSSVSDTIKTCIAMGNERAALKVKSEFKVPDKRWYWLKTCALAT  768

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  556
             + +WDALEKFS+E+RPP GYKPFVEAC++A  K EALKYIPKL DPRER+EAYA +GMAK
Sbjct  769   VGNWDALEKFSRERRPPGGYKPFVEACIDAGQKTEALKYIPKLTDPRERSEAYARMGMAK  828

Query  555   eaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  424
             EAADAASQAKD  EL GRLK+T +QN+AAASIFDTLRDRL+FQG 
Sbjct  829   EAADAASQAKDSDELFGRLKITLAQNSAAASIFDTLRDRLSFQGA  873



>dbj|BAJ97322.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=899

 Score =   388 bits (997),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 199/285 (70%), Positives = 232/285 (81%), Gaps = 10/285 (4%)
 Frame = -3

Query  1260  LVYLVLLHIWQK-----RPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVYLVL HIWQK        LE FG I +RPL RDLFI+YAR  KHE LKDFFLSTG+LQ
Sbjct  618   LVYLVLFHIWQKISVEKSAPLEFFGVINARPLARDLFIAYARHSKHEALKDFFLSTGRLQ  677

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             D  FLL KES EL ++PMASKGSPLHGP+++LVE+AH LFAETKEH+FESK+AEEH KLL
Sbjct  678   DAGFLLLKESRELERSPMASKGSPLHGPQVRLVEQAHRLFAETKEHLFESKSAEEHGKLL  737

Query  915   RIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
             R+QH+LEV+TKQAIFV SS+SDTI+TCIV+GN RAA KVK+EFKV +KRWYWLK  ALAT
Sbjct  738   RVQHQLEVSTKQAIFVGSSVSDTIKTCIVMGNERAAVKVKSEFKVPDKRWYWLKSCALAT  797

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  556
             + +WDALE FS+EKRPP GYKPFVEAC++A  K EA+KYIPKL DP ER+EAYA + M  
Sbjct  798   VGNWDALETFSREKRPPGGYKPFVEACIDAGQKMEAIKYIPKLTDPGERSEAYARLNMTD  857

Query  555   eaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  424
             EA  AAS+A +G EL GRLK T +QN    ++ DTLRDRL+FQGT
Sbjct  858   EAEKAASEANNGDELFGRLKSTLAQN----TLIDTLRDRLSFQGT  898



>ref|NP_001078020.1| vacuoleless1 [Arabidopsis thaliana]
 gb|AEC09480.1| vacuoleless1 [Arabidopsis thaliana]
Length=834

 Score =   385 bits (989),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRP LE F  IQ R L RDLF++YAR +KHEFLKDFFLSTGQ+ +VAFL
Sbjct  584   LVYLVIFHIWQKRPPLEFFAMIQGRVLARDLFVAYARCHKHEFLKDFFLSTGQIHEVAFL  643

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESW++ KNPMASKGSPLHGPRIKL+EKA  LF++TKEH FESKAAEEHAKLL+IQHE
Sbjct  644   LWKESWDMGKNPMASKGSPLHGPRIKLIEKARNLFSQTKEHTFESKAAEEHAKLLKIQHE  703

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE +TKQAIFVDSSI+DTIRTCIVLGN+RAA KVKTEFKVS+KRWYWLK FALATI+DW 
Sbjct  704   LEASTKQAIFVDSSINDTIRTCIVLGNNRAAIKVKTEFKVSDKRWYWLKAFALATIKDWA  763

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEA  580
             ALEKFSKEKRPP+G++PFVEAC++A++K EALKYIPKL+D  ER E 
Sbjct  764   ALEKFSKEKRPPMGFRPFVEACIDADEKAEALKYIPKLSDLVERGEV  810



>gb|KJB10619.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=772

 Score =   371 bits (952),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRP LE FG IQ+RPLPRDLFISYAR YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  565   LVYLVLFHIWQKRPPLEFFGMIQARPLPRDLFISYARCYKHEFLKDFFLSTGQLQEVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL++KA  LFAETKEH FESKAAEEHAKLLRIQHE
Sbjct  625   LWKESWELGKNPMASKGSPLHGPRIKLIDKAQHLFAETKEHTFESKAAEEHAKLLRIQHE  684

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LEV+TKQAIFVDSSISDTIRTCIVLGNHRAA KVKTEFKVSEKRWYWLKVFALATIRDW+
Sbjct  685   LEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATIRDWE  744

Query  720   ALEKFSKEKRPPIG  679
             ALEKFSKEKRPPIG
Sbjct  745   ALEKFSKEKRPPIG  758



>gb|EMS54442.1| Vacuolar protein sorting-associated protein 16-like protein [Triticum 
urartu]
Length=419

 Score =   349 bits (896),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 173/250 (69%), Positives = 199/250 (80%), Gaps = 17/250 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQK-----RPALELFGTIQSRPLPRDLFISYA------------RLYKHEF  1132
             LVYLVL HIWQK        L+ FG I +RPL RDLFI+YA            R  KHE 
Sbjct  131   LVYLVLFHIWQKISVEKSAPLDFFGVINARPLARDLFIAYASCVEHCSMSIMHRHSKHEA  190

Query  1131  LKDFFLSTGQLQDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVF  952
             LKDFFLSTG+LQD  FLL KES EL +NPMASKGSPLHGP+++LVE+AH LFAETKEH+F
Sbjct  191   LKDFFLSTGRLQDAGFLLLKESRELERNPMASKGSPLHGPQVRLVEQAHRLFAETKEHLF  250

Query  951   ESKAAEEHAKLLRIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEK  772
             ESK+AEEHAKLLR+QH+LEV+TKQAIFV SS+SDTI+TCIV+GN RAA KVK+EFKV +K
Sbjct  251   ESKSAEEHAKLLRVQHQLEVSTKQAIFVGSSVSDTIKTCIVMGNERAAVKVKSEFKVPDK  310

Query  771   RWYWLKVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRE  592
             RWYWLK  ALAT+ +WDALE FS+EKRPP GYKPFVEAC++A  K EALKYIPKL DP E
Sbjct  311   RWYWLKSCALATVGNWDALETFSREKRPPGGYKPFVEACIDAGQKTEALKYIPKLTDPGE  370

Query  591   RAEAYAGIGM  562
             R+E YA I +
Sbjct  371   RSEGYAQISI  380



>ref|XP_001777594.1| predicted protein [Physcomitrella patens]
 gb|EDQ57637.1| predicted protein [Physcomitrella patens]
Length=837

 Score =   339 bits (869),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 171/276 (62%), Positives = 214/276 (78%), Gaps = 0/276 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY  +LHIW+++P  + F  IQ++ L R LF++YAR    E LK FF+S GQLQ  A +
Sbjct  561   LVYFSILHIWRQKPLPDFFRIIQAKSLARHLFVAYARQNDPEILKKFFISIGQLQSAAEV  620

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               KESW  ++N     GS L GPR+K +++A  L+A+TKEH+FE+KAAEE  KLL++Q E
Sbjct  621   FLKESWSYSRNMGTRSGSALQGPRLKAIDQASELYAQTKEHMFEAKAAEEQGKLLKLQQE  680

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE++T Q IFVDSS+SDTIRT I LGNHRAA +VK +FKV +KR+YWLKVFALAT + WD
Sbjct  681   LEISTGQPIFVDSSVSDTIRTLITLGNHRAAQRVKVDFKVPDKRYYWLKVFALATAKQWD  740

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaada  541
             ALEKFSKE++PPIGYKPFVEAC+E E+  EALKYI KL +P ERAEAYA IGM KEA +A
Sbjct  741   ALEKFSKERKPPIGYKPFVEACIEEEENQEALKYIVKLTNPEERAEAYARIGMVKEATEA  800

Query  540   asqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTF  433
             A+QAKD ELLGRL+ TF QN  A ++FD+LRDRL+ 
Sbjct  801   AAQAKDNELLGRLRSTFGQNTPAGALFDSLRDRLSL  836



>ref|XP_002974680.1| hypothetical protein SELMODRAFT_101752 [Selaginella moellendorffii]
 gb|EFJ24200.1| hypothetical protein SELMODRAFT_101752 [Selaginella moellendorffii]
Length=839

 Score =   335 bits (858),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 170/279 (61%), Positives = 217/279 (78%), Gaps = 1/279 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY  L H+WQK+   E    +Q +PL R+LFI+YAR  + + LK FF S GQL  V  L
Sbjct  560   LVYFTLFHLWQKKSPSEFTRAVQDKPLARNLFIAYARQNEPDVLKKFFASIGQLHRVGEL  619

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             L  E+W  +KNP+  +GSPL GPRI+L+E+A  LF+ +KEH FE+KA +E A+LL+IQHE
Sbjct  620   LLWEAWAQSKNPVTRQGSPLQGPRIRLIEEAQRLFSHSKEHDFEAKACDEQARLLKIQHE  679

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFK-VSEKRWYWLKVFALATIRDW  724
             LE  T +AIFVD+S+SDTIRTCIVL NHR A +++ EFK V +KR+YWLK+ ALA I+DW
Sbjct  680   LEAKTGKAIFVDTSVSDTIRTCIVLKNHREAQRIRVEFKVVPDKRFYWLKILALAYIKDW  739

Query  723   DALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaad  544
             DALEKFSKE+RPP+G+KPFVEAC++     EALKYI KL+DP E+AEAYA  GMAKEAA+
Sbjct  740   DALEKFSKERRPPVGFKPFVEACLQEGQTSEALKYIQKLSDPEEKAEAYAQAGMAKEAAE  799

Query  543   aasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  427
              A+QAKD E+LGRLKLTF Q+  AA++FD++RDRL+ QG
Sbjct  800   VAAQAKDSEILGRLKLTFGQSTTAAALFDSIRDRLSLQG  838



>ref|XP_002963395.1| hypothetical protein SELMODRAFT_80688 [Selaginella moellendorffii]
 gb|EFJ35266.1| hypothetical protein SELMODRAFT_80688 [Selaginella moellendorffii]
Length=839

 Score =   332 bits (852),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 170/279 (61%), Positives = 216/279 (77%), Gaps = 1/279 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY  L H+WQK+   E    +Q +PL R+LFI+YAR  + + LK FF S GQL  V  L
Sbjct  560   LVYFTLFHLWQKKSPSEFTRAVQDKPLARNLFIAYARQNEPDVLKKFFASIGQLHRVGEL  619

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             L  E+W  +KNP+  +GSPL GPRI+L+E+A  LF+ +KEH FE+KA +E A+LL+IQ E
Sbjct  620   LLWEAWAQSKNPVTRQGSPLQGPRIRLIEEAQRLFSHSKEHDFEAKACDEQARLLKIQQE  679

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFK-VSEKRWYWLKVFALATIRDW  724
             LE  T +AIFVD+S+SDTIRTCIVL NHR A +++ EFK V +KR+YWLKV ALA I+DW
Sbjct  680   LEAKTGKAIFVDTSVSDTIRTCIVLKNHREAQRIRVEFKVVPDKRFYWLKVLALAYIKDW  739

Query  723   DALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaad  544
             DALEKFSKE+RPP+G+KPFVEAC++     EALKYI KL+DP E+AEAYA  GMAKEAA+
Sbjct  740   DALEKFSKERRPPVGFKPFVEACLQEGQTSEALKYIQKLSDPEEKAEAYAQAGMAKEAAE  799

Query  543   aasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  427
              A+QAKD E+LGRLKLTF Q+  AA++FD++RDRL+ QG
Sbjct  800   VAAQAKDSEILGRLKLTFGQSTTAAALFDSIRDRLSLQG  838



>gb|KCW89755.1| hypothetical protein EUGRSUZ_A02017 [Eucalyptus grandis]
Length=742

 Score =   296 bits (758),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKR  LE FG IQ++PL RDLFI+Y+R YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  567   LVYLVLFHIWQKRQPLEFFGMIQAKPLARDLFITYSRCYKHEFLKDFFLSTGQLQEVAFL  626

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMASKGSPLHGPRIKL+EKAHGLFAETKEH FESKAAEEHAKLLRIQHE
Sbjct  627   LWKESWELGKNPMASKGSPLHGPRIKLIEKAHGLFAETKEHNFESKAAEEHAKLLRIQHE  686

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVS  778
             LEVTTKQ IFVDSSISDTIRTCIVLGNHRAA KV+TEFKV 
Sbjct  687   LEVTTKQPIFVDSSISDTIRTCIVLGNHRAAMKVRTEFKVG  727



>ref|XP_006387719.1| hypothetical protein POPTR_0647s00230g, partial [Populus trichocarpa]
 gb|ERP46633.1| hypothetical protein POPTR_0647s00230g, partial [Populus trichocarpa]
Length=201

 Score =   275 bits (702),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 167/196 (85%), Gaps = 2/196 (1%)
 Frame = -3

Query  1002  LVEKAHGLFAETKE--HVFESKAAEEHAKLLRIQHELEVTTKQAIFVDSSISDTIRTCIV  829
             L+    G F  TK   +++E     ++    RIQHELEV+TKQ IFVDSSISDTIRTCI 
Sbjct  6     LISCVKGTFTCTKSFINLYELLFPSDYIFFCRIQHELEVSTKQPIFVDSSISDTIRTCIA  65

Query  828   LGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVE  649
             LGNHRAA +VKTEFKVSEKRWYWLKV AL TIRDW+ALEKFSKEKRPP+G++PFVEAC++
Sbjct  66    LGNHRAAMRVKTEFKVSEKRWYWLKVLALVTIRDWEALEKFSKEKRPPMGFRPFVEACID  125

Query  648   AEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKLTFSQNAAAA  469
              ++K EALKYIPKLADPRERAEAYA IGMAKEAADAASQAKDGELLGRLKL+F+QN AA+
Sbjct  126   VDEKAEALKYIPKLADPRERAEAYARIGMAKEAADAASQAKDGELLGRLKLSFAQNTAAS  185

Query  468   SIFDTLRDRLTFQGTS  421
             SIFDTLRDRL+FQG S
Sbjct  186   SIFDTLRDRLSFQGVS  201



>gb|EPS57825.1| hypothetical protein M569_16992, partial [Genlisea aurea]
Length=188

 Score =   246 bits (629),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 143/170 (84%), Gaps = 7/170 (4%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIW+KR  L+ F TIQ+RPL RDLFISYAR YKHEFLKDFFLSTGQ+QDVAFL
Sbjct  26    LVYLVLFHIWEKRAPLDFFSTIQARPLARDLFISYARCYKHEFLKDFFLSTGQIQDVAFL  85

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWE +KNP+        G RI +++KA  LF  TKEH+FE+KAAEEHA+LL+IQHE
Sbjct  86    LWKESWEQSKNPIK-------GHRIMVIKKAADLFKNTKEHIFEAKAAEEHAELLKIQHE  138

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKV  751
             LE TTKQAIFVDSSISDTIRTCI LGNH AANK+K  FKVSEKRWYWLKV
Sbjct  139   LEATTKQAIFVDSSISDTIRTCIALGNHHAANKLKATFKVSEKRWYWLKV  188



>gb|AFW83495.1| hypothetical protein ZEAMMB73_843554 [Zea mays]
Length=197

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -3

Query  915  RIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
            R QHELEV+TKQ IFV SS+SDTI+TCI +GN RAA +VK+EFKV +KRWYWLK  ALAT
Sbjct  32   RSQHELEVSTKQPIFVGSSVSDTIKTCIAMGNERAALRVKSEFKVPDKRWYWLKTCALAT  91

Query  735  IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMak  556
            + +WD LEKFS+EKRPP GYKPFVEAC++A  K EA+KYIPKL DPRER+EAYA +GMAK
Sbjct  92   VGNWDGLEKFSREKRPPGGYKPFVEACIDAGQKNEAVKYIPKLTDPRERSEAYARMGMAK  151

Query  555  eaadaasqakDG-ELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  427
            EA DAASQAKD  EL GRLK+T +Q++AAASIFDTLRDRL+FQG
Sbjct  152  EAQDAASQAKDSDELFGRLKITLAQSSAAASIFDTLRDRLSFQG  195



>ref|XP_009774600.1| PREDICTED: protein VACUOLELESS1-like isoform X2 [Nicotiana sylvestris]
Length=206

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRPALE FGTIQ RPL RDLF++YA+ +KHEFLKDFFLSTGQLQDVAFL
Sbjct  89    LVYLVLFHIWQKRPALEFFGTIQERPLARDLFVNYAQHFKHEFLKDFFLSTGQLQDVAFL  148

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRI  910
             LWKESWEL+KNPM SKGSPLHGPRIKL+EK+  LFAETKE+ FESKAAEEHAKLLR+
Sbjct  149   LWKESWELSKNPMDSKGSPLHGPRIKLIEKSQHLFAETKEYFFESKAAEEHAKLLRL  205



>ref|XP_009774599.1| PREDICTED: protein VACUOLELESS1-like isoform X1 [Nicotiana sylvestris]
Length=210

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRPALE FGTIQ RPL RDLF++YA+ +KHEFLKDFFLSTGQLQDVAFL
Sbjct  89    LVYLVLFHIWQKRPALEFFGTIQERPLARDLFVNYAQHFKHEFLKDFFLSTGQLQDVAFL  148

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRI  910
             LWKESWEL+KNPM SKGSPLHGPRIKL+EK+  LFAETKE+ FESKAAEEHAKLLR 
Sbjct  149   LWKESWELSKNPMDSKGSPLHGPRIKLIEKSQHLFAETKEYFFESKAAEEHAKLLRC  205



>gb|KJB10620.1| hypothetical protein B456_001G211500 [Gossypium raimondii]
Length=680

 Score =   218 bits (555),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 103/116 (89%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL HIWQKRP LE FG IQ+RPLPRDLFISYAR YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  565   LVYLVLFHIWQKRPPLEFFGMIQARPLPRDLFISYARCYKHEFLKDFFLSTGQLQEVAFL  624

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
             LWKESWEL KNPMASKGSPLHGPRIKL++KA  LFAETKEH FESKAAEEHAKLLR
Sbjct  625   LWKESWELGKNPMASKGSPLHGPRIKLIDKAQHLFAETKEHTFESKAAEEHAKLLR  680



>ref|XP_010271338.1| PREDICTED: protein VACUOLELESS1 isoform X2 [Nelumbo nucifera]
Length=691

 Score =   214 bits (546),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             L+YLVL HIWQKRP LE FG +Q+RPL RDLFISYAR YKHEFLKDFFLSTGQLQDVAFL
Sbjct  562   LIYLVLFHIWQKRPPLEFFGMVQARPLGRDLFISYARCYKHEFLKDFFLSTGQLQDVAFL  621

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
             LWKESWEL KNPMASKGSPLHGPRIK++EKA  LF+ETKEH FE+KAAEEHAKLLR
Sbjct  622   LWKESWELVKNPMASKGSPLHGPRIKIIEKAQNLFSETKEHAFEAKAAEEHAKLLR  677



>gb|KDO51890.1| hypothetical protein CISIN_1g003205mg [Citrus sinensis]
Length=691

 Score =   207 bits (527),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ HIWQKRPALE FG IQ+RPL  DLF  YAR YKHEFLKDFFLSTGQLQ+VAFL
Sbjct  560   LVYLVIFHIWQKRPALEFFGMIQTRPLACDLFTVYARCYKHEFLKDFFLSTGQLQEVAFL  619

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             LWKESWEL KNPMAS GS LHGPRIK +EKAH LF+ETKEH FESKAAEEHAKLL +  E
Sbjct  620   LWKESWELGKNPMASNGSALHGPRIKRIEKAHSLFSETKEHTFESKAAEEHAKLLSVIQE  679



>gb|AFW83494.1| hypothetical protein ZEAMMB73_114694 [Zea mays]
Length=726

 Score =   182 bits (462),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 5/121 (4%)
 Frame = -3

Query  1260  LVYLVLLHIWQK-----RPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVYLVL HIWQK     +  L+ FG I +RP+ RDLF++YAR  KHE LKDFFLSTG+LQ
Sbjct  592   LVYLVLFHIWQKVAVEKKAPLDFFGVINARPVARDLFMAYARHSKHEELKDFFLSTGRLQ  651

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             D AFLL KESWEL KNPMASKGSPLHGP+++L+E+AH LFAETKEHVFESKA+EEHAKLL
Sbjct  652   DAAFLLLKESWELEKNPMASKGSPLHGPQVRLIEQAHRLFAETKEHVFESKASEEHAKLL  711

Query  915   R  913
             R
Sbjct  712   R  712



>ref|XP_005650736.1| vacuolar protein sorting-associated protein 16 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26192.1| vacuolar protein sorting-associated protein 16 [Coccomyxa subellipsoidea 
C-169]
Length=859

 Score =   166 bits (419),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 100/288 (35%), Positives = 165/288 (57%), Gaps = 10/288 (3%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL  + +  P  +    + +RP  R LF +Y    + E L+   ++TG  + VA +
Sbjct  571   LVYLVLFRMQRTLPLQQFLAVLAARPAARSLFNAYCARTEPELLEQINMATGVYEGVAAM  630

Query  1080  LWKESWELAKNPMASKGSPLHGPR---------IKLVEKAHGLFAETKEHVFESKAAEEH  928
               +E+   +     ++ +     R         ++L+++A  L+A+TKEH F+S+AA E 
Sbjct  631   RVREALAASARLGRARAAAGGAGRAAEPAAAEVVRLLDRASDLYAQTKEHGFQSRAAAEW  690

Query  927   AKLLRIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVF  748
             A+L R+Q ELE  T  A  +  S++DT+R C+ LGNHRAA +++ +FKVSE+R++WLK+ 
Sbjct  691   ARLRRVQAELEAETGNAALLGLSLADTLRQCVRLGNHRAAARLRADFKVSERRFWWLKLK  750

Query  747   ALATIRDWDALEKFSKEKRPPIGYKPFVEACVE-AEDKGEALKYIPKLADPRERAEAYAG  571
              LA  +DW+ LE F++EK+ PIG +PFV A  +         + I +L D + +AE YA 
Sbjct  751   TLAAAKDWEGLESFAREKKSPIGIEPFVAAAKQHGAPDATVSRIIARLPDGKRKAEEYAA  810

Query  570   IGMakeaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQG  427
              G+ +EAA+ A++ +D ++L +L+      +        L+DRL   G
Sbjct  811   AGLLQEAAECAARVRDNDMLSKLQDMIGTVSPLGVAVSQLKDRLQSGG  858



>dbj|GAN01171.1| vacuolar protein sorting vps16 protein [Mucor ambiguus]
Length=820

 Score =   163 bits (412),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 137/232 (59%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVL H+ +K P  E F  I ++P+  +L   Y +    E LKDF+    +  D A +
Sbjct  557   LVYLVLFHLKRKLPLGEFFRMINNKPMACNLLEVYCKEQDTELLKDFYYQDDRRVDSANV  616

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             +  E +  A+  +A         RIK ++ A  +++E +E  FE+KA +E  KLL+ Q  
Sbjct  617   VLSEGF--AEMDIAE--------RIKKLKIAGKIYSEHREQAFEAKATDEAVKLLQFQLT  666

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE  T+Q+ F   S S+TI  C  LG H  A+K+KT+FKV +KR++W+K+ AL  +RDW+
Sbjct  667   LEKDTQQS-FTGLSTSETIYKCTTLGQHNKASKIKTDFKVPDKRFWWVKLRALVEVRDWE  725

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEK SK K+ PIGY+PFVE C++A    EA KYI K  DP  R   +  IG
Sbjct  726   NLEKLSKSKKSPIGYEPFVEECIKARQYQEASKYILK-CDPPVRPMLFVKIG  776



>gb|EPB85961.1| hypothetical protein HMPREF1544_07293 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=760

 Score =   160 bits (406),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 138/232 (59%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ H+ +K P  E F  I ++P+  +L   Y +    E LKDF+    +  D A +
Sbjct  522   LVYLVIFHLKRKLPLGEFFRMINNKPMACNLLEVYCKEQDTELLKDFYYQDDRRIDSANV  581

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             +  E +  A+  +A         RIK ++ A  ++++ +E  FE+KA +E  KLL++Q  
Sbjct  582   VLSEGF--AELDIAE--------RIKKLKIAGKIYSDHREQAFEAKAVDEAVKLLQLQLT  631

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE  T+Q+ F   S S+TI  C  LG H  A+K+KT+FK+ +KR++W+K+ AL  +RDW+
Sbjct  632   LEKDTQQS-FTGLSTSETIYKCTTLGQHNKASKIKTDFKIPDKRFWWVKLRALVEVRDWE  690

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEK SK K+ PIGY+PFVE C++A    EA KYI K  DP  R   +  IG
Sbjct  691   NLEKLSKSKKSPIGYEPFVEECIKARQYQEASKYILK-CDPPVRPMLFVKIG  741



>emb|CEP18375.1| hypothetical protein [Parasitella parasitica]
Length=820

 Score =   160 bits (404),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/233 (41%), Positives = 134/233 (58%), Gaps = 14/233 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ H+ +K P  E F  I ++ +  +L   Y +    E LKDF+    +  D A +
Sbjct  557   LVYLVIFHLKRKLPLGEFFRMINNKQMACNLLEVYCKEQDTELLKDFYYQDDRRIDSANV  616

Query  1080  LWKESW-ELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQH  904
             +  E + EL               RIK ++ A   ++E +EH FE+KA +E  KLL+ Q 
Sbjct  617   VLSEGFAELDVTE-----------RIKKLKIAGKTYSEHREHAFEAKAVDEAVKLLQFQL  665

Query  903   ELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDW  724
              LE  T+Q+ F   SIS+TI  C  LG H  A+K+KT+FKV +KR++W+K+ AL  +RDW
Sbjct  666   ALEKDTQQS-FTGLSISETIYKCTTLGQHNKASKIKTDFKVPDKRFWWVKLRALVEVRDW  724

Query  723   DALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             + LEK SK K+ PIGY+PFVE C+ A    EA KYI K  DP  R   +  IG
Sbjct  725   ENLEKLSKSKKSPIGYEPFVEECIRARQYQEASKYILK-CDPPVRPMLFVKIG  776



>emb|CEG71651.1| hypothetical protein RMATCC62417_07353 [Rhizopus microsporus]
Length=820

 Score =   159 bits (403),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 134/232 (58%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ H+ +K P  E F  I ++P+  +L   Y +    E LKDF+    +  D A  
Sbjct  557   LVYLVIFHLKRKLPLGEFFRVINNKPMACNLLEVYCKEQDTELLKDFYYQDDRRLDSANF  616

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             +  E +        +    L   RIK ++ A   + E +E  FE+KA +E  KLL+ Q  
Sbjct  617   MLLEGF--------NDSDILE--RIKKLKIAAKAYNEQREQTFEAKATDEAIKLLQYQLT  666

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE  T+Q+ F   S+S+TI  C  +G H  A+KVKT+FKV +KR++W+K+ AL  +RDWD
Sbjct  667   LEKDTQQS-FTGLSVSETIYKCTTIGQHNKASKVKTDFKVPDKRYWWVKLRALVEVRDWD  725

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEK +K ++ PIGY+PFVE C++A+   EA KYI K  DP  R   +  IG
Sbjct  726   NLEKLAKSRKSPIGYEPFVEECIKAKQYQEASKYILK-CDPPARPMLFIKIG  776



>ref|XP_002678979.1| predicted protein [Naegleria gruberi]
 gb|EFC46235.1| predicted protein [Naegleria gruberi]
Length=846

 Score =   154 bits (388),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 138/231 (60%), Gaps = 13/231 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRP--LPRDLFISYARLYKHEFLKDFFLSTGQLQDVA  1087
             LVYLVLLH+ +       F  I  +   + R+L ++Y +    +FLK FF +  + ++ A
Sbjct  583   LVYLVLLHMKKNMEVSSFFSVINEKGFRVARNLLVTYCKERDIDFLKIFFHALDKQEEAA  642

Query  1086  FLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQ  907
              +   ES+     P A K         KL+ +A  L+ + K++  +SK  EE  KLL++Q
Sbjct  643   AMNVFESFSFEGEPAAHK---------KLLLQAKELYNKKKDYQLDSKLCEEQVKLLQMQ  693

Query  906   HELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRD  727
              E +    + +F   S+S+TI  C++ GN + A KVK EF+VS+K+++WLK+ A + +  
Sbjct  694   REFDNALGRQLFTGLSVSETIYQCLLNGN-KQAKKVKKEFQVSDKKFWWLKIAAFSKLGK  752

Query  726   WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYA  574
             W+ +EKFSK K+ PIGY+PFVEAC++ ++  EA KYIPK+ DP E+ E Y 
Sbjct  753   WNKMEKFSK-KKSPIGYRPFVEACLQQKNTVEAHKYIPKVTDPWEKIELYV  802



>emb|CDH59927.1| vacuolar protein sorting vps16 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=785

 Score =   152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 131/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+  + +K P  E F  I ++PL   L   Y +    E LKDF+    +  D A  
Sbjct  522   LVYLVIFQLKRKLPLGEFFRVINNKPLACSLLEVYCKEQDKELLKDFYYQDDRRIDSANT  581

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             +  E +E     +AS        RI  ++ A   + + KE  FE+KA +E  KLL +Q +
Sbjct  582   ILSEGFE--HQEVAS--------RISELKVAAKTYQDDKECAFEAKATDEAVKLLHMQTQ  631

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE  T Q  F+  S+S+TI  C +LG    ++KVK+EFKV +KR++W+K+ AL  +RDW+
Sbjct  632   LEKDTHQP-FIGLSVSETIYKCTMLGQQSKSSKVKSEFKVPDKRYWWIKLRALVEVRDWE  690

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEK +K K  PIGY+PFVE C++A+   EA KYI K  D   R   +  IG
Sbjct  691   NLEKLAKTKNSPIGYEPFVEECIKAKQYQEASKYILK-CDTSVRPMLFVKIG  741



>emb|CDS07252.1| hypothetical protein LRAMOSA01201 [Absidia idahoensis var. thermophila]
Length=773

 Score =   151 bits (381),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 133/232 (57%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+  + +K P  E F  I ++PL   L   Y +    E LKDF+    +  D A  
Sbjct  510   LVYLVIFQLKRKLPLGEFFRVINNKPLACSLLEVYCKEQDKELLKDFYYQDDRRIDSANT  569

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             +  E +E  ++ +AS        RI  ++ A   + + KE  FE+KA +E  KLL +Q +
Sbjct  570   ILSEGFE--QHEVAS--------RISELKVAAKTYQDDKECAFEAKATDEAVKLLHMQTQ  619

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE  T Q  FV  S+S+TI  C +LG    ++KVK+EFKV +KR++W+K+ AL  ++DW+
Sbjct  620   LEKDTHQP-FVGLSVSETIYKCTMLGQQSKSSKVKSEFKVPDKRYWWIKLRALVEVQDWE  678

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEK +K K  PIGY+PFVE C++A+   EA KYI K  D   R   +  IG
Sbjct  679   NLEKLAKSKSSPIGYEPFVEECIKAKQYQEASKYILK-CDTAVRPMLFVKIG  729



>gb|ERZ97236.1| hypothetical protein GLOINDRAFT_334475 [Rhizophagus irregularis 
DAOM 181602]
Length=820

 Score =   148 bits (374),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 134/232 (58%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+LH+ +K P  E F  I ++P+  +LF  Y +    + L DF+    +  + A +
Sbjct  557   LVYLVMLHLKRKLPLPEFFRIINNKPMACNLFEVYCKQQDLKLLADFYYQDDRCVESANI  616

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++        K       ++K+  K+   + + KEH FE+KA +E+ +LL++Q +
Sbjct  617   TILESYK-------QKDLNERTNKLKIALKS---YQDDKEHAFEAKAVDENIRLLQVQAQ  666

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
              E    Q + V   +++T+  CI   N   ANK+K++FK+ +KR++W+K+ AL  +RDW 
Sbjct  667   FEKEMNQQL-VGLPLNETVHKCITTNNPNKANKLKSDFKIPDKRFWWIKLKALVEMRDWP  725

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LE+ SK K+ PIGY+PFVE C++A    EA+KYI K  DP  R   +  IG
Sbjct  726   ELERLSKSKKSPIGYEPFVEECIKAIQHKEAIKYITK-CDPAVRPGLFIKIG  776



>emb|CEG84393.1| hypothetical protein RMATCC62417_18202 [Rhizopus microsporus]
Length=213

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 117/203 (58%), Gaps = 12/203 (6%)
 Frame = -3

Query  1173  DLFISYARLYKHEFLKDFFLSTGQLQDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVE  994
             +L   Y +    E LKDF+    +  D A  +  E +        +    L   RIK ++
Sbjct  4     NLLEVYCKEQDTELLKDFYYQDDRRLDSANFMLLEGF--------NDSDILE--RIKKLK  53

Query  993   KAHGLFAETKEHVFESKAAEEHAKLLRIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHR  814
              A   ++E +E  FE+KA +E  KLL+ Q  LE  T+Q+ F   S+S+TI  C  LG H 
Sbjct  54    IAAKAYSEQREQTFEAKATDEAIKLLQYQLTLEKDTQQS-FTGLSVSETIYKCTTLGQHN  112

Query  813   AANKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKG  634
              A+KVKT+FKV +KR++W+K+ AL  +RDWD LEK +K ++ PIGY+PFVE C++A+   
Sbjct  113   KASKVKTDFKVPDKRFWWVKLRALVEVRDWDNLEKLAKSRKSPIGYEPFVEECIKAKQYQ  172

Query  633   EALKYIPKLADPRERAEAYAGIG  565
             EA KYI K  DP  R   +  IG
Sbjct  173   EASKYILK-CDPPARPMLFIKIG  194



>gb|KIM91586.1| hypothetical protein PILCRDRAFT_133551 [Piloderma croceum F 1598]
Length=845

 Score =   144 bits (363),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/237 (39%), Positives = 136/237 (57%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQ---SRPLPRD-LFISYARLYKHEFLKDFFLSTGQLQD  1093
             LVY VLLH+ ++ P  + F  I+   SR +P   L   YAR    E L+DF+ S  +  +
Sbjct  578   LVYHVLLHLHKRLPLGDFFRLIEDGGSRLVPASRLLQVYAREQNREMLRDFYYSDDRRVE  637

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L   E+  ++ +P A         +I  V+ A   F+E K+  FE+K  +E A+LL 
Sbjct  638   SAVLSLDEAARMS-DPNA---------KITSVKAAQKFFSEDKDRPFEAKMMDESARLLT  687

Query  912   IQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
             +Q +LE  T   I F   S+S+TIRTC++ G  R A+K+K+EFKV +KR++++K+ AL  
Sbjct  688   VQQQLEKETDGKITFFGLSVSETIRTCLLNGMSRRADKIKSEFKVPDKRFWYIKLQALTA  747

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             IRD+D L+ F+K KR PIGY+PFV   VE     EA  Y+ +  D  +R + Y   G
Sbjct  748   IRDFDGLDTFAKSKRSPIGYQPFVHHLVEKGYSKEAAGYVVR-CDANQRVDLYVECG  803



>gb|KDQ31847.1| hypothetical protein PLEOSDRAFT_48878 [Pleurotus ostreatus PC15]
Length=846

 Score =   143 bits (361),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/237 (38%), Positives = 132/237 (56%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSR----PLPRDLFISYARLYKHEFLKDFFLSTGQLQD  1093
             LVY VLLH++ + P    F  I+       L   L   YAR    E L+DF+ S  +  +
Sbjct  579   LVYHVLLHLYNRLPLGTFFRLIEDGGERLTLASRLLQVYAREQNREMLRDFYYSDDRRVE  638

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L  +ES ++  +P +         +I  V+ A   F+E K+  FE+K  +E  +LL 
Sbjct  639   SAVLSLEESIQIL-DPAS---------KINAVKAAQKFFSEDKDRAFEAKMMDESVRLLN  688

Query  912   IQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
             +Q +LE  T   I F   S++DTI TC+V G  + A+KVK++FKV +KR+++LK++AL +
Sbjct  689   LQMQLEQETDGKITFSGLSVNDTIHTCLVNGMAKRADKVKSDFKVPDKRFWYLKLYALTS  748

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              RD++ LE F+K KR PIGY+PFV   VE     EA  Y+ +   PR R + Y   G
Sbjct  749   TRDFEGLEAFTKSKRSPIGYEPFVNHLVEKGFSKEAATYVSRCDSPR-RPDLYVKCG  804



>ref|XP_004340672.1| vacuolar protein sorting 16, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR18630.1| vacuolar protein sorting 16, putative [Acanthamoeba castellanii 
str. Neff]
Length=861

 Score =   142 bits (358),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 130/236 (55%), Gaps = 19/236 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLVLLHI + R   + F  I+SR    DL ++Y +    + LKD +   G     A +
Sbjct  585   LVYLVLLHIRRSRSGADFFKIIRSRKGAVDLLVAYCKQQDLDLLKDIYYQAGMPNQSAHV  644

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                E+++ A+             R++ ++ A  L+ +T + +F SKA E   +LL +Q E
Sbjct  645   AVIEAYQHAELE----------KRVRGLQIALNLYKDTGD-LFASKATETEIRLLLVQKE  693

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFK--------VSEKRWYWLKVFA  745
             LE  T +  FV  S++DT+   I   N + A K+K++FK        V +KR++W+ V A
Sbjct  694   LESETGERDFVGGSLTDTLFRLIASRNLKRAQKIKSDFKARWLLRVKVPDKRFWWVAVRA  753

Query  744   LATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAY  577
             L+T RDW  LE+F+K K+ PIG++PF E C+E     EA KYI  L+D  ER + +
Sbjct  754   LSTARDWATLEQFAKSKKSPIGFRPFAEVCIEQGAMDEAAKYIAMLSDSAERVQMF  809



>ref|XP_004367009.1| hypothetical protein DFA_07142 [Dictyostelium fasciculatum]
 gb|EGG20026.1| hypothetical protein DFA_07142 [Dictyostelium fasciculatum]
Length=835

 Score =   142 bits (358),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 159/277 (57%), Gaps = 11/277 (4%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQ-SRPLPRDLFISYARLYKHE-FLKDFFLSTGQLQDVA  1087
             LVYLVLL + ++    + F  I  SRP+  DL IS+ +       LK  +   GQ+++  
Sbjct  567   LVYLVLLELKRQSGLTDGFLEIVFSRPVALDLLISFCKQKGDVVMLKKIYSIRGQVKETG  626

Query  1086  FLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQ  907
              L   E++   +  +  K   + G             ++ K+ +  +K  E+ AKL  +Q
Sbjct  627   HLHLSEAFSTDEFDIRHKHLAMAGSAYSQ--------SKDKDDLVYAKLCEDQAKLELLQ  678

Query  906   HELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRD  727
              ELE   +   F+  S+SDTI   I+LG H+  +K+K+EFKVS++R++W+K+ AL+ + D
Sbjct  679   KELENQHEGKEFLGISLSDTIYQLILLGEHKRVSKIKSEFKVSDRRFWWIKIKALSQVGD  738

Query  726   WDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaa  547
             W+ L  F+KEK+ P+GY+PFVE C++  +  EAL+YIPK+ D   RA+AY  I   +EAA
Sbjct  739   WEELHNFAKEKKSPVGYEPFVEVCMDFSNPVEALRYIPKIQDHVNRAQAYLQINYFREAA  798

Query  546   daasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLT  436
             + A + K+ +LL  +    + N  A++I D +R +L+
Sbjct  799   ETAFKEKNLDLLNFIARKCT-NPEASNIIDQMRAQLS  834



>gb|KIP07308.1| hypothetical protein PHLGIDRAFT_426170 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=845

 Score =   140 bits (354),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/237 (35%), Positives = 134/237 (57%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQ----SRPLPRDLFISYARLYKHEFLKDFFLSTGQLQD  1093
             LVY VLLH+ ++ P    F  I+    +  L   L   YAR    E L+DF+ S  +  D
Sbjct  578   LVYHVLLHLHKRLPLGSFFRLIEEGGPALALASKLLQVYARAQNREMLRDFYYSDDRRVD  637

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L   E+  ++ +P+A         +   V+ A   F+E KE  FE+K  +E+ +LL 
Sbjct  638   SAVLCLNEAATMS-DPVA---------KTNEVKAAQKFFSEDKERTFEAKMVDENVRLLT  687

Query  912   IQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
             +Q +LE      I F   S+++T+RTC++ G  + A+K++++FKV +KR+++LK+ AL  
Sbjct  688   LQQQLEKEADGKISFFGLSVNETLRTCLINGMGKRADKIRSDFKVPDKRYWYLKLHALTE  747

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             + DW++L+ F++ KR PIGY+ FV+  VE     EA+ Y+P+  D  +R + Y   G
Sbjct  748   VHDWESLDTFARSKRSPIGYQAFVQHLVEKGHTREAISYVPR-CDSNKRVDLYVLCG  803



>emb|CEI87038.1| hypothetical protein RMCBS344292_01458 [Rhizopus microsporus]
Length=733

 Score =   138 bits (348),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 124/232 (53%), Gaps = 25/232 (11%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ H+ +K P  E F  I ++P+  +L   Y +    E LKDF+    +  D A  
Sbjct  508   LVYLVIFHLKRKLPLGEFFRVINNKPMACNLLEVYCKEQDTELLKDFYYQDDRRLDSANF  567

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             +  E +        +    L   RIK ++ A   + E +E  FE+KA +E  KLL+ Q  
Sbjct  568   MLLEGF--------NDSDILE--RIKKLKIAAKAYNEQREQTFEAKATDEAIKLLQYQLT  617

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE  T+Q+ F   S+S+TI  C  LG H  A+KVKT+FKV +KR             DWD
Sbjct  618   LEKDTQQS-FTGLSVSETIYKCTTLGQHNKASKVKTDFKVPDKR-------------DWD  663

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEK +K ++ PIGY+PFVE C++A+   EA KYI K  DP  R   +  IG
Sbjct  664   NLEKLAKSRKSPIGYEPFVEECIKAKQYQEASKYILK-CDPPARPMLFIKIG  714



>ref|XP_009550055.1| hypothetical protein HETIRDRAFT_325388 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW78052.1| hypothetical protein HETIRDRAFT_325388 [Heterobasidion irregulare 
TC 32-1]
Length=846

 Score =   139 bits (349),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 85/237 (36%), Positives = 136/237 (57%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQ---SR-PLPRDLFISYARLYKHEFLKDFFLSTGQLQD  1093
             LVY VLLH++ + P    F  I+   SR      L   YAR    E L+DF+ S  +  +
Sbjct  579   LVYHVLLHLYNRLPLGNFFRLIEDGGSRLASASKLLQVYAREQNREMLRDFYFSDDRRVE  638

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A LL +E+  + ++P A         ++  V+ AH  F+E KE  FE+K+ +E+++LL 
Sbjct  639   SAVLLLEEAARM-QDPSA---------KVTAVKAAHKFFSEDKERAFEAKSMDEYSRLLT  688

Query  912   IQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
             +Q +LE  T   I F   S+++T+RTC+V G  + A+K++++FKV +KR++ LK+ AL +
Sbjct  689   VQQQLEKETDDKIPFFGLSVNETLRTCLVNGMSKRADKIRSDFKVPDKRFWHLKLHALVS  748

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              RD++ LE F++ +R PIGY+ FV   VE     EA  Y+ +   P+ R + Y   G
Sbjct  749   TRDFEGLEAFARSRRSPIGYEAFVRHLVEKGHAKEAASYVTRCDAPK-RVDLYVECG  804



>gb|EIE83259.1| hypothetical protein RO3G_07964 [Rhizopus delemar RA 99-880]
Length=644

 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 111/196 (57%), Gaps = 11/196 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVYLV+ H+ +K P  E F  I ++P+  DL   Y +    E LKDF+    +  D A  
Sbjct  414   LVYLVIFHLKRKLPLGEFFRVINNKPMACDLLEVYCKEQDTELLKDFYYQDDRRLDSANF  473

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             +  E +                 RIK ++ A+  + E +E  FE+KA +E  KLL+ Q  
Sbjct  474   MLLEGF----------NDKDITERIKKLKIANKAYNEQREQAFEAKAVDEAIKLLQYQTT  523

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE  T+Q+ F   S+S+TI  C  LG H  A KVKT+FKV +KR++W+K+ AL  +RDW+
Sbjct  524   LEKDTQQS-FTGLSVSETIYKCTTLGQHNKATKVKTDFKVPDKRFWWIKLRALVEVRDWE  582

Query  720   ALEKFSKEKRPPIGYK  673
              LEK +K KR PIGY+
Sbjct  583   NLEKLAKSKRSPIGYE  598



>ref|XP_007301979.1| vacuolar assembling/sorting protein VPS16 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM89070.1| vacuolar assembling/sorting protein VPS16 [Stereum hirsutum FP-91666 
SS1]
Length=846

 Score =   137 bits (346),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 134/237 (57%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQ---SRPLPRD-LFISYARLYKHEFLKDFFLSTGQLQD  1093
             LVY VLLH++ + P    F  I+   S+  P   L   YAR    E L+DF+ S  +  +
Sbjct  579   LVYHVLLHLYNRLPLGTFFRLIEDGGSKLAPASKLLQVYAREQNREMLRDFYYSDDRRVE  638

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L   E+  + ++P +         ++  V+ A   F+E KE  FE+K+ +E+++LL 
Sbjct  639   SAVLCLDEASRM-QDPAS---------KMTSVKAAQKFFSEDKERTFEAKSMDEYSRLLT  688

Query  912   IQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
             +Q +LE  T   I F   SI++TIR C+V G  + A+KVK++FKV +KR+++LK+ AL +
Sbjct  689   LQQQLEKETDNKIPFFGVSINETIRICLVNGMSKRADKVKSDFKVPDKRFWYLKLHALTS  748

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              RD++ LE FSK KR PIGY+ FV   VE     EA  Y+ +   P+ R + Y   G
Sbjct  749   TRDFEGLEAFSKSKRSPIGYEAFVRHLVEKGFPKEAATYVARCDAPK-RVDLYVECG  804



>ref|XP_004345413.1| vacuolar assembling/sorting protein VPS16 [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE95370.1| vacuolar assembling/sorting protein VPS16 [Capsaspora owczarzaki 
ATCC 30864]
Length=835

 Score =   137 bits (345),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/232 (35%), Positives = 132/232 (57%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V++ + QK    +    +QS+P   DLF +YA+      L++ +++     ++A++
Sbjct  570   LVYFVIMRLKQKMEEYDFLRFMQSKPAALDLFATYAKQQDPALLRNLYITDDGKVELAYM  629

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                          A K + L   R  +++ A   FA +KE  F ++A  E  +L ++Q+E
Sbjct  630   ---------DAAAAYKCTGLQ-ERFTVLKSAVEPFAASKEPPFVARAISEQMELYKLQNE  679

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE  +K   + D S+SDTI  C+  G  + A+ V++ FKV ++R++W+K+ A A   +W 
Sbjct  680   LEQVSK-VPWADLSVSDTIYKCLTSGYPKKASDVQSLFKVPDRRFWWIKIRATADTGNWI  738

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKF+K K+ PIGY PF++ C+E  + GEA KYI +LA P ER  AY  +G
Sbjct  739   ELEKFAKSKKSPIGYGPFIDVCMEKGNPGEAKKYIDRLA-PEERVAAYIRVG  789



>gb|EPS95124.1| hypothetical protein FOMPIDRAFT_1043679 [Fomitopsis pinicola 
FP-58527 SS1]
Length=844

 Score =   137 bits (344),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 134/234 (57%), Gaps = 18/234 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELF-----GTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVY VLL++ ++ P    F     G  +  P  R L   YAR    + L+DF+ S  +  
Sbjct  577   LVYHVLLYLQRRLPLGSFFRLLEEGGSKLAPASR-LLQVYAREQNRDMLRDFYYSDDRRV  635

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             + A L  +E+  + ++P +         +I  V+ A   F+E KE  FE+K A+E+A+LL
Sbjct  636   ESAVLCLEEAAAM-QDPTS---------KINSVKAAQKFFSEDKERGFEAKMADEYARLL  685

Query  915   RIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALA  739
               Q +LE      I F   SI++TIRTC++ G  + A+K+K +FKV +KR++++K+ AL 
Sbjct  686   AAQQQLEKEADGKISFFGQSINETIRTCLINGMAKRADKLKADFKVPDKRFWYVKLHALT  745

Query  738   TIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAY  577
               RD+D L+ F++ KR PIGY+PFV   VE + K EA  ++P+  D  +R + Y
Sbjct  746   ATRDFDGLDTFARSKRSPIGYEPFVRHLVEKDHKKEAATFVPR-CDAHKRVDLY  798



>ref|XP_007850547.1| vacuolar protein sorting vps16 [Moniliophthora roreri MCA 2997]
 gb|ESK90169.1| vacuolar protein sorting vps16 [Moniliophthora roreri MCA 2997]
Length=846

 Score =   136 bits (342),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 120/199 (60%), Gaps = 12/199 (6%)
 Frame = -3

Query  1170  LFISYARLYKHEFLKDFFLSTGQLQDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEK  991
             L   YAR    + L+DF+ S  +  + A L   E+  ++ +P +         +I  ++ 
Sbjct  613   LLQVYAREQNRDMLRDFYYSDDRRVESAVLALDEASRMS-DPAS---------KIAAIKS  662

Query  990   AHGLFAETKEHVFESKAAEEHAKLLRIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHR  814
             AH  F+E K+  FE+K  +E A+LL  Q +LE      I F   S+++TIRTCI+ G  +
Sbjct  663   AHKFFSEDKDRAFEAKMVDESARLLTTQQQLEAEADGKITFFGLSVNETIRTCIINGMMK  722

Query  813   AANKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKG  634
              A+K+K++FKV +KR++++K+FAL  IRD++ L+ FSK KR PIGY+PFV   VE +   
Sbjct  723   RADKLKSDFKVPDKRFWYIKLFALTEIRDFEGLDAFSKSKRSPIGYEPFVRHLVEKKHVK  782

Query  633   EALKYIPKLADPRERAEAY  577
             EA+ Y+ +  DP +RA+ Y
Sbjct  783   EAIPYVAR-CDPPKRADLY  800



>ref|XP_002591465.1| hypothetical protein BRAFLDRAFT_105238 [Branchiostoma floridae]
 gb|EEN47476.1| hypothetical protein BRAFLDRAFT_105238 [Branchiostoma floridae]
Length=795

 Score =   136 bits (342),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 131/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V++H+ +K    +   TI++ P  + L++ Y +    E L+D +      Q+ A  
Sbjct  530   LVYTVVMHLKEKLTLGDFLMTIRNLPTAQSLYLQYCKEQNREMLQDLYYQEDNFQESANC  589

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                +S+   +             R++ +++A   + + +   F +K  EE  +LL+ Q  
Sbjct  590   RVMDSYNETR----------MDERLRALQQAQEAYTKARNE-FAAKVTEEQVRLLKYQMR  638

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE   K+  ++D S+ DTI      GNH+ A +++ EFKV +KR++WLK+ ALA   DW 
Sbjct  639   LEEELKRP-YLDLSLHDTISQLTTEGNHKLAEQLRKEFKVPDKRFWWLKIQALAEGSDWA  697

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              L++F+K K+ PIGY+PF++ C++ +++ EA KY+ ++ADP  + +AY  IG
Sbjct  698   ELDRFAKSKKSPIGYEPFIDVCLKHQNRYEANKYVGRIADP-AKVKAYIKIG  748



>gb|EMD35361.1| hypothetical protein CERSUDRAFT_66538 [Ceriporiopsis subvermispora 
B]
Length=846

 Score =   136 bits (342),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 134/237 (57%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRP----LPRDLFISYARLYKHEFLKDFFLSTGQLQD  1093
             LVY VLLH+ ++ P    F TI+       L   L   YAR    + L+DF+ S  +  +
Sbjct  579   LVYHVLLHLQKRLPLGTFFRTIEEGGPQLGLASKLLQVYAREQNRDMLRDFYYSDDRRVE  638

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L  +E+  +  +P A         ++  V+ A   F+E KE  FE+K A+E A+LL 
Sbjct  639   SAVLCLEEARTML-DPSA---------KVTAVKAAQKFFSEDKERGFEAKMADESARLLA  688

Query  912   IQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
             +Q +LE      + F   S+S+TIRTC+V G  + A+KVK++FKV +KR++++K+ AL +
Sbjct  689   LQQQLEKEADGKVSFFGQSVSETIRTCLVNGMSKRADKVKSDFKVPDKRFWYIKLQALTS  748

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             +RD++ L+ F++ KR PIGY+ FV   V+     EA+ Y+ +  D  +R + Y   G
Sbjct  749   VRDFEGLDAFARSKRSPIGYEAFVRHLVDKGHPSEAVSYVAR-CDAHKRVDLYVLCG  804



>ref|XP_003030158.1| hypothetical protein SCHCODRAFT_69044 [Schizophyllum commune 
H4-8]
 gb|EFI95255.1| hypothetical protein SCHCODRAFT_69044 [Schizophyllum commune 
H4-8]
Length=848

 Score =   135 bits (341),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 80/237 (34%), Positives = 134/237 (57%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSR----PLPRDLFISYARLYKHEFLKDFFLSTGQLQD  1093
             LVY VLLH+ ++ P    F  I+       L   L   YAR    E L+DF+ S  +  +
Sbjct  581   LVYQVLLHLHKRLPLGTFFRLIEDGGPKLALASRLLQVYAREQDKEMLRDFYYSDDRRVE  640

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L  +E+  + ++P +         +I  V+ A   F+E K+  FE+K  +E  +L+ 
Sbjct  641   SAVLSLEEAATM-QDPES---------KITAVKAAQKFFSEDKDRAFEAKMMDESVRLMT  690

Query  912   IQHELEVTTK-QAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
             +Q +LE  T  +  F   ++++TIR C+  G  + A+K+K++FKV +KR+++ K++AL +
Sbjct  691   LQQQLEKETDGRVTFFGLTVNETIRACLTNGLSKRADKIKSDFKVPDKRFWYTKLYALTS  750

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             +RDW+AL+ F+K KR PIGY+PFV   +E     +A+ Y+ +   P+ RA+ Y   G
Sbjct  751   VRDWEALDTFAKSKRSPIGYEPFVRHLIEKGHPTQAVPYVARCDSPK-RADLYVECG  806



>ref|XP_002598771.1| hypothetical protein BRAFLDRAFT_212848 [Branchiostoma floridae]
 gb|EEN54783.1| hypothetical protein BRAFLDRAFT_212848 [Branchiostoma floridae]
Length=761

 Score =   134 bits (337),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/231 (32%), Positives = 130/231 (56%), Gaps = 13/231 (6%)
 Frame = -3

Query  1257  VYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFLL  1078
             VY V++H+ +K    +   TI++ P  + L++ Y +    E L+D +      Q+ A   
Sbjct  497   VYTVVMHLKEKLTLGDFLMTIRNLPTAQSLYLQYCKEQNREMLQDLYYQEDNFQESANCR  556

Query  1077  WKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHEL  898
               +S+   +             R++ +++A   + + +   F +K  EE  +LL+ Q  L
Sbjct  557   VMDSYNETR----------MDERLRALQQAQEAYTKARNE-FAAKVTEEQVRLLKYQMRL  605

Query  897   EVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWDA  718
             E   K+  ++D S+ DTI      GNH+ A +++ EFKV +KR++WLK+ ALA   DW  
Sbjct  606   EEELKRP-YLDLSLHDTISQLTTEGNHKLAEQLRKEFKVPDKRFWWLKIQALAEGSDWAE  664

Query  717   LEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             L++F+K K+ PIGY+PF++ C++ +++ EA KY+ ++ADP  + +AY  IG
Sbjct  665   LDRFAKSKKSPIGYEPFIDVCLKHQNRYEANKYVGRIADP-AKVKAYIKIG  714



>gb|KIK56666.1| hypothetical protein GYMLUDRAFT_230051 [Gymnopus luxurians FD-317 
M1]
Length=846

 Score =   134 bits (337),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 118/196 (60%), Gaps = 12/196 (6%)
 Frame = -3

Query  1158  YARLYKHEFLKDFFLSTGQLQDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGL  979
             YAR    + L+DF+ S  +  + A L   E+  +  +P A         RI  V+ +   
Sbjct  617   YAREQDRDMLRDFYYSDDRRVESAVLALDEASRMV-DPSA---------RISAVKSSQKF  666

Query  978   FAETKEHVFESKAAEEHAKLLRIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANK  802
             F+E K+ VFE+K  +E+++LL +Q +LE      I F   S+++TI TCIV G  + A+K
Sbjct  667   FSEDKDRVFEAKMMDEYSRLLSLQQQLEAEADGKIPFFGQSVNETIHTCIVNGMVKRADK  726

Query  801   VKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALK  622
             +K++FKV +KR+++ K++AL  IRD++ L+ F+K KR PIGY+PFV   VE     EA+ 
Sbjct  727   IKSDFKVPDKRFWYTKLYALTEIRDFEGLDAFAKSKRSPIGYEPFVRHLVEKGHNKEAVP  786

Query  621   YIPKLADPRERAEAYA  574
             Y+ +  DP +RA+ YA
Sbjct  787   YVAR-CDPPKRADLYA  801



>ref|XP_646623.2| hypothetical protein DDB_G0270754 [Dictyostelium discoideum AX4]
 sp|Q55C58.2|VPS16_DICDI RecName: Full=Vacuolar protein sorting-associated protein 16 
homolog [Dictyostelium discoideum]
 gb|EAL72727.2| hypothetical protein DDB_G0270754 [Dictyostelium discoideum AX4]
Length=832

 Score =   133 bits (334),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 84/236 (36%), Positives = 135/236 (57%), Gaps = 13/236 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEF--LKDFFLSTGQLQDVA  1087
             LVYLVLL + +  P  +      S+ +  DL IS  +  K++F  L++ +    Q +++ 
Sbjct  563   LVYLVLLAMQRSLPLADFLELTFSKVVALDLLISMCK-QKNDFPLLREIYHIKDQSKEMG  621

Query  1086  FLLWKESWELAKNPMASKGSPLHGPRIKLVEKA--HGLFAETKEHVFESKAAEEHAKLLR  913
              +  +E+       ++S  S L   RIK   K+  H   ++ K+    SK  ++  KL  
Sbjct  622   NIYLQEA-------LSSHPSQLDQ-RIKAYNKSIEHYHHSKDKDDQATSKFIDDQIKLEM  673

Query  912   IQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATI  733
             +Q ELE   +   FV  SI+DTI   I +   + A  +++EFKV +KR++W+K+ AL+ +
Sbjct  674   LQKELETNLQDESFVGISINDTIYKLITMNQPKKAQSIRSEFKVPDKRFWWIKIKALSIM  733

Query  732   RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              DW+ L KFSKEK+ PIGY+PFVE C++ +++ EALKYIPK+ D   + + Y  IG
Sbjct  734   NDWEELMKFSKEKKSPIGYEPFVEVCLDQKNQIEALKYIPKITDILPKIQFYIQIG  789



>gb|KIK00029.1| hypothetical protein K443DRAFT_101182 [Laccaria amethystina LaAM-08-1]
Length=846

 Score =   132 bits (333),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 89/237 (38%), Positives = 131/237 (55%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQS---RPLPRD-LFISYARLYKHEFLKDFFLSTGQLQD  1093
             LVY VLLH+ ++ P    F  I+    R  P   L   YAR    E L+DF+ S  +  +
Sbjct  579   LVYHVLLHLHKRLPLGSFFRLIEDGGERLSPASKLLEVYAREQNREMLRDFYYSDDRRVE  638

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L  +E+ ++  NP +         +I  V+ A   F+E K+H FE+K  EE A+LL 
Sbjct  639   SAVLSLEEASKM-NNPAS---------KISSVKAAQKFFSEDKDHTFEAKMMEESARLLT  688

Query  912   IQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
              Q +L+  T   I F  SS+++TIR C+V    + A+K+K++FKV +KR++ +K+ AL  
Sbjct  689   TQQQLDSETDGKIAFFGSSVNETIRLCLVNNMAKRADKIKSDFKVPDKRFWHIKLKALTE  748

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              + +  LE FSK KR PIGY+PFV   VE     EA+ YI +   P+ RA+ Y   G
Sbjct  749   AKAFGELETFSKSKRSPIGYEPFVRHLVEKGHPKEAVVYIARCDSPK-RADLYVECG  804



>gb|KFH65750.1| hypothetical protein MVEG_07854 [Mortierella verticillata NRRL 
6337]
Length=820

 Score =   132 bits (333),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 88/238 (37%), Positives = 125/238 (53%), Gaps = 18/238 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+L++ +K    + F  I ++PL   L  SY +    E LK+F+    +  D A L
Sbjct  556   LVYHVILYLKRKNDPGDFFRIINNKPLACHLLESYCKQQDPELLKNFYYQDDRSGDNANL  615

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++                R K ++ +  L+ E KEH FE+KA EE  KLL+ Q +
Sbjct  616   SLIESFQQKD----------LTERTKRLKTSLKLYQENKEHAFEAKAIEESLKLLQAQVQ  665

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE    Q  F   S+S T+   I +     A KV+ +F++ +KR++W+K+ AL  IRDWD
Sbjct  666   LEKDCNQP-FTGLSLSSTVYKLITINQGSRATKVRNDFQMPDKRFWWIKLRALVEIRDWD  724

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERA------EAYAGIG  565
              +   +K K+ PIGY+PFVE CV+A    EA KYI K  D   RA      EAY   G
Sbjct  725   GVATLAKSKKSPIGYEPFVEECVKAMQYREAAKYILK-CDAHLRAGLFLKIEAYQEAG  781



>ref|XP_007869321.1| vacuolar assembling/sorting protein VPS16 [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ52133.1| vacuolar assembling/sorting protein VPS16 [Gloeophyllum trabeum 
ATCC 11539]
Length=846

 Score =   132 bits (332),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/239 (36%), Positives = 133/239 (56%), Gaps = 20/239 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELF------GTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQL  1099
             LVY VLLH+ QK  +L  F      G  Q  P  R L   YAR    + L+DF+ S  + 
Sbjct  579   LVYHVLLHL-QKSMSLGSFFRLLEDGGEQLAPATR-LLQVYAREQNRDMLRDFYYSDDRR  636

Query  1098  QDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKL  919
              + A LL +E+  +  +P A         +I  V+ A   F+E KE  FE+K  +E  +L
Sbjct  637   VESAVLLLEEASNMT-DPTA---------KINTVKAAQKFFSEDKERGFEAKMMDESVRL  686

Query  918   LRIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFAL  742
             L  Q +LE      I F   S+++TIRTC++ G  + A+K+K++FKV +KR++++K++AL
Sbjct  687   LTAQQQLEKDADGKIPFFGLSVNETIRTCLLNGMSKKADKIKSDFKVPDKRFWYIKLYAL  746

Query  741   ATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
               +RD++ L+ F+K KR PIGY+ FV   VE   + EA  Y+ +  D  +R + Y   G
Sbjct  747   TAMRDFEGLDAFAKSKRSPIGYEAFVRHLVEKGHQKEAAGYVAR-CDASKRVDLYVQCG  804



>emb|CCX31232.1| Similar to Probable vacuolar protein sorting-associated protein 
16 homolog; acc. no. Q9UT38 [Pyronema omphalodes CBS 100304]
Length=833

 Score =   131 bits (330),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 128/235 (54%), Gaps = 13/235 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+ +K P    F  I  RP    L  S AR    E LKDF+    +  D A +
Sbjct  567   LVFFVLLHLKKKHPLANFFRIINDRPFAAALVESSARETDLELLKDFYYQDDRRADGAHV  626

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             + +ES       M +K   L   ++K+  K   L +++K+HV E+KA +E AKLL +Q  
Sbjct  627   ILRES-------MEAKDLQLKLEKLKVATK---LLSDSKDHVLEAKALDESAKLLHMQET  676

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
              E    +  F+  S++DTI   I  G    A KVK EF+V EKR++WL++ AL   RDW+
Sbjct  677   FERELNER-FMGISVNDTIFRLIRTGYSSRALKVKNEFRVPEKRYWWLRLRALVAKRDWN  735

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADP--RERAEAYAGIGM  562
              +E++ K K+ P+G++PF   C+ A +   A  ++ K ++   +ER + Y   G+
Sbjct  736   EIEEWGKTKKSPVGWEPFFNECLAAGNTKVAAGFVGKCSNLGYKERLDMYMRCGL  790



>ref|XP_007393336.1| hypothetical protein PHACADRAFT_193129 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM58005.1| hypothetical protein PHACADRAFT_193129 [Phanerochaete carnosa 
HHB-10118-sp]
Length=846

 Score =   130 bits (328),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/237 (35%), Positives = 130/237 (55%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQ----SRPLPRDLFISYARLYKHEFLKDFFLSTGQLQD  1093
             LVY VLLH+ ++ P  + F  I+    S  L   L   YA+    E L+DF+ S  +  D
Sbjct  579   LVYHVLLHLQRRLPLGDFFRLIEEGGPSLALASKLLQVYAKAQDREMLRDFYYSDDRRVD  638

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L   E+  +  +P+A         +I  V+ A   F+E KE  FE+K  +E  +LL 
Sbjct  639   SAVLSLSEAVTMT-DPVA---------KINAVKAAQKFFSEDKERSFEAKMTDETVRLLT  688

Query  912   IQHELEVTTK-QAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
              Q +LE     + +F   S+++TIRTC+V G  + A+K K++FKV +KR++++K+ AL  
Sbjct  689   FQQQLEKEADGRIVFFGLSVNETIRTCLVNGMGKRADKTKSDFKVPDKRFWYIKLHALTE  748

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             I D++ L+ F++ +R PIGY+ FV   VE     EA+ Y+ +  D  +R + Y   G
Sbjct  749   IHDFEGLDGFARSRRSPIGYEAFVRHLVEKGHTREAIPYVAR-CDSNKRVDLYVLCG  804



>gb|KDR80313.1| hypothetical protein GALMADRAFT_62817 [Galerina marginata CBS 
339.88]
Length=845

 Score =   130 bits (328),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 129/238 (54%), Gaps = 18/238 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQS-----RPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVY VLLH+ ++ P    F  ++       P  + L   YAR    E L+DF+ S  +  
Sbjct  578   LVYHVLLHLHKRLPLGSFFRLLEDGGKTLSPASK-LLEVYAREQNREMLRDFYYSDDRRV  636

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             + A L   ES  +               ++  V+ A   F+E KE  FE+K  +E+A+LL
Sbjct  637   ESAVLSLDESSRMLD----------QASKVSAVKTAQKFFSEDKERSFEAKVTDEYARLL  686

Query  915   RIQHELEV-TTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALA  739
               Q +LE  T  +  F   S+S+TIR C++    + A+K+K++FKVS+KR+ ++K++AL 
Sbjct  687   AFQQQLENETGGKTNFFGLSLSETIRVCLLNDLAKRADKIKSDFKVSDKRFSYIKLYALT  746

Query  738   TIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
               RD+  LE F++ KR PIGY+ FV   VE   + EA+ Y+ K  DP +RA+ Y   G
Sbjct  747   EARDFQGLEDFARSKRSPIGYEVFVRHLVEKGHQKEAITYVAK-CDPPKRADLYILCG  803



>emb|CCL98206.1| predicted protein [Fibroporia radiculosa]
Length=895

 Score =   130 bits (326),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 81/234 (35%), Positives = 131/234 (56%), Gaps = 18/234 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELF-----GTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVY VLLH+ ++ P    F     G  +  P  + L   YAR    E L+DF+ S  +  
Sbjct  580   LVYHVLLHLQRRLPLGSFFRLLEEGGNKLAPASK-LLQVYAREQNREMLRDFYYSDDRRV  638

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             + A L   E++ +  +P +         RI  ++ A   F+E KE  FE+K  +E+++LL
Sbjct  639   ESAVLCLDEAFTMM-DPSS---------RIASIKSAQKFFSEDKERGFEAKMMDEYSRLL  688

Query  915   RIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALA  739
               Q +LE      + F   S++DTIRTC+V G  + A+K+KT+FKV +KR++++K+ AL 
Sbjct  689   TTQQQLEKEADGKLSFFGLSVNDTIRTCLVNGMAKRADKLKTDFKVPDKRFWYIKLQALT  748

Query  738   TIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAY  577
             ++RD++ L+ F++ KR PIGY+ FV    +     EA  Y+P+  D  +R + Y
Sbjct  749   SVRDFEGLDTFARSKRSPIGYEAFVRHLADKGHMKEAASYVPR-CDAHKRVDLY  801



>gb|KIK92586.1| hypothetical protein PAXRUDRAFT_146989 [Paxillus rubicundulus 
Ve08.2h10]
Length=841

 Score =   130 bits (326),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 126/234 (54%), Gaps = 18/234 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQS-----RPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVY VLLH+ ++ P    F  I+       P  R L   YAR    E L+DF+ S  +  
Sbjct  574   LVYHVLLHLHKRLPLGSFFRLIEDGGERLAPASR-LLQVYAREQNREMLRDFYYSDDRRV  632

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             + A L  +E+  +                +  V+ A   F+E K+  FE+K  +E A+LL
Sbjct  633   ESASLALEEASRMTDQAAV----------VTSVKAAEKFFSEDKDRSFEAKMMDESARLL  682

Query  915   RIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALA  739
              IQ +LE  +   + F   S+S+T+  C+V G  + A+KVK EFKV +KR++++K+ AL 
Sbjct  683   TIQQQLEKDSDGKVKFFGQSVSETVHICLVNGMGKRADKVKAEFKVPDKRFWYIKLHALT  742

Query  738   TIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAY  577
              IRD+ +LE F++ KR PIGY+ FV+  VEA    EA  Y+ +   PR R E Y
Sbjct  743   AIRDFVSLEAFARSKRSPIGYEAFVQHLVEAGHPKEASTYVVRCDAPR-RVELY  795



>ref|XP_003287306.1| hypothetical protein DICPUDRAFT_32286 [Dictyostelium purpureum]
 gb|EGC36173.1| hypothetical protein DICPUDRAFT_32286 [Dictyostelium purpureum]
Length=831

 Score =   129 bits (324),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/235 (36%), Positives = 133/235 (57%), Gaps = 14/235 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKH-EFLKDFFLSTGQLQDVAF  1084
             LVYLVLL + +            S+ +  DL I+  +       L++ +   GQ+++++ 
Sbjct  565   LVYLVLLSMKRNLEISHFLEVTFSKTVALDLLINMCKQKNDLPLLREIYDIKGQIREMSN  624

Query  1083  LLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFES--KAAEEHAKLLRI  910
             +   E++   +NP       L G R+K   KA     ++K+   +S  K  E+  KL  +
Sbjct  625   IFLTEAF---RNP------DLDG-RMKAYHKAIDCLRQSKDKEDQSTLKNVEDQIKLEML  674

Query  909   QHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIR  730
             Q ELE T+ Q  F   SISDTI   I L   + AN +K+EFKV +KR++W+K+ AL+ + 
Sbjct  675   QKELE-TSLQEQFEGMSISDTIYKLISLNQGKRANSIKSEFKVPDKRFWWIKIKALSIMC  733

Query  729   DWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             DW+ L KFSK+K+ PIGY+PFVE C+E +++ EALKYIP++ +   + + Y  I 
Sbjct  734   DWEELMKFSKDKKSPIGYEPFVEVCLEQKNQIEALKYIPRITESLPKVQFYIQIS  788



>ref|XP_006272323.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Alligator mississippiensis]
Length=838

 Score =   129 bits (324),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 129/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + +  + E LKD +      Q++   
Sbjct  572   LVYTVVLHLKNELNRGNFFMTLQNQPVALSLYRQFCKHQERETLKDLYNQDDNHQELGNF  631

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   K         + G R+  ++ A   + + K   F +KA E+  KLLRIQH 
Sbjct  632   HVHTSYASEKR--------IEG-RVAALQNAVDEYYKAKNE-FAAKATEDQIKLLRIQHR  681

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  ++D S+ DTI   I+ G H+ A ++  EFK+ +KR++WLK+ +LA   DW+
Sbjct  682   LQEDLDKP-YLDCSLHDTISHLILDGKHKRAEQLYREFKIPDKRFWWLKISSLAECGDWE  740

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +EKFSK K+ PIGY PFVE CV+  ++ EA KY  ++  P ++ +A+  +G
Sbjct  741   EMEKFSKSKKSPIGYLPFVEICVKYHNRHEAKKYAARVV-PEQKVKAFILVG  791



>gb|KII87631.1| hypothetical protein PLICRDRAFT_111626 [Plicaturopsis crispa 
FD-325 SS-3]
Length=843

 Score =   129 bits (324),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/237 (35%), Positives = 130/237 (55%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQ---SRPLPRD-LFISYARLYKHEFLKDFFLSTGQLQD  1093
             LVY VLLH+ ++ P    F  I+   +R  P   L   YAR    E L+DF+ S  +  +
Sbjct  576   LVYHVLLHLHKRLPLGSFFRLIEDGGARLAPASKLLQVYAREQNREMLRDFYYSDDRRVE  635

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L  +E+  +  +P +         +I  ++ A   F+E KE  FE+K  +E A+LL 
Sbjct  636   SAVLSLEEAARMT-DPNS---------KITAIKAAQKFFSEDKERTFEAKMMDESARLLA  685

Query  912   IQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
              Q +LE      I F   S+++TIRTC++ G  + A+K+K++FKV +KR++ +K+ AL  
Sbjct  686   FQQQLEKDADGKIPFFGQSVNETIRTCLLNGMAKKADKIKSDFKVPDKRFWHVKLHALTA  745

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              RD++ L+ F++ KR PIGY+PFV   VE     EA  Y+ +  D  +R + Y   G
Sbjct  746   TRDFEGLDAFARSKRSPIGYEPFVRHLVEKGHPKEAAGYVQR-CDTSKRVDLYVECG  801



>emb|CCA70355.1| related to vacuolar protein sorting VACUOLELESS1 [Piriformospora 
indica DSM 11827]
Length=883

 Score =   129 bits (324),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/234 (37%), Positives = 127/234 (54%), Gaps = 18/234 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQS-----RPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVY VLL++ ++ P  + F  I+       P  R L I YAR    E L+DFF S  +  
Sbjct  617   LVYQVLLNLHKRLPLGDFFKLIEDGGPKVAPASRLLQI-YARDQNREMLRDFFYSDDRRV  675

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             D   LL ++         AS    L   RI  ++ A   F+E +E  FE++  +E+A+LL
Sbjct  676   DSGLLLLED---------ASTQEDLTA-RINSIKAAQKFFSEDRERGFEARMMDENARLL  725

Query  915   RIQHELEVTTK-QAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALA  739
              +Q  LE     +A FV  S+ DTI  C+  G H+ A KV++++KVS+K+++WLK+ AL 
Sbjct  726   ALQQTLEKDVDGKAAFVGLSVGDTIMLCLQCGLHKRAEKVRSDWKVSDKQFWWLKLRALT  785

Query  738   TIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAY  577
               + WD L+ FSK K+ PIGY+PFV   V      +A  Y+ +  D  +R E Y
Sbjct  786   EAKAWDELDAFSKSKKSPIGYEPFVRHLVSKGFHQQAAAYVAR-CDAAKRGELY  838



>ref|XP_002837491.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ81682.1| unnamed protein product [Tuber melanosporum]
Length=832

 Score =   129 bits (323),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 126/234 (54%), Gaps = 12/234 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+ +K P    F  I  RP+   L  S AR      LKDF+    +  D A++
Sbjct  566   LVFFVLLHLKKKLPLANFFRMINDRPVASSLIESSARETDPGLLKDFYYQDDRRADGAYV  625

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               ++S       +A K   L   ++KL  K   L A+ KEH  E+KA +E AKLL +Q  
Sbjct  626   TLRDS-------LAQKDLSLKMEKLKLASK---LLADAKEHALEAKALDESAKLLHMQEN  675

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
              E   +Q  FV   I++T+   I +G    ANKVK+EFKV EKR++WLK+ AL   RDW 
Sbjct  676   FEKDLQQERFVGDPINETVFKLIRMGYSSRANKVKSEFKVPEKRFWWLKLRALVAKRDWG  735

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD--PRERAEAYAGIG  565
              +E++ K K+ PIG++ F   C+ A +   A  +IPK  +  P +R + +   G
Sbjct  736   EIEEWGKTKKSPIGWEAFFNECLAAGNTKAASIFIPKCTNLPPADRIDMWVRCG  789



>ref|XP_007270430.1| vacuolar protein sorting-associated protein 16 [Fomitiporia mediterranea 
MF3/22]
 gb|EJC99299.1| vacuolar protein sorting-associated protein 16 [Fomitiporia mediterranea 
MF3/22]
Length=847

 Score =   129 bits (323),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/239 (35%), Positives = 133/239 (56%), Gaps = 20/239 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELF------GTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQL  1099
             L+Y VLLH+ QK  +L  F      G     P  R L   YAR    E L+DF+ S  + 
Sbjct  580   LIYSVLLHL-QKSLSLGSFFRLIEDGGPALAPAAR-LLQVYAREQDREMLRDFYYSDDRR  637

Query  1098  QDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKL  919
              D A LL +E+  +  NP A         ++  ++ A   F+E K+  FE+K  +E+ +L
Sbjct  638   VDSAVLLLEEARTMT-NPEA---------KMTAIKAAQKFFSEDKDRAFEAKMMDENVRL  687

Query  918   LRIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFAL  742
             L +Q +LE  +   I F   S+S+TIR C++ G  +   KV+T+FKV +KR+++LK++AL
Sbjct  688   LTLQQQLEKESDGKITFFGLSVSETIRMCLLNGMAKRVEKVRTDFKVPDKRFWYLKLYAL  747

Query  741   ATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
               +RD+++L+ F++ K+ PIGY+PFV+  +      EA+ Y+ K  D   R + Y   G
Sbjct  748   TQMRDFESLDAFARSKKSPIGYEPFVQHLLSKGHTREAVGYVAK-CDAGRRVDLYVECG  805



>gb|KIY47376.1| vacuolar protein sorting-associated protein 16 [Fistulina hepatica 
ATCC 64428]
Length=839

 Score =   128 bits (322),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/240 (36%), Positives = 136/240 (57%), Gaps = 22/240 (9%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELF------GTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQL  1099
             LVY VLLH+ QKR +L  F      G +   P  R L   YAR    E L+DF+ S  + 
Sbjct  572   LVYHVLLHL-QKRLSLGNFFKLIEDGGLALSPASR-LLQVYAREQNREMLRDFYYSDDRR  629

Query  1098  QDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKL  919
              + A L   E+  + ++P +         ++   + A   F+E K+  FE+K  +E+++L
Sbjct  630   VESAVLSLDEAARM-EDPES---------KVTAAKAAQKFFSEDKDRAFEAKMMDEYSRL  679

Query  918   LRIQHELE--VTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFA  745
             L  Q +LE  +  K  +F   ++++TIR CIV G+ + A+K+K++FKV +KR++++K+ A
Sbjct  680   LIAQRQLEKDLDGKVPLF-GLTVNETIRQCIVNGHSKRADKIKSDFKVPDKRFWYVKLHA  738

Query  744   LATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             L +IRD+  LE FSK KR PIGY+PFV   VE     +A  Y+ +   P+ R + YA  G
Sbjct  739   LTSIRDFAQLEAFSKSKRSPIGYEPFVRHLVERGHLKQAAAYVSRCDSPK-RVDLYADCG  797



>dbj|GAM26637.1| hypothetical protein SAMD00019534_098120 [Acytostelium subglobosum 
LB1]
Length=836

 Score =   128 bits (322),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/240 (34%), Positives = 130/240 (54%), Gaps = 20/240 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKH-EFLKDFFLSTGQLQDVAF  1084
             L++LVLL++ +  P   L  T+ SR +  DL +S+++   +   LK  +   GQ  D+A 
Sbjct  566   LIHLVLLNLERNEPRTYL-DTVFSRKVALDLLLSFSKQKGNVGLLKKIYEIRGQTTDLAL  624

Query  1083  LLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKE---HVFESKAAEEHAKLLR  913
             L   E +      M          R +  E A  +F  +K+   H++ SK  ++  KL  
Sbjct  625   LHLGEGFRSMDMDM----------RKRSFEDASRIFNASKDKDVHIY-SKMVDDQIKLES  673

Query  912   IQHELEVT----TKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFA  745
             +Q EL+       K+  ++  S+SDTI   +++G H+   K+  EFKVS+KR++W+K+ A
Sbjct  674   LQKELDTMRKDPNKEPSYMGLSLSDTIFQLVLMGEHKRVAKMLKEFKVSDKRFWWIKIKA  733

Query  744   LATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             L+  R W+ L  F+ EK+ PIGY+PFVE C++     EALKYIPK+ D   R + Y  + 
Sbjct  734   LSVSRQWEELSLFANEKKSPIGYEPFVEVCLDQSQHVEALKYIPKIQDVVNRCQCYVQVN  793



>ref|XP_008121385.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Anolis carolinensis]
Length=866

 Score =   128 bits (322),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 132/232 (57%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + +  + + LKD +      Q++   
Sbjct  603   LVYTVILHLKNELNRGAFFMTLQNQPVAMSLYRQFCKHQELDTLKDLYNQDDDHQELGNF  662

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+   K         + G R+  ++ A   + + K   F +KA E+  KLLRIQ  
Sbjct  663   HVRSSYVNEKR--------IEG-RVASLQNAVDEYYKAKNE-FAAKATEDQIKLLRIQRR  712

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  ++D S+ DT+   I+ GNH+ A ++  +FK+ +KR++WLK+ ALA   DW+
Sbjct  713   LQDDFDKP-YLDYSLHDTVYNLILEGNHKRAEQLYRDFKIPDKRFWWLKINALAEQGDWE  771

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +EKFSK K+ PIGY PFVE C++  ++ EA K+ P++A P +R +A+  +G
Sbjct  772   EMEKFSKSKKSPIGYLPFVEICMKHHNRHEARKFAPRVA-PEQRVKAFLLVG  822



>ref|XP_007384243.1| vacuolar assembling/sorting protein VPS16 [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN08291.1| vacuolar assembling/sorting protein VPS16 [Punctularia strigosozonata 
HHB-11173 SS5]
Length=842

 Score =   127 bits (320),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 132/237 (56%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQS---RPLPRD-LFISYARLYKHEFLKDFFLSTGQLQD  1093
             LVY VLLH+ ++ P    F  I+    R  P + L   YAR    E L+DF+ S  +  +
Sbjct  575   LVYHVLLHLHKRLPLGSFFRLIEDGGERLAPANKLLQVYARQQNREMLRDFYYSDDRRVE  634

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L  +E+  ++ +P A         +I  ++ A   F+E K+  FE+K  +E+ +LL 
Sbjct  635   SAVLSLEEAAAVS-DPFA---------KISCIKAAQKFFSEDKDRSFEAKMMDENVRLLA  684

Query  912   IQHELEVTTKQAIFV-DSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
              Q +LE  +   I    +S+++TIR C++ G  + A+K+K++FKV +KR++++K+ AL  
Sbjct  685   AQQQLEKESDGKIAAFGTSVNETIRACLLNGYPKKADKLKSDFKVPDKRFWYVKLQALTA  744

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             + DWD LE F+K KR PIGY+PFV   +E     EA  Y+ +  +  +R + Y   G
Sbjct  745   LSDWDGLETFAKSKRSPIGYEPFVRHLLEKGHPREAATYVAR-CESNKRVDLYIECG  800



>gb|KIJ59378.1| hypothetical protein HYDPIDRAFT_118596 [Hydnomerulius pinastri 
MD-312]
Length=841

 Score =   127 bits (319),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 129/234 (55%), Gaps = 18/234 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQS-----RPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVY VLLH+ ++ P    F  I+       P  R L   YAR    E L+DF+ S  +  
Sbjct  574   LVYHVLLHLHKRLPLGSFFRLIEDGGERLAPASR-LLQVYAREQNREMLRDFYYSDDRRV  632

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             + A L  +E+  +  +P A          +  V+ A   F+E K+  FE+K  +E+A+LL
Sbjct  633   ESAALALEEASRMT-DPAAV---------VTSVKAAEKFFSEDKDRSFEAKMMDENARLL  682

Query  915   RIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALA  739
              +Q +LE  +   + F   S+S+TIRTC++    + A+KVK EFKV +KR++++K+ AL 
Sbjct  683   AMQQQLEKDSDGKVQFFGQSVSETIRTCLMNKMGKKADKVKAEFKVPDKRFWYIKLHALT  742

Query  738   TIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAY  577
              +RD+D L+ F++ KR PIGY+ FV   VE     EA  Y+ +   P+ R + Y
Sbjct  743   ALRDFDGLDTFARSKRSPIGYEAFVRHLVEMGHSKEAAAYVMRCDAPK-RVDLY  795



>gb|EFA85317.1| hypothetical protein PPL_02318 [Polysphondylium pallidum PN500]
Length=860

 Score =   127 bits (319),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 87/260 (33%), Positives = 149/260 (57%), Gaps = 17/260 (7%)
 Frame = -3

Query  1200  TIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFLLWKESWELAKNPM--ASKGS  1027
             T+ S+ +  DL +S+++   +          G L++V + + ++S ELA   M  A +  
Sbjct  612   TVFSKKVALDLLLSFSKQKGN---------LGLLKEV-YTIKQQSTELALTFMYEAFRSG  661

Query  1026  PLHGPRIKLVEKAHGLFAETKE---HVFESKAAEEHAKLLRIQHELEVTTKQAIFVDSSI  856
              L   R+K    A   F  +K+   H++ +K  E+  KL  +Q ELE +   A F+  S+
Sbjct  662   DLD-QRVKSFGMAVNAFNSSKDKDIHLY-AKLTEDQIKLELLQKELETSMPDASFLGLSL  719

Query  855   SDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGY  676
             +DT+   ++LG  +  +K+K+EFKV++KR++W K+ AL+    W+ L  FSKEK+ PIGY
Sbjct  720   ADTMYQLVLLGEQKRVSKIKSEFKVTDKRFWWTKIKALSISGQWEELNNFSKEKKSPIGY  779

Query  675   KPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKL  496
             +PFVE C++   + EALKYIPK+ D   R ++Y  +G  +EAA+ A + K+ +LL  +  
Sbjct  780   EPFVEVCLDQNQQVEALKYIPKIQDTVNRCQSYIQVGYFREAAETAFKDKNLDLLNFVAK  839

Query  495   TFSQNAAAASIFDTLRDRLT  436
               + N    ++ D +R +L+
Sbjct  840   KCTNNEVVLNLIDQMRAQLS  859



>ref|XP_009098195.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Serinus canaria]
Length=1408

 Score =   127 bits (320),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 131/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + R  + E LKD +      Q++  L
Sbjct  1143  LVYTVVLHLKNELNRGSFFMTLQNQPVALSLYRQFCRHQERETLKDLYNQDDNHQELGNL  1202

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                  +   +         + G R+  ++ A   F + K   F +KA EE  KLLR+Q  
Sbjct  1203  HVLGGYCQRR---------IEG-RVAALQNALDEFYKAKND-FAAKATEEQIKLLRLQRH  1251

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  ++D S+ DT+ T I+ G+H+ A ++  +F++ +KR++WLK+ ALAT  DW+
Sbjct  1252  LQEELDKP-YLDLSLHDTVATLILDGHHKRAEQLYRDFRIPDKRYWWLKINALATRGDWE  1310

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  1311  EMEKFSKSKKSPIGYLPFVEVAVKHHNRYEAKKYAPRVP-PEQRVKAFVLVG  1361



>ref|XP_011117417.1| hypothetical protein AOL_s00004g466 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX53807.1| hypothetical protein AOL_s00004g466 [Arthrobotrys oligospora 
ATCC 24927]
Length=835

 Score =   127 bits (318),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 84/235 (36%), Positives = 123/235 (52%), Gaps = 12/235 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+ +K P    F  I  RPL   L  + AR    E LKD +    +  D A +
Sbjct  568   LVFYVLLHLKKKLPIATFFRIINDRPLAYSLIETSARNIDTELLKDLYYQDDRKSDGANV  627

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             + KES  L +    +        RI  ++ A  L  ++KEH  +S A EE  KLL +Q  
Sbjct  628   ILKES--LMQENFTT--------RIDKLKLASKLLKDSKEHALDSSALEESIKLLTMQES  677

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE    +  FV  S++DTI     LG H  ANK+++EFK+ +KR++W+K+  L   R+W 
Sbjct  678   LERDVFEETFVGLSLNDTIFKLTRLGFHPRANKIRSEFKMPDKRFWWIKLRGLVAKREWA  737

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADP--RERAEAYAGIGM  562
              +E++SK K  PIG++PF   C+ A +   A  +IPK  +    ER   +   GM
Sbjct  738   EIEEWSKLKTSPIGWEPFFNECLSAGNTKVASIFIPKCKNLGYAERVNMWVQCGM  792



>gb|KIM67291.1| hypothetical protein SCLCIDRAFT_179253 [Scleroderma citrinum 
Foug A]
Length=840

 Score =   126 bits (317),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 89/235 (38%), Positives = 130/235 (55%), Gaps = 20/235 (9%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELF------GTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQL  1099
             LVY VLLH+  KR +L  F      G  +  P  R L   YAR    E L+DF+ S  + 
Sbjct  573   LVYHVLLHL-HKRLSLGAFFRLIEDGGDRLAPASR-LLQVYAREQNREMLRDFYYSDDRR  630

Query  1098  QDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKL  919
              + A L  +E      N M  + +      I  V+     F+E K+  FE+K  +E A+L
Sbjct  631   VESAVLALEEV-----NRMTDQEAI-----ITSVKAGEKFFSEDKDRGFETKMMDECARL  680

Query  918   LRIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFAL  742
             L +Q +LE   +  + F   S+S+TIRTC+  G    A++VK++FKV +KR++++K+ AL
Sbjct  681   LAMQQQLEKDAQGKVKFFGLSVSETIRTCLTNGMGNKADRVKSDFKVPDKRFWYIKLHAL  740

Query  741   ATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAY  577
               IRD++ALEKF++ KR PIGY+ FV   VEA    EA  Y+ +   P+ R E Y
Sbjct  741   TAIRDFEALEKFARSKRSPIGYEAFVRHLVEAGHPREAAAYVIRCDAPK-RVELY  794



>ref|XP_001881053.1| vacuolar assembling/sorting protein VPS16 [Laccaria bicolor S238N-H82]
 gb|EDR07983.1| vacuolar assembling/sorting protein VPS16 [Laccaria bicolor S238N-H82]
Length=836

 Score =   126 bits (317),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 82/237 (35%), Positives = 129/237 (54%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSR----PLPRDLFISYARLYKHEFLKDFFLSTGQLQD  1093
             LVY VLLH+ ++ P    F  I+           L   YAR    E L+DF+ S  +  +
Sbjct  569   LVYHVLLHLHKRLPLGSFFRLIEDGGERLSSASKLLEVYAREQNREMLRDFYYSDDRRVE  628

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L  +E+ ++  NP +         +I  V+ A   F+E K+  FE+K  EE  +LL 
Sbjct  629   SAILSLEEASKM-NNPAS---------KISSVKAAQKFFSEDKDRTFEAKMMEESVRLLT  678

Query  912   IQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
              Q +L++ T   I F  +S++++IR C+V    + A+K+K++FKV +KR++ +K+ AL  
Sbjct  679   TQQQLDIETDGKITFFGTSVNESIRLCLVNNMAKRADKMKSDFKVPDKRFWHIKLKALTE  738

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             ++ +  LE FSK KR PIGY+PFV   VE     EA+ Y+ +   P+ RA+ Y   G
Sbjct  739   VKAFGELETFSKSKRSPIGYEPFVRHLVEKGLPKEAVAYVARCDSPK-RADLYVECG  794



>gb|KJA15614.1| hypothetical protein HYPSUDRAFT_1068261 [Hypholoma sublateritium 
FD-334 SS-4]
Length=845

 Score =   126 bits (316),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 86/238 (36%), Positives = 129/238 (54%), Gaps = 18/238 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQS-----RPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVY VLLH+ ++ P    F  I+       P  + L   YAR    E L+DF+ S  +  
Sbjct  578   LVYHVLLHLHKRLPLGSFFRLIEDGGKTLAPASK-LLEVYAREQNREMLRDFYYSDDRRV  636

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             + A L   E+  +               +I  V+ A   F+E KE  FE+K  +E A+LL
Sbjct  637   ESAVLSLDEASRMTD----------QSSKITAVKTAQKFFSEDKERSFEAKMMDESARLL  686

Query  915   RIQHELE-VTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALA  739
               Q +LE  T  +  F   ++++TI+TCI+ G  + A+K+K++FKV +KR+++LK+ AL 
Sbjct  687   TFQQQLEHETDGKVTFFGLNLNETIKTCILNGLTKRADKIKSDFKVPDKRFWYLKLHALT  746

Query  738   TIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
               RD++ L+ FSK KR PIGY+PFV   VE     EA+ Y+ +   P+ RAE Y   G
Sbjct  747   VARDFEGLDAFSKAKRSPIGYEPFVHHLVETGYAAEAVAYVARCDSPK-RAELYVACG  803



>gb|KIJ15884.1| hypothetical protein PAXINDRAFT_168867 [Paxillus involutus ATCC 
200175]
Length=841

 Score =   126 bits (316),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 125/234 (53%), Gaps = 18/234 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQS-----RPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVY VLLH+ ++ P    F  I+       P  R L   YAR    E L+DF+ S  +  
Sbjct  574   LVYHVLLHLHKRLPLGSFFRLIEDGGERLAPASR-LLQVYAREQNREMLRDFYYSDDRRV  632

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             + A L  +E+  +                +  V+ A   F+E K+  FE+K  +E A+LL
Sbjct  633   ESAALALEEASRMTDQAAV----------VTSVKAAEKFFSEDKDRSFEAKMMDESARLL  682

Query  915   RIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALA  739
              +Q +LE  +   + F   S+S+T+R C++ G  + A+KVK EFKV +KR++++K+ AL 
Sbjct  683   AMQQQLEKDSDGKVKFFGQSVSETVRICLMNGMSKRADKVKAEFKVPDKRFWYIKLHALT  742

Query  738   TIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAY  577
              IRD+  LE F++ KR PIGY+ FV   VEA    EA  Y+ +   P+ R E Y
Sbjct  743   AIRDFVNLEVFARSKRSPIGYEAFVRHLVEAGHPKEASTYVMRCDAPK-RVELY  795



>gb|AAH03944.1| Vps16 protein [Mus musculus]
Length=419

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 130/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  +    + F T++++P+   L+  + +  + + LKD +      Q++   
Sbjct  153   LVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNHQELGSF  212

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+        +    + G R+  ++ A   F + K   F +KA E+  +LLRIQ  
Sbjct  213   HIRASY--------AAEERIEG-RVAALQTAADAFYKAKNE-FAAKATEDQMRLLRIQRR  262

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE       F+D S+ DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+
Sbjct  263   LEDELG-GRFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWE  321

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  322   ELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  372



>ref|XP_011238156.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Mus musculus]
 ref|XP_011238157.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Mus musculus]
Length=452

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 130/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  +    + F T++++P+   L+  + +  + + LKD +      Q++   
Sbjct  186   LVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNHQELGSF  245

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+   +         + G R+  ++ A   F + K   F +KA E+  +LLRIQ  
Sbjct  246   HIRASYAAEER--------IEG-RVAALQTAADAFYKAKNE-FAAKATEDQMRLLRIQRR  295

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE       F+D S+ DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+
Sbjct  296   LEDELG-GRFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWE  354

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  355   ELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  405



>ref|XP_005518015.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Pseudopodoces humilis]
Length=693

 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 131/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + R  + E LKD +      Q++   
Sbjct  428   LVYTVVLHLKNELNRGTFFMTLQNQPVALSLYRQFCRHQERETLKDLYNQDDNHQELGNF  487

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 ++   +         + G R+  ++ A   F + K   F +KA EE  KLLR+Q  
Sbjct  488   HVHSAYCERR---------IEG-RVAALQNALDEFYKAKND-FAAKATEEQIKLLRLQRH  536

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  +++ S+ DT+ T I+ G+H+ A ++  +F++ +KR++WLK+ ALAT  DW+
Sbjct  537   LQEELDKP-YLELSLHDTVSTLILDGHHKRAEQLCRDFRIPDKRYWWLKINALATRGDWE  595

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  596   EVEKFSKSKKSPIGYLPFVEVAVKHHNRYEARKYAPRVP-PEQRVKAFVLVG  646



>emb|CDO74588.1| hypothetical protein BN946_scf184583.g15 [Trametes cinnabarina]
Length=828

 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 132/238 (55%), Gaps = 18/238 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPR-----DLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVY VLLH+ QKR +L  F  +     P+      L   YAR    + L+DF+ S  +  
Sbjct  561   LVYHVLLHL-QKRLSLGSFFRLIEEGGPKLALASRLLQVYAREQNRDMLRDFYYSDDRRV  619

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             + A L  +++   + +P A         +I  V  A   F+E K+  FE+K  +E  +LL
Sbjct  620   ESAVLCLEDAAR-SSDPTA---------KIASVRAAQKFFSEDKDRSFEAKMMDESVRLL  669

Query  915   RIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALA  739
              +Q +LE      + F   S+++TIRTC++ G  + A+K+K++FKV +KR++++K+ AL 
Sbjct  670   TLQQQLEKEADGKVAFFGLSVNETIRTCLINGMSKRADKIKSDFKVPDKRFWYVKLQALT  729

Query  738   TIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +RD++ LE F++ KR PIGY+ FV+  VE     EA  Y+ +   P+ RA+ Y   G
Sbjct  730   AVRDFEGLEAFARSKRSPIGYEVFVKHLVEKGHPREAAAYVSRCDGPK-RADLYVLCG  786



>ref|XP_008042309.1| vacuolar protein sorting-associated protein 16 [Trametes versicolor 
FP-101664 SS1]
 gb|EIW55040.1| vacuolar protein sorting-associated protein 16 [Trametes versicolor 
FP-101664 SS1]
Length=847

 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/238 (36%), Positives = 132/238 (55%), Gaps = 18/238 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPR-----DLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVY VLLH+ QKR +L  F  +     PR      L   YAR    + L+DF+ S  +  
Sbjct  580   LVYHVLLHL-QKRLSLGSFFRLIEEGGPRLALASRLLQVYAREQNRDMLRDFYYSDDRRV  638

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             + A L  +++        AS   P    +   V+ A   F+E K+  FE+K  +E+++LL
Sbjct  639   ESAVLCLEDA--------ASSSDP--AAKTTSVKAAQKFFSEDKDRSFEAKVTDEYSRLL  688

Query  915   RIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALA  739
               Q +LE      I F   S+++TIRTC++ G  + A+KVK++FKV +KR++++K+ AL 
Sbjct  689   AQQQQLEKEADGKIAFFGLSVNETIRTCLINGMAKRADKVKSDFKVPDKRFWYVKLHALT  748

Query  738   TIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              IRD++ LE F++ KR PIGY+ FV+  VE     EA  ++ +   P+ RA+ Y   G
Sbjct  749   EIRDFEGLELFARSKRSPIGYETFVKHLVEKGHPKEAGTFVARCDGPK-RADLYVLCG  805



>ref|XP_008495020.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Calypte anna]
Length=799

 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 129/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + +  + E LKD +      Q++   
Sbjct  534   LVYTVVLHLKNELTRGTFFMTLQNQPVALSLYRQFCKHQERETLKDLYNQDDNHQELGNF  593

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         + G R+  ++ A   F + K   F +KA E+  KLLR+Q  
Sbjct  594   HVHSSYSEKR---------IEG-RVGALQNALDEFYKAKNE-FAAKATEDQIKLLRLQRH  642

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  ++D S+ DT+   I+ G+H+ A ++  +FK+ +KR++WLK+ ALAT  DW+
Sbjct  643   LQEDLNRP-YLDLSLHDTVSNLILEGHHKRAEQLYRDFKIPDKRYWWLKISALATRGDWE  701

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +EKFS+ K+ PIGY PFVE  V+  ++ EA KY P++  P +R  A+  +G
Sbjct  702   EMEKFSRSKKSPIGYWPFVEISVKHHNRYEAKKYAPRVP-PEQRVRAFVLVG  752



>ref|XP_011598543.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X3 [Aquila chrysaetos canadensis]
Length=718

 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 129/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + +  + E LKD +      Q++   
Sbjct  453   LVYTVVLHLKNELNRGTFFMTLQNQPVALSLYRQFCKHQERETLKDLYNQDDNHQELGNF  512

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         + G R+  ++ A   + + K   F +KA E+  KLLR+Q  
Sbjct  513   HVHSSYSEKR---------IEG-RVGALQNALDEYYKAKNE-FAAKATEDQIKLLRLQRH  561

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  ++D S+ DT+   I+ G+H+ A ++  EFK+ +KR++WLK+ ALA   DW+
Sbjct  562   LQEDFDKP-YLDLSLHDTVSNLILDGHHKRAEQLYREFKIPDKRYWWLKINALANRGDWE  620

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  621   EMEKFSKSKKSPIGYLPFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  671



>gb|EWC48561.1| hypothetical protein DRE_01783 [Drechslerella stenobrocha 248]
Length=835

 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 123/235 (52%), Gaps = 12/235 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  K P    F  I SRPL   L  S AR +  E LKD +    +  D A +
Sbjct  568   LVFYVLLHLKNKLPVATFFRIINSRPLAYSLIESSARYHDTELLKDLYYQDDRKTDGANV  627

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             + +ES  LA+    +        RI  ++ A  L  ++K+H+ E+ A EE  KLL +Q  
Sbjct  628   ILRES--LAQENFTT--------RIDKLKLASKLLKDSKDHLIEATALEESIKLLNLQES  677

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE    +  FV   +++TI     LG H  ANK++ EFK+ +KR++W+K+  L   R+W 
Sbjct  678   LERDIFEETFVGLPLNETIFKLTRLGFHPRANKIRGEFKMPDKRFWWIKLRGLVAKREWA  737

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLA--DPRERAEAYAGIGM  562
              +E++ K K  PIG++PF   C+ A +   A  +IPK    +  ER   +   G+
Sbjct  738   EIEEWGKSKTSPIGWEPFFNECLSAGNTKVAAMFIPKCKHLNHTERINMWVQCGL  792



>gb|KIK32973.1| hypothetical protein CY34DRAFT_813942 [Suillus luteus UH-Slu-Lm8-n1]
Length=845

 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/228 (36%), Positives = 123/228 (54%), Gaps = 17/228 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELF-----GTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVY VLLH++++ P    F     G  Q  P  + L   YAR    E L+DF+ S  +  
Sbjct  578   LVYHVLLHLYKRLPLGSFFKLIEDGGDQLAPASK-LLQVYARELNREMLRDFYYSDDRRV  636

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             + A L   E+ ++  +P A          +  V  A   F+E K+  FE+K   E  +LL
Sbjct  637   ESATLALDEAAQMT-DPHAV---------MTAVNAAEKFFSEDKDRPFEAKMMNESVRLL  686

Query  915   RIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALA  739
              +Q + E  +   I F   S+S+TIRTCI     + A++VK+EFKV +KR+++LK+ AL 
Sbjct  687   ALQQQYEKDSDGKIKFFGQSVSETIRTCISNNMSKKADRVKSEFKVPDKRFWYLKLHALT  746

Query  738   TIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPR  595
              +RD+DAL+ F++ KR PIGY+ FV   VE     +A  Y+ +   P+
Sbjct  747   AMRDFDALDAFARSKRSPIGYEAFVRHLVETGHLKQAALYVMRCDGPK  794



>ref|XP_003134377.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoformX2 [Sus scrofa]
Length=695

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 132/232 (57%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  +    + F T++++P+   L+  + +  + E LKD +      Q++   
Sbjct  429   LVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSF  488

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+   ++        + G R+  ++KA   F + K   F +KA E+  +LLR+Q  
Sbjct  489   HIRASYTAEEH--------IEG-RVAALQKAAEAFNKAKND-FAAKATEDQMRLLRLQRC  538

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE       F+D S+ DT+ T I+ G+++ A +V  +F++ +KR +WLK+ ALA + DW+
Sbjct  539   LE-DELGGRFLDLSVHDTVTTLILGGHNKRAEQVARDFRIPDKRLWWLKLTALADLEDWE  597

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  598   ELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_007371512.1| vacuolar protein sorting-associated protein 16 [Dichomitus squalens 
LYAD-421 SS1]
 gb|EJF55761.1| vacuolar protein sorting-associated protein 16 [Dichomitus squalens 
LYAD-421 SS1]
Length=856

 Score =   125 bits (313),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 84/240 (35%), Positives = 134/240 (56%), Gaps = 24/240 (10%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPR-----DLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVY VLLH+ QKR +L  F  +     P+      L   YAR    + L+DF+ S  +  
Sbjct  583   LVYHVLLHL-QKRLSLGSFFRLIEEGGPKLALASRLLQVYAREQNRDMLRDFYYSDDRRV  641

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             + A L  +++   A +P A         ++  V+ A   F+E K+  FE+K  +E  +L+
Sbjct  642   ESAVLCLEDAAS-ASDPTA---------KLTSVKAAQKFFSEDKDRSFEAKMMDESVRLM  691

Query  915   RIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKR------WYWL  757
              +Q  LE      I F   S+++TIRTC+V G  + A+K+K++FKV +KR      ++++
Sbjct  692   TLQQTLEKEADGKIAFFGQSVNETIRTCLVNGMAKRADKIKSDFKVPDKRSVLIEQFWYV  751

Query  756   KVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAY  577
             K+ AL +I D++ LE F+K +R PIGY+ FV+  VE   + EAL Y+P+   P+ RA+ Y
Sbjct  752   KLQALTSIHDFEGLEAFAKSRRSPIGYEAFVKHLVEKGHQKEALSYVPRCDGPK-RADLY  810



>ref|XP_011598541.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Aquila chrysaetos canadensis]
Length=886

 Score =   125 bits (313),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 129/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + +  + E LKD +      Q++   
Sbjct  621   LVYTVVLHLKNELNRGTFFMTLQNQPVALSLYRQFCKHQERETLKDLYNQDDNHQELGNF  680

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         + G R+  ++ A   + + K   F +KA E+  KLLR+Q  
Sbjct  681   HVHSSYSEKR---------IEG-RVGALQNALDEYYKAKNE-FAAKATEDQIKLLRLQRH  729

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  ++D S+ DT+   I+ G+H+ A ++  EFK+ +KR++WLK+ ALA   DW+
Sbjct  730   LQEDFDKP-YLDLSLHDTVSNLILDGHHKRAEQLYREFKIPDKRYWWLKINALANRGDWE  788

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  789   EMEKFSKSKKSPIGYLPFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  839



>ref|XP_003134376.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoformX1 [Sus scrofa]
Length=839

 Score =   124 bits (312),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 132/232 (57%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  +    + F T++++P+   L+  + +  + E LKD +      Q++   
Sbjct  573   LVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSF  632

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+   ++        + G R+  ++KA   F + K   F +KA E+  +LLR+Q  
Sbjct  633   HIRASYTAEEH--------IEG-RVAALQKAAEAFNKAKND-FAAKATEDQMRLLRLQRC  682

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE       F+D S+ DT+ T I+ G+++ A +V  +F++ +KR +WLK+ ALA + DW+
Sbjct  683   LE-DELGGRFLDLSVHDTVTTLILGGHNKRAEQVARDFRIPDKRLWWLKLTALADLEDWE  741

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  742   ELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_011598542.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Aquila chrysaetos canadensis]
Length=838

 Score =   124 bits (312),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 129/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + +  + E LKD +      Q++   
Sbjct  573   LVYTVVLHLKNELNRGTFFMTLQNQPVALSLYRQFCKHQERETLKDLYNQDDNHQELGNF  632

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         + G R+  ++ A   + + K   F +KA E+  KLLR+Q  
Sbjct  633   HVHSSYSEKR---------IEG-RVGALQNALDEYYKAKNE-FAAKATEDQIKLLRLQRH  681

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  ++D S+ DT+   I+ G+H+ A ++  EFK+ +KR++WLK+ ALA   DW+
Sbjct  682   LQEDFDKP-YLDLSLHDTVSNLILDGHHKRAEQLYREFKIPDKRYWWLKINALANRGDWE  740

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  741   EMEKFSKSKKSPIGYLPFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  791



>ref|XP_010726024.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Meleagris gallopavo]
Length=980

 Score =   125 bits (313),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 130/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + +  + E LKD +      Q++   
Sbjct  715   LVYTVVLHLKNELNRGTFFMTLQNQPVALSLYRQFCKHQERETLKDLYNQDDNHQELGNF  774

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         + G R+  ++ A   + + K   F +KA E+  KLLR+Q  
Sbjct  775   HVHSSYSEKR---------IEG-RVGALQNAVDEYYKAKNE-FAAKATEDQIKLLRLQRH  823

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  ++D S+ +T+ T I  G+H+ A ++  EFK+ +KR++WLK+ ALAT  DW+
Sbjct  824   LQEDFDKP-YLDLSLHNTVSTLIQDGHHKKAEQLYREFKIPDKRYWWLKISALATRGDWE  882

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  883   EMEKFSKSKKSPIGYLPFVEIAVKHHNRYEAKKYAPRVT-PEQRVKAFILVG  933



>ref|XP_005239614.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Falco peregrinus]
Length=852

 Score =   124 bits (312),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 129/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + +  + E LKD +      Q++   
Sbjct  587   LVYAVVLHLKNELNRGTFFMTLQNQPVALSLYRQFCKHQERETLKDLYNQDDNHQELGNF  646

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         + G R+  ++ A   + + K   F +KA E+  KLLR+Q  
Sbjct  647   HVHSSYSEKR---------IEG-RVGALQNALDEYYKAKNE-FAAKATEDQIKLLRLQRH  695

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  ++D S+ DT+   I+ G+H+ A ++  EFK+ +KR++WLK+ ALA   DW+
Sbjct  696   LQEDFDKP-YLDLSLHDTVSNLILDGHHKRAEQLYREFKIPDKRYWWLKISALANRGDWE  754

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  755   EMEKFSKSKKSPIGYLPFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  805



>ref|XP_005435468.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Falco cherrug]
Length=855

 Score =   124 bits (312),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 129/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + +  + E LKD +      Q++   
Sbjct  590   LVYAVVLHLKNELNRGTFFMTLQNQPVALSLYRQFCKHQERETLKDLYNQDDNHQELGNF  649

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         + G R+  ++ A   + + K   F +KA E+  KLLR+Q  
Sbjct  650   HVHSSYSEKR---------IEG-RVGALQNALDEYYKAKNE-FAAKATEDQIKLLRLQRH  698

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  ++D S+ DT+   I+ G+H+ A ++  EFK+ +KR++WLK+ ALA   DW+
Sbjct  699   LQEDFDKP-YLDLSLHDTVSNLILDGHHKRAEQLYREFKIPDKRYWWLKISALANRGDWE  757

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  758   EMEKFSKSKKSPIGYLPFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  808



>ref|XP_007331990.1| hypothetical protein AGABI1DRAFT_77347 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM77345.1| hypothetical protein AGABI1DRAFT_77347 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=846

 Score =   124 bits (311),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 128/237 (54%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQ---SRPLPRD-LFISYARLYKHEFLKDFFLSTGQLQD  1093
             +VY VLL + ++ P    F  I+   +R  P   L   YAR    E L+DF+ S  +  +
Sbjct  579   MVYYVLLDLHKRLPLGSFFQLIEEGGNRLAPASRLLQVYAREQDREMLRDFYYSDDRRVE  638

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L  +E         AS  +     ++ LV+ A   F+E K+  FE+K  ++ A+LL 
Sbjct  639   SATLSLEE---------ASSATD-QAAKLSLVKSAQKFFSEDKDRAFEAKTMDDSARLLT  688

Query  912   IQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
              Q +LE      I F   S+++TIR CIV G  + A K++++FKV ++R+++LK+ AL  
Sbjct  689   FQQQLEKEADGKISFFGLSVNETIRECIVNGMSKRAEKIRSDFKVPDRRFWYLKLHALTE  748

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             I+D++ L+ FS+ KR PIGY+ FV   VE     EA+ Y+ +   P+ R + Y   G
Sbjct  749   IKDFEGLDAFSRTKRSPIGYESFVRHLVEKGHAKEAVMYVGRCDSPK-RVDLYVECG  804



>ref|XP_007898277.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Callorhinchus milii]
Length=838

 Score =   124 bits (311),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 130/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V++H+  +    + F T+Q++P+   L+  + +  + E L+D F      Q++   
Sbjct  572   LVYTVVMHLKNEMSRGDFFMTLQNQPVALSLYRQFCKHQEPETLQDLFNQDDNHQELGNF  631

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+        S  + + G R+  ++ A   + + K   F +K  EE  KLLR Q  
Sbjct  632   RVYSSY--------SNETTIEG-RVAALQNAVDEYNKAKNE-FAAKVTEEQIKLLRYQSR  681

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             ++  T +  ++D S+ DT+   ++    + A ++  +FK+ +KR++WLK+ ALA  +DW+
Sbjct  682   MQKDTGKT-YLDYSLHDTVYNLLLDSKLKQAEQLYKDFKIPDKRFWWLKISALAEKQDWE  740

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ P+GY PFVE CV+  +K EA KY+ K++ P ++ +A+  +G
Sbjct  741   ELEKFSKSKKSPVGYMPFVEICVKHHNKYEAKKYVTKVS-PEQKVKAFIMVG  791



>ref|XP_006463395.1| hypothetical protein AGABI2DRAFT_208148 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV45250.1| hypothetical protein AGABI2DRAFT_208148 [Agaricus bisporus var. 
bisporus H97]
Length=846

 Score =   124 bits (311),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 128/237 (54%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQ---SRPLPRD-LFISYARLYKHEFLKDFFLSTGQLQD  1093
             +VY VLL + ++ P    F  I+   +R  P   L   YAR    E L+DF+ S  +  +
Sbjct  579   MVYYVLLDLHKRLPLGSFFQLIEEGGNRLAPASRLLQVYAREQDREMLRDFYYSDDRRVE  638

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L  +E         AS  +     ++ LV+ A   F+E K+  FE+K  ++ A+LL 
Sbjct  639   SATLSLEE---------ASSATD-QAAKLSLVKSAQKFFSEDKDRAFEAKTMDDSARLLT  688

Query  912   IQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
              Q +LE      I F   S+++TIR CIV G  + A K++++FKV ++R+++LK+ AL  
Sbjct  689   FQQQLEKEADGKISFFGLSVNETIRECIVNGMSKRAEKIRSDFKVPDRRFWYLKLHALTE  748

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             I+D++ L+ FS+ KR PIGY+ FV   VE     EA+ Y+ +   P+ R + Y   G
Sbjct  749   IKDFEGLDAFSRTKRSPIGYESFVRHLVEKGHAKEAVMYVGRCDSPK-RVDLYVECG  804



>gb|KIM47049.1| hypothetical protein M413DRAFT_440594 [Hebeloma cylindrosporum 
h7]
Length=835

 Score =   124 bits (311),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 129/237 (54%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRP---LPRD-LFISYARLYKHEFLKDFFLSTGQLQD  1093
             LVY VLLH+ ++ P    F  ++      +P   L   YAR    E L+DF+ S  +  +
Sbjct  568   LVYHVLLHLHKRLPLGSFFRLLEEGGKALIPAGKLLEVYAREQNREMLRDFYYSDDRRVE  627

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L   E+  +     ASK        I  V+ A   F+E K+  FE+K  +E A+LL 
Sbjct  628   SAVLSLDEASRMLDQ--ASK--------ITAVKTAQKFFSEDKDRSFEAKMTDESARLLV  677

Query  912   IQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
              Q +LE      I F   ++++TIRTC++ G  + A+K+K++FKV +KR++++K+ AL  
Sbjct  678   FQQQLESEANGKIKFFGLTVNETIRTCLLNGLSKRADKIKSDFKVPDKRFWYIKLHALTE  737

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              RD++ LE F+K KR PIGY+ FV   VE     EA+ Y+ K   P+ RA+ +   G
Sbjct  738   SRDFEGLEGFAKSKRSPIGYEAFVHHLVEKGYPKEAVPYVSKCDSPK-RADLFVKCG  793



>ref|XP_001832533.2| vacuolar protein sorting 16 isoform 1 [Coprinopsis cinerea okayama7#130]
 gb|EAU89282.2| vacuolar protein sorting 16 isoform 1 [Coprinopsis cinerea okayama7#130]
Length=847

 Score =   124 bits (311),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 135/256 (53%), Gaps = 36/256 (14%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELF-----GTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVY VLLH+ ++ P    F     G  Q  P  R L   YAR    E L+DF+ +  +  
Sbjct  579   LVYHVLLHLHKRLPLGSFFRLLEDGGAQLAPATR-LLEVYAREQNREMLRDFYYAEDRRV  637

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAA-------  937
             + A L  +E+  + K+P A         +++ V+ A   F+E K+  FE+K         
Sbjct  638   ESAILCLEEAASM-KDPAA---------KLETVKAARRFFSEDKDRAFEAKVVVTDPSSP  687

Query  936   -----------EEHAKLLRIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKT  793
                        +E+A+LL  Q +LE  T   I F   S+++T+RTC+V G  + A+K+K+
Sbjct  688   LDESETREQMMDENARLLAFQQQLEAETDNKIPFFGLSVNETLRTCLVNGLSKRADKLKS  747

Query  792   EFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIP  613
             +FK+ +KR++++K+ AL   +D++ L+ F+K KR PIGY+PFV   +E     EA  Y+ 
Sbjct  748   DFKIPDKRFWYVKMKALTEAKDFEGLDAFAKSKRSPIGYEPFVRHLLEQGHAKEAAGYVA  807

Query  612   KLADPRERAEAYAGIG  565
             K   P+ R + YA  G
Sbjct  808   KCDSPK-RVDLYAECG  822



>emb|CCJ28605.1| unnamed protein product [Pneumocystis jirovecii]
Length=825

 Score =   124 bits (310),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 82/235 (35%), Positives = 128/235 (54%), Gaps = 14/235 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV  V+L++  K P    F  I+ + +   +  +YA+ +  E LKDF+    +  D A +
Sbjct  557   LVLYVILYLKDKLPLAHFFQIIRDKAVAVSILETYAKEHDSELLKDFYYQDDRRSDGANV  616

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             +  ES       + +    L   ++KL   + GL+ E K+  FE K  EEH  LL +Q  
Sbjct  617   ILLES-------LRTSNIDLKIEKLKL---SVGLYKEYKDFSFEIKNLEEHITLLELQQT  666

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
              E    + +F+  SI++T+   I +    AA K+K++FK+  KR++WLK+ AL  IRDW 
Sbjct  667   YEKEFHE-LFIGLSINETVFKLIKINQMTAALKIKSDFKIPIKRFWWLKLRALVAIRDWT  725

Query  720   ALEKF-SKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD--PRERAEAYAGIG  565
              LE + +K K+ PIGY+PFV  C+ A +K  A  +IPK ++  P  RAE +A  G
Sbjct  726   QLEDWANKSKKSPIGYEPFVSECLAAGNKKMAANFIPKCSEITPTFRAELWAKAG  780



>ref|NP_001258079.1| vacuolar protein sorting-associated protein 16 homolog [Gallus 
gallus]
Length=838

 Score =   124 bits (310),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 130/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + +  + E LKD +      Q++   
Sbjct  573   LVYTVVLHLKNELNRGTFFMTLQNQPVALSLYRQFCKHQERETLKDLYNQDDNHQELGNF  632

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         + G R+  ++ A   + + K   F +KA E+  KLLR+Q  
Sbjct  633   HVHSSYSEKR---------IEG-RVGALQNAVDEYYKAKNE-FAAKATEDQIKLLRLQRH  681

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  ++D S+ +T+ T I  G+H+ A ++  +FK+ +KR++WLK+ ALAT  DW+
Sbjct  682   LQEDFDKP-YLDLSLHNTVSTLIQDGHHKKAEQLYRDFKIPDKRYWWLKISALATRGDWE  740

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  741   EMEKFSKSKKSPIGYLPFVEIAVKHHNRYEAKKYAPRVT-PEQRVKAFILVG  791



>ref|XP_009883933.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Charadrius vociferus]
Length=859

 Score =   123 bits (309),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 129/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + +  + E LKD +      Q++   
Sbjct  594   LVYTVVLHLKNELNRGTFFMTLQNQPVALSLYRQFCKHQERETLKDLYNQDDNHQELGNF  653

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         + G R+  ++ A   + + K   F +KA E+  KLLR+Q  
Sbjct  654   HVHSSYSEKR---------IEG-RVGALQNALDEYYKAKNE-FAAKATEDQIKLLRLQRH  702

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  ++D S+ DT+   I+ G+H+ A ++  EFK+ +K+++WLK+ ALA   DW+
Sbjct  703   LQEDFDKP-YLDLSLHDTVSNLILDGHHKRAEQLYREFKIPDKKYWWLKISALANRGDWE  761

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  762   EMEKFSKSKKSPIGYLPFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  812



>ref|XP_011112781.1| hypothetical protein H072_7007 [Dactylellina haptotyla CBS 200.50]
 gb|EPS39211.1| hypothetical protein H072_7007 [Dactylellina haptotyla CBS 200.50]
Length=835

 Score =   122 bits (307),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 82/235 (35%), Positives = 124/235 (53%), Gaps = 12/235 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+ +K P    F  I  RPL   L  S AR+   E LKD +    +  D A +
Sbjct  568   LVFYVLLHLKKKLPIATFFRIINDRPLAYSLIESSARVMDTELLKDLYYQDDRKTDGANV  627

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             + +ES  LA+    +        RI  ++ A  L  ++K+H+ ++ A EE  KLL IQ  
Sbjct  628   ILRES--LAQENFTT--------RIDKLKLASKLLKDSKDHLVDATALEESIKLLNIQES  677

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE    +  FV  S+++TI     LG H  ANK+++EFK+ +KR++W+K+  L   R+W 
Sbjct  678   LERDIFEENFVGLSVNETIFKLTRLGFHPRANKIRSEFKMPDKRFWWIKLRGLVAKREWA  737

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLA--DPRERAEAYAGIGM  562
              +E++SK K  PIG++ F   C+ A +   A  +IPK       ER   +   GM
Sbjct  738   EIEEWSKLKSSPIGWEAFFNECLAAGNTKMAAIFIPKCKSLSHTERINMWVQCGM  792



>ref|XP_003488666.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Bombus impatiens]
Length=835

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 120/220 (55%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+ +  P  +   +I   PL   L+I Y + +  E L+D +         A  
Sbjct  572   LVYTVILHLRENMPLGDFQMSIMHCPLAMALYIKYCQNHNRETLRDIYNQYDDFHSQAIW  631

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++  KN M+         R  L++ A   F   +     +   EE  KLLR Q  
Sbjct  632   FITESYQ-RKNTMS---------REALLQSAQENFKLARNDT-NAALTEEQIKLLRYQRS  680

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             +E   K+ I V   + DT++  ++   ++ A+K+++E+K+S++R++WL++  LA    W+
Sbjct  681   MEDVLKKPI-VGKPLQDTVKVLLLRNEYKLADKLRSEYKISDRRYWWLRIQCLAEQGVWN  739

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              LEKFSK K+ PIGY+PF++ C++  ++ EA KY+PK+ D
Sbjct  740   ELEKFSKSKKSPIGYEPFIDQCLKYNEEREAKKYLPKVRD  779



>ref|XP_007771096.1| vacuolar assembling sorting protein VPS16 [Coniophora puteana 
RWD-64-598 SS2]
 gb|EIW78496.1| vacuolar assembling sorting protein VPS16 [Coniophora puteana 
RWD-64-598 SS2]
Length=845

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 131/238 (55%), Gaps = 18/238 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELF-----GTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVY VLLH+ ++ P    F     G  +  P  + L   YAR    E L+DF+ S  +  
Sbjct  578   LVYHVLLHLHKRLPLGSFFRLIEDGGTKLAPASK-LLQVYAREQNREMLRDFYYSDDRRV  636

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             + A L   E+ ++  +P A   S         V+ A   F+E K+  FE+K  +E+A+LL
Sbjct  637   ESAVLSLDEASQMT-DPAAILTS---------VKAAQKFFSEDKDRGFEAKMMDENARLL  686

Query  915   RIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALA  739
               Q +LE  +   I F   SI++T+RT ++ G  + A+KVK++FKV++KR++++K+ AL 
Sbjct  687   AYQQQLEKESDGKITFFGLSINETLRTLLMNGMSKKADKVKSDFKVADKRFWYVKLHALT  746

Query  738   TIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +RD++ L+ F++ KR PIGY+ FV   +E     EA  Y+ +   PR R + Y   G
Sbjct  747   AMRDFEGLDAFARSKRSPIGYEAFVRHLLEKGHSKEATSYVIRCDSPR-RVDLYVECG  803



>gb|KIK24542.1| hypothetical protein PISMIDRAFT_645755 [Pisolithus microcarpus 
441]
Length=841

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 111/199 (56%), Gaps = 12/199 (6%)
 Frame = -3

Query  1170  LFISYARLYKHEFLKDFFLSTGQLQDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEK  991
             L   YAR    E L+DF+ S  +  + A L  +E+  +                I  V+ 
Sbjct  608   LLQVYAREQNKEMLRDFYYSDDRRVESAVLALEEASRMTDQTAV----------ITSVKA  657

Query  990   AHGLFAETKEHVFESKAAEEHAKLLRIQHELEVTT-KQAIFVDSSISDTIRTCIVLGNHR  814
             A   F+E K+  FE+K  +E+A+LL +Q +LE      A F   S+S+TIR C++ G   
Sbjct  658   AEKFFSEDKDRNFEAKMMDENARLLAVQQQLEKDAPGNAKFFGLSVSETIRACVMNGMSN  717

Query  813   AANKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKG  634
              A++VK++FKV +KR++ +K+ AL T+RD+DALE F++ KR PIGY+ FV   VEA    
Sbjct  718   RADRVKSDFKVPDKRFWHIKLRALITMRDFDALEAFARSKRSPIGYEVFVRQLVEAGHPR  777

Query  633   EALKYIPKLADPRERAEAY  577
             EA  Y+ +   PR R E Y
Sbjct  778   EAAMYVVRCDAPR-RVELY  795



>ref|XP_007248949.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Astyanax mexicanus]
Length=835

 Score =   122 bits (305),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 130/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+ ++  +    + F T++++P+   L+  + +  + + LKD F      Q++   
Sbjct  570   LVYTVVTYLKNEMNRGDFFMTLRNQPVALSLYRQFCKHQEQDTLKDLFNQDDDHQELGNF  629

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               K S+         K   L   R+  ++ A   + + K   F +K  EE  +LLR Q +
Sbjct  630   YVKASY---------KEKRLEA-RVAHLQSAVDEYNKAKNE-FAAKTTEEEMRLLRFQKK  678

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE    +++ V  S+ DT+RT + +G H+ A ++  +FKV +KR++WLK+ ALA   DW+
Sbjct  679   LEEEKGESL-VGFSLHDTLRTLLAVGLHKHAEQLYKDFKVPDKRFWWLKLTALAEKEDWE  737

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKF+K K+ PIGY PFVE CV+  +K EA KY+ ++  P ++ +A+  +G
Sbjct  738   ELEKFAKSKKSPIGYLPFVEVCVKHHNKYEAKKYVSRVT-PEQKVKAHLAVG  788



>dbj|BAB64892.1| Vps16 [Mus musculus]
Length=839

 Score =   122 bits (305),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 130/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  +    + F T++++P+   L+  + +  + + LKD +      Q++   
Sbjct  573   LVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNHQELGSF  632

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+   +         + G R+  ++ A   F + K   F +KA E+  +LLRIQ  
Sbjct  633   HIRASYAAEER--------IEG-RVAALQTAADAFYKAKNE-FAAKATEDQMRLLRIQRR  682

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE       F+D S+ DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+
Sbjct  683   LE-DELGGRFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWE  741

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  742   ELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  792



>sp|Q920Q4.3|VPS16_MOUSE RecName: Full=Vacuolar protein sorting-associated protein 16 
homolog; Short=mVPS16 [Mus musculus]
Length=839

 Score =   122 bits (305),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 130/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  +    + F T++++P+   L+  + +  + + LKD +      Q++   
Sbjct  573   LVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNHQELGSF  632

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+   +         + G R+  ++ A   F + K   F +KA E+  +LLRIQ  
Sbjct  633   HIRASYAAEER--------IEG-RVAALQTAADAFYKAKNE-FAAKATEDQMRLLRIQRR  682

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE       F+D S+ DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+
Sbjct  683   LE-DELGGRFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWE  741

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  742   ELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  792



>dbj|BAC33966.1| unnamed protein product [Mus musculus]
Length=839

 Score =   122 bits (305),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 130/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  +    + F T++++P+   L+  + +  + + LKD +      Q++   
Sbjct  573   LVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNHQELGSF  632

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+   +         + G R+  ++ A   F + K   F +KA E+  +LLRIQ  
Sbjct  633   HIRASYAAEER--------IEG-RVAALQTAADAFYKAKNE-FAAKATEDQMRLLRIQRR  682

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE       F+D S+ DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+
Sbjct  683   LE-DELGGRFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWE  741

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  742   ELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  792



>ref|NP_085036.3| vacuolar protein sorting-associated protein 16 homolog [Mus musculus]
 gb|EDL28271.1| vacuolar protein sorting 16 (yeast) [Mus musculus]
Length=839

 Score =   122 bits (305),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 130/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  +    + F T++++P+   L+  + +  + + LKD +      Q++   
Sbjct  573   LVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNHQELGSF  632

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+   +         + G R+  ++ A   F + K   F +KA E+  +LLRIQ  
Sbjct  633   HIRASYAAEER--------IEG-RVAALQTAADAFYKAKNE-FAAKATEDQMRLLRIQRR  682

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE       F+D S+ DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+
Sbjct  683   LE-DELGGRFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWE  741

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  742   ELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  792



>gb|KDQ19047.1| hypothetical protein BOTBODRAFT_28535 [Botryobasidium botryosum 
FD-172 SS1]
Length=846

 Score =   122 bits (305),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 131/236 (56%), Gaps = 17/236 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRP---LPRDLFISYARLYKHEFLKDFFLSTGQLQDV  1090
             LVY VLLH+ ++R  L  F  + S P      +L   YAR  + E LKD++    +  D 
Sbjct  582   LVYHVLLHL-KRRLNLGDFFRLVSEPSLVTASNLLKVYARETEREMLKDYYYMEDKRVDS  640

Query  1089  AFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRI  910
             A L    S E +++   ++       RI  ++ A   F+E  +H FE+KA +E  +LL  
Sbjct  641   AVL----SLEDSEDKEVTE-------RISAIKTAAKFFSEDADHSFEAKAMDEALRLLVF  689

Query  909   QHELEVTTK-QAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATI  733
             Q +LE  +  Q  +V  S+++T+  C V G  + A+++K +++V +KR+++ K++AL +I
Sbjct  690   QQQLEKDSDGQKKYVGLSVNETMAACFVNGLAKKADRIKADWRVPDKRYWYTKLYALTSI  749

Query  732   RDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             RD+D L+ F++ KR PIGY+PFV          +A  Y+ +  DP +RA+ +   G
Sbjct  750   RDFDGLDAFARSKRSPIGYEPFVNHLASKGFNKQAAAYVSR-CDPAKRADMFVACG  804



>gb|AAH25626.1| Vacuolar protein sorting 16 (yeast) [Mus musculus]
Length=839

 Score =   122 bits (305),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 130/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  +    + F T++++P+   L+  + +  + + LKD +      Q++   
Sbjct  573   LVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNHQELGSF  632

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+   +         + G R+  ++ A   F + K   F +KA E+  +LLRIQ  
Sbjct  633   HIRASYAAEER--------IEG-RVAALQMAADAFYKAKNE-FAAKATEDQMRLLRIQRR  682

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE       F+D S+ DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+
Sbjct  683   LE-DELGGRFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWE  741

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  742   ELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  792



>ref|XP_010862318.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Esox lucius]
Length=835

 Score =   121 bits (304),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 126/232 (54%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+ ++  +    + F T++++P+   L+  + +  + E LKD F       ++   
Sbjct  570   LVYTVVTYLKNEMNRGDFFMTLRNQPVALSLYRQFCKHQEQETLKDLFNQDDDHHELGNF  629

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+         K S L   R+ L++ A   + + K   F +KA EE  KLLR Q  
Sbjct  630   YVRASY---------KESKLEA-RLSLLQSAVDEYNKAKNE-FAAKATEEEMKLLRFQRR  678

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +A+    S+ DT+   +    H+ A ++  +F+V +KR++WLK+ ALA   DWD
Sbjct  679   LDEEKGEALL-GLSLHDTLHALLSANYHKQAEQLYRDFRVPDKRYWWLKLTALAEKEDWD  737

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKF+K K+ PIGY PFVE CV+  +K EA KY+ K+  P ++ +A+  IG
Sbjct  738   ELEKFAKSKKSPIGYLPFVEVCVKRHNKYEAKKYVSKVT-PEQKVKAHLAIG  788



>ref|XP_003394905.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Bombus terrestris]
Length=835

 Score =   121 bits (304),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 120/220 (55%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+ +  P  +   +I   PL   L+I Y + +  E L+D +         A  
Sbjct  572   LVYTVILHLRENMPLGDFQMSIMHCPLAMALYIKYCQNHNRETLRDIYNQYDDFHSQAIW  631

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++  KN M+         R  L++ A   F   +     +   EE  KLLR Q  
Sbjct  632   FITESYQ-RKNTMS---------REALLQSAQENFKLARNDT-NAALTEEQIKLLRYQRS  680

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             +E   K+ I V   + DT++  ++   ++ A+K+++E+K+S++R++WL++  LA    W+
Sbjct  681   MEDVLKKPI-VGKPLQDTVKLLLLRNEYKLADKLRSEYKISDRRYWWLRIQCLAEQGVWN  739

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              LEKFSK K+ PIGY+PF++ C++  ++ EA KY+PK+ D
Sbjct  740   ELEKFSKSKKSPIGYEPFIDQCLKYNEEREAKKYLPKVRD  779



>gb|KIY70700.1| vacuolar assembling/sorting protein VPS16 [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=843

 Score =   121 bits (304),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 83/239 (35%), Positives = 130/239 (54%), Gaps = 20/239 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELF------GTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQL  1099
             LVY VLL +  +R AL  F      G  +  P  R L   YAR      L+DF+ S  + 
Sbjct  576   LVYTVLLQL-HRRLALGDFFRLLEDGGEKLVPASR-LLQVYAREQNRSMLRDFYYSDDRR  633

Query  1098  QDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKL  919
              + A L   ES  +  +P A         ++  V+ A   F+E K+  FE+K  +E+ +L
Sbjct  634   VESAVLALDESTTMM-DPAA---------KLTSVKSAQKFFSEDKDRGFEAKMMDEYGRL  683

Query  918   LRIQHELEVTTK-QAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFAL  742
             L +Q +LE     + +    S+++TIR C+  G  + A+KVK++FKV +KR++ +K+ AL
Sbjct  684   LALQQQLEKDADGRVVLYGLSVTETIRACLTNGLSKKADKVKSDFKVPDKRFWHVKLNAL  743

Query  741   ATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
                +D+D L+ F+K KR PIGY+PFV   +E +   EA+ Y+ +   P+ RA+ YA  G
Sbjct  744   VEQQDFDGLDAFAKSKRSPIGYEPFVRRLLEHKHSKEAIAYVARCDSPK-RADLYAECG  801



>gb|EMS22549.1| vacuolar protein sorting VPS16 [Rhodosporidium toruloides NP11]
 emb|CDR46740.1| RHTO0S13e00848g1_1 [Rhodosporidium toruloides]
Length=956

 Score =   122 bits (305),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 113/193 (59%), Gaps = 3/193 (2%)
 Frame = -3

Query  1017  GPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHELEVTTKQA--IFVDSSISDTI  844
             G ++  V +A   F+E KE  FE+K  ++H +LL  Q +LE  +  +   FV  S+++TI
Sbjct  760   GDKVAKVRQAQKSFSEDKERSFETKMVDDHIRLLVFQQQLEQDSAASGKTFVGLSVNETI  819

Query  843   RTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKPFV  664
             R CI+ G  + A KV++EFKV +KR+++LK+ +L ++RDWDAL+ F++ K+ PIGY+P+V
Sbjct  820   RQCILAGMDKKAEKVRSEFKVPDKRFWYLKLRSLISLRDWDALDTFARTKKSPIGYEPWV  879

Query  663   EACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaadaasqakDGELLGRLKLTFSQ  484
             +  + A    +A+KY+ +  D R R E Y   G    A     +  +   L  +K     
Sbjct  880   DELIRAGAHRQAVKYVER-CDVRNRVELYVKCGEWVMAGQECVRRGESGRLHDIKARSPN  938

Query  483   NAAAASIFDTLRD  445
             N  AA + + L+D
Sbjct  939   NIIAAQLDELLQD  951



>ref|XP_005278471.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Chrysemys picta bellii]
Length=862

 Score =   121 bits (303),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 126/228 (55%), Gaps = 12/228 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q +P+   L+  + +  + E LKD +      Q++   
Sbjct  596   LVYTVVLHLKNELNRGTFFMTLQKQPVALSLYRQFCKHQELETLKDLYNQDDDHQELGNF  655

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   K         + G R+  ++ A   + + K   F +KA E+  KLLR+Q  
Sbjct  656   HVHSSYSSEKR--------IEG-RVAALQNAVDEYYKAKNE-FAAKATEDQIKLLRMQRR  705

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  +VD S+ DT+   I+ GNH+ A ++  +F++ +KR++WLK+ ALA   DW+
Sbjct  706   LQDELDKP-YVDYSLHDTVYGLILDGNHKRAEQLYRDFRIPDKRFWWLKIGALAEREDWE  764

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAY  577
              +EKFSK K+ P+GY PFVE C++  ++ EA KY  ++  P +R +A+
Sbjct  765   EMEKFSKSKKSPVGYLPFVEICMKHHNRHEAKKYAARVT-PEQRVKAH  811



>ref|XP_010566769.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Haliaeetus leucocephalus]
Length=838

 Score =   120 bits (302),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 128/232 (55%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+L +  +      F T+Q++P+   L+  + +  + E LKD +      Q++   
Sbjct  573   LVYTVVLLLKNELNRGTFFMTLQNQPVALSLYRQFCKHQERETLKDLYNQDDNHQELGNF  632

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         + G R+  ++ A   + + K   F +KA E+  KLLR+Q  
Sbjct  633   HVHSSYSEKR---------IEG-RVGALQNALDEYYKAKNE-FAAKATEDQIKLLRLQRH  681

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  ++D S+ DT+   I+ G+H+ A ++  EFK+ +KR++WLK+ ALA   DW+
Sbjct  682   LQEDFDKP-YLDLSLHDTVSNLILDGHHKRAEQLYREFKIPDKRYWWLKISALANRGDWE  740

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  741   EMEKFSKSKKSPIGYLPFVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  791



>gb|KFP03155.1| Vacuolar protein sorting-associated protein 16, partial [Calypte 
anna]
Length=713

 Score =   120 bits (301),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 125/224 (56%), Gaps = 13/224 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + +  + E LKD +      Q++   
Sbjct  502   LVYTVVLHLKNELTRGTFFMTLQNQPVALSLYRQFCKHQERETLKDLYNQDDNHQELGNF  561

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         + G R+  ++ A   F + K   F +KA E+  KLLR+Q  
Sbjct  562   HVHSSYSEKR---------IEG-RVGALQNALDEFYKAKNE-FAAKATEDQIKLLRLQRH  610

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  ++D S+ DT+   I+ G+H+ A ++  +FK+ +KR++WLK+ ALAT  DW+
Sbjct  611   LQEDLNRP-YLDLSLHDTVSNLILEGHHKRAEQLYRDFKIPDKRYWWLKISALATRGDWE  669

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRER  589
              +EKFS+ K+ PIGY PFVE  V+  ++ EA KY P++  P +R
Sbjct  670   EMEKFSRSKKSPIGYWPFVEISVKHHNRYEAKKYAPRVP-PEQR  712



>ref|XP_005365673.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Microtus ochrogaster]
Length=695

 Score =   120 bits (300),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 129/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  +    + F T++++P+   L+  + +  + + LKD +      Q++   
Sbjct  429   LVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNHQELGSF  488

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+   +         + G R+  ++ A   F + K   F +KA E+  KLLR+Q  
Sbjct  489   HIRASYAAEER--------IEG-RVAALQTAADAFYKAKNE-FAAKATEDQMKLLRLQRR  538

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE       F+D S+ DT+ T I  G+++ A ++  +F++ +KR +WLK+ ALA + DW+
Sbjct  539   LE-DELGGQFLDLSLHDTVATLIRGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWE  597

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  598   ELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  648



>ref|XP_005365672.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Microtus ochrogaster]
Length=839

 Score =   120 bits (300),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 129/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  +    + F T++++P+   L+  + +  + + LKD +      Q++   
Sbjct  573   LVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNHQELGSF  632

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+   +         + G R+  ++ A   F + K   F +KA E+  KLLR+Q  
Sbjct  633   HIRASYAAEER--------IEG-RVAALQTAADAFYKAKNE-FAAKATEDQMKLLRLQRR  682

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE       F+D S+ DT+ T I  G+++ A ++  +F++ +KR +WLK+ ALA + DW+
Sbjct  683   LE-DELGGQFLDLSLHDTVATLIRGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWE  741

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  742   ELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>gb|ELU17286.1| hypothetical protein CAPTEDRAFT_168734 [Capitella teleta]
Length=819

 Score =   120 bits (300),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 120/232 (52%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY VLLH+    P  E    I++      L+I Y R      L+D         D A  
Sbjct  555   LVYTVLLHLQDTMPHGEFLMAIRNMDAAHSLYIQYCRDTNKNILQDIHYQEDNFFDGANC  614

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                +S+E  +  M +        R   +  A   F + K + + +K  EE  KLLR Q  
Sbjct  615   KVIDSYE--EETMEA--------RFGCLTSAQENFTKGK-YEWAAKQTEEQIKLLRYQRR  663

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE    +A ++D S+ +T+R  I  GN +   +++ EFKV ++R++WLKV A +   D+ 
Sbjct  664   LEEEFSRA-YLDLSLHETMRKLIAEGNTKVVEQMRKEFKVPDRRFWWLKVIAFSESGDFI  722

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY+PFVE C++  ++ EA KY+ +++ P  R + Y  +G
Sbjct  723   ELEKFSKSKKSPIGYEPFVEECMKQGNQTEAQKYLTRVS-PEHRVQCYVRVG  773



>ref|XP_005839798.1| hypothetical protein GUITHDRAFT_161084 [Guillardia theta CCMP2712]
 gb|EKX52818.1| hypothetical protein GUITHDRAFT_161084 [Guillardia theta CCMP2712]
Length=824

 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 121/236 (51%), Gaps = 13/236 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+L +LH+ + +   + F ++      +DL + Y++   H  L+    +     +    
Sbjct  557   LVFLAMLHMQKSKTTSDFFQSVLRHQTAKDLMLLYSKQQDHTLLRQLCQAMEAPHEAGSQ  616

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHV--FESKAAEEHAKLLRIQ  907
             L  ES+   K P  ++       R K +E A  LF+++K+      +K  EE  +L   Q
Sbjct  617   LLLESF---KAPDVTR-------RRKGMELAMSLFSQSKDESAKLMAKHTEEQIRLQEAQ  666

Query  906   HELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRD  727
              ELE  T +++F D+S S+T+R C V   H    ++  + K SEK  + LKV  LA   D
Sbjct  667   LELEQATGRSVFFDTSASETVRLCFVYNQHSRGLRIAKDMKFSEKLLWSLKVSGLAEGHD  726

Query  726   WDALEKFSKEKR-PPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGM  562
             W  LEKFSKE++ PPIG++ FVEAC+      E +KY  K+ D   ++E    +GM
Sbjct  727   WKELEKFSKERKTPPIGFELFVEACIRENRFDEGMKYAMKMTDMARKSELCVRMGM  782



>gb|KIO15844.1| hypothetical protein M407DRAFT_235273 [Tulasnella calospora MUT 
4182]
Length=511

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 116/204 (57%), Gaps = 12/204 (6%)
 Frame = -3

Query  1173  DLFISYARLYKHEFLKDFFLSTGQLQDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVE  994
             +L   YAR    E L+D++    +  D A L   ++     N            R++ V 
Sbjct  209   NLLQVYAREQNRELLRDYYFQDDRRVDSACLALDDASRAQTNE----------ERLEAVS  258

Query  993   KAHGLFAETKEHVFESKAAEEHAKLLRIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNH  817
             KA   FAE K+  FE+KA +E+AKLL +Q  LE      I FV  S++DTIR CI  G  
Sbjct  259   KAAKFFAEDKDRGFEAKAMDEYAKLLALQKLLEDEAGGKISFVGLSVNDTIRRCITTGYL  318

Query  816   RAANKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDK  637
             + A++++++FKV EKR++++K++AL   +D+D LE F+K KR PIGY+PF+   +++   
Sbjct  319   KRADRIRSDFKVPEKRFWYIKLYALTETKDFDGLEAFAKSKRSPIGYEPFINHLIKSGYL  378

Query  636   GEALKYIPKLADPRERAEAYAGIG  565
              +A  Y+P+  D + RA+ Y   G
Sbjct  379   KQAASYVPR-CDAKTRADLYVRCG  401



>ref|XP_005463829.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Oreochromis niloticus]
Length=690

 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 129/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+ ++  +    + F T++++P+   L+  + +L + E LKD +      Q++A  
Sbjct  426   LVYTVVSYLKNEMNRGDFFMTLRNQPVALSLYRQFCKLQEQETLKDLYNQDDDHQELANY  485

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         L G R+ L++ A   + + K   F  KA E+  +LLR Q +
Sbjct  486   YVTASYREKR---------LEG-RLSLLQSAVDEYNKAKNE-FAVKATEDEMRLLRFQRK  534

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+   K A  +  S+  T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD
Sbjct  535   LD-DEKGAGLLGLSLQVTMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWD  593

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  594   ELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  644



>ref|XP_003458681.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Oreochromis niloticus]
Length=834

 Score =   119 bits (299),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 129/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+ ++  +    + F T++++P+   L+  + +L + E LKD +      Q++A  
Sbjct  570   LVYTVVSYLKNEMNRGDFFMTLRNQPVALSLYRQFCKLQEQETLKDLYNQDDDHQELANY  629

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         L G R+ L++ A   + + K   F  KA E+  +LLR Q +
Sbjct  630   YVTASYREKR---------LEG-RLSLLQSAVDEYNKAKNE-FAVKATEDEMRLLRFQRK  678

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+   K A  +  S+  T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD
Sbjct  679   LD-DEKGAGLLGLSLQVTMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWD  737

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  738   ELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  788



>ref|XP_007313955.1| hypothetical protein SERLADRAFT_365727 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO29713.1| hypothetical protein SERLADRAFT_365727 [Serpula lacrymans var. 
lacrymans S7.9]
Length=845

 Score =   119 bits (299),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 125/237 (53%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQ---SRPLPRD-LFISYARLYKHEFLKDFFLSTGQLQD  1093
             LVY VLLH+ ++ P    F  I+   SR  P   L   YAR    + L+DF+ S  +  +
Sbjct  578   LVYHVLLHLHKRLPLGSFFRLIEDGGSRLAPASKLLQVYAREQNRDMLRDFYYSDDRRVE  637

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L   E+  +  +P A         +I  V+ A   F+E K+  FE+K  +E  +LL 
Sbjct  638   SATLCLDEASRMI-DPNA---------KITSVKAAQKFFSEDKDRSFEAKMMDESVRLLT  687

Query  912   IQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
              Q +LE      + F   SI++T+RTC++ G  + A+K++ +FKV +KR++ LK+ AL  
Sbjct  688   YQQQLEKEADGKVAFFGQSINETLRTCLINGMSKRADKIRADFKVPDKRFWHLKLHALTH  747

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             IRD+DAL+  ++ KR PIGY  FV    +     EA  Y+ +   P+ R + Y   G
Sbjct  748   IRDFDALDALARSKRSPIGYDAFVHHLADRGHLKEAAAYVVRCDLPK-RVDLYVECG  803



>ref|XP_009052918.1| hypothetical protein LOTGIDRAFT_115951 [Lottia gigantea]
 gb|ESO96565.1| hypothetical protein LOTGIDRAFT_115951 [Lottia gigantea]
Length=827

 Score =   119 bits (299),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 92/280 (33%), Positives = 154/280 (55%), Gaps = 15/280 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPAL-ELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAF  1084
             LVY VLL + +K   + E F  I+  P+   L+I Y R    + ++D +      Q+  F
Sbjct  560   LVYTVLLTMKEKISNMGEFFMAIRQMPVAYSLYIQYCRQQNPKVVEDLYY-----QEDNF  614

Query  1083  LLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQH  904
             L      E     + S    +   R++ +E A   + + K   F +K  E+  KLL++Q 
Sbjct  615   LA-----EGNCKVIRSFSEDIFEDRVRKLEAAINCYQKAKME-FAAKQTEDQIKLLKLQR  668

Query  903   ELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDW  724
             +LE  T +  ++D SI DT+      GNH+ A +++ +FKV +KR++ +++ ALA   DW
Sbjct  669   KLEDETNKP-YLDLSIQDTMYRLTQNGNHKLAEQIRKDFKVPDKRFWLMRMSALAESGDW  727

Query  723   DALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGMakeaad  544
               LEKFSK K+PP+G + FV  C++  ++ EA+KY+ ++  P ++ +A   IG AKEAAD
Sbjct  728   MELEKFSKTKKPPVGMEAFVNICMKYNNRSEAMKYLSRVL-PDQKVQALLNIGNAKEAAD  786

Query  543   aasqakDGELLGRLKLTFSQNAAAASIFDTLRDRLTFQGT  424
             AA + +  E LG L LT + N+    + ++++D +    T
Sbjct  787   AAFEMRSEEGLG-LVLTKAINSNNKQLVESVKDMMNRVNT  825



>ref|XP_006500493.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Mus musculus]
Length=836

 Score =   119 bits (299),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 128/229 (56%), Gaps = 12/229 (5%)
 Frame = -3

Query  1251  LVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFLLWK  1072
             LVLLH+  +    + F T++++P+   L+  + +  + + LKD +      Q++     +
Sbjct  573   LVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNHQELGSFHIR  632

Query  1071  ESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHELEV  892
              S+   +         + G R+  ++ A   F + K   F +KA E+  +LLRIQ  LE 
Sbjct  633   ASYAAEER--------IEG-RVAALQTAADAFYKAKNE-FAAKATEDQMRLLRIQRRLE-  681

Query  891   TTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWDALE  712
                   F+D S+ DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+ LE
Sbjct  682   DELGGRFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWEELE  741

Query  711   KFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             KFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  742   KFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVG-PEQKVKALLLVG  789



>gb|KDR24089.1| Vacuolar protein sorting-associated protein 16-like protein [Zootermopsis 
nevadensis]
Length=834

 Score =   119 bits (298),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/233 (31%), Positives = 128/233 (55%), Gaps = 13/233 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY VLLH+ +  P  E    +++ P+ + L++ Y R +  E L+D ++        A  
Sbjct  569   LVYTVLLHLRENMPLGEFQMAVRNYPVAQALYLKYCRDHNRETLRDIYVQEDDYNAQAAC  628

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               +E ++  KN +  + S         +  A   +   +   F +   EE  KLLR Q  
Sbjct  629   FIREIYD-PKNTLTVEAS---------LSAAQESYRRARNE-FSAGLCEEQQKLLRYQKT  677

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE   ++  FV  S+ DT+   ++L   + A+K++ E++V+++R++WL++ +L+ + +W 
Sbjct  678   LEEKFRRE-FVGRSLHDTVYLLLLLQETKLADKLRAEYRVTDRRYWWLRILSLSELGEWM  736

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIGM  562
              L+KFSK K+ PIG +PFV+ C++ E+K EA KY+PK+ D   + + Y   GM
Sbjct  737   ELDKFSKSKKSPIGIEPFVDVCLKYENKYEAQKYLPKVKD-ELKVKYYVKTGM  788



>ref|XP_007922652.1| hypothetical protein MYCFIDRAFT_60175 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME85262.1| hypothetical protein MYCFIDRAFT_60175 [Pseudocercospora fijiensis 
CIRAD86]
Length=825

 Score =   119 bits (298),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 121/235 (51%), Gaps = 12/235 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLL++ +K P    F TI SRP+   +  + A     E LKD +    +  D A L
Sbjct  558   LVFYVLLNLKKKIPLSSFFRTINSRPVATAIVEASAIDQDQEMLKDLYYQDDRRLDGANL  617

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             L  E+   +            GP    ++ A  L  ++KE   ++ A EE  KLLR+Q  
Sbjct  618   LVTEALTASD----------VGPASDKLKMATKLLRDSKEFALQATALEEAQKLLRLQEA  667

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
              E     A +V  S+++T+   I  GN + + K++TEFKVS+K ++W+++ AL + RDW 
Sbjct  668   FEKDLVNARYVGLSVNETLSKLIKTGNIKRSQKLQTEFKVSDKTYWWIRLRALVSRRDWR  727

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLA--DPRERAEAYAGIGM  562
              LE+ SK+++ PIG++PF    + A     A  +I K     P ER E +   GM
Sbjct  728   ELEEVSKQRKSPIGWEPFFNEILGAGQPKVAAAFISKCTSLSPAERIEMWVKCGM  782



>gb|KGL93811.1| Vacuolar protein sorting-associated protein 16, partial [Charadrius 
vociferus]
Length=696

 Score =   118 bits (296),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 124/225 (55%), Gaps = 13/225 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + +  + E LKD +      Q++   
Sbjct  485   LVYTVVLHLKNELNRGTFFMTLQNQPVALSLYRQFCKHQERETLKDLYNQDDNHQELGNF  544

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         + G R+  ++ A   + + K   F +KA E+  KLLR+Q  
Sbjct  545   HVHSSYSEKR---------IEG-RVGALQNALDEYYKAKNE-FAAKATEDQIKLLRLQRH  593

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +  ++D S+ DT+   I+ G+H+ A ++  EFK+ +K+++WLK+ ALA   DW+
Sbjct  594   LQEDFDKP-YLDLSLHDTVSNLILDGHHKRAEQLYREFKIPDKKYWWLKISALANRGDWE  652

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERA  586
              +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++  P +R 
Sbjct  653   EMEKFSKSKKSPIGYLPFVEISVKHHNRYEAKKYAPRVT-PEQRV  696



>ref|XP_007873551.1| hypothetical protein, variant [Pneumocystis murina B123]
 gb|EMR10341.1| hypothetical protein, variant [Pneumocystis murina B123]
Length=733

 Score =   118 bits (296),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 125/235 (53%), Gaps = 14/235 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV  V+L++  K P    F  I+ + +   +  +YA+    E LKDF+    +  D A +
Sbjct  466   LVLYVILYLRDKLPLAHFFQIIRDKAVAVSVLEAYAKDNDLELLKDFYYQDDRRSDSANI  525

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             +  ES       + +    L   ++KL   + GL+ E KE +FE K  EE  KLL +Q  
Sbjct  526   ILLES-------LKTCNIDLKIEKLKL---SLGLYKEYKEFLFEIKNLEEQIKLLDLQKS  575

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
              E     + F+  S+++TI   I L    AA K+K EFK+  KR++WLK+ AL  IRDW+
Sbjct  576   FEKEFHDS-FIGLSVNETIFKLIKLNQMIAALKIKAEFKIPIKRFWWLKLRALVAIRDWE  634

Query  720   ALEKF-SKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD--PRERAEAYAGIG  565
              +E + +K K+ PIG++PFV  C+ A +K  A  +IPK  +  P  R E +  +G
Sbjct  635   QIENWVNKSKKSPIGFEPFVSECLAAGNKKIAASFIPKCFELAPAFRTELWVKVG  689



>ref|XP_008852713.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Nannospalax galili]
Length=839

 Score =   119 bits (297),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 129/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  +    + F T++++P+   L+  + +  + + LKD +      Q++   
Sbjct  573   LVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNHQELGSF  632

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+   +         + G R+  ++ A   F + K   F +KA E+  KLLR+Q  
Sbjct  633   HIRASYAAEER--------IEG-RVAALQTAADAFYKAKNE-FAAKATEDQMKLLRLQRR  682

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+       F+D  + DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+
Sbjct  683   LQ-DELGGQFLDLPLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWE  741

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  742   ELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  792



>gb|KDQ58687.1| hypothetical protein JAAARDRAFT_57575 [Jaapia argillacea MUCL 
33604]
Length=863

 Score =   119 bits (297),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 127/238 (53%), Gaps = 18/238 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELF-----GTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQ  1096
             LVY VLLH+ +  P    F     G  Q  P   +L   YAR    + L+DF+ S  +  
Sbjct  596   LVYHVLLHLHKSMPLGSFFRLIEDGGDQLAP-AGELLQVYAREQNRDMLRDFYYSDDRRV  654

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             + A L  +E+  +  +P A         +I  ++ A   F+E KE  FE+K  +E+++LL
Sbjct  655   ESAVLCLEEAATMT-DPSA---------KITSIKAAQKFFSEDKERGFEAKMMDEYSRLL  704

Query  915   RIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALA  739
               Q +LE      I F   ++++T+ TC++ G  + A+K+K +FK+ +KR++++K+ AL 
Sbjct  705   AFQQQLEKEVDGKISFFGQNVNETLTTCLMNGMSKRADKLKADFKIPDKRFWFVKLHALT  764

Query  738   TIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
               RD++ L+ F+K +R PIGY+ FV   VE     EA  Y+ +  D  +R + Y   G
Sbjct  765   ATRDFEGLDAFAKSRRSPIGYEAFVRHLVEKGHGKEASTYVAR-CDANKRVDLYVECG  821



>ref|XP_007873550.1| hypothetical protein PNEG_01594 [Pneumocystis murina B123]
 gb|EMR10340.1| hypothetical protein PNEG_01594 [Pneumocystis murina B123]
Length=815

 Score =   118 bits (296),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 125/235 (53%), Gaps = 14/235 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV  V+L++  K P    F  I+ + +   +  +YA+    E LKDF+    +  D A +
Sbjct  548   LVLYVILYLRDKLPLAHFFQIIRDKAVAVSVLEAYAKDNDLELLKDFYYQDDRRSDSANI  607

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             +  ES +     +          +I+ ++ + GL+ E KE +FE K  EE  KLL +Q  
Sbjct  608   ILLESLKTCNIDL----------KIEKLKLSLGLYKEYKEFLFEIKNLEEQIKLLDLQKS  657

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
              E     + F+  S+++TI   I L    AA K+K EFK+  KR++WLK+ AL  IRDW+
Sbjct  658   FEKEFHDS-FIGLSVNETIFKLIKLNQMIAALKIKAEFKIPIKRFWWLKLRALVAIRDWE  716

Query  720   ALEKF-SKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD--PRERAEAYAGIG  565
              +E + +K K+ PIG++PFV  C+ A +K  A  +IPK  +  P  R E +  +G
Sbjct  717   QIENWVNKSKKSPIGFEPFVSECLAAGNKKIAASFIPKCFELAPAFRTELWVKVG  771



>gb|KIL59455.1| hypothetical protein M378DRAFT_85025 [Amanita muscaria Koide 
BX008]
Length=844

 Score =   118 bits (296),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 121/237 (51%), Gaps = 16/237 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSR----PLPRDLFISYARLYKHEFLKDFFLSTGQLQD  1093
             LVY VLL + ++ P  + F  I+           L   YAR    E L+DF+ S  +  +
Sbjct  577   LVYQVLLDLHKRLPLGDFFRLIEDGGPKLTSASKLLQVYAREQNREMLRDFYYSDDRRVE  636

Query  1092  VAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLR  913
              A L   E+  +               ++  V+ A   F+E K+  FE+K  +E  +LL 
Sbjct  637   SAVLSLDEASRMTD----------QSAKVMAVKAAQKFFSEDKDRAFEAKMMDESVRLLT  686

Query  912   IQHELEVTTKQAIFV-DSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALAT  736
             +Q +LE  T   + V    +++TI+ C +    + A+K+K +FKV +KR+++LK+ AL  
Sbjct  687   LQEQLEKETDGKVPVFGLCVNETIKKCCMNDMSKRADKIKADFKVPDKRFWYLKLHALTE  746

Query  735   IRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             IRD+  LE F+K KR PIGY+PFV   V      EA++Y+ +   P+ R + Y   G
Sbjct  747   IRDFQGLEAFAKSKRSPIGYEPFVRYLVSKGHSKEAIQYVARCDSPK-RMDLYIECG  802



>ref|NP_001091659.1| vacuolar protein sorting-associated protein 16 homolog [Danio 
rerio]
 gb|AAI39871.1| MGC162584 protein [Danio rerio]
Length=835

 Score =   118 bits (296),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 129/232 (56%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V++++  +    + F  ++++P+   L+  + +  + + LKD F      +++   
Sbjct  570   LVYTVVMYLKNELNRGDFFMMLRNQPVALSLYRQFCKHQEQDTLKDLFNQDDDHEELGNF  629

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               K S+         K   L   RI L++ A   + + K   F +K+ E+  +LLR Q +
Sbjct  630   YVKASY---------KEQRLEA-RIALLQSAVDEYYKAKNE-FSAKSTEDEMRLLRFQRK  678

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE   K    V  S+ DT+ T + +G H+ A ++  +F+V +KR++WLK+ ALA   DWD
Sbjct  679   LE-EEKGEPLVGFSLHDTMTTLLSVGLHKHAEQLYKDFRVPDKRFWWLKLKALAEKEDWD  737

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKF+K K+ PIGY PFV+ C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  738   ELEKFAKSKKSPIGYLPFVDVCIKHHNKYEARKYVSKVT-PEQKVKAHLAVG  788



>ref|XP_005735067.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Pundamilia nyererei]
Length=811

 Score =   118 bits (295),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 128/232 (55%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+ ++  +    + F T++++P+   L+  + +L + E LKD +      Q++A  
Sbjct  547   LVYTVVSYLKNEMNRGDFFMTLRNQPVALSLYRQFCKLQEQETLKDLYNQDDDHQELANY  606

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         L G R+ L++ A   + + K   F  K  E+  +LLR Q +
Sbjct  607   YVTASYREKR---------LEG-RLSLLQSAVDEYNKAKNE-FAVKTTEDEMRLLRFQRK  655

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+   K A  +  S+  T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD
Sbjct  656   LD-DEKGAGLLGLSLQVTMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWD  714

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  715   ELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  765



>ref|XP_005735066.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Pundamilia nyererei]
Length=834

 Score =   118 bits (295),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 128/232 (55%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+ ++  +    + F T++++P+   L+  + +L + E LKD +      Q++A  
Sbjct  570   LVYTVVSYLKNEMNRGDFFMTLRNQPVALSLYRQFCKLQEQETLKDLYNQDDDHQELANY  629

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         L G R+ L++ A   + + K   F  K  E+  +LLR Q +
Sbjct  630   YVTASYREKR---------LEG-RLSLLQSAVDEYNKAKNE-FAVKTTEDEMRLLRFQRK  678

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+   K A  +  S+  T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD
Sbjct  679   LD-DEKGAGLLGLSLQVTMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWD  737

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  738   ELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  788



>ref|XP_005735068.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X3 [Pundamilia nyererei]
Length=690

 Score =   117 bits (294),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 128/232 (55%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+ ++  +    + F T++++P+   L+  + +L + E LKD +      Q++A  
Sbjct  426   LVYTVVSYLKNEMNRGDFFMTLRNQPVALSLYRQFCKLQEQETLKDLYNQDDDHQELANY  485

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         L G R+ L++ A   + + K   F  K  E+  +LLR Q +
Sbjct  486   YVTASYREKR---------LEG-RLSLLQSAVDEYNKAKNE-FAVKTTEDEMRLLRFQRK  534

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+   K A  +  S+  T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD
Sbjct  535   LD-DEKGAGLLGLSLQVTMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWD  593

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  594   ELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  644



>ref|XP_005951516.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Haplochromis burtoni]
Length=811

 Score =   118 bits (295),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 128/232 (55%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+ ++  +    + F T++++P+   L+  + +L + E LKD +      Q++A  
Sbjct  547   LVYTVVSYLKNEMNRGDFFMTLRNQPVALSLYRQFCKLQEQETLKDLYNQDDDHQELANY  606

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         L G R+ L++ A   + + K   F  K  E+  +LLR Q +
Sbjct  607   YVTASYREKR---------LEG-RLSLLQSAVDEYNKAKNE-FAVKTTEDEMRLLRFQRK  655

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+   K A  +  S+  T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD
Sbjct  656   LD-DEKGAGLLGLSLQVTMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWD  714

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  715   ELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  765



>ref|XP_004575656.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Maylandia zebra]
Length=834

 Score =   118 bits (295),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 128/232 (55%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+ ++  +    + F T++++P+   L+  + +L + E LKD +      Q++A  
Sbjct  570   LVYTVVSYLKNEMNRGDFFMTLRNQPVALSLYRQFCKLQEQETLKDLYNQDDDHQELANY  629

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         L G R+ L++ A   + + K   F  K  E+  +LLR Q +
Sbjct  630   YVTASYREKR---------LEG-RLSLLQSAVDEYNKAKNE-FAVKTTEDEMRLLRFQRK  678

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+   K A  +  S+  T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD
Sbjct  679   LD-DEKGAGLLGLSLQVTMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWD  737

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  738   ELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  788



>ref|XP_005951517.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X3 [Haplochromis burtoni]
Length=690

 Score =   117 bits (294),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 128/232 (55%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+ ++  +    + F T++++P+   L+  + +L + E LKD +      Q++A  
Sbjct  426   LVYTVVSYLKNEMNRGDFFMTLRNQPVALSLYRQFCKLQEQETLKDLYNQDDDHQELANY  485

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         L G R+ L++ A   + + K   F  K  E+  +LLR Q +
Sbjct  486   YVTASYREKR---------LEG-RLSLLQSAVDEYNKAKNE-FAVKTTEDEMRLLRFQRK  534

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+   K A  +  S+  T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD
Sbjct  535   LD-DEKGAGLLGLSLQVTMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWD  593

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  594   ELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  644



>ref|XP_005951515.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Haplochromis burtoni]
Length=834

 Score =   118 bits (295),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 128/232 (55%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+ ++  +    + F T++++P+   L+  + +L + E LKD +      Q++A  
Sbjct  570   LVYTVVSYLKNEMNRGDFFMTLRNQPVALSLYRQFCKLQEQETLKDLYNQDDDHQELANY  629

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   +         L G R+ L++ A   + + K   F  K  E+  +LLR Q +
Sbjct  630   YVTASYREKR---------LEG-RLSLLQSAVDEYNKAKNE-FAVKTTEDEMRLLRFQRK  678

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+   K A  +  S+  T+ T + LG H+ A ++  +F+V +KR++WLK+ +LA   +WD
Sbjct  679   LD-DEKGAGLLGLSLQVTMETLLSLGLHKQAEQLYKDFRVPDKRYWWLKLKSLAEKEEWD  737

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY  FVE C++  +K EA KY+ K+  P ++ +A+  +G
Sbjct  738   ELEKFSKSKKSPIGYLAFVEVCIKCNNKYEAKKYVSKVT-PEQKVKAHLAVG  788



>ref|XP_006636484.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Lepisosteus oculatus]
Length=835

 Score =   117 bits (294),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 127/232 (55%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+ ++  +    + F T++++P+   L+  + +  + + LKD F      Q++   
Sbjct  570   LVYTVVTYLKNEMNRGDFFMTLRNQPVALSLYRQFCKHQEQDTLKDLFNQDDDHQELGNF  629

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+   K             R+  ++ A   + + K   F +KA EE  +LLR Q  
Sbjct  630   YVRASYREGKLEA----------RLAALQSAVDEYNKAKNE-FAAKATEEQMRLLRFQRR  678

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             ++    +  F+D S+ +T+ + ++ G  R A ++  +F++ +KR++WLK+ ALA   DW+
Sbjct  679   MQEEFDRP-FMDYSLQETLHSLLMEGRIRPAEQLYKDFRIPDKRYWWLKISALAEKEDWE  737

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFS+ K+ PIGY PFVE CV+  +K EA KY+ K+  P ++ +A+  +G
Sbjct  738   ELEKFSRSKKSPIGYLPFVEICVKHHNKYEAKKYVSKVT-PEQKVKAHLAVG  788



>gb|KIO05251.1| hypothetical protein M404DRAFT_141113 [Pisolithus tinctorius 
Marx 270]
Length=841

 Score =   117 bits (293),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 111/199 (56%), Gaps = 12/199 (6%)
 Frame = -3

Query  1170  LFISYARLYKHEFLKDFFLSTGQLQDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEK  991
             L   YAR    E L+DF+ S  +  + A L   E+  +                I  V  
Sbjct  608   LLQVYAREQNREMLRDFYYSDDRRVESAVLALGEASRMTDQTAI----------ITSVRA  657

Query  990   AHGLFAETKEHVFESKAAEEHAKLLRIQHELEVTTK-QAIFVDSSISDTIRTCIVLGNHR  814
             A   F+E K+  FE+K  +E+A+LL +Q +LE  ++  A F   S+S+TIR CI+ G   
Sbjct  658   AEKFFSEDKDRSFEAKMMDENARLLAVQQQLEKDSQGNAKFFGLSVSETIRACIMNGMSN  717

Query  813   AANKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKG  634
              A++V+++FKV +KR++ +K+ AL  +RD++ALE F++ KR PIGY+ FV+  VEA    
Sbjct  718   KADRVRSDFKVPDKRFWHIKLRALIALRDFEALEVFARSKRSPIGYEVFVKQLVEAGHSR  777

Query  633   EALKYIPKLADPRERAEAY  577
             EA  Y+ +   P+ R E Y
Sbjct  778   EAAMYVVRCDAPK-RVELY  795



>ref|XP_007351763.1| vacuolar protein sorting-associated protein 16 [Auricularia delicata 
TFB-10046 SS5]
 gb|EJD40200.1| vacuolar protein sorting-associated protein 16 [Auricularia delicata 
TFB-10046 SS5]
Length=843

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 83/236 (35%), Positives = 129/236 (55%), Gaps = 22/236 (9%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALEL--FGTIQSRPLPR-----DLFISYARLYKHEFLKDFFLSTGQ  1102
             LVY VLL +   RP L+L  F  +     PR      L   YAR    E L+DF+ +  +
Sbjct  575   LVYTVLLAL---RPRLQLGDFFRLVEEGGPRLAPAASLLQVYARQQDREMLRDFYYADDR  631

Query  1101  LQDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAK  922
                 A L  +E+  + ++P+A   S         ++ A   F+E K+  FE+K  +E+ K
Sbjct  632   RVASAVLALEEASGI-EDPVAKMAS---------IKAAQKFFSEDKDRAFEAKMMDENIK  681

Query  921   LLRIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFA  745
             L+  Q +LE   +  + FV  S+S+TI+TC+V G  + A+KVK ++ V +KR++ +K+ A
Sbjct  682   LMAFQLDLEKEVEHKVKFVGLSVSETIKTCLVNGLSKKADKVKKDWVVPDKRFWHIKLQA  741

Query  744   LATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAY  577
             L  I D+DALE F+K K+ PIGY+PFV    E     +A  Y+P+  D  +R + Y
Sbjct  742   LTQIGDFDALEAFAKSKKSPIGYEPFVHHLAENGHLAQAAIYVPR-CDASKRVDLY  796



>ref|XP_009462172.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Nipponia nippon]
Length=803

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/215 (33%), Positives = 120/215 (56%), Gaps = 13/215 (6%)
 Frame = -3

Query  1209  LFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFLLWKESWELAKNPMASKG  1030
              F T+Q++P+   L+  + +  + E LKD +      Q++       S+   +       
Sbjct  555   FFMTLQNQPVALSLYRQFCKHQERETLKDLYNQDDNHQELGNFHVHSSYSEKR-------  607

Query  1029  SPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHELEVTTKQAIFVDSSISD  850
               + G R+  ++ A   + + K   F +KA E+  KLLR+Q  L+    +  ++D S+ D
Sbjct  608   --IEG-RVGALQNALDEYYKAKNE-FAAKATEDQIKLLRLQRHLQEDFDKP-YLDLSLHD  662

Query  849   TIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKP  670
             T+   I+ G+H+ A ++  EFK+ +KR++WLK+ ALA   DW+ +EKFSK K+ PIGY P
Sbjct  663   TVSNLILDGHHKRAEQLYREFKIPDKRYWWLKISALANRGDWEEMEKFSKSKKSPIGYLP  722

Query  669   FVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
             FVE  V+  ++ EA KY P++  P +R +A+  +G
Sbjct  723   FVEISVKHHNRYEAKKYAPRVT-PEQRVKAFVLVG  756



>ref|XP_499728.1| YALI0A03553p [Yarrowia lipolytica]
 emb|CAG83651.1| YALI0A03553p [Yarrowia lipolytica CLIB122]
Length=840

 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/229 (31%), Positives = 122/229 (53%), Gaps = 15/229 (7%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             L+ LV LH+       +L+  I+  P+   ++ + A++   E L+ ++  + +  D A  
Sbjct  573   LITLVQLHLQDTLSMAQLYKLIREFPIASHVYENNAKVNSKEALEQYYYQSDRQTDSANC  632

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             ++          + + G  L+  +++   KA  +++E    V ++   EE +KLL++Q +
Sbjct  633   VY----------LNALGQNLNSEKLEGFRKAASMYSEHGS-VGDAAIIEEQSKLLKLQEQ  681

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE    +  F+  S++DTI   +V+G    A K+KT+FK+SE++W WLK+ A    RDW 
Sbjct  682   LE-RDYECNFLGLSVTDTIHNLLVMGQASKALKIKTDFKISERKWTWLKLNAYVERRDWT  740

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKL---ADPRERAE  583
              L +F+  +R PIGY PF +AC+ A  K  A +YI      AD  ER +
Sbjct  741   GLMEFATSRRSPIGYVPFYDACMAAGSKRNAAEYITMTALDADVDERVQ  789



>ref|XP_006038082.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Alligator sinensis]
Length=868

 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 122/232 (53%), Gaps = 15/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+  +      F T+Q++P+   L+  + +  + E LKD +      Q++   
Sbjct  605   LVYTVVLHLKNELNRGNFFMTLQNQPVALSLYRQFCKHQERETLKDLYNQDDNHQELGNF  664

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                 S+   K         + G R+  ++ A   + + K   F +KA E+  KLLR QH 
Sbjct  665   HVHTSYANEKR--------IEG-RVAALQNAVDEYYKAKNE-FAAKATEDQIKLLRSQHR  714

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+    +          TI   I+ G H+ A ++  EFK+ +KR++WLK+ +LA   DW+
Sbjct  715   LQ----EGFGPPPXXXXTISHLILDGKHKRAEQLYREFKIPDKRFWWLKISSLAECGDWE  770

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              +EKFSK K+ PIGY PFVE CV+  ++ EA KY  ++  P +R +A+  +G
Sbjct  771   EMEKFSKSKKSPIGYLPFVEICVKYHNRHEAKKYAARVT-PEQRVKAFILVG  821



>ref|XP_001641101.1| predicted protein [Nematostella vectensis]
 gb|EDO49038.1| predicted protein [Nematostella vectensis]
Length=770

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 124/232 (53%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY+V++ + +     E    +   P+  +L++ + +      L+  +L   Q  D+A +
Sbjct  551   LVYMVIMKLKKDLKLGEFLLELSKCPVALNLYMKFCKENNPNDLESIYLMQSQFMDLANM  610

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               ++S     + + SK   L   ++   +  + ++         +K  EE  KLL  Q  
Sbjct  611   SVRKSINKELD-VESKMDCLSDAKMNYTKAGNVIY---------TKITEEQMKLLDDQSR  660

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE    Q  F ++S+SDTI  CI LG+ + A K++ +FKV +  ++W+KV ALA  R+W 
Sbjct  661   LEKEQHQE-FKNTSLSDTIEKCIELGHLKDAEKLRKDFKVPDVHYHWIKVKALAGSRNWT  719

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK ++ PIGY+PFV+ C++   + EA KYI K+  P  +A+ Y  IG
Sbjct  720   ELEKFSKSRKSPIGYEPFVDFCLQQNHRIEAEKYIAKV-QPENKAKYYLKIG  770



>ref|XP_011864427.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Vollenhovia emeryi]
Length=830

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 118/220 (54%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+ +     +   +I   PL   L+I Y + +  E L+D +         A  
Sbjct  567   LVYTVILHLRENMTLGDFQMSIMHCPLAMALYIKYCQSHNRETLRDIYNQYDDFHSQAVW  626

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++  KN M+         R  L++ A   F   +     +   EE  KLL+ Q  
Sbjct  627   FITESYQ-RKNTMS---------RDALLQSAQENFRLARNDT-NASLTEEQIKLLKYQRS  675

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE T  ++I V   + DT++  ++    + A+K+++E+K+ ++R++WL++  LA    W+
Sbjct  676   LEDTLHESI-VGKPLHDTVKVLLLRNELKLADKLRSEYKIPDRRYWWLRIQCLAEQGLWN  734

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              LEKFSK K+ PIGY+PF++ C++  +K EA KY+PK+ D
Sbjct  735   DLEKFSKSKKSPIGYEPFIDECLKYNEKLEARKYLPKVKD  774



>ref|XP_006617477.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X3 [Apis dorsata]
Length=729

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 116/220 (53%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+ +  P  +   +I   PL   L+I Y + +  E L+D +         A  
Sbjct  466   LVYTVILHLRENMPLGDFQMSIMHCPLAMALYIKYCQNHNRETLRDIYNQYDDFHSQAIW  525

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++  KN M+         R  L++ A   F   +     +   EE  KLLR Q  
Sbjct  526   FITESYQ-RKNVMS---------REALLQSAQENFKLARNDT-NAALTEEQIKLLRYQRS  574

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             +E  T Q I V   + DT++  ++    + A+K+K+E+++S++R++WL++  LA    W+
Sbjct  575   ME-DTLQEIIVGKPLHDTVKILLLRNELKLADKLKSEYRISDRRYWWLRIQCLAEQGAWN  633

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              LEKFSK K+ PIGY+PF++ C++     EA KY+ K+ +
Sbjct  634   ELEKFSKSKKSPIGYEPFIDECLKYNKDREAKKYLSKVKN  673



>ref|XP_006567258.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Apis mellifera]
Length=730

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 116/220 (53%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+ +  P  +   +I   PL   L+I Y + +  E L+D +         A  
Sbjct  467   LVYTVILHLRENMPLGDFQMSIMHCPLAMALYIKYCQNHNRETLRDIYNQYDDFHSQAIW  526

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++  KN M+         R  L++ A   F   +     +   EE  KLLR Q  
Sbjct  527   FITESYQ-RKNVMS---------REALLQSAQENFKLARNDT-NAALTEEQIKLLRYQRS  575

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             +E  T Q I V   + DT++  ++    + A+K+K+E+++S++R++WL++  LA    W+
Sbjct  576   ME-DTLQEIIVGKPLHDTVKILLLRNELKLADKLKSEYRISDRRYWWLRIQCLAEQGAWN  634

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              LEKFSK K+ PIGY+PF++ C++     EA KY+ K+ +
Sbjct  635   ELEKFSKSKKSPIGYEPFIDECLKYNKDREAKKYLSKVKN  674



>ref|XP_006617476.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Apis dorsata]
Length=798

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 116/220 (53%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+ +  P  +   +I   PL   L+I Y + +  E L+D +         A  
Sbjct  535   LVYTVILHLRENMPLGDFQMSIMHCPLAMALYIKYCQNHNRETLRDIYNQYDDFHSQAIW  594

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++  KN M+         R  L++ A   F   +     +   EE  KLLR Q  
Sbjct  595   FITESYQ-RKNVMS---------REALLQSAQENFKLARNDT-NAALTEEQIKLLRYQRS  643

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             +E  T Q I V   + DT++  ++    + A+K+K+E+++S++R++WL++  LA    W+
Sbjct  644   ME-DTLQEIIVGKPLHDTVKILLLRNELKLADKLKSEYRISDRRYWWLRIQCLAEQGAWN  702

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              LEKFSK K+ PIGY+PF++ C++     EA KY+ K+ +
Sbjct  703   ELEKFSKSKKSPIGYEPFIDECLKYNKDREAKKYLSKVKN  742



>dbj|GAA99834.1| hypothetical protein E5Q_06537 [Mixia osmundae IAM 14324]
 gb|KEI42324.1| hypothetical protein L969DRAFT_84183 [Mixia osmundae IAM 14324]
Length=878

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 118/229 (52%), Gaps = 12/229 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV++V  H+ +     + F  I+ +P    L  ++ +    E L+D++    +  D A L
Sbjct  614   LVFVVFAHLKKAHSLGQFFRIIEKKPAAAALLRAWCKDEDIELLRDYYYQDDRRVDAACL  673

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES  +               ++  V      FAE KE  FE++  E++ +LL  Q  
Sbjct  674   ALHESTRITD----------FAEKMAKVRSGSKSFAEDKERSFETRMTEDYLRLLAYQQA  723

Query  900   LEV-TTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDW  724
             LE     +  F   SI  TIR CI+    + A+K+K+EF+V + R++++K+ AL   RDW
Sbjct  724   LEKEADDRKTFQGLSIDGTIRACILCSWPKKADKIKSEFEVPDIRFWFIKIKALIEARDW  783

Query  723   DALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAY  577
             D+LE FS+ KR PIGY+PFVE  V +  K +A+ ++ +  + R R E Y
Sbjct  784   DSLEAFSRSKRSPIGYEPFVELLVASGHKRQAVTFVQR-CEMRNRIELY  831



>ref|XP_002110165.1| hypothetical protein TRIADDRAFT_20725 [Trichoplax adhaerens]
 gb|EDV28331.1| hypothetical protein TRIADDRAFT_20725, partial [Trichoplax adhaerens]
Length=721

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 122/235 (52%), Gaps = 15/235 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYAR-LYKHEFLKDFFLSTGQLQDVAF  1084
             L+Y+ + H+       E F TI   P+   LF  Y R +  H  L D        Q    
Sbjct  488   LIYMAIFHLKGTLQLGEFFRTIHKMPVALKLFEKYCREINDHRLLMDVAKQFDDFQKAGI  547

Query  1083  LLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQH  904
              + + S++                RI  + +A   F+     + + ++ E+   LLR+Q 
Sbjct  548   YVAQSSYKTNNAE----------DRIDKLNEAARAFSAADRPICK-RSTEDQINLLRLQS  596

Query  903   ELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDW  724
              +E    Q  FV+ S+++T    I LG  + A+K+K +FK+ ++R++W+K+ ALA  R W
Sbjct  597   VMETDLGQP-FVEMSLNETAYQLIFLGRLKLADKLKKDFKIPDRRYWWIKIRALAQSRSW  655

Query  723   DALEKFSKEKRPPIGYKPFVEACVEA-EDKGEALKYIPKLADPRERAEAYAGIGM  562
             D LE+FSK K+ PIGY+PFV+AC+ + ++  EA KYI ++   ++ A+ Y  IG+
Sbjct  656   DELERFSKSKKSPIGYEPFVDACINSHKNATEACKYIERVPLSKQ-AKCYIKIGL  709



>ref|XP_006567257.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Apis mellifera]
Length=799

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 116/220 (53%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+ +  P  +   +I   PL   L+I Y + +  E L+D +         A  
Sbjct  536   LVYTVILHLRENMPLGDFQMSIMHCPLAMALYIKYCQNHNRETLRDIYNQYDDFHSQAIW  595

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++  KN M+         R  L++ A   F   +     +   EE  KLLR Q  
Sbjct  596   FITESYQ-RKNVMS---------REALLQSAQENFKLARNDT-NAALTEEQIKLLRYQRS  644

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             +E  T Q I V   + DT++  ++    + A+K+K+E+++S++R++WL++  LA    W+
Sbjct  645   ME-DTLQEIIVGKPLHDTVKILLLRNELKLADKLKSEYRISDRRYWWLRIQCLAEQGAWN  703

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              LEKFSK K+ PIGY+PF++ C++     EA KY+ K+ +
Sbjct  704   ELEKFSKSKKSPIGYEPFIDECLKYNKDREAKKYLSKVKN  743



>ref|XP_006617475.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Apis dorsata]
Length=834

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 116/220 (53%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+ +  P  +   +I   PL   L+I Y + +  E L+D +         A  
Sbjct  571   LVYTVILHLRENMPLGDFQMSIMHCPLAMALYIKYCQNHNRETLRDIYNQYDDFHSQAIW  630

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++  KN M+         R  L++ A   F   +     +   EE  KLLR Q  
Sbjct  631   FITESYQ-RKNVMS---------REALLQSAQENFKLARNDT-NAALTEEQIKLLRYQRS  679

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             +E  T Q I V   + DT++  ++    + A+K+K+E+++S++R++WL++  LA    W+
Sbjct  680   ME-DTLQEIIVGKPLHDTVKILLLRNELKLADKLKSEYRISDRRYWWLRIQCLAEQGAWN  738

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              LEKFSK K+ PIGY+PF++ C++     EA KY+ K+ +
Sbjct  739   ELEKFSKSKKSPIGYEPFIDECLKYNKDREAKKYLSKVKN  778



>ref|XP_392642.2| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X3 [Apis mellifera]
Length=835

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 116/220 (53%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+ +  P  +   +I   PL   L+I Y + +  E L+D +         A  
Sbjct  572   LVYTVILHLRENMPLGDFQMSIMHCPLAMALYIKYCQNHNRETLRDIYNQYDDFHSQAIW  631

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++  KN M+         R  L++ A   F   +     +   EE  KLLR Q  
Sbjct  632   FITESYQ-RKNVMS---------REALLQSAQENFKLARNDT-NAALTEEQIKLLRYQRS  680

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             +E  T Q I V   + DT++  ++    + A+K+K+E+++S++R++WL++  LA    W+
Sbjct  681   ME-DTLQEIIVGKPLHDTVKILLLRNELKLADKLKSEYRISDRRYWWLRIQCLAEQGAWN  739

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              LEKFSK K+ PIGY+PF++ C++     EA KY+ K+ +
Sbjct  740   ELEKFSKSKKSPIGYEPFIDECLKYNKDREAKKYLSKVKN  779



>ref|XP_011420366.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X2 [Crassostrea gigas]
Length=828

 Score =   115 bits (288),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 116/232 (50%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY VLLH+ +     E F  I++ P+   LFI Y R    + ++D F      Q+    
Sbjct  564   LVYTVLLHLKESMNQGEFFMAIRNMPIAYALFIQYCRQQNRKLMEDLFYQEDNFQE----  619

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                   E     + S        RI+ ++ A   F + K   F     EE  KLL+ Q  
Sbjct  620   ------EGTCKVVNSFNEDRMEDRIEELKLAQACFTKAKNE-FAKVQTEEQIKLLKYQQR  672

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE    +  +++ S+  TI    +  NH+ A +++ EFKV ++R++WLK+ AL    DW 
Sbjct  673   LEEEMNRP-YLNLSLYQTIYRLTLANNHKVAEQLRKEFKVPDRRFWWLKINALGECGDWV  731

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LE+FSK K+ P+G + FVE C +  +  EA+KY+ K++ P ++ +    +G
Sbjct  732   ELERFSKGKKAPVGMEAFVEVCAKHGNMKEAMKYLVKVS-PEQKVKCLVKVG  782



>ref|XP_011420359.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
isoform X1 [Crassostrea gigas]
 gb|EKC23509.1| Vacuolar protein sorting-associated protein 16-like protein [Crassostrea 
gigas]
Length=828

 Score =   115 bits (288),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 116/232 (50%), Gaps = 13/232 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY VLLH+ +     E F  I++ P+   LFI Y R    + ++D F      Q+    
Sbjct  564   LVYTVLLHLKESMNQGEFFMAIRNMPIAYALFIQYCRQQNRKLMEDLFYQEDNFQE----  619

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                   E     + S        RI+ ++ A   F + K   F     EE  KLL+ Q  
Sbjct  620   ------EGTCKVVNSFNEDRMEDRIEELKLAQACFTKAKNE-FAKVQTEEQIKLLKYQQR  672

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE    +  +++ S+  TI    +  NH+ A +++ EFKV ++R++WLK+ AL    DW 
Sbjct  673   LEEEMNRP-YLNLSLYQTIYRLTLANNHKVAEQLRKEFKVPDRRFWWLKINALGECGDWV  731

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LE+FSK K+ P+G + FVE C +  +  EA+KY+ K++ P ++ +    +G
Sbjct  732   ELERFSKGKKAPVGMEAFVEVCAKHGNMKEAMKYLVKVS-PEQKVKCLVKVG  782



>ref|XP_004930556.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Bombyx mori]
Length=827

 Score =   115 bits (287),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 121/220 (55%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY+VLLH+ +K    +   TI+S PL   L+I Y   +  E L+  ++     Q  A  
Sbjct  562   LVYVVLLHLKEKMGKHDFELTIRSFPLAHALYIKYCASHNREALRLVYVQEDDFQGQAAT  621

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ++ E   NP +++ S +          A   + + K  +  S   E+  KL + Q  
Sbjct  622   HICDAIE-QTNPGSAEASLI---------SARECYKKGKNELGAS-VCEDARKLCKQQSS  670

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             L+ T   + FV  S+ DT++  +  G  R A+K+++E+K+ ++R++WL++  LA   +W+
Sbjct  671   LQETYGTS-FVGLSLHDTVKKLLDQGEVRLADKLRSEYKMPDRRYWWLRILTLAEKSNWE  729

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              L+KFSK K+ P+GY+PFV+AC++     EALKY+P+  D
Sbjct  730   ELDKFSKSKKSPVGYEPFVDACLKYNKADEALKYLPRCRD  769



>ref|XP_005431022.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Geospiza fortis]
Length=799

 Score =   114 bits (286),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 111/193 (58%), Gaps = 18/193 (9%)
 Frame = -3

Query  1143  KHEFLKDFFLSTGQLQDVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETK  964
             K+E  +  F  T Q Q VA  L+++  E                R+  ++ A   F + K
Sbjct  578   KNELNRGSFFMTLQNQPVALSLYRQRIE---------------GRVAALQNALDEFYKAK  622

Query  963   EHVFESKAAEEHAKLLRIQHELEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFK  784
                F +KA EE  KLLR+Q  L+    +  ++D S+ DT+ T I+ G+H+ A ++  +F+
Sbjct  623   ND-FAAKATEEQIKLLRLQLHLQEELDKP-YLDLSLHDTVATLILDGHHKRAEQLYRDFR  680

Query  783   VSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLA  604
             + +KR++WLK+ ALAT  DW+ +EKFSK K+ PIGY PFVE  V+  ++ EA KY P++ 
Sbjct  681   IPDKRYWWLKINALATRGDWEEMEKFSKSKKSPIGYLPFVEVAVKHHNRYEAKKYAPRVP  740

Query  603   DPRERAEAYAGIG  565
              P +R +A+  +G
Sbjct  741   -PEQRVKAFVLVG  752



>ref|XP_011056171.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Acromyrmex echinatior]
 gb|EGI64462.1| Vacuolar protein sorting-associated protein 16-like protein [Acromyrmex 
echinatior]
Length=830

 Score =   114 bits (285),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 117/220 (53%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+ +     +   +I   PL   L+I Y + +  E L+D +         A  
Sbjct  567   LVYTVILHLRENMTLGDFQMSIMHCPLAMALYIKYCQSHNRETLRDIYNQYDDFHSQAVW  626

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++  KN M+         R  L++ A   F   +     +   EE  KLL+ Q  
Sbjct  627   FITESYQ-RKNTMS---------RDALLQSAQENFRLARNDT-NASLTEEQIKLLKYQRS  675

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE T  ++I V   + DT+R  ++    + A+K+++E+K+ ++R++WLK+  LA    W+
Sbjct  676   LEDTLHESI-VGKPLHDTVRILLLRNELKLADKLRSEYKIPDRRYWWLKIQCLAEQGLWN  734

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              LEKFSK K+ PIGY+PF++ C++  +K EA KY+ K+ D
Sbjct  735   DLEKFSKSKKSPIGYEPFIDECLKYNEKLEARKYLVKVKD  774



>ref|XP_012060505.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Atta cephalotes]
Length=830

 Score =   114 bits (285),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 72/221 (33%), Positives = 121/221 (55%), Gaps = 14/221 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+ +     +   +I   PL   L+I Y + +  E L+D +         A  
Sbjct  567   LVYTVILHLRENMTLGDFQMSIMHCPLAMALYIKYCQSHNRETLRDIYNQYDDFHSQAVW  626

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++  KN M+         R  L++ A   F   +  +  +   EE  KLL+ Q  
Sbjct  627   FITESYQ-RKNTMS---------RDALLQSAQENFRLARNDI-NASLTEEQIKLLKYQRS  675

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNH-RAANKVKTEFKVSEKRWYWLKVFALATIRDW  724
             LE T  ++I +   + DT+R  ++LGN  + A+K+++E+K+ ++R++WL++  LA    W
Sbjct  676   LEDTLHESI-IGKPLHDTVRI-LLLGNELKLADKLRSEYKIPDRRYWWLRIQCLAEQGLW  733

Query  723   DALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
             + LEKFSK K+ PIGY+PF++ C++  +K EA KY+ K+ D
Sbjct  734   NDLEKFSKSKKSPIGYEPFIDECLKYNEKLEARKYLVKVKD  774



>gb|EPY49689.1| HOPS complex subunit Vps16 [Schizosaccharomyces cryophilus OY26]
Length=835

 Score =   114 bits (285),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 81/256 (32%), Positives = 137/256 (54%), Gaps = 14/256 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             L+  V+L I Q+      F  + + P    +++ +A+    + L DFF      + +A L
Sbjct  569   LILYVILQIKQQMSIASFFQILNTHPNAAQVYVEFAKQNDRKTLHDFFYQDDDRKGLAIL  628

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               +++  L  N            RI  ++ A  +  E+KE   ESK  +E  KLL+++  
Sbjct  629   AIEDT--LTVNTF--------NERIASLQTASKVCGESKEFALESKLLDEQVKLLQLEEA  678

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
              E +   + FV  +I++ I   I L  ++ A+K+++EF V EKR+ WLK+ AL  IRDW 
Sbjct  679   YE-SQLASNFVGLTINELIVKLIELNQNQKASKIRSEFGVPEKRFSWLKLRALVAIRDWL  737

Query  720   ALEKFSKE-KRPPIGYKPFVEACVEAEDKGEALKYIPKLA--DPRERAEAYAGIGMakea  550
              +E+++   +R PIG++PFV   + A +K EA KYIP+      +E+ + +  +G  K A
Sbjct  738   QIEQWAASMRRSPIGFEPFVNEILSAGNKREAAKYIPRCTQISTQEKVDLWIQVGDVKSA  797

Query  549   adaasqakDGELLGRL  502
             ++ A++AK G LLG L
Sbjct  798   SEEAAEAKSGNLLGEL  813



>ref|XP_011699104.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Wasmannia auropunctata]
Length=830

 Score =   114 bits (284),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 118/220 (54%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+ +     +   +I   PL   L+I Y + +  E L+D +         A  
Sbjct  567   LVYTVILHLRENMTLGDFQMSIMHCPLAMALYIKYCQSHNRETLRDIYNQYDDFHSQAVW  626

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++  KN M+         R  L++ A   F   +     +   EE  KLL+ Q  
Sbjct  627   FITESYQ-RKNTMS---------RDALLQSAQENFRLARNDT-NASLTEEQIKLLKYQRS  675

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE T ++++ V   + DT++  ++    + A+K+++E+K+ ++R++WLK+  LA    W+
Sbjct  676   LEDTLRESV-VGKPLHDTVKILLLRNELKLADKLRSEYKIPDRRYWWLKIQCLAEQGLWN  734

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              LEKFSK K+ PIGY+PF++ C++  +K EA KY+ K+ D
Sbjct  735   DLEKFSKSKKSPIGYEPFIDECLKYNEKLEARKYLAKVKD  774



>ref|XP_003690002.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Apis florea]
Length=835

 Score =   114 bits (284),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 116/220 (53%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+ +  P  +   +I   PL   L+I Y + +  E L+D +         A  
Sbjct  572   LVYTVILHLRENMPLGDFQMSIMHCPLAMALYIKYCQNHNRETLRDIYNQYDDFHSQAIW  631

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++  KN  +         R  L++ A   F   +     +   EE  KLLR Q  
Sbjct  632   FITESYQ-RKNVTS---------REALLQSAQENFKLARNDT-NAALTEEQIKLLRYQRS  680

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             +E  T Q I V   + DT++  ++    + A+K+K+E+++S++R++WL++  LA    W+
Sbjct  681   ME-DTLQEIIVGKPLHDTVKILLLRNELKLADKLKSEYRISDRRYWWLRIQCLAEQGAWN  739

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              LEKFSK K+ PIGY+PF++ C++   + EA KY+ K+ +
Sbjct  740   ELEKFSKSKKSPIGYEPFIDECLKYNKEREAKKYLSKVKN  779



>gb|AAH64406.1| VPS16 protein, partial [Homo sapiens]
Length=283

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 130/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  +    + F T++++P+   L+  + +  + E LKD +      Q++   
Sbjct  17    LVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSF  76

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+        +    + G R+  ++ A   F + K   F +KA E+  +LLR+Q  
Sbjct  77    HIRASY--------AAEERIEG-RVAALQTAADAFYKAKNE-FAAKATEDQMRLLRLQRR  126

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE       F+D S+ DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+
Sbjct  127   LEDELG-GQFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWE  185

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  186   ELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  236



>ref|XP_001943896.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Acyrthosiphon pisum]
Length=798

 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 116/220 (53%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY+VLLH+    P  +    I+   + + L+I Y        L D +      +++A  
Sbjct  577   LVYMVLLHMQTSMPLGKFQMEIKKSSVAQALYIKYCHQQSGYSLLDMYTQEDNHEELALY  636

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES + +KN      S         + +A   +  T++  F     E   KL+R Q  
Sbjct  637   HITESIK-SKNTKEMSVS---------INEAINCYKRTRDE-FSLTTCESQIKLIRYQSS  685

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE   K   F + +++DT+   I +   + A+K+++EFKV E+R++W ++  LA  +DW+
Sbjct  686   LEEKLKND-FRNLTLNDTLLKLIEINELKLADKLRSEFKVPERRYWWARLTILAKQQDWN  744

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              LEK SK K+ PIGY+PFV+ C+E  +K EALKY+PK+ D
Sbjct  745   ELEKLSKVKKSPIGYEPFVDVCIEHGNKYEALKYLPKVRD  784



>gb|EGU11808.1| Vacuolar assembling/sorting protein VPS16 [Rhodotorula glutinis 
ATCC 204091]
Length=956

 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 149/295 (51%), Gaps = 31/295 (11%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQS-----------------RPLPRDLFISYARLYKHEF  1132
             LV+ VLLH+ QK    +LF  ++                   P  RD   S   L+   F
Sbjct  665   LVFQVLLHLRQKLSPGDLFRLVERVSTTTSASASSAAPSPYTPHTRD---SDPILFLQLF  721

Query  1131  LKDFFLSTGQLQDVAFLLWKES---WELAKNPMASKGSPLH-GPRIKLVEKAHGLFAETK  964
             L++     G L+D     W +     E+    +   G     G ++  V +A   F+E K
Sbjct  722   LREIGEDKGLLRD----FWYQDDRRVEMGCEMLVEAGREQDFGDKVAKVRQAQKSFSEDK  777

Query  963   EHVFESKAAEEHAKLLRIQHELEVTTKQA--IFVDSSISDTIRTCIVLGNHRAANKVKTE  790
             E  FE+K  ++H +LL +Q +LE  +  +   FV  S+++TIR CI+ G  + A KV++E
Sbjct  778   ERSFEAKMVDDHIRLLVLQQQLEQDSAASGKTFVGLSVNETIRQCILAGMDKKAEKVRSE  837

Query  789   FKVSEKRWYWLKVFALATIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPK  610
             FKV +KR+++LK+ +L ++RDWDAL+ F++ K+ PIGY+P+V+  + A    +A+KY+ K
Sbjct  838   FKVPDKRFWYLKLRSLISLRDWDALDTFARSKKSPIGYEPWVDNLIRAGAHRQAVKYVEK  897

Query  609   LADPRERAEAYAGIGMakeaadaasqakDGELLGRLKLTFSQNAAAASIFDTLRD  445
               D R R E Y   G    A     +  +   L  LK     N  AA + + L+D
Sbjct  898   -CDVRNRVELYVKCGEWVMAGQECVRRGESGRLHDLKARSPNNIIAAQLDELLQD  951



>gb|EPX74952.1| HOPS complex subunit Vps16 [Schizosaccharomyces octosporus yFS286]
Length=835

 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 139/256 (54%), Gaps = 14/256 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             L+  V+L I Q+      F  + S P   ++++ +A+    + L DFF      + +A L
Sbjct  569   LILYVILQIKQQMSIASFFQLLNSHPDAANVYVKFAKRNDRKTLHDFFYQDDDRKGLAIL  628

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               +++  L+ N +          RI  ++ A  +  ++KE   ESK  +E  +LL+++  
Sbjct  629   AIEDT--LSANTI--------NKRITSLQTASKVCHDSKEFSLESKLLDEQVRLLQLEES  678

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
              E     + FV  +I++ I   I L  ++ A+K+++EF V EKR+ WLK+ AL  IRDW 
Sbjct  679   YE-NQLASNFVGLTINELIVKLIELNQNQKASKIRSEFAVPEKRFSWLKLRALVAIRDWL  737

Query  720   ALEKFSKE-KRPPIGYKPFVEACVEAEDKGEALKYIPKLA--DPRERAEAYAGIGMakea  550
              +E+++   +R PIG++PFV   + A +K EA KYIP+      +E+ + +  +G  K A
Sbjct  738   QIEQWAASLRRSPIGFEPFVNEILSAGNKREAAKYIPRCTQLSTQEKVDLWIQVGDVKGA  797

Query  549   adaasqakDGELLGRL  502
             ++ A++AK G LLG L
Sbjct  798   SEEAAKAKSGNLLGEL  813



>gb|EAX10565.1| hCG2039972, isoform CRA_b [Homo sapiens]
Length=323

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 130/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  +    + F T++++P+   L+  + +  + E LKD +      Q++   
Sbjct  57    LVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSF  116

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+        +    + G R+  ++ A   F + K   F +KA E+  +LLR+Q  
Sbjct  117   HIRASY--------AAEERIEG-RVAALQTAADAFYKAKNE-FAAKATEDQMRLLRLQRR  166

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE       F+D S+ DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+
Sbjct  167   LEDELG-GQFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWE  225

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  226   ELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  276



>ref|XP_011644142.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Pogonomyrmex barbatus]
Length=830

 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/220 (31%), Positives = 118/220 (54%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+ +     +   +I   PL   L+I Y + +  E L+D +         A  
Sbjct  567   LVYTVILHLRENMTLGDFQMSIMHCPLAMALYIKYCQSHNRETLRDIYNQYDDFHSQAVW  626

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++  KN M+         R  L++ A   F   +  +  +   EE  KLL+ Q  
Sbjct  627   FITESYQ-RKNTMS---------RDALLQSAQENFRLARNDI-NASLTEEQIKLLKYQRS  675

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE T  +++ V   + DT++  ++    + A+K+++E+K+ ++R++WL++  LA    W+
Sbjct  676   LEDTLHESV-VGKPLHDTVKVLLLRNELKLADKLRSEYKIPDRRYWWLRIQCLAEQGLWN  734

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              LEKFSK K+ PIGY+PF++ C++  +K EA KY+ K+ D
Sbjct  735   DLEKFSKSKKSPIGYEPFIDECLKYNEKLEARKYLAKVKD  774



>gb|AAI26432.1| VPS16 protein, partial [Homo sapiens]
Length=315

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 130/232 (56%), Gaps = 12/232 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLLH+  +    + F T++++P+   L+  + +  + E LKD +      Q++   
Sbjct  49    LVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSF  108

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
               + S+        +    + G R+  ++ A   F + K   F +KA E+  +LLR+Q  
Sbjct  109   HIRASY--------AAEERIEG-RVAALQTAADAFYKAKNE-FAAKATEDQMRLLRLQRR  158

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE       F+D S+ DT+ T I+ G+++ A ++  +F++ +KR +WLK+ ALA + DW+
Sbjct  159   LEDELG-GQFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWE  217

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
              LEKFSK K+ PIGY PFVE C++  +K EA KY  ++  P ++ +A   +G
Sbjct  218   ELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG-PEQKVKALLLVG  268



>gb|EJU02203.1| vacuolar protein sorting-associated protein 16 [Dacryopinax sp. 
DJM-731 SS1]
Length=840

 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/238 (32%), Positives = 122/238 (51%), Gaps = 18/238 (8%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPR-----DLFISYARLYKHEFLKDFFLSTGQLQ  1096
             +VY VLL + +KR  L  F  +     P       L   YAR    E L+DF+    +  
Sbjct  571   MVYHVLLTL-KKRLNLGDFFRLLEDGGPELAPAASLLQVYARQQNRELLRDFYFQDDRRT  629

Query  1095  DVAFLLWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLL  916
             + A L  +E+ E   N +          R   +  A   F+E K+  FE++  +EH+KLL
Sbjct  630   ESAILKLEEAAE--ANDVVD--------RTAAIRAAGKSFSEDKDRGFEARMMDEHSKLL  679

Query  915   RIQHELEVTTKQAI-FVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALA  739
              +Q   E      + F+  SI+DTI  CI  G  + A KV+++++V +KR++++K+ AL 
Sbjct  680   ILQQAFEKDADGRVEFIGLSINDTIYKCITTGQSKKAEKVRSDWRVPDKRFWYIKLHALT  739

Query  738   TIRDWDALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLADPRERAEAYAGIG  565
               RDW+ L+ F+K+KR PIGY+ FV   V      +A  ++P+  D ++R + Y   G
Sbjct  740   EARDWEGLDAFAKQKRSPIGYEAFVNHLVSKGFPNQAKNFVPR-CDAKQRIDLYIKCG  796



>ref|XP_011173487.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog 
[Solenopsis invicta]
 gb|EFZ09129.1| hypothetical protein SINV_00468, partial [Solenopsis invicta]
Length=830

 Score =   112 bits (281),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 117/220 (53%), Gaps = 12/220 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LVY V+LH+ +     +   +I   PL   L+I Y + +  E L+D +         A  
Sbjct  567   LVYTVILHLRENMTLGDFQMSIMHCPLAMALYIKYCQSHNRETLRDIYNQYDDFHSQAVW  626

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
                ES++  KN M+         R  L++ A   F   +     +   EE  KLL+ Q  
Sbjct  627   FITESYQ-RKNMMS---------RDALLQSAQENFRLARNDT-NASLTEEQIKLLKYQRS  675

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
             LE T  +++ V   + DT+R  ++    + A+K+++E+K+ ++R++WL++  LA    W+
Sbjct  676   LEDTLHESV-VGKPLHDTVRILLLRNELKLADKLRSEYKIPDRRYWWLRIQCLAEQGLWN  734

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
              LEKFSK K+ PIGY+PF++ C++  +K EA KY+ K+ D
Sbjct  735   DLEKFSKSKKSPIGYEPFIDECLKYNEKLEARKYLAKVKD  774



>gb|ERL93903.1| hypothetical protein D910_11189 [Dendroctonus ponderosae]
Length=735

 Score =   112 bits (280),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/221 (31%), Positives = 125/221 (57%), Gaps = 12/221 (5%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             L+Y+V+L + +K P  +   TI++ P+ + L+I Y + Y    L + ++        A +
Sbjct  508   LIYMVVLKLREKMPLGDFKMTIRNFPVAQALYIKYCKEYYKSALAEIYIQEDDFPSQAQM  567

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             + +ES       ++ K S L   ++ +  +A+    + ++ ++ S   EE  KL + Q E
Sbjct  568   IIEES-------LSDKNSHLRDSQLTVAIEAYN---KGRKDLYAS-MCEETLKLSKFQRE  616

Query  900   LEVT-TKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDW  724
             LE     +  FV  S+ DT +  + + + + A KVK +FK+ +KR+++L++  LA +++W
Sbjct  617   LEEKFQSENKFVGKSVHDTCKILLEMKDVKLAEKVKNDFKIPDKRYWFLRINTLAALKEW  676

Query  723   DALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD  601
               L+KF+K K+ P+GY PFV+AC    +K EALKY+ K+ D
Sbjct  677   IELDKFAKLKKSPVGYGPFVDACWANHNKDEALKYMQKVPD  717



>ref|XP_007674604.1| hypothetical protein BAUCODRAFT_66530 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC97761.1| hypothetical protein BAUCODRAFT_66530 [Baudoinia compniacensis 
UAMH 10762]
Length=823

 Score =   112 bits (281),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 122/235 (52%), Gaps = 13/235 (6%)
 Frame = -3

Query  1260  LVYLVLLHIWQKRPALELFGTIQSRPLPRDLFISYARLYKHEFLKDFFLSTGQLQDVAFL  1081
             LV+ VLL++ +K P    F TI SRP    +  S A     E LKD +    +  + + L
Sbjct  557   LVFYVLLNLRKKMPLSSFFRTINSRPTATAIVESSAVDQDEELLKDLYYQDDRRIEGSNL  616

Query  1080  LWKESWELAKNPMASKGSPLHGPRIKLVEKAHGLFAETKEHVFESKAAEEHAKLLRIQHE  901
             L  E+  LA +  A        P    ++ A  L  ++KE+  +  A E+  KLLR+Q  
Sbjct  617   LVSEA--LAASDTA--------PATDKLKMAAKLVRDSKEYAVQVTAIEDAQKLLRLQET  666

Query  900   LEVTTKQAIFVDSSISDTIRTCIVLGNHRAANKVKTEFKVSEKRWYWLKVFALATIRDWD  721
                   +  FV  S+++T+   I  GN + A KV+TEFKV+EK ++W+++ AL + RDW 
Sbjct  667   FAKELNER-FVGLSVNETLSKLIRTGNMKRATKVQTEFKVTEKVYWWIRLRALVSNRDWR  725

Query  720   ALEKFSKEKRPPIGYKPFVEACVEAEDKGEALKYIPKLAD--PRERAEAYAGIGM  562
              LE+ SK ++ PIG++PF    + A +   A  +IPK A     ER E +   G+
Sbjct  726   ELEEMSKARKSPIGWEPFYNEILAAGNTKVAALFIPKCASLTLSERIEMWLKCGL  780



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3610050248732