BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9679

Length=859
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007031183.1|  Importin alpha isoform 1                           360   1e-117   Theobroma cacao [chocolate]
gb|AAK38726.1|AF369706_1  importin alpha 1                              360   2e-117   Capsicum annuum
ref|XP_007031184.1|  Importin alpha isoform 2                           360   2e-117   
ref|XP_006344784.1|  PREDICTED: importin subunit alpha-1                352   1e-114   Solanum tuberosum [potatoes]
gb|KJB26294.1|  hypothetical protein B456_004G235800                    351   4e-114   Gossypium raimondii
ref|NP_001275782.1|  importin alpha                                     349   2e-113   Citrus sinensis [apfelsine]
ref|XP_004230322.1|  PREDICTED: importin subunit alpha-1                349   3e-113   Solanum lycopersicum
ref|XP_012088868.1|  PREDICTED: importin subunit alpha-4 isoform X1     349   3e-113   Jatropha curcas
ref|XP_012088870.1|  PREDICTED: importin subunit alpha-4 isoform X2     349   3e-113   Jatropha curcas
emb|CAN64716.1|  hypothetical protein VITISV_026717                     347   8e-113   Vitis vinifera
ref|XP_002281670.1|  PREDICTED: importin subunit alpha                  347   1e-112   Vitis vinifera
ref|XP_008370371.1|  PREDICTED: importin subunit alpha-like             346   4e-112   
ref|XP_009337642.1|  PREDICTED: importin subunit alpha-like isofo...    346   5e-112   Pyrus x bretschneideri [bai li]
ref|XP_009337641.1|  PREDICTED: importin subunit alpha-like isofo...    345   6e-112   Pyrus x bretschneideri [bai li]
ref|XP_008453295.1|  PREDICTED: importin subunit alpha                  345   8e-112   Cucumis melo [Oriental melon]
ref|XP_002319478.1|  importin alpha-1 subunit family protein            344   2e-111   Populus trichocarpa [western balsam poplar]
ref|XP_007205030.1|  hypothetical protein PRUPE_ppa004046mg             343   3e-111   Prunus persica
ref|XP_009796205.1|  PREDICTED: importin subunit alpha-1                343   4e-111   Nicotiana sylvestris
ref|XP_009592620.1|  PREDICTED: importin subunit alpha-1                342   8e-111   Nicotiana tomentosiformis
emb|CDY31102.1|  BnaA08g26520D                                          342   2e-110   Brassica napus [oilseed rape]
ref|XP_011023801.1|  PREDICTED: importin subunit alpha                  341   3e-110   Populus euphratica
ref|XP_008246117.1|  PREDICTED: importin subunit alpha-1                341   4e-110   Prunus mume [ume]
emb|CDY32165.1|  BnaCnng06740D                                          340   9e-110   Brassica napus [oilseed rape]
ref|XP_004302281.1|  PREDICTED: importin subunit alpha-4                339   2e-109   Fragaria vesca subsp. vesca
ref|XP_010267916.1|  PREDICTED: importin subunit alpha-like             339   2e-109   Nelumbo nucifera [Indian lotus]
ref|XP_010024140.1|  PREDICTED: importin subunit alpha                  338   4e-109   Eucalyptus grandis [rose gum]
ref|XP_009148181.1|  PREDICTED: importin subunit alpha-1                338   7e-109   Brassica rapa
emb|CDX93514.1|  BnaA06g05340D                                          338   8e-109   
ref|XP_010475758.1|  PREDICTED: importin subunit alpha-1a-like          338   9e-109   Camelina sativa [gold-of-pleasure]
ref|XP_009110839.1|  PREDICTED: importin subunit alpha-1-like iso...    338   1e-108   Brassica rapa
ref|XP_002512528.1|  importin alpha, putative                           335   1e-108   
gb|KFK43224.1|  hypothetical protein AALP_AA1G096500                    337   2e-108   Arabis alpina [alpine rockcress]
gb|ABO21639.1|  importin alpha-like protein                             336   3e-108   Brassica napus [oilseed rape]
ref|XP_004144743.1|  PREDICTED: importin subunit alpha-4                336   3e-108   Cucumis sativus [cucumbers]
emb|CDX94988.1|  BnaC05g06830D                                          335   6e-108   
ref|XP_006304709.1|  hypothetical protein CARUB_v10011976mg             333   4e-107   Capsella rubella
ref|XP_010549392.1|  PREDICTED: importin subunit alpha-1                333   5e-107   Tarenaya hassleriana [spider flower]
ref|XP_010270837.1|  PREDICTED: importin subunit alpha-like             332   7e-107   Nelumbo nucifera [Indian lotus]
ref|XP_010458212.1|  PREDICTED: importin subunit alpha-1b-like is...    331   3e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010458211.1|  PREDICTED: importin subunit alpha-1b-like is...    331   4e-106   Camelina sativa [gold-of-pleasure]
ref|XP_002889740.1|  hypothetical protein ARALYDRAFT_888168             331   4e-106   Arabidopsis lyrata subsp. lyrata
ref|XP_008388467.1|  PREDICTED: importin subunit alpha-1                330   5e-106   
gb|ABB55384.1|  importin alpha 1-like                                   327   9e-106   Solanum tuberosum [potatoes]
ref|XP_009373302.1|  PREDICTED: importin subunit alpha-1-like           330   1e-105   Pyrus x bretschneideri [bai li]
ref|XP_010544159.1|  PREDICTED: importin subunit alpha-1b-like          327   1e-104   Tarenaya hassleriana [spider flower]
ref|XP_008806746.1|  PREDICTED: importin subunit alpha-1-like           312   2e-103   
ref|XP_006417589.1|  hypothetical protein EUTSA_v10007310mg             323   2e-103   Eutrema salsugineum [saltwater cress]
ref|XP_010674568.1|  PREDICTED: importin subunit alpha-1a               323   2e-103   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010931776.1|  PREDICTED: importin subunit alpha-like             322   5e-103   Elaeis guineensis
ref|XP_010914627.1|  PREDICTED: importin subunit alpha isoform X2       322   5e-103   Elaeis guineensis
ref|XP_011092170.1|  PREDICTED: importin subunit alpha                  322   1e-102   Sesamum indicum [beniseed]
gb|EYU38410.1|  hypothetical protein MIMGU_mgv1a004192mg                322   1e-102   Erythranthe guttata [common monkey flower]
ref|XP_010914626.1|  PREDICTED: importin subunit alpha isoform X1       322   2e-102   Elaeis guineensis
ref|XP_002519264.1|  importin alpha, putative                           316   2e-101   Ricinus communis
ref|XP_006488809.1|  PREDICTED: importin subunit alpha-1b-like          318   3e-101   Citrus sinensis [apfelsine]
ref|NP_001031011.1|  importin alpha isoform 4                           315   4e-101   Arabidopsis thaliana [mouse-ear cress]
gb|KDO72000.1|  hypothetical protein CISIN_1g009700mg                   317   9e-101   Citrus sinensis [apfelsine]
ref|NP_172398.1|  importin alpha isoform 4                              317   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010095558.1|  Importin subunit alpha                             318   2e-100   
ref|XP_008801729.1|  PREDICTED: importin subunit alpha-1a isoform X2    313   2e-99    Phoenix dactylifera
gb|ACF86631.1|  unknown                                                 302   4e-99    Zea mays [maize]
ref|XP_004144766.1|  PREDICTED: importin subunit alpha-2                312   5e-99    Cucumis sativus [cucumbers]
ref|XP_008453860.1|  PREDICTED: importin subunit alpha-1                311   1e-98    Cucumis melo [Oriental melon]
gb|AFW77280.1|  hypothetical protein ZEAMMB73_231111                    300   2e-98    
ref|XP_012084120.1|  PREDICTED: importin subunit alpha-4-like           308   1e-97    Jatropha curcas
ref|XP_010093918.1|  Importin subunit alpha                             317   1e-97    
gb|EEC78554.1|  hypothetical protein OsI_18524                          307   2e-97    Oryza sativa Indica Group [Indian rice]
ref|NP_001054692.1|  Os05g0155500                                       308   4e-97    
ref|XP_008458386.1|  PREDICTED: importin subunit alpha-1-like           307   5e-97    Cucumis melo [Oriental melon]
dbj|BAK07842.1|  predicted protein                                      299   6e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008801728.1|  PREDICTED: importin subunit alpha-1a isoform X1    307   6e-97    Phoenix dactylifera
ref|XP_004150082.1|  PREDICTED: importin subunit alpha-1                306   1e-96    Cucumis sativus [cucumbers]
ref|XP_003591197.1|  Importin subunit alpha-1                           306   2e-96    Medicago truncatula
dbj|BAA88950.1|  importin alpha 1b                                      305   2e-96    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001141568.1|  uncharacterized protein LOC100273684               305   3e-96    Zea mays [maize]
ref|XP_006382424.1|  Importin alpha-1 subunit family protein            305   3e-96    Populus trichocarpa [western balsam poplar]
gb|KHN16078.1|  Importin subunit alpha-1                                305   3e-96    Glycine soja [wild soybean]
ref|XP_003536050.1|  PREDICTED: importin subunit alpha-1-like           305   4e-96    Glycine max [soybeans]
ref|XP_006655009.1|  PREDICTED: importin subunit alpha-1b-like          305   4e-96    Oryza brachyantha
ref|XP_002440631.1|  hypothetical protein SORBIDRAFT_09g004320          304   6e-96    Sorghum bicolor [broomcorn]
ref|XP_011036931.1|  PREDICTED: importin subunit alpha-1 isoform X2     304   6e-96    Populus euphratica
ref|XP_011036930.1|  PREDICTED: importin subunit alpha-1 isoform X1     304   6e-96    Populus euphratica
emb|CDO98800.1|  unnamed protein product                                304   7e-96    Coffea canephora [robusta coffee]
emb|CAA75513.1|  Importin alpha-like protein                            304   8e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008350735.1|  PREDICTED: importin subunit alpha-1b-like          294   8e-96    
ref|XP_004977076.1|  PREDICTED: importin subunit alpha-1b-like is...    304   8e-96    Setaria italica
ref|XP_003554623.1|  PREDICTED: importin subunit alpha-1-like           304   9e-96    Glycine max [soybeans]
ref|XP_003556535.1|  PREDICTED: importin subunit alpha-1-like iso...    304   9e-96    Glycine max [soybeans]
gb|AAB72116.2|  AtKAP alpha                                             304   9e-96    Arabidopsis thaliana [mouse-ear cress]
ref|NP_187328.1|  Importin subunit alpha-1                              304   9e-96    Arabidopsis thaliana [mouse-ear cress]
gb|AAL06825.1|  AT3g06720/F3E22_14                                      304   1e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842676.1|  PREDICTED: importin subunit alpha-1                303   1e-95    Amborella trichopoda
gb|AFW81447.1|  hypothetical protein ZEAMMB73_731576                    303   2e-95    
ref|XP_004494548.1|  PREDICTED: importin subunit alpha-like             303   2e-95    Cicer arietinum [garbanzo]
emb|CAA74966.1|  Importin alpha-like protein                            303   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010094009.1|  Importin subunit alpha-1                           302   3e-95    Morus notabilis
ref|XP_003521670.1|  PREDICTED: importin subunit alpha-1-like           302   3e-95    Glycine max [soybeans]
ref|XP_002318966.1|  Importin alpha-1 subunit family protein            302   4e-95    Populus trichocarpa [western balsam poplar]
gb|KHN03948.1|  Importin subunit alpha                                  302   4e-95    Glycine soja [wild soybean]
ref|XP_009781700.1|  PREDICTED: importin subunit alpha-1-like iso...    300   4e-95    Nicotiana sylvestris
gb|KHN12909.1|  Importin subunit alpha-1                                302   4e-95    Glycine soja [wild soybean]
ref|XP_003533220.1|  PREDICTED: importin subunit alpha-1-like iso...    302   4e-95    
ref|XP_006380207.1|  hypothetical protein POPTR_0008s22930g             302   4e-95    Populus trichocarpa [western balsam poplar]
ref|XP_002882488.1|  AT-IMP                                             302   4e-95    
ref|XP_008810191.1|  PREDICTED: importin subunit alpha-1b-like          302   4e-95    Phoenix dactylifera
ref|XP_008797160.1|  PREDICTED: importin subunit alpha-1b-like          302   4e-95    Phoenix dactylifera
ref|XP_007031099.1|  Importin alpha, ALPHA,AIMP ALPHA isoform 2         302   5e-95    
ref|XP_007144986.1|  hypothetical protein PHAVU_007G199900g             302   5e-95    Phaseolus vulgaris [French bean]
ref|XP_011013186.1|  PREDICTED: importin subunit alpha-1-like           302   5e-95    Populus euphratica
gb|ABM05487.1|  Impa1                                                   301   6e-95    Nicotiana benthamiana
ref|XP_006297392.1|  hypothetical protein CARUB_v10013416mg             302   6e-95    Capsella rubella
ref|XP_010914512.1|  PREDICTED: importin subunit alpha-1b-like          301   8e-95    Elaeis guineensis
gb|KHN14650.1|  Importin subunit alpha-1                                301   8e-95    Glycine soja [wild soybean]
gb|EPS72677.1|  impa2                                                   290   9e-95    Genlisea aurea
ref|XP_008781168.1|  PREDICTED: importin subunit alpha-like isofo...    301   9e-95    Phoenix dactylifera
ref|XP_002512485.1|  importin alpha, putative                           301   9e-95    Ricinus communis
ref|XP_009414157.1|  PREDICTED: importin subunit alpha-1a-like          301   9e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003546338.1|  PREDICTED: importin subunit alpha-1-like iso...    301   1e-94    Glycine max [soybeans]
ref|XP_009789105.1|  PREDICTED: importin subunit alpha                  301   1e-94    Nicotiana sylvestris
ref|XP_010931697.1|  PREDICTED: importin subunit alpha-1b               301   1e-94    Elaeis guineensis
ref|XP_010486198.1|  PREDICTED: importin subunit alpha-1 isoform X1     301   1e-94    Camelina sativa [gold-of-pleasure]
gb|KJB82641.1|  hypothetical protein B456_013G206500                    301   1e-94    Gossypium raimondii
ref|XP_010259399.1|  PREDICTED: importin subunit alpha-1                301   1e-94    Nelumbo nucifera [Indian lotus]
ref|XP_012088940.1|  PREDICTED: importin subunit alpha-2                301   1e-94    Jatropha curcas
ref|XP_009781699.1|  PREDICTED: importin subunit alpha-1-like iso...    301   1e-94    Nicotiana sylvestris
ref|XP_004495675.1|  PREDICTED: importin subunit alpha-1b-like is...    298   2e-94    
emb|CDO98799.1|  unnamed protein product                                300   2e-94    Coffea canephora [robusta coffee]
ref|XP_002275593.1|  PREDICTED: importin subunit alpha-1 isoform X1     300   2e-94    
gb|AII99829.1|  importin alpha                                          300   3e-94    Nicotiana tabacum [American tobacco]
gb|KHG29743.1|  Importin subunit alpha-1 -like protein                  301   3e-94    Gossypium arboreum [tree cotton]
gb|ABM05488.1|  Impa2                                                   300   3e-94    Nicotiana benthamiana
ref|XP_009631847.1|  PREDICTED: importin subunit alpha-1a-like          300   3e-94    Nicotiana tomentosiformis
ref|XP_010649543.1|  PREDICTED: importin subunit alpha-1 isoform X2     299   3e-94    
ref|XP_010444089.1|  PREDICTED: importin subunit alpha-1-like           300   4e-94    Camelina sativa [gold-of-pleasure]
ref|XP_009796163.1|  PREDICTED: importin subunit alpha-1a-like          300   4e-94    Nicotiana sylvestris
gb|AES65063.2|  importin subunit alpha-1b                               300   4e-94    Medicago truncatula
ref|XP_004495674.1|  PREDICTED: importin subunit alpha-1b-like is...    300   4e-94    Cicer arietinum [garbanzo]
ref|XP_008781167.1|  PREDICTED: importin subunit alpha-like isofo...    300   4e-94    Phoenix dactylifera
ref|XP_008345591.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...    299   5e-94    
ref|XP_012084020.1|  PREDICTED: importin subunit alpha-2 isoform X2     299   6e-94    Jatropha curcas
ref|XP_012084019.1|  PREDICTED: importin subunit alpha-2 isoform X1     299   6e-94    Jatropha curcas
ref|XP_009373267.1|  PREDICTED: importin subunit alpha-1b               299   7e-94    Pyrus x bretschneideri [bai li]
ref|XP_009621534.1|  PREDICTED: importin subunit alpha-1-like           299   8e-94    Nicotiana tomentosiformis
ref|XP_010548966.1|  PREDICTED: importin subunit alpha-1-like           298   9e-94    Tarenaya hassleriana [spider flower]
ref|XP_010464259.1|  PREDICTED: importin subunit alpha-1-like           299   9e-94    Camelina sativa [gold-of-pleasure]
ref|XP_009606138.1|  PREDICTED: importin subunit alpha                  298   9e-94    Nicotiana tomentosiformis
ref|XP_004487798.1|  PREDICTED: importin subunit alpha-1-like           298   1e-93    Cicer arietinum [garbanzo]
ref|XP_010231685.1|  PREDICTED: importin subunit alpha-1b               298   1e-93    Brachypodium distachyon [annual false brome]
gb|AES82394.2|  importin subunit alpha-1b                               298   2e-93    Medicago truncatula
dbj|BAE71209.1|  putative importin alpha                                298   2e-93    Trifolium pratense [peavine clover]
ref|XP_010024115.1|  PREDICTED: importin subunit alpha-1a               298   2e-93    Eucalyptus grandis [rose gum]
ref|NP_001234006.1|  importin subunit alpha                             297   3e-93    Solanum lycopersicum
ref|XP_006355841.1|  PREDICTED: importin subunit alpha-like             296   6e-93    Solanum tuberosum [potatoes]
ref|XP_008388495.1|  PREDICTED: importin subunit alpha-1b-like          296   6e-93    Malus domestica [apple tree]
ref|XP_007138966.1|  hypothetical protein PHAVU_009G253500g             296   6e-93    Phaseolus vulgaris [French bean]
ref|XP_009338212.1|  PREDICTED: importin subunit alpha-1-like           296   6e-93    Pyrus x bretschneideri [bai li]
gb|EYU46779.1|  hypothetical protein MIMGU_mgv1a0058492mg               291   9e-93    Erythranthe guttata [common monkey flower]
ref|XP_010684628.1|  PREDICTED: importin subunit alpha                  296   1e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007051048.1|  Importin alpha, ALPHA,AIMP ALPHA isoform 1         296   1e-92    
ref|XP_002282816.1|  PREDICTED: importin subunit alpha-1                296   1e-92    Vitis vinifera
ref|XP_004244944.1|  PREDICTED: importin subunit alpha-1                296   1e-92    Solanum lycopersicum
ref|XP_006407910.1|  hypothetical protein EUTSA_v10020480mg             295   2e-92    Eutrema salsugineum [saltwater cress]
ref|XP_009402512.1|  PREDICTED: importin subunit alpha-1b-like          295   2e-92    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB41861.1|  hypothetical protein B456_007G124900                    293   2e-92    Gossypium raimondii
ref|XP_011079596.1|  PREDICTED: importin subunit alpha-like             295   2e-92    Sesamum indicum [beniseed]
ref|XP_001778004.1|  predicted protein                                  295   2e-92    
ref|XP_007205032.1|  hypothetical protein PRUPE_ppa004091mg             295   4e-92    Prunus persica
ref|XP_008245768.1|  PREDICTED: importin subunit alpha-1                294   4e-92    Prunus mume [ume]
gb|KHG01621.1|  Importin subunit alpha-1 -like protein                  294   5e-92    Gossypium arboreum [tree cotton]
ref|XP_004295110.1|  PREDICTED: importin subunit alpha-1-like           294   5e-92    Fragaria vesca subsp. vesca
gb|KJB41862.1|  hypothetical protein B456_007G124900                    294   5e-92    Gossypium raimondii
ref|XP_011082432.1|  PREDICTED: importin subunit alpha-like             294   5e-92    Sesamum indicum [beniseed]
gb|EYU25627.1|  hypothetical protein MIMGU_mgv1a004356mg                294   5e-92    Erythranthe guttata [common monkey flower]
ref|XP_011023747.1|  PREDICTED: importin subunit alpha-1-like iso...    294   6e-92    Populus euphratica
ref|XP_003550530.1|  PREDICTED: importin subunit alpha-1-like           294   6e-92    Glycine max [soybeans]
ref|XP_011023748.1|  PREDICTED: importin subunit alpha-1-like iso...    294   6e-92    Populus euphratica
ref|XP_009412111.1|  PREDICTED: importin subunit alpha-1b-like          294   6e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001763761.1|  predicted protein                                  294   6e-92    
ref|XP_006345634.1|  PREDICTED: importin subunit alpha-1-like           294   6e-92    Solanum tuberosum [potatoes]
ref|XP_010043209.1|  PREDICTED: importin subunit alpha-1a-like          294   7e-92    Eucalyptus grandis [rose gum]
ref|XP_007163337.1|  hypothetical protein PHAVU_001G226400g             293   9e-92    Phaseolus vulgaris [French bean]
ref|XP_001773628.1|  predicted protein                                  293   1e-91    
gb|KHG15238.1|  Importin subunit alpha-1 -like protein                  293   2e-91    Gossypium arboreum [tree cotton]
ref|XP_007222489.1|  hypothetical protein PRUPE_ppa004118mg             293   2e-91    Prunus persica
ref|XP_009401503.1|  PREDICTED: importin subunit alpha-1b-like          292   3e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAK38727.1|AF369707_1  importin alpha 2                              292   3e-91    Capsicum annuum
ref|XP_011046400.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...    292   3e-91    Populus euphratica
ref|XP_009393195.1|  PREDICTED: importin subunit alpha-1b-like          292   4e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS62504.1|  hypothetical protein M569_12283                         292   5e-91    Genlisea aurea
ref|XP_004302255.1|  PREDICTED: importin subunit alpha-1                291   5e-91    Fragaria vesca subsp. vesca
ref|XP_008223291.1|  PREDICTED: importin subunit alpha-1-like           291   6e-91    Prunus mume [ume]
ref|XP_010268071.1|  PREDICTED: importin subunit alpha-1-like           291   8e-91    Nelumbo nucifera [Indian lotus]
ref|XP_003626176.1|  Importin subunit alpha                             292   8e-91    
gb|KHN02923.1|  Importin subunit alpha-1                                291   1e-90    Glycine soja [wild soybean]
ref|XP_001773629.1|  predicted protein                                  291   1e-90    
ref|XP_010546997.1|  PREDICTED: importin subunit alpha-1                291   1e-90    Tarenaya hassleriana [spider flower]
ref|XP_011092122.1|  PREDICTED: importin subunit alpha-1                290   1e-90    Sesamum indicum [beniseed]
gb|KJB24392.1|  hypothetical protein B456_004G143100                    290   1e-90    Gossypium raimondii
emb|CDY34430.1|  BnaC01g22030D                                          290   1e-90    Brassica napus [oilseed rape]
gb|KHG28859.1|  Importin subunit alpha-1                                290   1e-90    Gossypium arboreum [tree cotton]
ref|XP_010094336.1|  Importin subunit alpha-1                           290   2e-90    Morus notabilis
gb|KJB24393.1|  hypothetical protein B456_004G143100                    290   2e-90    Gossypium raimondii
ref|XP_012082851.1|  PREDICTED: importin subunit alpha-like             290   2e-90    Jatropha curcas
ref|XP_010558435.1|  PREDICTED: importin subunit alpha-1-like           290   2e-90    Tarenaya hassleriana [spider flower]
gb|AAM96997.1|  unknown protein                                         283   2e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CAA74965.1|  Importin alpha-like protein                            290   3e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489893.1|  PREDICTED: importin subunit alpha-1-like           290   3e-90    Camelina sativa [gold-of-pleasure]
gb|KJB49857.1|  hypothetical protein B456_008G142000                    290   3e-90    Gossypium raimondii
ref|XP_002274422.1|  PREDICTED: importin subunit alpha                  289   4e-90    Vitis vinifera
ref|XP_003594812.1|  Importin subunit alpha-1                           290   4e-90    
emb|CDP17235.1|  unnamed protein product                                289   5e-90    Coffea canephora [robusta coffee]
ref|XP_009146474.1|  PREDICTED: importin subunit alpha-1-like           289   6e-90    Brassica rapa
ref|XP_001760522.1|  predicted protein                                  289   6e-90    
gb|AIU34461.1|  putative importin subunit alpha-2                       289   6e-90    Taraxacum brevicorniculatum
emb|CDY22779.1|  BnaA08g06090D                                          289   6e-90    Brassica napus [oilseed rape]
ref|XP_009107883.1|  PREDICTED: importin subunit alpha-1-like           288   8e-90    Brassica rapa
gb|EMT29219.1|  Importin subunit alpha-1b                               288   9e-90    
ref|XP_006414387.1|  hypothetical protein EUTSA_v10024884mg             288   9e-90    Eutrema salsugineum [saltwater cress]
ref|XP_007154341.1|  hypothetical protein PHAVU_003G110500g             288   1e-89    Phaseolus vulgaris [French bean]
emb|CDY09716.1|  BnaC07g33450D                                          288   1e-89    Brassica napus [oilseed rape]
ref|XP_010434881.1|  PREDICTED: importin subunit alpha-1-like           288   2e-89    Camelina sativa [gold-of-pleasure]
ref|XP_009136744.1|  PREDICTED: importin subunit alpha-1                287   2e-89    Brassica rapa
emb|CDY52043.1|  BnaC08g48070D                                          287   3e-89    Brassica napus [oilseed rape]
gb|AHJ25927.1|  importin subunit alpha-1                                287   3e-89    Senecio scandens
ref|XP_009369966.1|  PREDICTED: importin subunit alpha-1-like           286   4e-89    Pyrus x bretschneideri [bai li]
ref|XP_007031098.1|  Importin alpha, alpha,aimp alpha,impa-1,impa...    288   4e-89    
gb|AAK32824.1|AF361811_1  AT3g06720/F3E22_14                            285   1e-88    Arabidopsis thaliana [mouse-ear cress]
gb|KJB28705.1|  hypothetical protein B456_005G065400                    285   1e-88    Gossypium raimondii
ref|NP_001154239.1|  importin alpha isoform 2                           285   1e-88    Arabidopsis thaliana [mouse-ear cress]
gb|KDO71825.1|  hypothetical protein CISIN_1g009544mg                   283   2e-88    Citrus sinensis [apfelsine]
ref|XP_008360251.1|  PREDICTED: importin subunit alpha-1-like iso...    285   2e-88    
ref|XP_006285325.1|  hypothetical protein CARUB_v10006712mg             285   3e-88    Capsella rubella
ref|XP_009347771.1|  PREDICTED: importin subunit alpha-1-like           285   3e-88    Pyrus x bretschneideri [bai li]
ref|XP_010551087.1|  PREDICTED: importin subunit alpha-1-like           284   4e-88    Tarenaya hassleriana [spider flower]
gb|KDO71823.1|  hypothetical protein CISIN_1g009544mg                   283   6e-88    Citrus sinensis [apfelsine]
ref|XP_006488879.1|  PREDICTED: importin subunit alpha-1-like           283   6e-88    Citrus sinensis [apfelsine]
ref|XP_008340751.1|  PREDICTED: importin subunit alpha-1                283   8e-88    
ref|XP_006378029.1|  hypothetical protein POPTR_0010s00370g             275   9e-88    
gb|KHG28860.1|  Importin subunit alpha-1                                283   2e-87    Gossypium arboreum [tree cotton]
ref|XP_004967840.1|  PREDICTED: importin subunit alpha-1a-like          282   2e-87    Setaria italica
ref|XP_002515324.1|  importin alpha, putative                           280   2e-87    
gb|KDO87079.1|  hypothetical protein CISIN_1g009679mg                   279   2e-87    Citrus sinensis [apfelsine]
gb|EMS47918.1|  Importin subunit alpha-1a                               281   3e-87    Triticum urartu
gb|AFW79686.1|  importin alpha-1b subunit, mRNA                         275   3e-87    
ref|XP_010024770.1|  PREDICTED: importin subunit alpha-1                281   3e-87    Eucalyptus grandis [rose gum]
ref|XP_006480039.1|  PREDICTED: importin subunit alpha-like             281   6e-87    Citrus sinensis [apfelsine]
gb|KJB12655.1|  hypothetical protein B456_002G029800                    281   8e-87    Gossypium raimondii
gb|KJB12653.1|  hypothetical protein B456_002G029800                    280   8e-87    Gossypium raimondii
gb|KHG26190.1|  Importin subunit alpha-1 -like protein                  280   9e-87    Gossypium arboreum [tree cotton]
gb|KDO87077.1|  hypothetical protein CISIN_1g009679mg                   279   1e-86    Citrus sinensis [apfelsine]
ref|XP_004228994.1|  PREDICTED: importin subunit alpha-1a               280   1e-86    Solanum lycopersicum
ref|XP_007035863.1|  Importin alpha, putative                           282   1e-86    
ref|XP_006355403.1|  PREDICTED: importin subunit alpha-1-like iso...    280   2e-86    Solanum tuberosum [potatoes]
ref|XP_007031101.1|  Importin alpha, alpha,aimp alpha,impa-1,impa...    279   3e-86    
ref|XP_009612538.1|  PREDICTED: importin subunit alpha-1a-like          278   7e-86    Nicotiana tomentosiformis
ref|XP_006472169.1|  PREDICTED: importin subunit alpha-1b-like          277   2e-85    Citrus sinensis [apfelsine]
ref|XP_010556709.1|  PREDICTED: importin subunit alpha-2-like           277   2e-85    Tarenaya hassleriana [spider flower]
ref|XP_002868159.1|  AT3g06720/F3E22_14                                 278   3e-85    
ref|XP_007035722.1|  Importin alpha isoform 2                           276   4e-85    
ref|XP_007035721.1|  Importin alpha isoform 1                           276   5e-85    
ref|NP_001148537.1|  LOC100282153                                       276   6e-85    Zea mays [maize]
ref|XP_011100802.1|  PREDICTED: importin subunit alpha-1a-like          276   7e-85    Sesamum indicum [beniseed]
ref|XP_003566399.1|  PREDICTED: importin subunit alpha-1a               275   7e-85    Brachypodium distachyon [annual false brome]
ref|XP_010670910.1|  PREDICTED: importin subunit alpha-1                275   7e-85    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002320318.1|  hypothetical protein POPTR_0014s11920g             276   8e-85    Populus trichocarpa [western balsam poplar]
ref|XP_008673870.1|  PREDICTED: importin subunit alpha-1a               274   2e-84    Zea mays [maize]
ref|XP_011041680.1|  PREDICTED: importin subunit alpha-like             274   3e-84    Populus euphratica
ref|XP_009763482.1|  PREDICTED: importin subunit alpha-1a-like          274   4e-84    Nicotiana sylvestris
ref|XP_002966958.1|  hypothetical protein SELMODRAFT_439828             273   5e-84    
ref|XP_002961054.1|  hypothetical protein SELMODRAFT_266556             273   6e-84    Selaginella moellendorffii
gb|KFK42624.1|  hypothetical protein AALP_AA1G019500                    273   7e-84    Arabis alpina [alpine rockcress]
ref|XP_006644004.1|  PREDICTED: importin subunit alpha-1a-like          272   7e-84    
dbj|BAJ34004.1|  unnamed protein product                                266   1e-83    Eutrema halophilum
gb|KJB09437.1|  hypothetical protein B456_001G142300                    271   3e-83    Gossypium raimondii
ref|XP_003610377.1|  Importin alpha-1b subunit                          268   3e-83    Medicago truncatula
gb|EYU44000.1|  hypothetical protein MIMGU_mgv1a004419mg                271   5e-83    Erythranthe guttata [common monkey flower]
ref|XP_002302745.2|  hypothetical protein POPTR_0002s20060g             270   2e-82    Populus trichocarpa [western balsam poplar]
ref|XP_004508265.1|  PREDICTED: importin subunit alpha-1-like           269   2e-82    
ref|XP_011042196.1|  PREDICTED: importin subunit alpha-like             270   2e-82    Populus euphratica
gb|KEH32336.1|  importin subunit alpha                                  269   2e-82    
pdb|4BQK|A  Chain A, Rice Importin_alpha : Vird2nls Complex             266   3e-82    
pdb|4BQK|B  Chain B, Rice Importin_alpha : Vird2nls Complex             266   3e-82    
ref|XP_006307204.1|  hypothetical protein CARUB_v10008795mg             269   3e-82    
pdb|4BPL|A  Chain A, Rice Importin_alpha In Complex With Nucleopl...    266   4e-82    
gb|EMS45808.1|  Importin subunit alpha-1b                               273   5e-82    
gb|KDO81726.1|  hypothetical protein CISIN_1g009184mg                   268   5e-82    
pdb|2YNS|A  Chain A, Rimp_alpha_b54nls                                  267   5e-82    
ref|XP_006396421.1|  hypothetical protein EUTSA_v10028572mg             268   6e-82    
gb|EAY73331.1|  hypothetical protein OsI_01208                          268   8e-82    
ref|NP_001042611.1|  Os01g0253300                                       268   9e-82    
pdb|4B8J|A  Chain A, Rimp_alpha1a                                       267   1e-81    
ref|NP_171769.1|  importin alpha isoform 6                              267   2e-81    
ref|NP_973743.1|  importin alpha isoform 6                              267   2e-81    
ref|XP_002519178.1|  importin alpha, putative                           264   8e-81    
ref|XP_002508520.1|  predicted protein                                  265   8e-81    
gb|AAQ13406.1|AF005265_1  importin                                      265   1e-80    
ref|XP_003638654.1|  Importin subunit alpha                             258   2e-79    
gb|KEH18646.1|  importin subunit alpha-like protein                     259   3e-79    
ref|XP_006289883.1|  hypothetical protein CARUB_v10003501mg             258   7e-78    
ref|XP_005646985.1|  importin alpha                                     257   9e-78    
emb|CDY01921.1|  BnaC02g28060D                                          256   2e-77    
emb|CAA70703.1|  Kap alpha protein                                      256   2e-77    
ref|NP_192124.1|  Importin alpha 3                                      256   2e-77    
emb|CAA75514.1|  Importin alpha-like protein                            256   3e-77    
ref|XP_002872853.1|  ATIMPALPHA3/MOS6                                   255   8e-77    
gb|KHN03320.1|  Importin subunit alpha-1                                253   1e-76    
ref|XP_009119620.1|  PREDICTED: importin subunit alpha-1                253   2e-76    
emb|CDX89948.1|  BnaA10g01340D                                          253   2e-76    
emb|CDX97257.1|  BnaA02g20480D                                          253   3e-76    
ref|XP_009128526.1|  PREDICTED: importin subunit alpha-2-like           253   3e-76    
ref|XP_010474848.1|  PREDICTED: importin subunit alpha-2                252   9e-76    
ref|XP_003057280.1|  predicted protein                                  251   2e-75    
ref|XP_004306871.1|  PREDICTED: importin subunit alpha-1-like           250   3e-75    
gb|KJB34728.1|  hypothetical protein B456_006G080400                    250   4e-75    
ref|XP_010424664.1|  PREDICTED: importin subunit alpha-2-like           249   4e-75    
gb|AGZ15387.1|  importin alpha                                          250   5e-75    
ref|XP_010456072.1|  PREDICTED: importin subunit alpha-2                249   5e-75    
emb|CDY64806.1|  BnaCnng45030D                                          248   3e-74    
ref|XP_010501291.1|  PREDICTED: importin subunit alpha-2-like           255   4e-74    
ref|XP_010429262.1|  PREDICTED: importin subunit alpha-2                247   6e-74    
ref|XP_005849695.1|  hypothetical protein CHLNCDRAFT_30497              247   8e-74    
ref|XP_007510824.1|  predicted protein                                  247   8e-74    
emb|CDY15260.1|  BnaC05g01390D                                          249   7e-73    
ref|XP_001698656.1|  importin alpha                                     244   1e-72    
ref|XP_008360253.1|  PREDICTED: importin subunit alpha-1-like iso...    242   2e-72    
ref|XP_001419614.1|  predicted protein                                  243   3e-72    
ref|XP_010522815.1|  PREDICTED: importin subunit alpha isoform X1       242   3e-72    
emb|CEF99159.1|  Armadillo-type fold                                    243   3e-72    
gb|KHN03926.1|  Importin subunit alpha                                  242   5e-72    
ref|XP_003520790.1|  PREDICTED: importin subunit alpha-like             242   5e-72    
gb|AES92711.2|  importin subunit alpha-like protein                     241   7e-72    
ref|XP_003610514.1|  Importin alpha-1b subunit                          241   1e-71    
emb|CDY05638.1|  BnaC02g38990D                                          241   1e-71    
gb|KHG14170.1|  Importin subunit alpha-1 -like protein                  236   2e-71    
gb|AES92712.2|  importin subunit alpha-like protein                     239   4e-71    
emb|CDX90948.1|  BnaA03g26280D                                          238   1e-70    
ref|XP_009134443.1|  PREDICTED: importin subunit alpha-2-like           238   1e-70    
gb|KDD73677.1|  hypothetical protein H632_c1936p0                       238   2e-70    
ref|XP_003610515.1|  Importin alpha-1b subunit                          239   6e-70    
ref|XP_003609724.1|  Importin alpha-1b subunit                          236   2e-69    
gb|KEH32656.1|  importin subunit alpha                                  229   2e-69    
ref|XP_011396312.1|  Importin subunit alpha-1                           235   3e-69    
ref|XP_010495334.1|  PREDICTED: importin subunit alpha-1-like           234   3e-69    
gb|KDO38489.1|  hypothetical protein CISIN_1g043950mg                   233   4e-69    
ref|XP_003553699.1|  PREDICTED: importin subunit alpha-1a-like          234   8e-69    
gb|KDO44063.1|  hypothetical protein CISIN_1g043116mg                   232   1e-68    
gb|KJB81070.1|  hypothetical protein B456_013G128000                    224   1e-68    
ref|XP_002957574.1|  hypothetical protein VOLCADRAFT_84159              233   2e-68    
gb|KDO41451.1|  hypothetical protein CISIN_1g037142mg                   228   3e-68    
gb|AES92706.2|  importin subunit alpha                                  230   4e-68    
gb|KDO37705.1|  hypothetical protein CISIN_1g039940mg                   229   1e-67    
gb|KDO38014.1|  hypothetical protein CISIN_1g0355071mg                  231   2e-67    
ref|XP_005778844.1|  hypothetical protein EMIHUDRAFT_421349             230   2e-67    
ref|XP_003610509.1|  Importin alpha-1b subunit                          229   3e-67    
gb|AES92265.2|  importin subunit alpha                                  227   4e-67    
ref|XP_006471707.1|  PREDICTED: importin subunit alpha-1a-like          231   6e-67    
ref|XP_003610068.1|  Importin alpha-1b subunit                          227   8e-67    
ref|XP_006471848.1|  PREDICTED: importin subunit alpha-1a-like          224   9e-67    
ref|XP_010513590.1|  PREDICTED: importin subunit alpha-1-like           225   1e-66    
gb|KDO42368.1|  hypothetical protein CISIN_1g043676mg                   226   1e-66    
gb|KFK30907.1|  hypothetical protein AALP_AA6G041500                    225   1e-65    
ref|XP_005758728.1|  hypothetical protein EMIHUDRAFT_460128             225   1e-65    
emb|CDY33917.1|  BnaA02g30700D                                          225   1e-65    
ref|XP_010045351.1|  PREDICTED: importin subunit alpha-1b-like          225   1e-65    
gb|KCW87526.1|  hypothetical protein EUGRSUZ_B03975                     225   1e-65    
gb|EEE54508.1|  hypothetical protein OsJ_01650                          223   2e-65    
gb|EPS69743.1|  hypothetical protein M569_05021                         224   2e-65    
ref|NP_001042958.1|  Os01g0343200                                       224   4e-65    
ref|XP_009129776.1|  PREDICTED: importin subunit alpha-1-like           223   6e-65    
gb|KDO52349.1|  hypothetical protein CISIN_1g042204mg                   224   8e-65    
ref|XP_010045353.1|  PREDICTED: importin subunit alpha-1b-like is...    223   9e-65    
gb|KDO38957.1|  hypothetical protein CISIN_1g013228mg                   221   9e-65    
ref|XP_003081334.1|  putative importin alpha 2 (ISS)                    224   1e-64    
gb|KCW87525.1|  hypothetical protein EUGRSUZ_B03974                     223   1e-64    
ref|XP_006494500.1|  PREDICTED: disease resistance protein At4g27...    231   2e-64    
ref|XP_006494501.1|  PREDICTED: disease resistance protein At4g27...    231   3e-64    
ref|XP_002590287.1|  hypothetical protein BRAFLDRAFT_279360             222   3e-64    
gb|KEH41662.1|  importin subunit alpha                                  215   4e-64    
ref|XP_002455600.1|  hypothetical protein SORBIDRAFT_03g013687          212   6e-64    
ref|XP_006301945.1|  hypothetical protein CARUB_v10022422mg             220   7e-64    
ref|XP_005705411.1|  importin alpha                                     220   1e-63    
gb|ESA20675.1|  hypothetical protein GLOINDRAFT_343521                  220   1e-63    
gb|KFH71790.1|  hypothetical protein MVEG_02085                         220   2e-63    
gb|KEH41661.1|  importin subunit alpha                                  213   2e-63    
ref|XP_010045354.1|  PREDICTED: importin subunit alpha-1b-like is...    219   2e-63    
ref|NP_001171841.1|  importin subunit alpha-7                           219   3e-63    
ref|XP_006695628.1|  hypothetical protein CTHT_0052900                  219   3e-63    
ref|XP_010045352.1|  PREDICTED: importin subunit alpha-1a-like is...    219   3e-63    
ref|XP_006471714.1|  PREDICTED: importin subunit alpha-1-like iso...    216   5e-63    
gb|KFH71830.1|  hypothetical protein MVEG_02124                         219   5e-63    
ref|XP_003610507.1|  Importin alpha-1b subunit                          209   6e-63    
gb|KEH28816.1|  importin subunit alpha                                  213   8e-63    
gb|AES92704.2|  importin subunit alpha-like protein                     209   9e-63    
gb|EDL80567.1|  karyopherin (importin) alpha 6                          209   1e-62    
ref|XP_010152917.1|  PREDICTED: importin subunit alpha-7                210   2e-62    
gb|KFK30899.1|  hypothetical protein AALP_AA6G040600                    215   2e-62    
ref|XP_011433097.1|  PREDICTED: importin subunit alpha-7-like           217   2e-62    
ref|XP_006471717.1|  PREDICTED: disease resistance protein At4g27...    225   2e-62    
ref|XP_006480868.1|  PREDICTED: uncharacterized protein LOC102608919    224   2e-62    
gb|EKC25623.1|  Importin subunit alpha-7                                217   3e-62    
gb|KEH41663.1|  importin subunit alpha                                  212   3e-62    
gb|KDR14157.1|  Importin subunit alpha-7                                216   3e-62    
ref|XP_002182420.1|  predicted protein                                  217   3e-62    
gb|KDO38849.1|  hypothetical protein CISIN_1g037562mg                   219   4e-62    
ref|XP_005302236.1|  PREDICTED: importin subunit alpha-7                216   4e-62    
ref|XP_005707794.1|  importin alpha                                     216   4e-62    
ref|XP_007406517.1|  hypothetical protein MELLADRAFT_42367              216   7e-62    
ref|XP_006494499.1|  PREDICTED: importin subunit alpha-1a-like          214   9e-62    
ref|XP_968505.1|  PREDICTED: importin subunit alpha-7                   215   1e-61    
ref|XP_006471709.1|  PREDICTED: importin subunit alpha-1a-like is...    218   1e-61    
ref|XP_009065239.1|  hypothetical protein LOTGIDRAFT_108452             215   1e-61    
ref|XP_659746.1|  hypothetical protein AN2142.2                         215   1e-61    
ref|XP_006274864.1|  PREDICTED: importin subunit alpha-7                214   2e-61    
gb|KFK30823.1|  hypothetical protein AALP_AA6G030600                    219   2e-61    
ref|XP_006117607.1|  PREDICTED: importin subunit alpha-7                214   2e-61    
ref|XP_006019402.1|  PREDICTED: importin subunit alpha-7                214   2e-61    
gb|EAX07569.1|  karyopherin alpha 6 (importin alpha 7), isoform C...    208   2e-61    
ref|XP_008064994.1|  PREDICTED: importin subunit alpha-5-like           204   3e-61    
gb|KFP47367.1|  Importin subunit alpha-7                                211   3e-61    
emb|CBN79488.1|  conserved unknown protein                              214   3e-61    
gb|KIN05105.1|  hypothetical protein OIDMADRAFT_115625                  214   4e-61    
gb|ELU00208.1|  hypothetical protein CAPTEDRAFT_220826                  213   5e-61    
ref|XP_003050006.1|  predicted protein                                  214   5e-61    
gb|EPS32782.1|  hypothetical protein PDE_07742                          213   6e-61    
ref|XP_009541289.1|  hypothetical protein HETIRDRAFT_378302             213   8e-61    
ref|XP_007908530.1|  PREDICTED: importin subunit alpha-6                213   8e-61    
gb|KFQ60322.1|  Importin subunit alpha-7                                213   9e-61    
ref|XP_009330442.1|  PREDICTED: importin subunit alpha-7 isoform X2     211   9e-61    
ref|XP_005710150.1|  Predicted protein                                  214   9e-61    
ref|XP_010144524.1|  PREDICTED: importin subunit alpha-5-like           204   1e-60    
ref|XP_003228760.2|  PREDICTED: importin subunit alpha-7                213   1e-60    
gb|KFO10902.1|  Importin subunit alpha-7                                212   1e-60    
gb|KFP59542.1|  Importin subunit alpha-7                                212   1e-60    
ref|XP_011582253.1|  PREDICTED: importin subunit alpha-7 isoform X3     212   1e-60    
ref|XP_009479218.1|  PREDICTED: importin subunit alpha-7                212   1e-60    
ref|XP_010300779.1|  PREDICTED: importin subunit alpha-7                212   1e-60    
ref|XP_009906721.1|  PREDICTED: importin subunit alpha-7                212   1e-60    
gb|KFV75068.1|  Importin subunit alpha-7                                212   1e-60    
gb|ENN80631.1|  hypothetical protein YQE_02952                          212   1e-60    
gb|KFP95806.1|  Importin subunit alpha-7                                212   1e-60    
ref|XP_003661324.1|  hypothetical protein MYCTH_2300575                 212   2e-60    
gb|ERL93916.1|  hypothetical protein D910_11202                         212   2e-60    
ref|XP_009881056.1|  PREDICTED: importin subunit alpha-7                212   2e-60    
gb|KFP10882.1|  Importin subunit alpha-7                                212   2e-60    
ref|XP_009646820.1|  PREDICTED: importin subunit alpha-7 isoform X1     212   2e-60    
gb|KKA25648.1|  Importin subunit alpha                                  214   2e-60    
ref|XP_001506386.1|  PREDICTED: importin subunit alpha-7 isoform X2     212   2e-60    
ref|XP_007668668.1|  PREDICTED: importin subunit alpha-7 isoform X1     212   2e-60    
ref|XP_009702207.1|  PREDICTED: importin subunit alpha-7 isoform X2     212   2e-60    
gb|KIL91152.1|  hypothetical protein FAVG1_05850                        212   2e-60    
ref|XP_009998863.1|  PREDICTED: importin subunit alpha-7                211   2e-60    
ref|XP_007298970.1|  ARM repeat-containing protein                      211   2e-60    
ref|XP_009646822.1|  PREDICTED: importin subunit alpha-7 isoform X2     211   2e-60    
ref|XP_002295213.1|  importin alpha 1 subunit-like protein              212   2e-60    
ref|XP_005239839.1|  PREDICTED: importin subunit alpha-7                211   2e-60    
gb|KFM11285.1|  Importin subunit alpha-7                                211   2e-60    
ref|XP_009679325.1|  PREDICTED: importin subunit alpha-7                211   2e-60    
ref|XP_009957438.1|  PREDICTED: importin subunit alpha-7                211   2e-60    
ref|XP_009702206.1|  PREDICTED: importin subunit alpha-7 isoform X1     212   2e-60    
gb|KFV84485.1|  Importin subunit alpha-7                                211   3e-60    
gb|KFQ03858.1|  Importin subunit alpha-7                                211   3e-60    
gb|KFV03609.1|  Importin subunit alpha-7                                211   3e-60    
ref|XP_008945481.1|  PREDICTED: importin subunit alpha-5-like           204   3e-60    
gb|KFU91827.1|  Importin subunit alpha-7                                211   3e-60    
ref|XP_010076088.1|  PREDICTED: importin subunit alpha-7                211   3e-60    
ref|XP_005079689.1|  PREDICTED: importin subunit alpha-7                211   3e-60    
ref|XP_001923921.1|  PREDICTED: importin subunit alpha-7                211   3e-60    
ref|XP_002583100.1|  importin alpha subunit                             210   3e-60    
ref|XP_009925144.1|  PREDICTED: importin subunit alpha-7 isoform X1     212   3e-60    
ref|XP_003299932.1|  hypothetical protein PTT_11044                     211   3e-60    
ref|XP_001500078.2|  PREDICTED: importin subunit alpha-7 isoform X1     211   3e-60    
ref|XP_005607308.1|  PREDICTED: importin subunit alpha-7 isoform X3     211   3e-60    
gb|KFV40758.1|  Importin subunit alpha-7                                211   3e-60    
ref|XP_009970296.1|  PREDICTED: importin subunit alpha-7                211   3e-60    
ref|XP_011582250.1|  PREDICTED: importin subunit alpha-7 isoform X1     212   3e-60    
ref|XP_003801323.1|  PREDICTED: importin subunit alpha-7                209   4e-60    
ref|XP_007842722.1|  karyopherin alpha                                  211   4e-60    
ref|XP_005607307.1|  PREDICTED: importin subunit alpha-7 isoform X2     211   4e-60    
pdb|4UAD|A  Chain A, Importin Alpha 7 Delta Ibb In Complex With I...    209   4e-60    
gb|KIW03736.1|  hypothetical protein PV09_05043                         211   4e-60    
emb|CAG31953.1|  hypothetical protein RCJMB04_14f8                      211   4e-60    
ref|XP_001229199.1|  hypothetical protein CHGG_02683                    211   4e-60    
ref|NP_001012859.2|  importin subunit alpha-7                           211   5e-60    
ref|XP_001936253.1|  importin subunit alpha-1                           211   5e-60    
ref|XP_003500689.1|  PREDICTED: importin subunit alpha-7 isoform X1     211   5e-60    
ref|XP_004174449.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...    211   5e-60    
ref|XP_006994430.1|  PREDICTED: importin subunit alpha-7 isoform X2     211   5e-60    
ref|NP_989192.1|  karyopherin alpha 1 (importin alpha 5)                211   5e-60    
ref|XP_001800558.1|  hypothetical protein SNOG_10279                    209   6e-60    
ref|XP_011935805.1|  PREDICTED: importin subunit alpha-7                210   6e-60    
gb|EER42016.1|  importin alpha subunit                                  205   6e-60    
ref|NP_001015029.2|  importin subunit alpha-7                           211   6e-60    
gb|AAC53373.1|  importin alpha S2                                       210   6e-60    
ref|XP_008936591.1|  PREDICTED: importin subunit alpha-7                210   6e-60    
ref|XP_007125169.1|  PREDICTED: importin subunit alpha-7                210   6e-60    
ref|XP_004266580.1|  PREDICTED: importin subunit alpha-7 isoform 3      210   6e-60    
ref|XP_005317797.1|  PREDICTED: importin subunit alpha-7 isoform X2     210   6e-60    
ref|XP_005058299.1|  PREDICTED: importin subunit alpha-7 isoform X1     210   6e-60    
ref|XP_007170659.1|  PREDICTED: importin subunit alpha-7 isoform X3     210   6e-60    
ref|NP_032494.3|  importin subunit alpha-7                              210   6e-60    



>ref|XP_007031183.1| Importin alpha isoform 1 [Theobroma cacao]
 gb|EOY11685.1| Importin alpha isoform 1 [Theobroma cacao]
Length=536

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 192/204 (94%), Gaps = 3/204 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLL QNHKKSIKKEACWTISNITAGNR QIQAVIEANIILPLV+LLQ+AEFDIKKEAA
Sbjct  335  LYQLLVQNHKKSIKKEACWTISNITAGNRTQIQAVIEANIILPLVHLLQHAEFDIKKEAA  394

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  395  WAISNATSGGAHEQIQFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMG  454

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +N GINLYAQ+IDEC+G DK+E+LQTHDNHEIYEKAVKILE++W+EEE+++QN+ D   G
Sbjct  455  MNGGINLYAQMIDECDGLDKIENLQTHDNHEIYEKAVKILERYWAEEEDDEQNLQD--GG  512

Query  319  NQ-QQAFSFGENQPNVPPGGFKFG  251
            N+ QQ F+FG NQPNVPPGGFKFG
Sbjct  513  NENQQGFNFGANQPNVPPGGFKFG  536



>gb|AAK38726.1|AF369706_1 importin alpha 1 [Capsicum annuum]
Length=535

 Score =   360 bits (923),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 189/203 (93%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLV+LLQNAEFDIKKEAA
Sbjct  335  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVHLLQNAEFDIKKEAA  394

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS+EQIRFL +QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGE DKETG
Sbjct  395  WAISNATSGGSNEQIRFLASQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEMDKETG  454

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N GINLYAQ+IDECEG DK+E+LQTHDN+EIYEK VKILEK+W+EE+ E+QN+ D VDG
Sbjct  455  ANGGINLYAQMIDECEGLDKIENLQTHDNNEIYEKTVKILEKYWAEED-EEQNLPDGVDG  513

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ F FG NQPNVP GGFKFG
Sbjct  514  N-QQGFQFGNNQPNVPAGGFKFG  535



>ref|XP_007031184.1| Importin alpha isoform 2 [Theobroma cacao]
 gb|EOY11686.1| Importin alpha isoform 2 [Theobroma cacao]
Length=540

 Score =   360 bits (923),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 192/204 (94%), Gaps = 3/204 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLL QNHKKSIKKEACWTISNITAGNR QIQAVIEANIILPLV+LLQ+AEFDIKKEAA
Sbjct  339  LYQLLVQNHKKSIKKEACWTISNITAGNRTQIQAVIEANIILPLVHLLQHAEFDIKKEAA  398

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  399  WAISNATSGGAHEQIQFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMG  458

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +N GINLYAQ+IDEC+G DK+E+LQTHDNHEIYEKAVKILE++W+EEE+++QN+ D   G
Sbjct  459  MNGGINLYAQMIDECDGLDKIENLQTHDNHEIYEKAVKILERYWAEEEDDEQNLQD--GG  516

Query  319  NQ-QQAFSFGENQPNVPPGGFKFG  251
            N+ QQ F+FG NQPNVPPGGFKFG
Sbjct  517  NENQQGFNFGANQPNVPPGGFKFG  540



>ref|XP_006344784.1| PREDICTED: importin subunit alpha-1 [Solanum tuberosum]
Length=534

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 187/203 (92%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILP+V+LLQNAEFDIKKEAA
Sbjct  334  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPMVHLLQNAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS++QIRFL +QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGE DKE G
Sbjct  394  WAISNATSGGSNDQIRFLASQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEVDKEAG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N GINLYAQ IDEC+G DK+E+LQTHDN+E+YEKAVKILEK+W+EE+ E+QN+ D  DG
Sbjct  454  ANGGINLYAQTIDECDGLDKIENLQTHDNNELYEKAVKILEKYWAEED-EEQNLPDGADG  512

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ F FG NQPNVP GGFKFG
Sbjct  513  N-QQGFQFGNNQPNVPAGGFKFG  534



>gb|KJB26294.1| hypothetical protein B456_004G235800 [Gossypium raimondii]
Length=537

 Score =   351 bits (901),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 190/205 (93%), Gaps = 4/205 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLL QNHKKSIKKEACWTISNITAGN+AQIQAVIEANIILPLV+LLQ AEFDIKKEAA
Sbjct  335  LYQLLVQNHKKSIKKEACWTISNITAGNKAQIQAVIEANIILPLVHLLQLAEFDIKKEAA  394

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  395  WAISNATSGGSHEQIQFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMG  454

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +N GINLYAQ+IDEC+G DK+E+LQTHDNHEIYEKAVKILE++W+EEE ++QNI D   G
Sbjct  455  MNGGINLYAQMIDECDGLDKIENLQTHDNHEIYEKAVKILERYWAEEEEDEQNIQD--GG  512

Query  319  NQ-QQAFSFGEN-QPNVPPGGFKFG  251
            N+ QQ F+FG N QP+ PPGGFKFG
Sbjct  513  NENQQGFNFGVNQQPSAPPGGFKFG  537



>ref|NP_001275782.1| importin alpha [Citrus sinensis]
 gb|ACU56981.1| importin alpha [Citrus sinensis]
Length=535

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLT NHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLV+LLQ+AEF+IKKEAA
Sbjct  333  LYQLLTHNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVHLLQHAEFEIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  393  WAISNATSGGSHQQIQFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEADKEMG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +N+GIN+YAQ+IDEC+G DK+E+LQTHDN+EIYEKAVKILE++W+EEE E+Q I +   G
Sbjct  453  MNNGINVYAQMIDECDGLDKIENLQTHDNNEIYEKAVKILERYWAEEEEEEQLIQEGGIG  512

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            NQQQ F F  NQPN+PPGGFKFG
Sbjct  513  NQQQGFGFATNQPNIPPGGFKFG  535



>ref|XP_004230322.1| PREDICTED: importin subunit alpha-1 [Solanum lycopersicum]
Length=534

 Score =   349 bits (895),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 185/203 (91%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLV+LLQNAEFDIKKEAA
Sbjct  334  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVHLLQNAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS++QIRFL +QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGE DKE G
Sbjct  394  WAISNATSGGSNDQIRFLTSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEVDKEAG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N GIN+Y  +IDEC+G DK+E+LQTHDN+EIYEKAVKILEK+W+EE+ E+QN+ D  DG
Sbjct  454  TNGGINMYTHMIDECDGLDKIENLQTHDNNEIYEKAVKILEKYWAEED-EEQNLPDGADG  512

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N  Q F FG NQPNVP GGFKFG
Sbjct  513  N-PQGFQFGNNQPNVPAGGFKFG  534



>ref|XP_012088868.1| PREDICTED: importin subunit alpha-4 isoform X1 [Jatropha curcas]
 gb|KDP23371.1| hypothetical protein JCGZ_23204 [Jatropha curcas]
Length=535

 Score =   349 bits (895),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 187/203 (92%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLL QNHKKSIKKEACWTISNITAGNR QIQAVIEANIIL LV+LLQ+AEFDIKKEAA
Sbjct  335  LYQLLMQNHKKSIKKEACWTISNITAGNRTQIQAVIEANIILSLVHLLQHAEFDIKKEAA  394

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLVNQGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  395  WAISNATSGGSHEQIQFLVNQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMG  454

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN GINLYAQ+IDEC+G DK+E+LQTHDNHEIYEKAVKILE++W+EEE E+Q + D  DG
Sbjct  455  LNGGINLYAQMIDECDGLDKIENLQTHDNHEIYEKAVKILERYWAEEE-EEQTVQDGGDG  513

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ F FG NQPN PPGGFKFG
Sbjct  514  N-QQGFPFGSNQPNAPPGGFKFG  535



>ref|XP_012088870.1| PREDICTED: importin subunit alpha-4 isoform X2 [Jatropha curcas]
Length=534

 Score =   349 bits (895),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 187/203 (92%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLL QNHKKSIKKEACWTISNITAGNR QIQAVIEANIIL LV+LLQ+AEFDIKKEAA
Sbjct  334  LYQLLMQNHKKSIKKEACWTISNITAGNRTQIQAVIEANIILSLVHLLQHAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLVNQGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  394  WAISNATSGGSHEQIQFLVNQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN GINLYAQ+IDEC+G DK+E+LQTHDNHEIYEKAVKILE++W+EEE E+Q + D  DG
Sbjct  454  LNGGINLYAQMIDECDGLDKIENLQTHDNHEIYEKAVKILERYWAEEE-EEQTVQDGGDG  512

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ F FG NQPN PPGGFKFG
Sbjct  513  N-QQGFPFGSNQPNAPPGGFKFG  534



>emb|CAN64716.1| hypothetical protein VITISV_026717 [Vitis vinifera]
Length=523

 Score =   347 bits (891),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 187/203 (92%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLTQNHKKSIKKEACWTISNITAGN+ QIQAVIEANIILPLV LLQ+AEFDIKKEAA
Sbjct  323  LYQLLTQNHKKSIKKEACWTISNITAGNKGQIQAVIEANIILPLVNLLQHAEFDIKKEAA  382

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            W ISNATSGGSHEQI+FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE+G
Sbjct  383  WGISNATSGGSHEQIQFLVSQGCIKPLCDLLMCPDPRIVTVCLEGLENILKVGEADKESG  442

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N GINLYAQ+IDEC+G DK+E LQTHDN+EIYEK+VK+LE++W+EE+ E QN+ D  DG
Sbjct  443  KNGGINLYAQMIDECDGLDKIELLQTHDNNEIYEKSVKLLERYWAEEDEEVQNVQDG-DG  501

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ F FG +QPN+PPGGFKFG
Sbjct  502  N-QQGFGFGSSQPNLPPGGFKFG  523



>ref|XP_002281670.1| PREDICTED: importin subunit alpha [Vitis vinifera]
 emb|CBI39614.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   347 bits (891),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 187/203 (92%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLTQNHKKSIKKEACWTISNITAGN+ QIQAVIEANIILPLV LLQ+AEFDIKKEAA
Sbjct  335  LYQLLTQNHKKSIKKEACWTISNITAGNKGQIQAVIEANIILPLVNLLQHAEFDIKKEAA  394

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            W ISNATSGGSHEQI+FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE+G
Sbjct  395  WGISNATSGGSHEQIQFLVSQGCIKPLCDLLMCPDPRIVTVCLEGLENILKVGEADKESG  454

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N GINLYAQ+IDEC+G DK+E LQTHDN+EIYEK+VK+LE++W+EE+ E QN+ D  DG
Sbjct  455  KNGGINLYAQMIDECDGLDKIELLQTHDNNEIYEKSVKLLERYWAEEDEEVQNVQDG-DG  513

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ F FG +QPN+PPGGFKFG
Sbjct  514  N-QQGFGFGSSQPNLPPGGFKFG  535



>ref|XP_008370371.1| PREDICTED: importin subunit alpha-like [Malus domestica]
Length=532

 Score =   346 bits (888),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 182/203 (90%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L QLLTQ+HKKSIKKEACWTISNITAGNR QIQAVI+A II+PLV LLQNAEFDIKKEAA
Sbjct  334  LNQLLTQSHKKSIKKEACWTISNITAGNRGQIQAVIDAGIIIPLVQLLQNAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  394  WAISNATSGGSHEQIQFLVAQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +N GINLYAQLIDECEGSDK+E+LQTHDNHEIYEKAVK+LE++W+EE+ E Q  G+    
Sbjct  454  MNGGINLYAQLIDECEGSDKIENLQTHDNHEIYEKAVKLLERYWTEEDEEVQENGN----  509

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              QQ F+FG NQPN PPGGF FG
Sbjct  510  GTQQGFTFGTNQPNPPPGGFTFG  532



>ref|XP_009337642.1| PREDICTED: importin subunit alpha-like isoform X2 [Pyrus x bretschneideri]
Length=532

 Score =   346 bits (887),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 182/203 (90%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L QLLTQ+HKKSIKKEACWTISNITAGNR QIQAVI+A II+PLV LLQNAEFDIKKEAA
Sbjct  334  LGQLLTQSHKKSIKKEACWTISNITAGNRGQIQAVIDAGIIIPLVQLLQNAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  394  WAISNATSGGSHEQIQFLVAQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +N GINLYAQLIDECEGSDK+E+LQTHDNHEIYEKAVK+LE++W+EE+ E Q  G+    
Sbjct  454  MNGGINLYAQLIDECEGSDKIENLQTHDNHEIYEKAVKLLERYWTEEDEEVQENGN----  509

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              QQ F+FG NQPN PPGGF FG
Sbjct  510  GTQQGFTFGTNQPNPPPGGFNFG  532



>ref|XP_009337641.1| PREDICTED: importin subunit alpha-like isoform X1 [Pyrus x bretschneideri]
Length=533

 Score =   345 bits (886),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 182/203 (90%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L QLLTQ+HKKSIKKEACWTISNITAGNR QIQAVI+A II+PLV LLQNAEFDIKKEAA
Sbjct  335  LGQLLTQSHKKSIKKEACWTISNITAGNRGQIQAVIDAGIIIPLVQLLQNAEFDIKKEAA  394

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  395  WAISNATSGGSHEQIQFLVAQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMG  454

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +N GINLYAQLIDECEGSDK+E+LQTHDNHEIYEKAVK+LE++W+EE+ E Q  G+    
Sbjct  455  MNGGINLYAQLIDECEGSDKIENLQTHDNHEIYEKAVKLLERYWTEEDEEVQENGN----  510

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              QQ F+FG NQPN PPGGF FG
Sbjct  511  GTQQGFTFGTNQPNPPPGGFNFG  533



>ref|XP_008453295.1| PREDICTED: importin subunit alpha [Cucumis melo]
Length=536

 Score =   345 bits (886),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLV+LLQ+AEFDIKKEA 
Sbjct  334  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVHLLQHAEFDIKKEAG  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI+FLV QGCIKPLCDLL CPDPRI+TVCLEGL+NILKVGEADK+ G
Sbjct  394  WAISNATSGGSHQQIQFLVTQGCIKPLCDLLTCPDPRIVTVCLEGLDNILKVGEADKDMG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQ-QNIGDEVD  323
            +N GIN+YAQ IDECEG DK+E+LQ+HDN+EIYEKAVK+LE++W+EE+ EQ QN     D
Sbjct  454  MNGGINIYAQAIDECEGLDKIENLQSHDNNEIYEKAVKMLERYWAEEDEEQEQNPQQNGD  513

Query  322  GNQQQAFSFGENQPNVPPGGFKFG  251
             NQ   F+FG NQPNVPPGGFKFG
Sbjct  514  ANQH-GFAFGANQPNVPPGGFKFG  536



>ref|XP_002319478.1| importin alpha-1 subunit family protein [Populus trichocarpa]
 gb|EEE95401.1| importin alpha-1 subunit family protein [Populus trichocarpa]
Length=537

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 186/203 (92%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+QLL QNHKKSIKKEACWTISNITAGNR QIQAVIEANIILPLV LLQ+AEFDIKKEAA
Sbjct  336  LHQLLLQNHKKSIKKEACWTISNITAGNRTQIQAVIEANIILPLVNLLQHAEFDIKKEAA  395

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATS GSHEQI+FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  396  WAISNATSAGSHEQIQFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMG  455

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN G+NLYAQ++DEC+G DK+E+LQTHDN+EIYEKAVKILE++W+EEE+ +  + D  DG
Sbjct  456  LNGGVNLYAQMVDECDGLDKIENLQTHDNNEIYEKAVKILERYWAEEEDGEPIVQDGGDG  515

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ F+FG NQP+VP GGFKFG
Sbjct  516  N-QQGFAFGTNQPSVPQGGFKFG  537



>ref|XP_007205030.1| hypothetical protein PRUPE_ppa004046mg [Prunus persica]
 gb|EMJ06229.1| hypothetical protein PRUPE_ppa004046mg [Prunus persica]
Length=533

 Score =   343 bits (881),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 186/202 (92%), Gaps = 2/202 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+QLLTQNHKKSIKKEACWTISNITAGN+ QIQAVIEA+IILPLV +LQ+AEFDIKKEAA
Sbjct  334  LHQLLTQNHKKSIKKEACWTISNITAGNKIQIQAVIEADIILPLVQVLQHAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+ L ++GCIKPLCDLL+CPDPRIITVCLEGLENILKVGEADKE G
Sbjct  394  WAISNATSGGSHEQIQHLASRGCIKPLCDLLICPDPRIITVCLEGLENILKVGEADKEMG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +NDGINLYAQL+DECEG DK+E+LQTHDN+EIYEKAVKILE++W+EEE E QNI +  DG
Sbjct  454  MNDGINLYAQLVDECEGLDKIENLQTHDNNEIYEKAVKILERYWAEEE-EGQNIQENGDG  512

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
            NQ   F+FG NQPN PPGGFKF
Sbjct  513  NQHD-FTFGANQPNPPPGGFKF  533



>ref|XP_009796205.1| PREDICTED: importin subunit alpha-1 [Nicotiana sylvestris]
Length=531

 Score =   343 bits (880),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 187/203 (92%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L QLLTQNHKKSIKKEACWTISNITAGN+AQIQAVIEANII PLV+LLQ+AEFDIKKEAA
Sbjct  331  LCQLLTQNHKKSIKKEACWTISNITAGNKAQIQAVIEANIIPPLVHLLQSAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS++QIRFL +QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGE DKE G
Sbjct  391  WAISNATSGGSYDQIRFLASQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEMDKEAG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +N GINLYAQ+IDEC+G DK+E+LQTHDN+EIYEKAVKILEK+W+ EE+E+Q + D +DG
Sbjct  451  MNGGINLYAQMIDECDGLDKIENLQTHDNNEIYEKAVKILEKYWA-EEDEEQILPDGIDG  509

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ F FG +QPNVP GGFKFG
Sbjct  510  N-QQGFQFGNSQPNVPAGGFKFG  531



>ref|XP_009592620.1| PREDICTED: importin subunit alpha-1 [Nicotiana tomentosiformis]
Length=531

 Score =   342 bits (878),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 186/203 (92%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L QLLTQNHKKSIKKEACWTISNITAGN+AQIQAVIEANII PLV+LLQ+AEFDIKKEAA
Sbjct  331  LCQLLTQNHKKSIKKEACWTISNITAGNKAQIQAVIEANIIPPLVHLLQSAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS++QIRFL +QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGE DKE G
Sbjct  391  WAISNATSGGSYDQIRFLASQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEVDKEAG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +N GINLYAQ++DEC+G DK+E+LQTHDN+EIYEKAVKILEK+W+ EE+E+Q   D VDG
Sbjct  451  MNGGINLYAQMMDECDGLDKIENLQTHDNNEIYEKAVKILEKYWA-EEDEEQIFPDGVDG  509

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ F FG +QPNVP GGFKFG
Sbjct  510  N-QQGFQFGNSQPNVPAGGFKFG  531



>emb|CDY31102.1| BnaA08g26520D [Brassica napus]
Length=542

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+AQI+AV+ A ++LPLV+LLQNAEFDIKKEAA
Sbjct  340  LYNLLTQNHKKSIKKEACWTISNITAGNQAQIEAVVGAGLVLPLVHLLQNAEFDIKKEAA  399

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LVNQGCIKPLCDLL+CPDPRI+TVCLEGLENILK+ EADKE G
Sbjct  400  WAISNATSGGSHEQIQYLVNQGCIKPLCDLLICPDPRIVTVCLEGLENILKISEADKEMG  459

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN G+NLYAQ+I+E +G DK+E+LQ+HDN+EIYEKAVKILEK+W+EEE+E+Q + D  + 
Sbjct  460  LNGGVNLYAQIIEESDGLDKIENLQSHDNNEIYEKAVKILEKYWAEEEDEEQILTDGGNE  519

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ FSFG NQP  PPGGFKFG
Sbjct  520  NPQQGFSFGNNQPAAPPGGFKFG  542



>ref|XP_011023801.1| PREDICTED: importin subunit alpha [Populus euphratica]
Length=537

 Score =   341 bits (875),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 185/203 (91%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+QLL QNHKKSIKKEACWTISNITAGNR QIQAVIEANIILPLV LLQ+AEF+IKKEAA
Sbjct  336  LHQLLLQNHKKSIKKEACWTISNITAGNRTQIQAVIEANIILPLVNLLQHAEFEIKKEAA  395

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATS GSHEQI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  396  WAISNATSAGSHEQIQFLVSQGCIKPLCDLLTCPDPRIVTVCLEGLENILKVGEADKEMG  455

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN G+NLYAQ++DEC+G DK+E+LQTHDN+EIYEKAVKILE++W+EEE+ +  + D  DG
Sbjct  456  LNGGVNLYAQMVDECDGLDKIENLQTHDNNEIYEKAVKILERYWAEEEDGEPIVQDGGDG  515

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ F+FG NQP+VP GGFKFG
Sbjct  516  N-QQGFAFGTNQPSVPQGGFKFG  537



>ref|XP_008246117.1| PREDICTED: importin subunit alpha-1 [Prunus mume]
Length=533

 Score =   341 bits (874),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 185/202 (92%), Gaps = 2/202 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+QLLTQNHKKSIKKEACWTISNITAGN+ QIQAVIEA+IILPLV LLQ+AEFDIKKEAA
Sbjct  334  LHQLLTQNHKKSIKKEACWTISNITAGNKIQIQAVIEADIILPLVQLLQHAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI+ L ++GCIKPLCDLL+CPDPRIITVCLEGLENILKVGEADKE G
Sbjct  394  WAISNATSGGSHDQIQHLASRGCIKPLCDLLICPDPRIITVCLEGLENILKVGEADKEMG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +NDGINLYAQL+DECEG DK+E+LQTHDN+EIYEKAVKILE++W+EE+ E QNI    DG
Sbjct  454  MNDGINLYAQLVDECEGLDKIENLQTHDNNEIYEKAVKILERYWAEED-EGQNIQVNGDG  512

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
            NQ   F+FG NQPN PPGGFKF
Sbjct  513  NQHD-FTFGANQPNPPPGGFKF  533



>emb|CDY32165.1| BnaCnng06740D [Brassica napus]
Length=542

 Score =   340 bits (872),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+AQI+AV+ A ++LPLV+LLQNAEFDIKKEAA
Sbjct  340  LYNLLTQNHKKSIKKEACWTISNITAGNQAQIEAVVGAGLVLPLVHLLQNAEFDIKKEAA  399

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LVNQGCIKP+CDLL+CPDPRI+TVCLEGLENILK+ EADKE G
Sbjct  400  WAISNATSGGSHEQIQYLVNQGCIKPICDLLICPDPRIVTVCLEGLENILKISEADKEMG  459

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN G+NLYAQ+I+E +G DK+E+LQ+HDN+EIYEKAVKILE++W+EEE+E+Q + D  + 
Sbjct  460  LNGGVNLYAQIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEEEDEEQILTDGGNE  519

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ FSFG NQP  PPGGFKFG
Sbjct  520  NPQQGFSFGNNQPAAPPGGFKFG  542



>ref|XP_004302281.1| PREDICTED: importin subunit alpha-4 [Fragaria vesca subsp. vesca]
Length=531

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 184/203 (91%), Gaps = 3/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLL QNHKKSIKKEACWTISNITAGN+AQIQAVI+A II PLV LLQ+AEFDIKKEAA
Sbjct  332  LYQLLNQNHKKSIKKEACWTISNITAGNKAQIQAVIDAQIINPLVQLLQHAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  392  WAISNATSGGSHEQIQFLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N+GINL+AQ+IDE +G +K+E+LQTHDN+EIYEKAVKILE++W+EEE+E+QN+    DG
Sbjct  452  ANNGINLFAQMIDEFDGLEKIENLQTHDNNEIYEKAVKILERYWAEEEDEEQNLQQNGDG  511

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N   AF+FG NQP  PPGGFKFG
Sbjct  512  N---AFTFGGNQPAAPPGGFKFG  531



>ref|XP_010267916.1| PREDICTED: importin subunit alpha-like [Nelumbo nucifera]
Length=533

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 183/204 (90%), Gaps = 4/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLTQNHKKSIKKEACWTISNITAGNR QIQAVI+ANII PLV LLQ+AEF+IKKEAA
Sbjct  333  LYQLLTQNHKKSIKKEACWTISNITAGNRGQIQAVIDANIIFPLVQLLQHAEFEIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LVNQGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  393  WAISNATSGGSHEQIQYLVNQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEADKELG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGD-EVD  323
               G+N+YAQ+IDECEG DK+E+LQ HDN+EIYEK++KILE++W +EE E+QNI D E+ 
Sbjct  453  KTGGVNIYAQMIDECEGLDKIENLQNHDNNEIYEKSMKILERYWVDEEEEEQNIQDGEI-  511

Query  322  GNQQQAFSFGENQPNVPPGGFKFG  251
               QQ F FG NQPNVP GGFKFG
Sbjct  512  --AQQGFEFGTNQPNVPSGGFKFG  533



>ref|XP_010024140.1| PREDICTED: importin subunit alpha [Eucalyptus grandis]
 gb|KCW60572.1| hypothetical protein EUGRSUZ_H03303 [Eucalyptus grandis]
Length=542

 Score =   338 bits (868),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 185/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAV+EANII PLV+LLQ+AEF+IKKEAA
Sbjct  340  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVVEANIIHPLVHLLQHAEFEIKKEAA  399

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLEN+LK+GEADKE G
Sbjct  400  WAISNATSGGSHEQIQFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENVLKIGEADKEMG  459

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENE-QQNIGDEVD  323
            LN G+NLY Q+IDECEG DK+E LQTHDN+EIYEKAVKILE++W+EEE+  + +  D V+
Sbjct  460  LNGGVNLYGQMIDECEGLDKIESLQTHDNNEIYEKAVKILERYWAEEEDGVEDDTQDAVN  519

Query  322  GNQQQAFSFGENQPNVPPGGFKFG  251
            G+  Q F+FG N PN+P  GFKFG
Sbjct  520  GD-AQGFTFGANAPNLPSNGFKFG  542



>ref|XP_009148181.1| PREDICTED: importin subunit alpha-1 [Brassica rapa]
Length=542

 Score =   338 bits (867),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+ QI+AV+ A I+LPLV+LLQNAEFDIKKEAA
Sbjct  340  LYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAVVGAGIVLPLVHLLQNAEFDIKKEAA  399

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILK+GEADKE G
Sbjct  400  WAISNATSGGSHEQIQYLVAQGCIKPLCDLLICPDPRIVTVCLEGLENILKIGEADKEMG  459

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN G+NLYAQ+++E +G DK+E+LQ+HDN+EIYEKAVKILE++W+EEE ++Q + D V+ 
Sbjct  460  LNGGVNLYAQIVEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEEEEDEQILPDGVNE  519

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ FSFG NQ   PPGGFKFG
Sbjct  520  NPQQGFSFGNNQTAAPPGGFKFG  542



>emb|CDX93514.1| BnaA06g05340D [Brassica napus]
Length=542

 Score =   338 bits (866),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+ QI+AV+ A I+LPLV+LLQNAEFDIKKEAA
Sbjct  340  LYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAVVGAGIVLPLVHLLQNAEFDIKKEAA  399

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILK+GEADKE G
Sbjct  400  WAISNATSGGSHEQIQYLVAQGCIKPLCDLLICPDPRIVTVCLEGLENILKIGEADKEMG  459

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN G+NLYAQ+++E +G DK+E+LQ+HDN+EIYEKAVKILE++W+EEE ++Q + D V+ 
Sbjct  460  LNGGVNLYAQIVEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEEEEDEQILPDGVNE  519

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ FSFG NQ   PPGGFKFG
Sbjct  520  NPQQGFSFGNNQTAAPPGGFKFG  542



>ref|XP_010475758.1| PREDICTED: importin subunit alpha-1a-like [Camelina sativa]
Length=540

 Score =   338 bits (866),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 184/203 (91%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+ QI+AV+ A IILPLV+LLQNAEFDIKKEAA
Sbjct  339  LYNLLTQNHKKSIKKEACWTISNITAGNKGQIEAVVGAGIILPLVHLLQNAEFDIKKEAA  398

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKV EADKE G
Sbjct  399  WAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVSEADKEMG  458

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LNDG+NLYA +I+E +G DK+E+LQ+HDN+EIYEKAVKILE++W+E+E E+Q++ D V+ 
Sbjct  459  LNDGVNLYAHIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWNEDE-EEQSLQDGVNE  517

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ F+FG NQP  PPGGFKFG
Sbjct  518  NSQQTFNFGTNQPAAPPGGFKFG  540



>ref|XP_009110839.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Brassica 
rapa]
 ref|XP_009110840.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Brassica 
rapa]
Length=542

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+AQI+AV+ A ++LPLV+LLQNAEFDIKKEAA
Sbjct  340  LYNLLTQNHKKSIKKEACWTISNITAGNQAQIEAVVGAGLVLPLVHLLQNAEFDIKKEAA  399

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LVNQGCIKPLCDLL+CPDPRI+TVCLEGLENILK+ EADKE G
Sbjct  400  WAISNATSGGSHEQIQYLVNQGCIKPLCDLLICPDPRIVTVCLEGLENILKISEADKEMG  459

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN G+NLYAQ+I+E +G DK+E+LQ+HDN+EIYEKAVKILE++W+EEE+E+Q + D  + 
Sbjct  460  LNGGVNLYAQIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEEEDEEQILTDGGNE  519

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ FSFG NQ   PPGGFKFG
Sbjct  520  NPQQGFSFGNNQAAAPPGGFKFG  542



>ref|XP_002512528.1| importin alpha, putative [Ricinus communis]
 gb|EEF49980.1| importin alpha, putative [Ricinus communis]
Length=450

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 188/203 (93%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLL QNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLV+LLQ+AEFDIKKEAA
Sbjct  253  LYQLLMQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVHLLQHAEFDIKKEAA  312

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLVNQGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA KE G
Sbjct  313  WAISNATSGGSHEQIQFLVNQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAKKEMG  372

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +N G+NLYAQ+IDEC+G DK+E+LQTHDN+EIYEKAVKILE++W+EEE E+QN+ +  DG
Sbjct  373  MNGGVNLYAQMIDECDGLDKIENLQTHDNNEIYEKAVKILERYWAEEE-EEQNVQESGDG  431

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ+F+FG NQP    GGF+FG
Sbjct  432  N-QQSFAFGTNQPQ---GGFQFG  450



>gb|KFK43224.1| hypothetical protein AALP_AA1G096500 [Arabis alpina]
Length=539

 Score =   337 bits (863),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 184/204 (90%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+ QI+AV+ A IILPLV+LLQ AEFDIKKEAA
Sbjct  338  LYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAVVGAGIILPLVHLLQTAEFDIKKEAA  397

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  398  WAISNATSGGSHEQIQYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEADKEMG  457

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQ--QNIGDEV  326
            LNDG+NLYAQLI+E +G DK+E+LQ+HDN+EIYEKAVKILE++W+EE+ EQ  Q+ G+E 
Sbjct  458  LNDGVNLYAQLIEESDGLDKVENLQSHDNNEIYEKAVKILERYWAEEDEEQILQDGGNE-  516

Query  325  DGNQQQAFSFGENQPNVPPGGFKF  254
              N QQAF+FG NQP  PPGGFKF
Sbjct  517  --NPQQAFNFGNNQPAAPPGGFKF  538



>gb|ABO21639.1| importin alpha-like protein [Brassica napus]
 gb|ABO21640.1| importin alpha-like protein [Brassica napus]
Length=542

 Score =   336 bits (862),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+ QI+AV+ A I+LPLV+LLQNAEFDIKKEAA
Sbjct  340  LYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAVVGAGIVLPLVHLLQNAEFDIKKEAA  399

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILK+GEADKE G
Sbjct  400  WAISNATSGGSHEQIQYLVAQGCIKPLCDLLICPDPRIVTVCLEGLENILKIGEADKEMG  459

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN G+NLYAQ+++E +G DK+E+LQ+HDN+EIYEKAVKILE++W+EEE ++Q + D V+ 
Sbjct  460  LNGGVNLYAQIVEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEEEEDEQILPDGVNE  519

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ FSFG NQ   PPGGFKF 
Sbjct  520  NPQQGFSFGNNQTAAPPGGFKFA  542



>ref|XP_004144743.1| PREDICTED: importin subunit alpha-4 [Cucumis sativus]
 gb|KGN61011.1| hypothetical protein Csa_2G034640 [Cucumis sativus]
Length=537

 Score =   336 bits (862),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 186/204 (91%), Gaps = 1/204 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLV+LLQ+AEFDIKKEA 
Sbjct  334  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVHLLQHAEFDIKKEAG  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI+FLV QGCIKPLCDLL CPDPRI+TVCLEGL+NILKVGEADK+ G
Sbjct  394  WAISNATSGGSHQQIQFLVTQGCIKPLCDLLTCPDPRIVTVCLEGLDNILKVGEADKDMG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +N GIN+YAQ IDECEG DK+E+LQ+HDN+EIYEKAVK+LE++W+EE+ EQ+    + +G
Sbjct  454  MNGGINIYAQAIDECEGLDKIENLQSHDNNEIYEKAVKMLERYWAEEDEEQEQNPQQQNG  513

Query  319  N-QQQAFSFGENQPNVPPGGFKFG  251
            +  Q  F+FG NQPNVPPGGFKFG
Sbjct  514  DANQHGFAFGANQPNVPPGGFKFG  537



>emb|CDX94988.1| BnaC05g06830D [Brassica napus]
Length=540

 Score =   335 bits (860),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 183/203 (90%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+ QI+AV+ A I+LPLV+LLQNAEFDIKKEAA
Sbjct  339  LYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAVVGAGIVLPLVHLLQNAEFDIKKEAA  398

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILK+GEADKE G
Sbjct  399  WAISNATSGGSHEQIQYLVAQGCIKPLCDLLICPDPRIVTVCLEGLENILKIGEADKEMG  458

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN G+NLYAQ+I+E +G DK+E+LQ+HDN+EIYEKAVKILE++W+EEE+EQ  + D V+ 
Sbjct  459  LNGGVNLYAQIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEEEDEQI-LPDGVNE  517

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ FSFG NQ   PPGGFKFG
Sbjct  518  NPQQGFSFGNNQTAAPPGGFKFG  540



>ref|XP_006304709.1| hypothetical protein CARUB_v10011976mg [Capsella rubella]
 gb|EOA37607.1| hypothetical protein CARUB_v10011976mg [Capsella rubella]
Length=540

 Score =   333 bits (855),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 183/205 (89%), Gaps = 5/205 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+ QI+AV+ A IILPLV+LLQNAEFDIKKEAA
Sbjct  339  LYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAVVGAGIILPLVHLLQNAEFDIKKEAA  398

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++L  QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGE DKE G
Sbjct  399  WAISNATSGGSHEQIQYLATQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGETDKEMG  458

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQ--QNIGDEV  326
            LNDG+NLY Q+I+EC+G DK+E LQ+HDN+EIYEKAVKILE++W+EEE EQ  Q+ G+E 
Sbjct  459  LNDGVNLYGQIIEECDGLDKVESLQSHDNNEIYEKAVKILERYWAEEEEEQILQDGGNE-  517

Query  325  DGNQQQAFSFGENQPNVPPGGFKFG  251
              N QQAFSFG NQP  PPGGFKFG
Sbjct  518  --NSQQAFSFGTNQPAAPPGGFKFG  540



>ref|XP_010549392.1| PREDICTED: importin subunit alpha-1 [Tarenaya hassleriana]
Length=537

 Score =   333 bits (854),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 182/203 (90%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGNR QIQAV++A I+LPLV+LLQ+AEFDIKKEAA
Sbjct  336  LYNLLTQNHKKSIKKEACWTISNITAGNRVQIQAVVDAGIVLPLVHLLQHAEFDIKKEAA  395

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI+FLV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKV EADKE G
Sbjct  396  WAISNATSGGTHDQIKFLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVSEADKEMG  455

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN G+NLYAQ+++E +G DK+E+LQTHDN+EIYEKAVKILE++W+EEE E QN  D ++ 
Sbjct  456  LNGGVNLYAQMVEESDGLDKIENLQTHDNNEIYEKAVKILERYWAEEE-EDQNHQDAMNE  514

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ F+FG +QP+VP GGF F 
Sbjct  515  NAQQGFNFGNSQPSVPSGGFNFS  537



>ref|XP_010270837.1| PREDICTED: importin subunit alpha-like [Nelumbo nucifera]
Length=533

 Score =   332 bits (852),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 182/203 (90%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLTQNHKKSIKKEACWTISNITAGNR QIQAVI+ANII PLV LLQ+AEF+IKKEAA
Sbjct  333  LYQLLTQNHKKSIKKEACWTISNITAGNRGQIQAVIDANIIFPLVQLLQHAEFEIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  393  WAISNATSGGTHEQIQYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEADKELG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGD-EVD  323
               G+N+YAQ+IDECEG DK+E+LQ HDN+EIYEKA+KILE++W +EE E+QN+ D E+ 
Sbjct  453  KTGGVNMYAQMIDECEGLDKIENLQNHDNNEIYEKAMKILERYWVDEEEEEQNLQDGEIT  512

Query  322  GNQQQAFSFGENQPNVPPGGFKF  254
               QQ F FG +QPNVP GGFKF
Sbjct  513  ---QQGFEFGNSQPNVPSGGFKF  532



>ref|XP_010458212.1| PREDICTED: importin subunit alpha-1b-like isoform X2 [Camelina 
sativa]
Length=540

 Score =   331 bits (849),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 182/205 (89%), Gaps = 5/205 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+ QI+A++ A IILPLV+LLQ AEFDIKKEAA
Sbjct  339  LYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAMVGAGIILPLVHLLQTAEFDIKKEAA  398

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKV EADKE G
Sbjct  399  WAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVSEADKEMG  458

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQ--QNIGDEV  326
            LNDG+NLYA +I+E +G DK+E+LQ+HDN+EIYEKAVKILE++W+E+E EQ  Q+ G+E 
Sbjct  459  LNDGVNLYAHIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEDEEEQILQDGGNE-  517

Query  325  DGNQQQAFSFGENQPNVPPGGFKFG  251
              N QQ F+FG NQP  PPGGFKFG
Sbjct  518  --NSQQTFNFGTNQPAAPPGGFKFG  540



>ref|XP_010458211.1| PREDICTED: importin subunit alpha-1b-like isoform X1 [Camelina 
sativa]
Length=540

 Score =   331 bits (848),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 182/205 (89%), Gaps = 5/205 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+ QI+A++ A IILPLV+LLQ AEFDIKKEAA
Sbjct  339  LYNLLTQNHKKSIKKEACWTISNITAGNKGQIEAMVGAGIILPLVHLLQTAEFDIKKEAA  398

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKV EADKE G
Sbjct  399  WAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVSEADKEMG  458

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQ--QNIGDEV  326
            LNDG+NLYA +I+E +G DK+E+LQ+HDN+EIYEKAVKILE++W+E+E EQ  Q+ G+E 
Sbjct  459  LNDGVNLYAHIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEDEEEQILQDGGNE-  517

Query  325  DGNQQQAFSFGENQPNVPPGGFKFG  251
              N QQ F+FG NQP  PPGGFKFG
Sbjct  518  --NSQQTFNFGTNQPAAPPGGFKFG  540



>ref|XP_002889740.1| hypothetical protein ARALYDRAFT_888168 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65999.1| hypothetical protein ARALYDRAFT_888168 [Arabidopsis lyrata subsp. 
lyrata]
Length=538

 Score =   331 bits (848),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 185/205 (90%), Gaps = 5/205 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+ QI+AV+ A IILPLV+LLQNAEFDIKKEAA
Sbjct  337  LYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAVVAAGIILPLVHLLQNAEFDIKKEAA  396

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  397  WAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMG  456

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQ--QNIGDEV  326
            LN G+NLYAQ+I+E +G DK+E+LQ+HDN+EIYEKAVKILE++W+EEE EQ  Q+ G+E 
Sbjct  457  LNGGVNLYAQIIEESDGLDKVENLQSHDNNEIYEKAVKILERYWAEEEEEQILQDGGNE-  515

Query  325  DGNQQQAFSFGENQPNVPPGGFKFG  251
              N QQAF+FG NQP  PPGGFKFG
Sbjct  516  --NSQQAFNFGNNQPAAPPGGFKFG  538



>ref|XP_008388467.1| PREDICTED: importin subunit alpha-1 [Malus domestica]
Length=534

 Score =   330 bits (847),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 177/203 (87%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L QLL QNHKKSIKKEACWTISNITAGN+ QIQAVI+A II PLV LLQ+AEFDIKKEAA
Sbjct  334  LNQLLKQNHKKSIKKEACWTISNITAGNKGQIQAVIDAGIIFPLVQLLQHAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  394  WAISNATSGGSHEQIQFLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNMG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +N GINLYAQ+IDECEGSDK+E+LQTHDNHEIYEKAVK+LE++W+EE+ E Q        
Sbjct  454  MNGGINLYAQIIDECEGSDKIENLQTHDNHEIYEKAVKLLERYWTEEDEEVQEN--GNGN  511

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              QQ ++FG NQPN PPGGF FG
Sbjct  512  GNQQGYTFGANQPNPPPGGFNFG  534



>gb|ABB55384.1| importin alpha 1-like [Solanum tuberosum]
Length=445

 Score =   327 bits (838),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 176/192 (92%), Gaps = 2/192 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILP+V+LLQNAEFDIKKEAA
Sbjct  255  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPMVHLLQNAEFDIKKEAA  314

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS++QIRFL +QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGE DKE G
Sbjct  315  WAISNATSGGSNDQIRFLASQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEVDKEAG  374

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N GINLYAQ IDEC+G DK+E+LQTHDN+E+YEKAVKILEK+W+EE+ E+QN+ D  DG
Sbjct  375  ANGGINLYAQTIDECDGLDKIENLQTHDNNELYEKAVKILEKYWAEED-EEQNLPDGADG  433

Query  319  NQQQAFSFGENQ  284
            N Q  F FG NQ
Sbjct  434  N-QLGFQFGNNQ  444



>ref|XP_009373302.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009373303.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=534

 Score =   330 bits (845),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 176/203 (87%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L QLL QNHKKSIKKEACWTISNITAGN+ QIQAVI+A II PLV LLQ+AEFDIKKEAA
Sbjct  334  LNQLLKQNHKKSIKKEACWTISNITAGNKGQIQAVIDAGIIFPLVQLLQHAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  394  WAISNATSGGSHEQIQFLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNMG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +N GINLYAQ+IDECEGSDK+E+LQTHDNHEIYEKAVK+LE++W+EE+ E Q        
Sbjct  454  MNGGINLYAQIIDECEGSDKIENLQTHDNHEIYEKAVKLLERYWTEEDEEVQEN--GNGN  511

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              QQ F+F  NQPN PPGGF FG
Sbjct  512  GNQQGFTFAANQPNPPPGGFNFG  534



>ref|XP_010544159.1| PREDICTED: importin subunit alpha-1b-like [Tarenaya hassleriana]
Length=540

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 184/203 (91%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGNRAQIQAVI+A IILPLV+LLQ+AEFDIKKEAA
Sbjct  339  LYNLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIDACIILPLVHLLQHAEFDIKKEAA  398

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI+FLV Q CIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  399  WAISNATSGGSHDQIKFLVTQDCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMG  458

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN G+NLYAQ+++E +G DK+E+LQTHDN+EIYEKAVKILE++W+EEE E+QN+ D ++ 
Sbjct  459  LNGGVNLYAQVVEESDGLDKIENLQTHDNNEIYEKAVKILERYWAEEE-EEQNLQDGMNQ  517

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQ F+FG +QP  P GGF FG
Sbjct  518  NGQQGFNFGTDQPGAPSGGFNFG  540



>ref|XP_008806746.1| PREDICTED: importin subunit alpha-1-like, partial [Phoenix dactylifera]
Length=210

 Score =   312 bits (800),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 174/203 (86%), Gaps = 3/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+QLLTQNHKKSIKKEACWTISNITAGNRAQIQAVI+ANII PLV LLQ+AEFDIKKEAA
Sbjct  11   LFQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIDANIINPLVQLLQHAEFDIKKEAA  70

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISN TSGGS+EQI FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K+ G
Sbjct  71   WAISNTTSGGSNEQIHFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKDLG  130

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               GIN YAQ+ID CEG DK+E+LQ HDN+EIYE+ +KILE+FW EE++E Q +    +G
Sbjct  131  RTGGINPYAQMIDGCEGLDKIENLQGHDNNEIYERTIKILERFWVEEDDEGQVVQGSAEG  190

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
                AF F  NQ +VP GGFKFG
Sbjct  191  T---AFEFRANQSSVPSGGFKFG  210



>ref|XP_006417589.1| hypothetical protein EUTSA_v10007310mg [Eutrema salsugineum]
 gb|ESQ35942.1| hypothetical protein EUTSA_v10007310mg [Eutrema salsugineum]
Length=539

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+AQI+AV+ A IILPLV+LLQ AEFDIKKEAA
Sbjct  338  LYNLLTQNHKKSIKKEACWTISNITAGNKAQIEAVVGAGIILPLVHLLQTAEFDIKKEAA  397

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK+ G
Sbjct  398  WAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKDMG  457

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN G+NLYAQ+I+E +G DK+E+LQ+HDN+EIYEKAVKILE++W+EEE E+QN+ D    
Sbjct  458  LNGGVNLYAQIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEEE-EEQNMPDGGSE  516

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
            N Q  F+FG NQP  PPGGFKF
Sbjct  517  NPQLGFNFGNNQPAAPPGGFKF  538



>ref|XP_010674568.1| PREDICTED: importin subunit alpha-1a [Beta vulgaris subsp. vulgaris]
Length=534

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 182/202 (90%), Gaps = 2/202 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+QLLTQNHKKSIKKEACWTISNITAGN+AQIQAV+EA ++ PLV LLQNAEFDIKKEAA
Sbjct  334  LHQLLTQNHKKSIKKEACWTISNITAGNKAQIQAVVEAGLVQPLVQLLQNAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+ EQIRFLV+QGCIKPLCDLL+CPDPRI+TVCLEGLEN+LKVGE DKE G
Sbjct  394  WAISNATSGGAPEQIRFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENLLKVGETDKEMG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +N G+N+YAQ+IDECEG DK+E+LQTHDN++IYEKAVK+LEK+W+EEE E+QN  D    
Sbjct  454  MNGGVNIYAQMIDECEGLDKIENLQTHDNNDIYEKAVKVLEKYWAEEE-EEQNAQDGAAM  512

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
            N QQ F+FG  QPN+P GGFKF
Sbjct  513  N-QQGFNFGATQPNIPAGGFKF  533



>ref|XP_010931776.1| PREDICTED: importin subunit alpha-like [Elaeis guineensis]
Length=533

 Score =   322 bits (826),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 177/203 (87%), Gaps = 3/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+QLLTQNHKKSIKKEACWTISNITAG+RAQIQAVI+ANII PL  LLQ+AEFDIKKEAA
Sbjct  334  LFQLLTQNHKKSIKKEACWTISNITAGSRAQIQAVIDANIINPLAQLLQHAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WA+SNATSGGS+EQI FLVNQGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K+ G
Sbjct  394  WAMSNATSGGSNEQIHFLVNQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKDLG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               GIN YAQ+IDECEG DK+E+LQ HDN+EIYEK +KILE++W EE++E Q +    +G
Sbjct  454  RTGGINPYAQMIDECEGLDKIENLQGHDNNEIYEKTIKILERYWVEEDDEGQVVQGSAEG  513

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
                AF FG NQP+VP GGFKFG
Sbjct  514  ---VAFEFGANQPSVPSGGFKFG  533



>ref|XP_010914627.1| PREDICTED: importin subunit alpha isoform X2 [Elaeis guineensis]
Length=533

 Score =   322 bits (826),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 177/203 (87%), Gaps = 3/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+QLLTQNHKKSIKKEACWTISNITAGNRAQIQAVI+ANII PLV LLQ+AEFDIKKEAA
Sbjct  334  LFQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIDANIINPLVQLLQHAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS+EQI FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K+ G
Sbjct  394  WAISNATSGGSNEQIHFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKDLG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               GIN YAQ+IDECEG DK+E+LQ HDN+EIYEK +KILE++W EE++E Q +    +G
Sbjct  454  RTGGINPYAQMIDECEGLDKIENLQGHDNNEIYEKTIKILERYWVEEDDEGQVVQGTGEG  513

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
                AF FG NQP+ P GGFKFG
Sbjct  514  ---AAFEFGANQPSAPSGGFKFG  533



>ref|XP_011092170.1| PREDICTED: importin subunit alpha [Sesamum indicum]
Length=540

 Score =   322 bits (825),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 177/203 (87%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L QLLTQNHKKSIKKEACWTISNITAGNRAQIQAVI+A+II PLV LL++AEF+IKKEAA
Sbjct  340  LQQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIQADIIPPLVQLLEHAEFEIKKEAA  399

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAI NATSGGS  QIR L + GCIKPLCDLL+CPDPRI+TVCLEGLENILKVGE DKE G
Sbjct  400  WAIFNATSGGSPAQIRLLASHGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEIDKENG  459

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +N GIN+YAQ+ID CEG DKLE+LQ+HDN+EIY+KAVKILEK+W EE+ E QN+ D VDG
Sbjct  460  MNGGINIYAQMIDYCEGLDKLENLQSHDNNEIYDKAVKILEKYWVEED-EDQNLADGVDG  518

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N  Q FSFG N+ NVP GGF FG
Sbjct  519  N-HQGFSFGNNKANVPAGGFNFG  540



>gb|EYU38410.1| hypothetical protein MIMGU_mgv1a004192mg [Erythranthe guttata]
Length=540

 Score =   322 bits (824),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 186/204 (91%), Gaps = 2/204 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L QLLTQNHKKSIKKEACWTISNITAGNRAQIQAVI+A+I+LPLV LLQ+AEFDIKKEAA
Sbjct  338  LQQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIQADILLPLVQLLQHAEFDIKKEAA  397

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS EQIRFLV+QGCIKPLCDLL+ PDPRI+TVCLEGLENILKVGEADKE+G
Sbjct  398  WAISNATSGGSPEQIRFLVSQGCIKPLCDLLISPDPRIVTVCLEGLENILKVGEADKESG  457

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDE-VD  323
            LN GIN+YAQ+ID+CEG DK+E LQ+HDN+EIYEKAVKILEK+W+EE+ E QNI D  VD
Sbjct  458  LNGGINIYAQMIDDCEGLDKIETLQSHDNNEIYEKAVKILEKYWAEED-EDQNIADAGVD  516

Query  322  GNQQQAFSFGENQPNVPPGGFKFG  251
            GN  Q F+FG NQPNVP GGF FG
Sbjct  517  GNNNQGFNFGNNQPNVPNGGFNFG  540



>ref|XP_010914626.1| PREDICTED: importin subunit alpha isoform X1 [Elaeis guineensis]
Length=557

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 177/203 (87%), Gaps = 3/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+QLLTQNHKKSIKKEACWTISNITAGNRAQIQAVI+ANII PLV LLQ+AEFDIKKEAA
Sbjct  358  LFQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIDANIINPLVQLLQHAEFDIKKEAA  417

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS+EQI FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K+ G
Sbjct  418  WAISNATSGGSNEQIHFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKDLG  477

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               GIN YAQ+IDECEG DK+E+LQ HDN+EIYEK +KILE++W EE++E Q +    +G
Sbjct  478  RTGGINPYAQMIDECEGLDKIENLQGHDNNEIYEKTIKILERYWVEEDDEGQVVQGTGEG  537

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
                AF FG NQP+ P GGFKFG
Sbjct  538  ---AAFEFGANQPSAPSGGFKFG  557



>ref|XP_002519264.1| importin alpha, putative [Ricinus communis]
 gb|EEF43128.1| importin alpha, putative [Ricinus communis]
Length=453

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 181/203 (89%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLTQN+KKSIKKEACWTISNITAGN+ QIQAVIEANII PLV+LLQNAEF++KKEAA
Sbjct  255  LYQLLTQNYKKSIKKEACWTISNITAGNKHQIQAVIEANIISPLVHLLQNAEFEVKKEAA  314

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS EQI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILK+GE +KE+G
Sbjct  315  WAISNATSGGSREQIQYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKIGETEKESG  374

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N  +N+YAQLID+C+G DK+E+LQ+HDNHEIYEKAVKILEK+W EEE E QNI D  +G
Sbjct  375  -NTTVNMYAQLIDDCDGLDKIENLQSHDNHEIYEKAVKILEKYWIEEEEEDQNIIDASNG  433

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            +     SFG NQP++P GGFKF 
Sbjct  434  D----LSFGTNQPSIPIGGFKFS  452



>ref|XP_006488809.1| PREDICTED: importin subunit alpha-1b-like [Citrus sinensis]
Length=528

 Score =   318 bits (815),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 183/203 (90%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLTQN+KKSIKKEACWTISNITAG+R+QIQAVIEANII PLVYLLQ+AEF++KKEA+
Sbjct  331  LYQLLTQNYKKSIKKEACWTISNITAGSRSQIQAVIEANIIAPLVYLLQHAEFEVKKEAS  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+ EQI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILK+GEADKE G
Sbjct  391  WAISNATSGGTREQIQFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKIGEADKEAG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +N+Y+++IDEC+G DK+E+LQ+HDN+EIYEKAVK+LE++W EEE+++QNI    DG
Sbjct  451  -STTVNVYSEMIDECDGLDKIENLQSHDNNEIYEKAVKLLERYWVEEEDDEQNIP---DG  506

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N  + F+FG  QPN+P  GFKF 
Sbjct  507  NNPE-FNFGTGQPNIPSEGFKFS  528



>ref|NP_001031011.1| importin alpha isoform 4 [Arabidopsis thaliana]
 gb|AEE28423.1| importin alpha isoform 4 [Arabidopsis thaliana]
Length=456

 Score =   315 bits (807),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 180/203 (89%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+ QI+AV+ A IILPLV+LLQNAEFDIKKEAA
Sbjct  256  LYNLLTQNHKKSIKKEACWTISNITAGNKLQIEAVVGAGIILPLVHLLQNAEFDIKKEAA  315

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  316  WAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMG  375

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN G+NLYAQ+I+E +G DK+E+LQ+HDN+EIYEKAVKILE++W+EEE EQ  + D  + 
Sbjct  376  LNSGVNLYAQIIEESDGLDKVENLQSHDNNEIYEKAVKILERYWAEEEEEQI-LQDGGND  434

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQAF+FG N P  P GGFKF 
Sbjct  435  NSQQAFNFG-NNPAAPVGGFKFA  456



>gb|KDO72000.1| hypothetical protein CISIN_1g009700mg [Citrus sinensis]
Length=528

 Score =   317 bits (811),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 182/203 (90%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLTQN+KKSIKKEACWTISNITAG+R+QIQAVIEANII PLVYLLQ+AEF++KKEA+
Sbjct  331  LYQLLTQNYKKSIKKEACWTISNITAGSRSQIQAVIEANIIAPLVYLLQHAEFEVKKEAS  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+ EQI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILK+GEADKE G
Sbjct  391  WAISNATSGGTREQIQFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKIGEADKEAG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +   N+Y+++IDEC+G DK+E+LQ+HDN+EIYEKAVK+LE++W EEE+++QNI    DG
Sbjct  451  -STTANVYSEMIDECDGLDKIENLQSHDNNEIYEKAVKLLERYWVEEEDDEQNIP---DG  506

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N  + F+FG  QPN+P  GFKF 
Sbjct  507  NNPE-FNFGTGQPNIPSEGFKFS  528



>ref|NP_172398.1| importin alpha isoform 4 [Arabidopsis thaliana]
 ref|NP_849623.1| importin alpha isoform 4 [Arabidopsis thaliana]
 sp|O80480.1|IMPA4_ARATH RecName: Full=Importin subunit alpha-4; Short=IMPa-4 [Arabidopsis 
thaliana]
 gb|AAC24079.1| Match to mRNA for importin alpha-like protein 4 (impa4) gb|Y14616 
from A. thaliana. ESTs gb|N96440, gb|N37503, gb|N37498 
and gb|T42198 come from this gene [Arabidopsis thaliana]
 gb|AAM13992.1| putative importin alpha protein [Arabidopsis thaliana]
 gb|AAM51388.1| putative importin alpha protein [Arabidopsis thaliana]
 dbj|BAH19416.1| AT1G09270 [Arabidopsis thaliana]
 gb|AEE28421.1| importin alpha isoform 4 [Arabidopsis thaliana]
 gb|AEE28422.1| importin alpha isoform 4 [Arabidopsis thaliana]
Length=538

 Score =   317 bits (812),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 180/203 (89%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLTQNHKKSIKKEACWTISNITAGN+ QI+AV+ A IILPLV+LLQNAEFDIKKEAA
Sbjct  338  LYNLLTQNHKKSIKKEACWTISNITAGNKLQIEAVVGAGIILPLVHLLQNAEFDIKKEAA  397

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE G
Sbjct  398  WAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMG  457

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN G+NLYAQ+I+E +G DK+E+LQ+HDN+EIYEKAVKILE++W+EEE EQ  + D  + 
Sbjct  458  LNSGVNLYAQIIEESDGLDKVENLQSHDNNEIYEKAVKILERYWAEEEEEQI-LQDGGND  516

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N QQAF+FG N P  P GGFKF 
Sbjct  517  NSQQAFNFG-NNPAAPVGGFKFA  538



>ref|XP_010095558.1| Importin subunit alpha [Morus notabilis]
 gb|EXB60957.1| Importin subunit alpha [Morus notabilis]
Length=628

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 175/203 (86%), Gaps = 12/203 (6%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+QLLTQNHKKSIKKEACWTISNITAGN+AQIQAVI+ANII PLV+LLQ+AEF+IKKEAA
Sbjct  334  LFQLLTQNHKKSIKKEACWTISNITAGNKAQIQAVIDANIIQPLVHLLQHAEFEIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV QGCI PLCDLL CPDPRIITVCLEGLENILKVGEADKE G
Sbjct  394  WAISNATSGGSHEQIQFLVTQGCIAPLCDLLACPDPRIITVCLEGLENILKVGEADKEMG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN GINLYAQ IDEC+G DK+E LQ HDN+EIYEKAVKILE++W+EE+++ +N+      
Sbjct  454  LNGGINLYAQQIDECDGLDKIESLQNHDNNEIYEKAVKILERYWTEEDDD-ENLP-----  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
                   F   QP +PPGGFKFG
Sbjct  508  ------VFAGGQPTLPPGGFKFG  524



>ref|XP_008801729.1| PREDICTED: importin subunit alpha-1a isoform X2 [Phoenix dactylifera]
Length=533

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 174/203 (86%), Gaps = 3/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+QLLTQNHKKSIKKEACWTISNITAG++AQIQAVI+ANII PLV LLQ+AEFDIKKEAA
Sbjct  334  LFQLLTQNHKKSIKKEACWTISNITAGSKAQIQAVIDANIINPLVQLLQHAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS+EQI FL +QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K+ G
Sbjct  394  WAISNATSGGSNEQIHFLASQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKDLG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                IN YAQ+IDECEG DK+E+LQ HDN+EIYEK +KILE++W EE++E Q +    +G
Sbjct  454  RTGDINPYAQMIDECEGLDKIENLQGHDNNEIYEKTIKILERYWIEEDDEGQVVQGTGEG  513

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
                 F FG NQP+ P GGFKFG
Sbjct  514  ---ATFEFGANQPSAPSGGFKFG  533



>gb|ACF86631.1| unknown [Zea mays]
Length=234

 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 170/203 (84%), Gaps = 6/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVI ANII PLV LLQ AEFDIKKEAA
Sbjct  38   LLNLLTTNHKKSIKKEACWTISNITAGNREQIQAVINANIIAPLVQLLQTAEFDIKKEAA  97

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  98   WAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  157

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              D +N+YAQ+ID+ EG DK+E+LQ+HDN EIYEKAVK+LE +W EEE++    GD    
Sbjct  158  AGD-VNVYAQMIDDAEGLDKIENLQSHDNTEIYEKAVKMLESYWLEEEDDAMPSGD----  212

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N Q  F+FG NQP+VP GGF FG
Sbjct  213  NPQNGFNFG-NQPSVPSGGFNFG  234



>ref|XP_004144766.1| PREDICTED: importin subunit alpha-2 [Cucumis sativus]
 gb|KGN60977.1| hypothetical protein Csa_2G033320 [Cucumis sativus]
Length=529

 Score =   312 bits (800),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 173/203 (85%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+AQIQAVI+ANI+ PLV+LLQNAEFDIKKEAA
Sbjct  331  LLNLLTNNHKKSIKKEACWTISNITAGNKAQIQAVIDANIVAPLVHLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LVNQGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K T 
Sbjct  391  WAISNATSGGSHDQIKYLVNQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNTT  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    G +   
Sbjct  451  NTGGVNLYAQLIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDETMPPGTD---  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG ++P VP GGF FG
Sbjct  508  -PQAGFNFGGDRPVVPSGGFNFG  529



>ref|XP_008453860.1| PREDICTED: importin subunit alpha-1 [Cucumis melo]
Length=529

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 172/203 (85%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+AQIQAVI+ANI+ PLV+LLQNAEFDIKKEAA
Sbjct  331  LLNLLTNNHKKSIKKEACWTISNITAGNKAQIQAVIDANIVAPLVHLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LVNQGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K T 
Sbjct  391  WAISNATSGGSHDQIKYLVNQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNTT  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    G    G
Sbjct  451  DTGGVNLYAQLIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDETMPPGTAPQG  510

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
                 F+FG ++P VP GGF FG
Sbjct  511  ----GFNFGGDRPVVPSGGFNFG  529



>gb|AFW77280.1| hypothetical protein ZEAMMB73_231111, partial [Zea mays]
Length=227

 Score =   300 bits (768),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 170/203 (84%), Gaps = 6/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVI ANII PLV LLQ AEFDIKKEAA
Sbjct  31   LLNLLTTNHKKSIKKEACWTISNITAGNREQIQAVINANIIAPLVQLLQTAEFDIKKEAA  90

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  91   WAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  150

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              D +N+YAQ+ID+ EG DK+E+LQ+HDN EIYEKAVK+LE +W EEE++    GD    
Sbjct  151  AGD-VNVYAQMIDDAEGLDKIENLQSHDNTEIYEKAVKMLESYWLEEEDDAMPSGD----  205

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N Q  F+FG NQP+VP GGF FG
Sbjct  206  NPQNGFNFG-NQPSVPSGGFNFG  227



>ref|XP_012084120.1| PREDICTED: importin subunit alpha-4-like [Jatropha curcas]
 gb|KDP27954.1| hypothetical protein JCGZ_19034 [Jatropha curcas]
Length=527

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 175/202 (87%), Gaps = 5/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LYQLLTQN+KKSIKKEACWTISNITAGNR QIQA+I+ANII PLV+LLQ+AEF++KKEAA
Sbjct  331  LYQLLTQNYKKSIKKEACWTISNITAGNRNQIQAIIDANIIAPLVHLLQHAEFEVKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+ EQI+ LV++GCIKPLCDLL CPDPRIITVCLEGLENILK+GE DKE+G
Sbjct  391  WAISNATSGGTQEQIQHLVSRGCIKPLCDLLACPDPRIITVCLEGLENILKIGETDKESG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N  +N+Y  +I++C+G DK+E+LQ HDN EIYEK VKILE++W EEE+  Q+I D +DG
Sbjct  451  -NTQVNVYRHMIEDCDGLDKIENLQNHDNQEIYEKVVKILERYWIEEEDPDQDIADGIDG  509

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
                + SFG NQP++P GGFKF
Sbjct  510  ----SLSFGTNQPSLPSGGFKF  527



>ref|XP_010093918.1| Importin subunit alpha [Morus notabilis]
 gb|EXB54870.1| Importin subunit alpha [Morus notabilis]
Length=840

 Score =   317 bits (811),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 173/203 (85%), Gaps = 12/203 (6%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+QLLTQNHKKSIKKEACWTISNITAGN+AQIQAVI+ANII PLV+LLQ+AEF+IKKEAA
Sbjct  334  LFQLLTQNHKKSIKKEACWTISNITAGNKAQIQAVIDANIIQPLVHLLQHAEFEIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV QGCI PLCDLL CPDPRIITVCLEGLENILKVGEADKE G
Sbjct  394  WAISNATSGGSHEQIQFLVTQGCIAPLCDLLACPDPRIITVCLEGLENILKVGEADKEMG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            LN GINLYAQ IDEC+G DK+E LQ HDN+EIYEKAVKILE++W+EE+++          
Sbjct  454  LNGGINLYAQQIDECDGLDKIESLQNHDNNEIYEKAVKILERYWTEEDDD----------  503

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              +    F   QP +PPGGFKFG
Sbjct  504  --ENLPVFAGGQPTLPPGGFKFG  524


 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 110/166 (66%), Gaps = 30/166 (18%)
 Frame = -1

Query  631  FLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETGLNDGINLYAQLIDECE  452
            FLV QGCI PLCDLL CPDPRIITVCLEGLENILKVGEADKE GLN GINLYAQ IDEC+
Sbjct  525  FLVTQGCIAPLCDLLACPDPRIITVCLEGLENILKVGEADKEMGLNGGINLYAQQIDECD  584

Query  451  GSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDGNQQQAFSFGENQPNVP  272
            G DK+E LQ HDN+EIYEKAVKILE++W+EE+++            +    F   QP +P
Sbjct  585  GLDKIESLQNHDNNEIYEKAVKILERYWTEEDDD------------ENLPVFAGGQPTLP  632

Query  271  PGGFKFG*EKMCRSGLLVLIVSCLLGRKLLVAICHLPRVRCFWSGA  134
            PGGFKF        GL  L++ C L R           VR  W G+
Sbjct  633  PGGFKF--------GLRTLLMLCGLVRA----------VRGVWEGS  660



>gb|EEC78554.1| hypothetical protein OsI_18524 [Oryza sativa Indica Group]
Length=502

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 169/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVI ANII PLV+LLQ AEFDIKKEAA
Sbjct  305  LLNLLTNNHKKSIKKEACWTISNITAGNREQIQAVINANIIAPLVHLLQTAEFDIKKEAA  364

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  365  WAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  424

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              D +N YAQ+ID+ EG +K+E+LQ+HDN EIYEKAVK+LE +W EEE++    GD    
Sbjct  425  AGD-VNAYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKMLESYWLEEEDDAMPSGD----  479

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N Q  F+FG  QPNVP GGF FG
Sbjct  480  NAQNGFNFGNQQPNVPSGGFNFG  502



>ref|NP_001054692.1| Os05g0155500 [Oryza sativa Japonica Group]
 sp|Q9SLX0.2|IMA1B_ORYSJ RecName: Full=Importin subunit alpha-1b [Oryza sativa Japonica 
Group]
 dbj|BAF16606.1| Os05g0155500 [Oryza sativa Japonica Group]
 gb|EEE62387.1| hypothetical protein OsJ_17176 [Oryza sativa Japonica Group]
 gb|AGW80665.1| hypothetical protein [Oryza sativa Japonica Group]
Length=534

 Score =   308 bits (788),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 169/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVI ANII PLV+LLQ AEFDIKKEAA
Sbjct  337  LLNLLTNNHKKSIKKEACWTISNITAGNREQIQAVINANIIAPLVHLLQTAEFDIKKEAA  396

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  397  WAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  456

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              D +N YAQ+ID+ EG +K+E+LQ+HDN EIYEKAVK+LE +W EEE++    GD    
Sbjct  457  AGD-VNSYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKMLESYWLEEEDDAMPSGD----  511

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N Q  F+FG  QPNVP GGF FG
Sbjct  512  NAQNGFNFGNQQPNVPSGGFNFG  534



>ref|XP_008458386.1| PREDICTED: importin subunit alpha-1-like [Cucumis melo]
 ref|XP_008458387.1| PREDICTED: importin subunit alpha-1-like [Cucumis melo]
Length=530

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 168/203 (83%), Gaps = 3/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV LLQNAEFDIKKEAA
Sbjct  331  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIPPLVNLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N  +NLYAQ+ID+ EG +K+E+LQ+HDNHEIYEKAVKILE +W EEE+E        DG
Sbjct  451  TNGDVNLYAQMIDDAEGLEKIENLQSHDNHEIYEKAVKILETYWLEEEDEAL---PTTDG  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG N+  VP GGF F 
Sbjct  508  GAQPGFRFGGNELPVPSGGFNFS  530



>dbj|BAK07842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   299 bits (765),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 169/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVI+ANII PLV+LLQ AEFDIKKEAA
Sbjct  93   LLNLLTTNHKKSIKKEACWTISNITAGNRDQIQAVIQANIIGPLVHLLQGAEFDIKKEAA  152

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  153  WAISNATSGGTHDQIKYLVGQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  212

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              D +N YAQ+ID+ EG +K+E+LQ+HDN EIYEKAVK+LE +W EEE+E    GD    
Sbjct  213  AGD-VNNYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKMLESYWLEEEDEVMPSGD----  267

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N Q  F+FG  Q +VP GGF FG
Sbjct  268  NAQNGFNFGSQQNSVPSGGFNFG  290



>ref|XP_008801728.1| PREDICTED: importin subunit alpha-1a isoform X1 [Phoenix dactylifera]
Length=539

 Score =   307 bits (786),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 175/209 (84%), Gaps = 9/209 (4%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+QLLTQNHKKSIKKEACWTISNITAG++AQIQAVI+ANII PLV LLQ+AEFDIKKEAA
Sbjct  334  LFQLLTQNHKKSIKKEACWTISNITAGSKAQIQAVIDANIINPLVQLLQHAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIR------FLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGE  518
            WAISNATSGGS+EQI+      FL +QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGE
Sbjct  394  WAISNATSGGSNEQIQYVLFFIFLASQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGE  453

Query  517  ADKETGLNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNI  338
            A+K+ G    IN YAQ+IDECEG DK+E+LQ HDN+EIYEK +KILE++W EE++E Q +
Sbjct  454  AEKDLGRTGDINPYAQMIDECEGLDKIENLQGHDNNEIYEKTIKILERYWIEEDDEGQVV  513

Query  337  GDEVDGNQQQAFSFGENQPNVPPGGFKFG  251
                +G     F FG NQP+ P GGFKFG
Sbjct  514  QGTGEG---ATFEFGANQPSAPSGGFKFG  539



>ref|XP_004150082.1| PREDICTED: importin subunit alpha-1 [Cucumis sativus]
 gb|KGN47403.1| hypothetical protein Csa_6G312550 [Cucumis sativus]
Length=530

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 168/203 (83%), Gaps = 3/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  + TQNHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV LLQNAEFDIKKEAA
Sbjct  331  LLGIFTQNHKKSIKKEACWTISNITAGNKEQIQAVIEARLIPPLVNLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N  +NLYAQ+ID+ EG +K+E+LQ+HDNHEIYEKAVKILE +W EEE+E        DG
Sbjct  451  TNGDVNLYAQMIDDAEGLEKIENLQSHDNHEIYEKAVKILETYWLEEEDEAL---PATDG  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG N+  VP GGF F 
Sbjct  508  GAQPGFRFGGNELPVPSGGFNFS  530



>ref|XP_003591197.1| Importin subunit alpha-1 [Medicago truncatula]
 gb|AES61448.1| importin subunit alpha-1b [Medicago truncatula]
Length=533

 Score =   306 bits (783),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 170/203 (84%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            LY LLT N+KKSIKKEACWTISNITAGN+ QIQAVIEANI  PLV LLQNAEFDIKKEAA
Sbjct  333  LYNLLTNNYKKSIKKEACWTISNITAGNKQQIQAVIEANIFGPLVSLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  393  WAISNATSGGSHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNIG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N  +NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD    
Sbjct  453  NNGDVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDETMPPGDA---  509

Query  319  NQQQAFSFGENQ-PNVPPGGFKF  254
              Q  F+FG  + P+VP GGF F
Sbjct  510  -SQSGFNFGSAEVPSVPSGGFNF  531



>dbj|BAA88950.1| importin alpha 1b [Oryza sativa Japonica Group]
Length=534

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 168/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVI ANII PLV+LLQ AEFDIKKEAA
Sbjct  337  LLNLLTNNHKKSIKKEACWTISNITAGNREQIQAVINANIIAPLVHLLQTAEFDIKKEAA  396

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  397  WAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  456

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              D +N YAQ+ID+ EG +K+E+LQ+HDN EIYEKAVK+LE +W EEE++    GD    
Sbjct  457  AGD-VNSYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKMLESYWLEEEDDAMPSGD----  511

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N Q  F+ G  QPNVP GGF FG
Sbjct  512  NAQNGFNLGNQQPNVPSGGFNFG  534



>ref|NP_001141568.1| uncharacterized protein LOC100273684 [Zea mays]
 gb|ACN28186.1| unknown [Zea mays]
 gb|ACN28383.1| unknown [Zea mays]
 gb|AFW77281.1| hypothetical protein ZEAMMB73_231111 [Zea mays]
 gb|AFW77282.1| hypothetical protein ZEAMMB73_231111 [Zea mays]
Length=528

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 170/203 (84%), Gaps = 6/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVI ANII PLV LLQ AEFDIKKEAA
Sbjct  332  LLNLLTTNHKKSIKKEACWTISNITAGNREQIQAVINANIIAPLVQLLQTAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  392  WAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              D +N+YAQ+ID+ EG DK+E+LQ+HDN EIYEKAVK+LE +W EEE++    GD    
Sbjct  452  AGD-VNVYAQMIDDAEGLDKIENLQSHDNTEIYEKAVKMLESYWLEEEDDAMPSGD----  506

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N Q  F+FG NQP+VP GGF FG
Sbjct  507  NPQNGFNFG-NQPSVPSGGFNFG  528



>ref|XP_006382424.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
 gb|ERP60221.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
Length=529

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 169/203 (83%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQAVIEAN+I PLV+LLQNAEFDIKKE+A
Sbjct  331  LLNLLTNNYKKSIKKEACWTISNITAGNKEQIQAVIEANLIGPLVHLLQNAEFDIKKESA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK   
Sbjct  391  WAISNATSGGTHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNVS  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  451  DTGGVNLYAQMIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEDDETMPPGDA---  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG + P VP GGF FG
Sbjct  508  -SQSGFQFGGDAPAVPSGGFNFG  529



>gb|KHN16078.1| Importin subunit alpha-1 [Glycine soja]
Length=532

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 168/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQAVIEAN+I PLV LLQNAEFDIKKEAA
Sbjct  333  LLNLLTNNYKKSIKKEACWTISNITAGNKQQIQAVIEANLIAPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  393  WAISNATSGGSHEQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNIG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+IDE EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD    
Sbjct  453  NTGDVNLYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDETMPPGDA---  509

Query  319  NQQQAFSFG-ENQPNVPPGGFKF  254
              Q  F+FG  + P VP GGF F
Sbjct  510  -SQSGFNFGSSDAPTVPSGGFNF  531



>ref|XP_003536050.1| PREDICTED: importin subunit alpha-1-like [Glycine max]
Length=532

 Score =   305 bits (781),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 168/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQAVIEAN+I PLV LLQNAEFDIKKEAA
Sbjct  333  LLNLLTNNYKKSIKKEACWTISNITAGNKQQIQAVIEANLIAPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  393  WAISNATSGGSHEQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNIG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+IDE EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD    
Sbjct  453  NTGDVNLYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDETMPPGDA---  509

Query  319  NQQQAFSFG-ENQPNVPPGGFKF  254
              Q  F+FG  + P VP GGF F
Sbjct  510  -SQSGFNFGSSDAPTVPSGGFNF  531



>ref|XP_006655009.1| PREDICTED: importin subunit alpha-1b-like [Oryza brachyantha]
Length=529

 Score =   305 bits (780),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 168/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVI ANII PLV+LLQ AEFDIKKEAA
Sbjct  332  LLNLLTTNHKKSIKKEACWTISNITAGNREQIQAVINANIIGPLVHLLQTAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K   
Sbjct  392  WAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLA  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              D +N YAQ+ID+ EG +K+E+LQ+HDN EIYEKAVK+LE +W EEE++    GD    
Sbjct  452  AGD-VNAYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKMLESYWLEEEDDAMPSGD----  506

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N Q  F+FG  QPNVP GGF FG
Sbjct  507  NAQNGFNFGNQQPNVPSGGFNFG  529



>ref|XP_002440631.1| hypothetical protein SORBIDRAFT_09g004320 [Sorghum bicolor]
 gb|EES19061.1| hypothetical protein SORBIDRAFT_09g004320 [Sorghum bicolor]
Length=530

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 170/203 (84%), Gaps = 6/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVI ANII PLV LLQ AEFDIKKEAA
Sbjct  334  LLNLLTTNHKKSIKKEACWTISNITAGNREQIQAVINANIIAPLVQLLQTAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  394  WAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              D +N+YAQ+ID+ EG DK+E+LQ+HDN EIYEKAVK+LE +W EEE++    GD    
Sbjct  454  GGD-VNVYAQMIDDAEGLDKIENLQSHDNTEIYEKAVKMLESYWLEEEDDAMPSGD----  508

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N Q  F+FG NQP+VP GGF FG
Sbjct  509  NPQNGFNFG-NQPSVPSGGFNFG  530



>ref|XP_011036931.1| PREDICTED: importin subunit alpha-1 isoform X2 [Populus euphratica]
Length=529

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 168/203 (83%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQAVIEAN+I PLV+LLQNAEFDIKKE+A
Sbjct  331  LLNLLTNNYKKSIKKEACWTISNITAGNKEQIQAVIEANLIGPLVHLLQNAEFDIKKESA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK   
Sbjct  391  WAISNATSGGTHEQIKYLVGQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNVS  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  451  NTGGVNLYAQMIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEDDETMPPGDA---  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG + P VP GGF FG
Sbjct  508  -SQSGFQFGGDAPAVPSGGFNFG  529



>ref|XP_011036930.1| PREDICTED: importin subunit alpha-1 isoform X1 [Populus euphratica]
Length=530

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 168/203 (83%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQAVIEAN+I PLV+LLQNAEFDIKKE+A
Sbjct  332  LLNLLTNNYKKSIKKEACWTISNITAGNKEQIQAVIEANLIGPLVHLLQNAEFDIKKESA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK   
Sbjct  392  WAISNATSGGTHEQIKYLVGQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNVS  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  452  NTGGVNLYAQMIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEDDETMPPGDA---  508

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG + P VP GGF FG
Sbjct  509  -SQSGFQFGGDAPAVPSGGFNFG  530



>emb|CDO98800.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   304 bits (778),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 167/203 (82%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV LLQ AEFDIKKEAA
Sbjct  332  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAQLIGPLVNLLQTAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLLVCPDPRII VCLEGLENILKVGE +K  G
Sbjct  392  WAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIIAVCLEGLENILKVGEVEKSLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +N YAQLIDE EG +K+EHLQ+HDN+EIYEKAVKILE +W EEE+E    GD    
Sbjct  452  HSGDVNFYAQLIDEAEGLEKIEHLQSHDNNEIYEKAVKILETYWLEEEDETLPAGD----  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG N   +PPGGFKFG
Sbjct  508  GGQPGFNFGGNDMQLPPGGFKFG  530



>emb|CAA75513.1| Importin alpha-like protein [Arabidopsis thaliana]
Length=532

 Score =   304 bits (778),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 169/203 (83%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQNHKKSIKKEACWTISNITAGN+ QIQ V+EAN+I PLV LLQNAEFDIKKEAA
Sbjct  331  LANLLTQNHKKSIKKEACWTISNITAGNKDQIQTVVEANLISPLVSLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LV QGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N YAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+++      VDG
Sbjct  451  HTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDDETQQPPGVDG  510

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            + Q  F FG NQ  VP GGF F 
Sbjct  511  S-QAGFQFGGNQAPVPSGGFNFS  532



>ref|XP_008350735.1| PREDICTED: importin subunit alpha-1b-like, partial [Malus domestica]
Length=239

 Score =   294 bits (753),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 167/204 (82%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QI+AV+EANII PLV LLQNAEFDIKKEAA
Sbjct  40   LLNLLTNNYKKSIKKEACWTISNITAGNKEQIRAVVEANIIGPLVNLLQNAEFDIKKEAA  99

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  100  WAISNATSGGSHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  159

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ I++ +G +K+E LQ+HDN EIYEKAVK+LE +W E+++E    GD    
Sbjct  160  TTGGVNLYAQAIEDADGLEKIESLQSHDNTEIYEKAVKMLETYWLEDDDETMPPGDAA--  217

Query  319  NQQQAFSFGENQ-PNVPPGGFKFG  251
                 F+FG N  P VP GGF FG
Sbjct  218  --PTTFNFGGNDVPTVPSGGFNFG  239



>ref|XP_004977076.1| PREDICTED: importin subunit alpha-1b-like isoform X2 [Setaria 
italica]
Length=530

 Score =   304 bits (778),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 171/203 (84%), Gaps = 6/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVI ANII PLV+LLQ AEFDIKKEAA
Sbjct  334  LLNLLTTNHKKSIKKEACWTISNITAGNREQIQAVINANIIAPLVHLLQTAEFDIKKEAA  393

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+++QI++LV QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  394  WAISNATSGGTNDQIKYLVGQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  453

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              D +N+YAQLID+ EG DK+E+LQ+HDN EIYEKAVK+LE +W EEE++    GD    
Sbjct  454  AGD-VNVYAQLIDDAEGLDKIENLQSHDNTEIYEKAVKMLESYWLEEEDDAMPSGD----  508

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N Q  F+FG NQP+VP GGF FG
Sbjct  509  NPQNGFNFG-NQPSVPSGGFNFG  530



>ref|XP_003554623.1| PREDICTED: importin subunit alpha-1-like [Glycine max]
 gb|KHN43332.1| Importin subunit alpha-1b [Glycine soja]
Length=532

 Score =   304 bits (778),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 169/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQ VIEA+II PLV+LLQNAEFDIKKEAA
Sbjct  333  LLNLLTNNYKKSIKKEACWTISNITAGNKKQIQDVIEASIIAPLVHLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K   
Sbjct  393  WAISNATSGGSHEQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNVS  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              DG+NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  453  NTDGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWMEEDDETMPPGDA---  509

Query  319  NQQQAFSFGENQ-PNVPPGGFKF  254
              Q  F+FG  Q P VP GGF F
Sbjct  510  -SQSGFNFGGAQPPAVPSGGFNF  531



>ref|XP_003556535.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine 
max]
 ref|XP_006606551.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine 
max]
 gb|KHN20271.1| Importin subunit alpha-1 [Glycine soja]
Length=532

 Score =   304 bits (778),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 168/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQAVIEAN+I PLV LLQNAEFDIKKEAA
Sbjct  333  LLNLLTNNYKKSIKKEACWTISNITAGNKQQIQAVIEANLIAPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  393  WAISNATSGGSHEQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNIG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+IDE EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD    
Sbjct  453  NTGDVNLYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDETMPPGDA---  509

Query  319  NQQQAFSFG-ENQPNVPPGGFKF  254
              Q  F+FG  + P VP GGF F
Sbjct  510  -SQSGFNFGSSDAPAVPSGGFNF  531



>gb|AAB72116.2| AtKAP alpha [Arabidopsis thaliana]
Length=532

 Score =   304 bits (778),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 169/203 (83%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQNHKKSIKKEACWTISNITAGN+ QIQ V+EAN+I PLV LLQNAEFDIKKEAA
Sbjct  331  LANLLTQNHKKSIKKEACWTISNITAGNKDQIQTVVEANLISPLVSLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LV QGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N YAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+++      VDG
Sbjct  451  HTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDDETQQPPGVDG  510

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            + Q  F FG NQ  VP GGF F 
Sbjct  511  S-QAGFQFGGNQAPVPSGGFNFS  532



>ref|NP_187328.1| Importin subunit alpha-1 [Arabidopsis thaliana]
 ref|NP_850524.1| Importin subunit alpha-1 [Arabidopsis thaliana]
 sp|Q96321.2|IMPA1_ARATH RecName: Full=Importin subunit alpha-1; Short=IMPa-1; AltName: 
Full=Karyopherin subunit alpha-1; Short=KAP-alpha-1 [Arabidopsis 
thaliana]
 gb|AAC27644.1| importin alpha [Arabidopsis thaliana]
 gb|AAF63826.1| importin alpha [Arabidopsis thaliana]
 gb|AAM19769.1| AT3g06720/F3E22_14 [Arabidopsis thaliana]
 gb|AAM67050.1| importin alpha [Arabidopsis thaliana]
 gb|AAM78039.1| AT3g06720/F3E22_14 [Arabidopsis thaliana]
 gb|AEE74447.1| Importin subunit alpha-1 [Arabidopsis thaliana]
 gb|AEE74448.1| Importin subunit alpha-1 [Arabidopsis thaliana]
Length=532

 Score =   304 bits (778),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 169/203 (83%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQNHKKSIKKEACWTISNITAGN+ QIQ V+EAN+I PLV LLQNAEFDIKKEAA
Sbjct  331  LANLLTQNHKKSIKKEACWTISNITAGNKDQIQTVVEANLISPLVSLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LV QGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N YAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+++      VDG
Sbjct  451  HTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDDETQQPPGVDG  510

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            + Q  F FG NQ  VP GGF F 
Sbjct  511  S-QAGFQFGGNQAPVPSGGFNFS  532



>gb|AAL06825.1| AT3g06720/F3E22_14 [Arabidopsis thaliana]
Length=532

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 169/203 (83%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQNHKKSIKKEACWTISNITAGN+ QIQ V+EAN+I PLV LLQNAEFDIKKEAA
Sbjct  331  LANLLTQNHKKSIKKEACWTISNITAGNKDQIQTVVEANLISPLVSLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LV QGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N YAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+++      VDG
Sbjct  451  HTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDDETQQPPGVDG  510

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            + Q  F FG NQ  VP GGF F 
Sbjct  511  S-QAGFQFGGNQAPVPSGGFNFS  532



>ref|XP_006842676.1| PREDICTED: importin subunit alpha-1 [Amborella trichopoda]
 gb|ERN04351.1| hypothetical protein AMTR_s00147p00043750 [Amborella trichopoda]
Length=527

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 168/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI+ANII PLV LLQ AEFDIKKEAA
Sbjct  330  LLTLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIDANIIPPLVQLLQTAEFDIKKEAA  389

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LVNQGCI+PLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  390  WAISNATSGGTHEQIKYLVNQGCIRPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  449

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              DG+NLYAQLID+ EG DK+E+LQ+HDN+EIYEKAVKILE +W EE+ +      E   
Sbjct  450  NTDGVNLYAQLIDDAEGLDKIENLQSHDNNEIYEKAVKILETYWLEEDEDTLLPPGE---  506

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
                AF+FG NQP  P GGF F 
Sbjct  507  TAPAAFTFGSNQP--PIGGFNFS  527



>gb|AFW81447.1| hypothetical protein ZEAMMB73_731576 [Zea mays]
 gb|AFW81448.1| hypothetical protein ZEAMMB73_731576 [Zea mays]
Length=529

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 170/203 (84%), Gaps = 6/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI ANII PLV LLQ AEFDIKKEAA
Sbjct  333  LLNLLTTNHKKSIKKEACWTISNITAGNKEQIQAVINANIIAPLVQLLQTAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  393  WAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              D +N+YAQ+ID+ EG DK+E+LQ+HDN EIYEKAVK+LE +W EEE++    GD    
Sbjct  453  AGD-VNVYAQMIDDAEGLDKIENLQSHDNTEIYEKAVKMLESYWLEEEDDAMPSGD----  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N Q  F+FG NQP+VP GGF FG
Sbjct  508  NPQNGFNFG-NQPSVPSGGFNFG  529



>ref|XP_004494548.1| PREDICTED: importin subunit alpha-like [Cicer arietinum]
Length=531

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 171/203 (84%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQAVI+ANI  PLV+LLQNAEFDIKKEAA
Sbjct  332  LLNLLTNNYKKSIKKEACWTISNITAGNKQQIQAVIDANIFGPLVHLLQNAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQ+++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK   
Sbjct  392  WAISNATSGGSHEQLKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNVS  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              DG+NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W E+E+E    GD    
Sbjct  452  NTDGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEDEDETMPPGDA---  508

Query  319  NQQQAFSFGENQ-PNVPPGGFKF  254
              Q  F+FG ++ P+VP GGF F
Sbjct  509  -SQSGFNFGGSEVPSVPTGGFNF  530



>emb|CAA74966.1| Importin alpha-like protein [Arabidopsis thaliana]
Length=528

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 173/196 (88%), Gaps = 2/196 (1%)
 Frame = -1

Query  838  NHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAAWAISNAT  659
            NHKKSIKKEACWTISNITAGN+ QI+AV+ A IILPLV+LLQNAEFDIKKEAAWAISNAT
Sbjct  335  NHKKSIKKEACWTISNITAGNKLQIEAVVGAGIILPLVHLLQNAEFDIKKEAAWAISNAT  394

Query  658  SGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETGLNDGINL  479
            SGGSHEQI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADKE GLN G+NL
Sbjct  395  SGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMGLNSGVNL  454

Query  478  YAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDGNQQQAFS  299
            YAQ+I+E +G DK+E+LQ+HDN+EIYEKAVKILE++W+EEE EQ  + D  + N QQ F+
Sbjct  455  YAQIIEESDGLDKVENLQSHDNNEIYEKAVKILERYWAEEEEEQI-LQDGGNDNSQQGFN  513

Query  298  FGENQPNVPPGGFKFG  251
            FG N P  P GGFKF 
Sbjct  514  FG-NNPAAPVGGFKFA  528



>ref|XP_010094009.1| Importin subunit alpha-1 [Morus notabilis]
 gb|EXB55043.1| Importin subunit alpha-1 [Morus notabilis]
Length=530

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 169/204 (83%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL  NHKKSIKKEACWTISNITAGN+ QIQAVIEANII PLV LLQNAEFDIKKEAA
Sbjct  331  LLNLLNTNHKKSIKKEACWTISNITAGNKDQIQAVIEANIIGPLVNLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHEQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE++    GD    
Sbjct  451  NTGGVNQYAQLIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDDTMPPGDA---  507

Query  319  NQQQAFSFGENQ-PNVPPGGFKFG  251
              Q  F+FG +Q P+VP GGF F 
Sbjct  508  -SQSGFNFGGDQVPSVPSGGFNFS  530



>ref|XP_003521670.1| PREDICTED: importin subunit alpha-1-like [Glycine max]
Length=532

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 169/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  +LT N+KKSIKKEACWTISNITAGN+ QIQ VIEA+II PLV+LLQNAEFDIKKEAA
Sbjct  333  LLNILTNNYKKSIKKEACWTISNITAGNKKQIQDVIEASIIAPLVHLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCI+PLCDLL+CPDPRI+TVCLEGLENILKVGEA+K   
Sbjct  393  WAISNATSGGSHEQIKFLVSQGCIRPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNVS  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              DG+NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  453  NTDGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWMEEDDETMPPGDA---  509

Query  319  NQQQAFSFGENQ-PNVPPGGFKF  254
              Q  F+FG  Q P VP GGF F
Sbjct  510  -SQSGFNFGGTQPPAVPSGGFDF  531



>ref|XP_002318966.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
 gb|EEE94889.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
Length=529

 Score =   302 bits (774),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 165/203 (81%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL  N+KKSIKKEACWTISNITAGN+ QIQAVIEANII PLV LLQNAEFDIKKEAA
Sbjct  331  LLNLLANNYKKSIKKEACWTISNITAGNKEQIQAVIEANIIGPLVNLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK   
Sbjct  391  WAISNATSGGAHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNVS  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD    
Sbjct  451  ETGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDETMPPGDA---  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG   P VP GGF F 
Sbjct  508  -SQSGFQFGGEAPAVPSGGFNFS  529



>gb|KHN03948.1| Importin subunit alpha [Glycine soja]
Length=532

 Score =   302 bits (774),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 169/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  +LT N+KKSIKKEACWTISNITAGN+ QIQ VIEA+II PLV+LLQNAEFDIKKEAA
Sbjct  333  LLNILTNNYKKSIKKEACWTISNITAGNKKQIQDVIEASIIAPLVHLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCI+PLCDLL+CPDPRI+TVCLEGLENILKVGEA+K   
Sbjct  393  WAISNATSGGSHEQIKFLVSQGCIRPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNVS  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              DG+NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  453  NTDGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWMEEDDETMPPGDA---  509

Query  319  NQQQAFSFGENQ-PNVPPGGFKF  254
              Q  F+FG  Q P VP GGF F
Sbjct  510  -SQSGFNFGGTQPPAVPSGGFDF  531



>ref|XP_009781700.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Nicotiana 
sylvestris]
Length=453

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 167/202 (83%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL  NHKKSIKKEACWTISNITAGNR QIQ+VIEA II PLV LLQNAEFDIKKEAA
Sbjct  255  LLNLLNGNHKKSIKKEACWTISNITAGNREQIQSVIEAGIIGPLVNLLQNAEFDIKKEAA  314

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  315  WAISNATSGGSHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  374

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  375  RTADVNLYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILETYWLEEDDETMPPGDA---  431

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              QQ F FG+ + +VP GGF F
Sbjct  432  -PQQGFQFGDGEVSVPSGGFSF  452



>gb|KHN12909.1| Importin subunit alpha-1 [Glycine soja]
Length=526

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 168/203 (83%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAV+EA +I PLV LLQNAEFDIKKEAA
Sbjct  328  LLSLLTHNHKKSIKKEACWTISNITAGNRDQIQAVVEAGLIAPLVNLLQNAEFDIKKEAA  387

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  388  WAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKSMG  447

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +NLYAQ+IDE EG +K+E+LQ+HDN+EIYEKAVKILE +W E+++E    GD    
Sbjct  448  NSGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEDDDETLPTGD----  503

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG N   VP GGF F 
Sbjct  504  GAQPGFNFGNNDVPVPSGGFNFS  526



>ref|XP_003533220.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine 
max]
 ref|XP_006586905.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine 
max]
 ref|XP_006586906.1| PREDICTED: importin subunit alpha-1-like isoform X3 [Glycine 
max]
Length=531

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 168/203 (83%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAV+EA +I PLV LLQNAEFDIKKEAA
Sbjct  333  LLSLLTHNHKKSIKKEACWTISNITAGNRDQIQAVVEAGLIAPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  393  WAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKSMG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +NLYAQ+IDE EG +K+E+LQ+HDN+EIYEKAVKILE +W E+++E    GD    
Sbjct  453  NSGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEDDDETLPTGD----  508

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG N   VP GGF F 
Sbjct  509  GAQPGFNFGNNDVPVPSGGFNFS  531



>ref|XP_006380207.1| hypothetical protein POPTR_0008s22930g [Populus trichocarpa]
 gb|ERP58004.1| hypothetical protein POPTR_0008s22930g [Populus trichocarpa]
Length=529

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 168/202 (83%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV LLQNAEFDIKKEAA
Sbjct  332  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIGPLVNLLQNAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WA+SNATSGG+HEQI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  392  WAVSNATSGGTHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +N YAQ+ID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EE++E    GD    
Sbjct  452  NSGDVNFYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEDDEALPSGD----  507

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              QQ F FGEN   VP GGF F
Sbjct  508  GAQQGFHFGENNVQVPSGGFNF  529



>ref|XP_002882488.1| AT-IMP [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58747.1| AT-IMP [Arabidopsis lyrata subsp. lyrata]
Length=532

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 169/203 (83%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAGN+ QIQ V+EAN+I PLV LLQNAEFDIKKEAA
Sbjct  331  LANLLTQNYKKSIKKEACWTISNITAGNKDQIQTVVEANLIAPLVSLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LV QGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N YAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+++      VDG
Sbjct  451  NTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDDETQQPPGVDG  510

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            + Q  F FG NQ  VP GGF F 
Sbjct  511  S-QAGFQFGGNQAPVPSGGFNFS  532



>ref|XP_008810191.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
 ref|XP_008810193.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
 ref|XP_008810194.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
Length=531

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 166/204 (81%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI A II PLV+LLQ AEFDIKKEAA
Sbjct  332  LLSLLTHNHKKSIKKEACWTISNITAGNKDQIQAVIAAGIIGPLVHLLQTAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  392  WAISNATSGGTHDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ+IDE EG +K+E+LQ+HDN EIYEKAVKILE +W EEE++    GD    
Sbjct  452  ATAGVNLYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDDAMPTGDAA--  509

Query  319  NQQQAFSFGEN-QPNVPPGGFKFG  251
              Q  F FG N Q  VP GGF F 
Sbjct  510  --QSGFQFGNNEQVQVPSGGFNFS  531



>ref|XP_008797160.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
Length=531

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 167/204 (82%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI A II PLV+LLQ AEFDIKKEAA
Sbjct  332  LLSLLTHNHKKSIKKEACWTISNITAGNKDQIQAVIAAGIIGPLVHLLQTAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  392  WAISNATSGGTHDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ+IDE EG +K+E+LQ+HDN EIYEKAVKILE +W EEE++    GD    
Sbjct  452  TTGGVNLYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDDAMPTGDAA--  509

Query  319  NQQQAFSFGEN-QPNVPPGGFKFG  251
              Q  F+FG N Q  VP GGF F 
Sbjct  510  --QTGFNFGNNEQVQVPSGGFNFS  531



>ref|XP_007031099.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
 ref|XP_007031100.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
 gb|EOY11601.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
 gb|EOY11602.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
Length=529

 Score =   302 bits (773),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N KKSIKKEACWTISNITAGN+ QIQAVIEANII PLV+LLQNAEFDIKKEAA
Sbjct  331  LLNLLTNNFKKSIKKEACWTISNITAGNKEQIQAVIEANIIAPLVHLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  391  WAISNATSGGTHDQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKVGEADKNQG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVK+LE +W EEE+E    GD    
Sbjct  451  NTGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKVLETYWLEEEDETMPPGDA---  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG  + +VP GGF F 
Sbjct  508  -SQTGFQFGPGEVHVPSGGFNFS  529



>ref|XP_007144986.1| hypothetical protein PHAVU_007G199900g [Phaseolus vulgaris]
 gb|ESW16980.1| hypothetical protein PHAVU_007G199900g [Phaseolus vulgaris]
Length=532

 Score =   302 bits (773),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 168/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQ+VIEAN+I PLV LLQNAEFDIKKEAA
Sbjct  333  LLNLLTNNYKKSIKKEACWTISNITAGNKQQIQSVIEANLITPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  393  WAISNATSGGSHEQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKSIG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  453  NTGDVNLYAQIIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEDDETMPPGDA---  509

Query  319  NQQQAFSFGENQ-PNVPPGGFKF  254
              Q  F+FG N  P VP GGF F
Sbjct  510  -SQSGFNFGNNDAPAVPSGGFNF  531



>ref|XP_011013186.1| PREDICTED: importin subunit alpha-1-like [Populus euphratica]
Length=529

 Score =   302 bits (773),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 168/202 (83%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV LLQNAEFDIKKEAA
Sbjct  332  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIGPLVNLLQNAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WA+SNATSGG+HEQI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  392  WAVSNATSGGTHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +N YAQ+ID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EE++E    GD    
Sbjct  452  NSGDVNFYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEDDEALPSGD----  507

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              QQ F FGEN   VP GGF F
Sbjct  508  GAQQGFHFGENNVQVPSGGFNF  529



>gb|ABM05487.1| Impa1 [Nicotiana benthamiana]
Length=532

 Score =   301 bits (772),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 171/203 (84%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAG+R QIQAVIEA II PLV+LLQNAEF+IKKEAA
Sbjct  333  LLNLLTQNYKKSIKKEACWTISNITAGSRNQIQAVIEAGIIAPLVHLLQNAEFEIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILK+GEADK+ G
Sbjct  393  WAISNATSGGNHDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKIGEADKDLG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              +G+N+YAQLIDE EG +K+E+LQ+HDN EIYEKAVKILE +W EE++EQ    D    
Sbjct  453  NTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEDDEQLPSADA---  509

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
             Q   F+FG  +  +P GGF F 
Sbjct  510  -QHSGFNFGGGELPLPSGGFNFS  531



>ref|XP_006297392.1| hypothetical protein CARUB_v10013416mg [Capsella rubella]
 ref|XP_006297393.1| hypothetical protein CARUB_v10013416mg [Capsella rubella]
 gb|EOA30290.1| hypothetical protein CARUB_v10013416mg [Capsella rubella]
 gb|EOA30291.1| hypothetical protein CARUB_v10013416mg [Capsella rubella]
Length=536

 Score =   302 bits (773),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 168/203 (83%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAGN+ QIQ V++AN+I PLV LLQNAEFDIKKEAA
Sbjct  335  LANLLTQNYKKSIKKEACWTISNITAGNKDQIQTVVDANLIAPLVSLLQNAEFDIKKEAA  394

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LV QGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEA+K  G
Sbjct  395  WAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKNLG  454

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N YAQLID+ EG +K+E+LQ+HDNHEIYEKAVKILE +W EE +E+      VD 
Sbjct  455  NTGDMNYYAQLIDDAEGLEKIENLQSHDNHEIYEKAVKILEAYWLEEGDEETQQAPGVDS  514

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            + Q  F FG NQ +VP GGF F 
Sbjct  515  S-QAGFQFGGNQASVPSGGFNFS  536



>ref|XP_010914512.1| PREDICTED: importin subunit alpha-1b-like [Elaeis guineensis]
Length=531

 Score =   301 bits (771),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 166/204 (81%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI A II PLV+LLQ AEFDIKKEAA
Sbjct  332  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIAAGIIGPLVHLLQTAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  392  WAISNATSGGTHDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ+IDE EG +K+E+LQ+HDN EIYEKAVKILE +W EEE++    GD    
Sbjct  452  TTGGVNLYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDDAMPAGDAA--  509

Query  319  NQQQAFSFGEN-QPNVPPGGFKFG  251
              Q  F FG N Q  VP GGF F 
Sbjct  510  --QTGFHFGNNEQLQVPSGGFNFS  531



>gb|KHN14650.1| Importin subunit alpha-1 [Glycine soja]
Length=533

 Score =   301 bits (772),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVIEA +I PLV LLQNAEFDIKKEAA
Sbjct  335  LLSLLTHNHKKSIKKEACWTISNITAGNRDQIQAVIEAGLIAPLVNLLQNAEFDIKKEAA  394

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  395  WAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKSLG  454

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+IDE EG +K+E+LQ+HDN+EIYEKAVKILE +W E+++E    GD    
Sbjct  455  NTGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEDDDETLPAGD----  510

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG N   VP GGF F 
Sbjct  511  GAQPGFNFGNNDLPVPSGGFNFS  533



>gb|EPS72677.1| impa2, partial [Genlisea aurea]
Length=211

 Score =   290 bits (743),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 170/203 (84%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL+QN+KKSIKKEACWTISNITAGN+ QIQAVI++ II PLV LLQ AEF+IKKEAA
Sbjct  10   LLNLLSQNYKKSIKKEACWTISNITAGNKDQIQAVIDSGIISPLVSLLQTAEFEIKKEAA  69

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS EQI+FLV QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGE++K  G
Sbjct  70   WAISNATSGGSQEQIKFLVEQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGESEKNQG  129

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +N++AQL+DE EG DK+E LQ+HDN+EIYEKAVKILE +W E+++EQ   GD+ + 
Sbjct  130  NSGNVNVFAQLVDEAEGLDKIETLQSHDNNEIYEKAVKILEAYWLEDDDEQLAAGDD-NV  188

Query  319  NQQQAFSFGENQPN-VPPGGFKF  254
             QQ  F+FG    N VP GGFKF
Sbjct  189  QQQSGFNFGGGDDNGVPSGGFKF  211



>ref|XP_008781168.1| PREDICTED: importin subunit alpha-like isoform X2 [Phoenix dactylifera]
Length=536

 Score =   301 bits (772),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 172/203 (85%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L QLLTQ ++KSIKKEACWTISNITAGNRAQIQAVI+ANII PLV LLQ+AEFDIKKEAA
Sbjct  335  LLQLLTQQYRKSIKKEACWTISNITAGNRAQIQAVIDANIIGPLVQLLQHAEFDIKKEAA  394

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS EQI +LV+QGCIKPLCDLLV PDPRI+ VCLEGLENILKVGE +KE G
Sbjct  395  WAISNATSGGSDEQIHYLVSQGCIKPLCDLLVSPDPRIVIVCLEGLENILKVGETEKELG  454

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              DGINLYAQLI +CEG DK+E+LQ H N+EIYEK +K+LE++W EEE+E Q+    ++G
Sbjct  455  KTDGINLYAQLIYDCEGLDKIENLQGHGNNEIYEKTIKMLERYWLEEEDEAQSARGSLEG  514

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              + AF FG ++ ++PP  FKFG
Sbjct  515  T-EHAFEFGVSKSSLPPAVFKFG  536



>ref|XP_002512485.1| importin alpha, putative [Ricinus communis]
 gb|EEF49937.1| importin alpha, putative [Ricinus communis]
Length=531

 Score =   301 bits (771),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 171/205 (83%), Gaps = 6/205 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQAVIEANII PLV+LL+NAEFDIKKEAA
Sbjct  331  LLNLLTNNYKKSIKKEACWTISNITAGNKEQIQAVIEANIIGPLVHLLENAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  391  WAISNATSGGTHDQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNLG  450

Query  499  LND-GINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVD  323
             ND G+NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD   
Sbjct  451  NNDGGVNLYAQMIDDAEGLEKIENLQSHDNIEIYEKAVKILETYWLEEEDETMPPGDA--  508

Query  322  GNQQQAFSF-GENQPNVPPGGFKFG  251
               Q  F F G + P +P GGF F 
Sbjct  509  --SQSGFQFGGSDMPTIPSGGFNFS  531



>ref|XP_009414157.1| PREDICTED: importin subunit alpha-1a-like [Musa acuminata subsp. 
malaccensis]
Length=536

 Score =   301 bits (771),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+QLLTQ+HKKSIKKEACWTISNITAGNRAQIQAVI+ANII PLV+LLQ+AEFDIKKEAA
Sbjct  336  LFQLLTQSHKKSIKKEACWTISNITAGNRAQIQAVIDANIISPLVHLLQHAEFDIKKEAA  395

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSG S+EQI +L +QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGE +K+ G
Sbjct  396  WAISNATSGSSNEQIHYLASQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEIEKDLG  455

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+N YAQLIDECEG DK+E+LQ HDN+EIYEK +K+LE++W EEE+E Q+     +G
Sbjct  456  -KCGVNPYAQLIDECEGLDKIENLQGHDNNEIYEKTIKLLERYWVEEEDEAQDALGSTEG  514

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
             +  +     +QP+VP GGFKF
Sbjct  515  AEHSS-EVAISQPSVPSGGFKF  535



>ref|XP_003546338.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine 
max]
 ref|XP_006597715.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine 
max]
Length=531

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVIEA +I PLV LLQNAEFDIKKEAA
Sbjct  333  LLSLLTHNHKKSIKKEACWTISNITAGNRDQIQAVIEAGLIAPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  393  WAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKSLG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+IDE EG +K+E+LQ+HDN+EIYEKAVKILE +W E+++E    GD    
Sbjct  453  NTGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEDDDETLPAGD----  508

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG N   VP GGF F 
Sbjct  509  GAQPGFNFGNNDLPVPSGGFNFS  531



>ref|XP_009789105.1| PREDICTED: importin subunit alpha [Nicotiana sylvestris]
Length=532

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 170/203 (84%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAG+R QIQAVIEA II PLV+LLQNAEF+IKKEAA
Sbjct  333  LLNLLTQNYKKSIKKEACWTISNITAGSRNQIQAVIEAGIIAPLVHLLQNAEFEIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILK+GEADK+ G
Sbjct  393  WAISNATSGGNHDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKIGEADKDLG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              +G+N+YAQLIDE EG +K+E+LQ+HDN EIYEKAVKILE +W EE++EQ    D    
Sbjct  453  NTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEDDEQLPSADA---  509

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
             Q   F+FG     +P GGF F 
Sbjct  510  -QHSGFNFGGGDLPLPSGGFNFS  531



>ref|XP_010931697.1| PREDICTED: importin subunit alpha-1b [Elaeis guineensis]
Length=531

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 166/204 (81%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI A II PLV+LLQ AEFDIKKEAA
Sbjct  332  LLSLLTHNHKKSIKKEACWTISNITAGNKDQIQAVIAAGIIGPLVHLLQTAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI+FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  392  WAISNATSGGTHDQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ+IDE EG +K+E+LQ+HDN EIYEKAVKILE +W EEE++    GD    
Sbjct  452  ATGGVNLYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDDAMPTGDAA--  509

Query  319  NQQQAFSFGEN-QPNVPPGGFKFG  251
              Q  F FG N Q  VP GGF F 
Sbjct  510  --QSGFHFGNNEQVQVPSGGFNFS  531



>ref|XP_010486198.1| PREDICTED: importin subunit alpha-1 isoform X1 [Camelina sativa]
 ref|XP_010486199.1| PREDICTED: importin subunit alpha-1 isoform X2 [Camelina sativa]
 ref|XP_010486200.1| PREDICTED: importin subunit alpha-1 isoform X2 [Camelina sativa]
 ref|XP_010486201.1| PREDICTED: importin subunit alpha-1 isoform X2 [Camelina sativa]
Length=534

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 168/203 (83%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAGN+ QIQ V+EAN+I PLV LLQNAEFDIKKEAA
Sbjct  333  LANLLTQNYKKSIKKEACWTISNITAGNKDQIQTVVEANLITPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LV QGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEA+K  G
Sbjct  393  WAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKNLG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W E+E+E+      VDG
Sbjct  453  NTGDMNYYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILEAYWLEDEDEETPQPPGVDG  512

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            + Q  F FG NQ  VP GGF F 
Sbjct  513  S-QAGFQFGGNQAPVPSGGFNFS  534



>gb|KJB82641.1| hypothetical protein B456_013G206500 [Gossypium raimondii]
 gb|KJB82642.1| hypothetical protein B456_013G206500 [Gossypium raimondii]
Length=529

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 166/203 (82%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N KKSIKKEACWTISNITAGN+ QIQAVIEANII PLV+LLQNAEFDIKKEAA
Sbjct  331  LLNLLTNNFKKSIKKEACWTISNITAGNKEQIQAVIEANIISPLVHLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  391  WAISNATSGGTHDQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKVGEADKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVK+LE +W EEE+E    GD    
Sbjct  451  TTGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKVLETYWLEEEDETMPPGDA---  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG  +  VP GGF F 
Sbjct  508  -SQTGFHFGGGELPVPSGGFNFS  529



>ref|XP_010259399.1| PREDICTED: importin subunit alpha-1 [Nelumbo nucifera]
Length=529

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 166/202 (82%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEANII PLV LLQ AEFDIKKEAA
Sbjct  331  LLSLLTHNHKKSIKKEACWTISNITAGNKDQIQAVIEANIIGPLVQLLQTAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGNHDQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQLID+ EG +K+E+LQ HDN EIYEKAVKILE +W EEE+E    GD    
Sbjct  451  NTGGVNLYAQLIDDAEGLEKIENLQNHDNTEIYEKAVKILETYWMEEEDETLPPGDA---  507

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q  F FG N+  VP GGF F
Sbjct  508  -SQPGFRFGGNELPVPSGGFNF  528



>ref|XP_012088940.1| PREDICTED: importin subunit alpha-2 [Jatropha curcas]
 gb|KDP23418.1| hypothetical protein JCGZ_23251 [Jatropha curcas]
Length=528

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 170/203 (84%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQAVIEA II PLV+LLQNAEFDIKKEAA
Sbjct  329  LLNLLTNNYKKSIKKEACWTISNITAGNKEQIQAVIEAGIIGPLVHLLQNAEFDIKKEAA  388

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  389  WAISNATSGGTHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNLG  448

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             + G+NLYAQ+ID+ +G +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD    
Sbjct  449  NSGGVNLYAQMIDDSDGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDETMPPGDA---  505

Query  319  NQQQAFSFGENQ-PNVPPGGFKF  254
              Q  F FG ++ P VP GGF F
Sbjct  506  -SQSGFQFGGSEMPAVPSGGFNF  527



>ref|XP_009781699.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Nicotiana 
sylvestris]
Length=529

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 167/202 (83%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL  NHKKSIKKEACWTISNITAGNR QIQ+VIEA II PLV LLQNAEFDIKKEAA
Sbjct  331  LLNLLNGNHKKSIKKEACWTISNITAGNREQIQSVIEAGIIGPLVNLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  451  RTADVNLYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILETYWLEEDDETMPPGDA---  507

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              QQ F FG+ + +VP GGF F
Sbjct  508  -PQQGFQFGDGEVSVPSGGFSF  528



>ref|XP_004495675.1| PREDICTED: importin subunit alpha-1b-like isoform X2 [Cicer arietinum]
Length=455

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 169/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+ LLT N+KKSIKKEACWTISNITAGN+ QIQAVIEANI  PLV LLQNAEFDIKKEAA
Sbjct  255  LFNLLTNNYKKSIKKEACWTISNITAGNKQQIQAVIEANIFGPLVNLLQNAEFDIKKEAA  314

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  315  WAISNATSGGSHDQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNIG  374

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  375  NTGDVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEDDETMPPGDAA--  432

Query  319  NQQQAFSFGENQ-PNVPPGGFKF  254
              Q  F+FG  + P+VP GGF F
Sbjct  433  --QSGFNFGSAEVPSVPSGGFNF  453



>emb|CDO98799.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV LLQ AEFDIKKEAA
Sbjct  330  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAQLIGPLVNLLQTAEFDIKKEAA  389

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLLVCPDPRII VCLEGLENILKVGE +K  G
Sbjct  390  WAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIIAVCLEGLENILKVGEVEKSLG  449

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +N YAQL+DE EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    GD    
Sbjct  450  NSGDVNFYAQLVDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDETLPAGD----  505

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG N   +PPGGFKFG
Sbjct  506  GGQPGFNFGGNDMQLPPGGFKFG  528



>ref|XP_002275593.1| PREDICTED: importin subunit alpha-1 isoform X1 [Vitis vinifera]
 ref|XP_010649542.1| PREDICTED: importin subunit alpha-1 isoform X1 [Vitis vinifera]
 emb|CBI22923.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 167/202 (83%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV+LLQ AEFDIKKEAA
Sbjct  331  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGVIAPLVHLLQTAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKTLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +N YAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    GD    
Sbjct  451  NSGDVNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDETLPSGD----  506

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q  F FG N  +VP GGF F
Sbjct  507  GSQPGFQFGGNDVSVPSGGFNF  528



>gb|AII99829.1| importin alpha [Nicotiana tabacum]
Length=528

 Score =   300 bits (768),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 167/203 (82%), Gaps = 6/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV LLQ AEFDIKKEAA
Sbjct  332  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQTAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K   
Sbjct  392  WAISNATSGGTHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKAN-  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               GIN YAQL D+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    GDE   
Sbjct  451  -TGGINFYAQLTDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDETLPAGDET--  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG N   +P GGFKFG
Sbjct  508  --QAGFNFGGNDIQLPSGGFKFG  528



>gb|KHG29743.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
Length=556

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 166/202 (82%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N KKSIKKEACWTISNITAGN+ QIQAVIEANII PLV+LLQNAEFDIKKEAA
Sbjct  331  LLNLLTNNFKKSIKKEACWTISNITAGNKEQIQAVIEANIISPLVHLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+Q++FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  391  WAISNATSGGTHDQMKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKVGEADKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVK+LE +W EEE+E    GD    
Sbjct  451  TTGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKVLETYWLEEEDETMPPGDA---  507

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q  F FG  +  VP GGF F
Sbjct  508  -SQTGFHFGGGELPVPSGGFSF  528



>gb|ABM05488.1| Impa2 [Nicotiana benthamiana]
Length=529

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 167/203 (82%), Gaps = 6/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV LLQ AEFDIKKEAA
Sbjct  333  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQTAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K   
Sbjct  393  WAISNATSGGTHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKAN-  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               GIN YAQL D+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    GDE   
Sbjct  452  -TGGINYYAQLTDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDETLPAGDEA--  508

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG N   +P GGFKFG
Sbjct  509  --QAGFNFGGNDIQLPSGGFKFG  529



>ref|XP_009631847.1| PREDICTED: importin subunit alpha-1a-like [Nicotiana tomentosiformis]
Length=529

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 167/203 (82%), Gaps = 6/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV LLQ AEFDIKKEAA
Sbjct  333  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQTAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K   
Sbjct  393  WAISNATSGGTHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKAN-  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               GIN YAQL D+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    GDE   
Sbjct  452  -TGGINYYAQLTDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDETLPAGDET--  508

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG N   +P GGFKFG
Sbjct  509  --QAGFNFGGNDIQLPSGGFKFG  529



>ref|XP_010649543.1| PREDICTED: importin subunit alpha-1 isoform X2 [Vitis vinifera]
Length=509

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 167/202 (83%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV+LLQ AEFDIKKEAA
Sbjct  311  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGVIAPLVHLLQTAEFDIKKEAA  370

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  371  WAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKTLG  430

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +N YAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    GD    
Sbjct  431  NSGDVNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDETLPSGD----  486

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q  F FG N  +VP GGF F
Sbjct  487  GSQPGFQFGGNDVSVPSGGFNF  508



>ref|XP_010444089.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
Length=534

 Score =   300 bits (767),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 168/203 (83%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAGN+ QIQ V++AN+I PLV LLQNAEFDIKKEAA
Sbjct  333  LANLLTQNYKKSIKKEACWTISNITAGNKDQIQTVVDANLITPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LV QGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEA+K  G
Sbjct  393  WAISNATSGGSHDQIKYLVQQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKNLG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W E+E+E+      VDG
Sbjct  453  NTGDMNYYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILEAYWLEDEDEETPQPPGVDG  512

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            + Q  F FG NQ  VP GGF F 
Sbjct  513  S-QAGFQFGGNQAPVPSGGFNFS  534



>ref|XP_009796163.1| PREDICTED: importin subunit alpha-1a-like [Nicotiana sylvestris]
Length=528

 Score =   300 bits (767),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 167/203 (82%), Gaps = 6/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV LLQ AEFDIKKEAA
Sbjct  332  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQTAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K   
Sbjct  392  WAISNATSGGTHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKAN-  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               GIN YAQL D+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    GDE   
Sbjct  451  -TGGINYYAQLTDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDETLPAGDET--  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG N   +P GGFKFG
Sbjct  508  --QAGFNFGGNDIQLPSGGFKFG  528



>gb|AES65063.2| importin subunit alpha-1b [Medicago truncatula]
Length=530

 Score =   300 bits (767),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 168/203 (83%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV LLQNAEFDIKKEAA
Sbjct  332  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQNAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WA+SNATSGG+HEQI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILK+GEA+K  G
Sbjct  392  WALSNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKIGEAEKSFG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+IDE EG +K+E+LQ+HDN+EIYEKAVKILE +W E+E+E    GD    
Sbjct  452  NAGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEDEDETLPPGD----  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG N   VP GGF FG
Sbjct  508  GSQPGFNFGGNDLPVPSGGFNFG  530



>ref|XP_004495674.1| PREDICTED: importin subunit alpha-1b-like isoform X1 [Cicer arietinum]
Length=533

 Score =   300 bits (767),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 169/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+ LLT N+KKSIKKEACWTISNITAGN+ QIQAVIEANI  PLV LLQNAEFDIKKEAA
Sbjct  333  LFNLLTNNYKKSIKKEACWTISNITAGNKQQIQAVIEANIFGPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  393  WAISNATSGGSHDQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNIG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  453  NTGDVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEDDETMPPGDAA--  510

Query  319  NQQQAFSFGENQ-PNVPPGGFKF  254
              Q  F+FG  + P+VP GGF F
Sbjct  511  --QSGFNFGSAEVPSVPSGGFNF  531



>ref|XP_008781167.1| PREDICTED: importin subunit alpha-like isoform X1 [Phoenix dactylifera]
Length=567

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 172/203 (85%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L QLLTQ ++KSIKKEACWTISNITAGNRAQIQAVI+ANII PLV LLQ+AEFDIKKEAA
Sbjct  366  LLQLLTQQYRKSIKKEACWTISNITAGNRAQIQAVIDANIIGPLVQLLQHAEFDIKKEAA  425

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS EQI +LV+QGCIKPLCDLLV PDPRI+ VCLEGLENILKVGE +KE G
Sbjct  426  WAISNATSGGSDEQIHYLVSQGCIKPLCDLLVSPDPRIVIVCLEGLENILKVGETEKELG  485

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              DGINLYAQLI +CEG DK+E+LQ H N+EIYEK +K+LE++W EEE+E Q+    ++G
Sbjct  486  KTDGINLYAQLIYDCEGLDKIENLQGHGNNEIYEKTIKMLERYWLEEEDEAQSARGSLEG  545

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              + AF FG ++ ++PP  FKFG
Sbjct  546  T-EHAFEFGVSKSSLPPAVFKFG  567



>ref|XP_008345591.1| PREDICTED: LOW QUALITY PROTEIN: importin subunit alpha-1-like 
[Malus domestica]
Length=524

 Score =   299 bits (766),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 168/204 (82%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QI+AV+EANII PLV LLQNAEFDIKKEAA
Sbjct  325  LLNLLTNNYKKSIKKEACWTISNITAGNKDQIRAVVEANIISPLVNLLQNAEFDIKKEAA  384

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  385  WAISNATSGGSHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  444

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ I++ +G +K+E LQ+HDN EIYEKAVK+LE +W E+++E    GD    
Sbjct  445  TTGGVNLYAQAIEDADGLEKIESLQSHDNTEIYEKAVKMLETYWLEDDDETMPPGDAAPA  504

Query  319  NQQQAFSFGENQ-PNVPPGGFKFG  251
                AF+FG N  P VP GGF FG
Sbjct  505  ----AFNFGGNDVPTVPSGGFNFG  524



>ref|XP_012084020.1| PREDICTED: importin subunit alpha-2 isoform X2 [Jatropha curcas]
 gb|KDP27876.1| hypothetical protein JCGZ_18956 [Jatropha curcas]
Length=529

 Score =   299 bits (766),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 168/203 (83%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV LLQNAEFDIKKEAA
Sbjct  331  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG++EQI++LV+QGC+KPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGTNEQIKYLVSQGCVKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +N+YAQLID+ EG +K+E+LQ+HDN EIYEKAVK+LE +W EE++E    GD    
Sbjct  451  NSGDVNMYAQLIDDAEGLEKIENLQSHDNTEIYEKAVKVLETYWLEEDDETLPTGDGF--  508

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              QQ F FG   P+VP GGF F 
Sbjct  509  --QQGFHFGGKDPSVPSGGFNFS  529



>ref|XP_012084019.1| PREDICTED: importin subunit alpha-2 isoform X1 [Jatropha curcas]
Length=531

 Score =   299 bits (766),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 168/203 (83%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV LLQNAEFDIKKEAA
Sbjct  333  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG++EQI++LV+QGC+KPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  393  WAISNATSGGTNEQIKYLVSQGCVKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +N+YAQLID+ EG +K+E+LQ+HDN EIYEKAVK+LE +W EE++E    GD    
Sbjct  453  NSGDVNMYAQLIDDAEGLEKIENLQSHDNTEIYEKAVKVLETYWLEEDDETLPTGDGF--  510

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              QQ F FG   P+VP GGF F 
Sbjct  511  --QQGFHFGGKDPSVPSGGFNFS  531



>ref|XP_009373267.1| PREDICTED: importin subunit alpha-1b [Pyrus x bretschneideri]
Length=530

 Score =   299 bits (765),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 169/204 (83%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QI+AV+EANII PLV LLQNAEFDIKKEAA
Sbjct  331  LLNLLTNNYKKSIKKEACWTISNITAGNKEQIRAVVEANIIGPLVNLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ I++ +G +K+E LQ+HDN EIYEKAVK+LE +W E+++E    GD    
Sbjct  451  TTGGVNLYAQAIEDADGLEKIESLQSHDNTEIYEKAVKMLETYWLEDDDETMPPGDAA--  508

Query  319  NQQQAFSFGENQ-PNVPPGGFKFG  251
                AF+FG N  P+VP GGF FG
Sbjct  509  --STAFNFGGNDVPSVPSGGFNFG  530



>ref|XP_009621534.1| PREDICTED: importin subunit alpha-1-like [Nicotiana tomentosiformis]
 ref|XP_009621540.1| PREDICTED: importin subunit alpha-1-like [Nicotiana tomentosiformis]
Length=529

 Score =   299 bits (765),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 166/202 (82%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL  NHKKSIKKEACWTISNITAGNR QIQ+VIE  II PLV LLQNAEFDIKKEAA
Sbjct  331  LLNLLNGNHKKSIKKEACWTISNITAGNREQIQSVIETGIIGPLVNLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  451  RTADVNLYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILETYWLEEDDETMPPGDA---  507

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              QQ F FG+ + +VP GGF F
Sbjct  508  -PQQGFQFGDGEVSVPSGGFSF  528



>ref|XP_010548966.1| PREDICTED: importin subunit alpha-1-like [Tarenaya hassleriana]
Length=524

 Score =   298 bits (764),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL+ NHKKSIKKEACWTISNITAGNR QIQAVIEA +I PLV LLQN+EFDIKKEAA
Sbjct  326  LLSLLSHNHKKSIKKEACWTISNITAGNRNQIQAVIEAGLIGPLVNLLQNSEFDIKKEAA  385

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV QGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEA+K  G
Sbjct  386  WAISNATSGGSHEQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKTMG  445

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N YAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    GD    
Sbjct  446  NTGDVNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDEASPPGD----  501

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
               Q F FG N+  +P GGF F
Sbjct  502  GSAQGFQFGGNEAPLPSGGFNF  523



>ref|XP_010464259.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
Length=534

 Score =   299 bits (765),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAGN+ QIQ V+ AN+I PLV LLQNAEFDIKKEAA
Sbjct  333  LANLLTQNYKKSIKKEACWTISNITAGNKDQIQTVVAANLITPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LV QGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEA+K  G
Sbjct  393  WAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKNLG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W E+E+E+      VDG
Sbjct  453  NTGDMNYYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILEAYWLEDEDEETPQPPGVDG  512

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            + Q  F FG NQ  VP GGF F 
Sbjct  513  S-QAGFQFGGNQAPVPSGGFNFS  534



>ref|XP_009606138.1| PREDICTED: importin subunit alpha [Nicotiana tomentosiformis]
Length=530

 Score =   298 bits (764),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 170/203 (84%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAG+R QIQAVIEA II PLV+LLQNAEF+IKKEAA
Sbjct  332  LLNLLTQNYKKSIKKEACWTISNITAGSRNQIQAVIEAGIIAPLVHLLQNAEFEIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+ +QI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILK+GEADK+ G
Sbjct  392  WAISNATSGGNQDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKIGEADKDLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              +G+N+YAQLIDE EG +K+E+LQ+HDN EIYEKAVKILE +W EE++EQ    D    
Sbjct  452  NTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEDDEQLPSADA---  508

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
             Q   F+FG  +  +P GGF F 
Sbjct  509  -QHSGFNFGGGELPLPSGGFNFS  530



>ref|XP_004487798.1| PREDICTED: importin subunit alpha-1-like [Cicer arietinum]
Length=531

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 167/203 (82%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEA +I PLV LLQNAEFDIKKEAA
Sbjct  333  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  393  WAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKSFG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+ID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W E+E+E    GD    
Sbjct  453  NTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEDEDETLPAGD----  508

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG +   VP GGF F 
Sbjct  509  GSQPGFNFGSSDLPVPSGGFNFS  531



>ref|XP_010231685.1| PREDICTED: importin subunit alpha-1b [Brachypodium distachyon]
Length=532

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 168/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVI ANII PLV+LLQ AEFDIKKEAA
Sbjct  335  LLNLLTTNHKKSIKKEACWTISNITAGNRDQIQAVINANIIGPLVHLLQGAEFDIKKEAA  394

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  395  WAISNATSGGTHDQIKYLVAQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  454

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              D +N YAQ+ID+ EG +K+E+LQ+HDN EIYEKAVK+LE +W EE++E    G+    
Sbjct  455  AGD-VNTYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKMLESYWLEEDDEAMPTGE----  509

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N Q  F+FG  Q +VP GGF FG
Sbjct  510  NPQNGFNFGNQQNSVPSGGFNFG  532



>gb|AES82394.2| importin subunit alpha-1b [Medicago truncatula]
Length=532

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 169/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL  ++KKSIKKEACWTISNITAGN+ QIQ VI+ANII PLV LLQNAEFDIKKEAA
Sbjct  333  LTNLLINSYKKSIKKEACWTISNITAGNKQQIQDVIDANIIAPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQ+++LV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  393  WAISNATSGGSHEQLKYLVSQGCIKPLCDLLTCPDPRIVTVCLEGLENILKVGEADKNAG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            + DG+N YA+LIDE EG +K+E+LQ+HDN+EIYEKAVKILE +W EE++E    GD    
Sbjct  453  ITDGVNRYAELIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEDDEAMPPGDA---  509

Query  319  NQQQAFSFGENQ-PNVPPGGFKF  254
              Q  F+FG ++ P VP GGF F
Sbjct  510  -SQSGFNFGGSEVPAVPSGGFNF  531



>dbj|BAE71209.1| putative importin alpha [Trifolium pratense]
Length=533

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 168/203 (83%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+ LLT N+KKSIKKEACWTISNITAGN+ QIQAVIE NI  PLV LLQNAEFDIKKEAA
Sbjct  333  LFNLLTNNYKKSIKKEACWTISNITAGNKQQIQAVIEGNIFGPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  393  WAISNATSGGSHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNIG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    G+    
Sbjct  453  NTGDVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDETMPPGEAA--  510

Query  319  NQQQAFSFGENQ-PNVPPGGFKF  254
              Q  F+FG  + P+VP GGF F
Sbjct  511  --QSGFNFGGAEVPSVPSGGFNF  531



>ref|XP_010024115.1| PREDICTED: importin subunit alpha-1a [Eucalyptus grandis]
 gb|KCW60545.1| hypothetical protein EUGRSUZ_H03281 [Eucalyptus grandis]
 gb|KCW60546.1| hypothetical protein EUGRSUZ_H03281 [Eucalyptus grandis]
Length=531

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 169/204 (83%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQAVIEANII PLV+LLQNAEFDIKKEAA
Sbjct  332  LLNLLTGNYKKSIKKEACWTISNITAGNKEQIQAVIEANIIAPLVHLLQNAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  392  WAISNATSGGSHEQIKFLVCQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+ID+ EG +K+E+LQ+HDN+EIYEKAVK+LE +W EEE+E     D    
Sbjct  452  GTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKLLETYWLEEEDEAMPPED----  507

Query  319  NQQQAFSFGENQ-PNVPPGGFKFG  251
            +      FG N+ P VP GGFKFG
Sbjct  508  SAHPGVPFGGNELPPVPSGGFKFG  531



>ref|NP_001234006.1| importin subunit alpha [Solanum lycopersicum]
 sp|O22478.2|IMA_SOLLC RecName: Full=Importin subunit alpha; AltName: Full=Karyopherin 
subunit alpha; Short=KAP alpha [Solanum lycopersicum]
 gb|AAC23722.1| importin alpha [Solanum lycopersicum]
Length=527

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 169/203 (83%), Gaps = 7/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAGNR QIQ VIEA II PLVYLLQNAEF+IKKEAA
Sbjct  332  LVNLLTQNYKKSIKKEACWTISNITAGNRNQIQIVIEAGIIAPLVYLLQNAEFEIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILK+GEADK+ G
Sbjct  392  WAISNATSGGNHDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKIGEADKDLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              +G+N+YAQLIDE EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+        V  
Sbjct  452  NTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDV------PVSL  505

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            N+ Q F FG    ++P GGF F 
Sbjct  506  NEDQ-FEFGGADISLPSGGFNFS  527



>ref|XP_006355841.1| PREDICTED: importin subunit alpha-like [Solanum tuberosum]
Length=527

 Score =   296 bits (759),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 169/203 (83%), Gaps = 7/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAGNR QIQ VIEA II PLVYLLQNAEF+IKKEAA
Sbjct  332  LVNLLTQNYKKSIKKEACWTISNITAGNRNQIQIVIEAGIIAPLVYLLQNAEFEIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            W ISNATSGG+H+QI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILK+GEADK+ G
Sbjct  392  WGISNATSGGNHDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKIGEADKDLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              +G+N+YAQLIDE EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+ Q ++ ++   
Sbjct  452  NTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDVQVSLIED---  508

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
                 F FG    ++P GGF F 
Sbjct  509  ----QFEFGGADISLPSGGFNFS  527



>ref|XP_008388495.1| PREDICTED: importin subunit alpha-1b-like [Malus domestica]
Length=530

 Score =   296 bits (759),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 167/204 (82%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QI+AV+EANII PLV LLQNAEFDIKKEAA
Sbjct  331  LLNLLTNNYKKSIKKEACWTISNITAGNKEQIRAVVEANIIGPLVNLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ I++ +G +K+E LQ+HDN EIYEKAVK+LE +W E+++E    GD    
Sbjct  451  TTGGVNLYAQAIEDADGLEKIESLQSHDNTEIYEKAVKMLETYWLEDDDETMPPGDAA--  508

Query  319  NQQQAFSFGENQ-PNVPPGGFKFG  251
                 F+FG N  P VP GGF FG
Sbjct  509  --PTTFNFGGNDVPTVPSGGFNFG  530



>ref|XP_007138966.1| hypothetical protein PHAVU_009G253500g [Phaseolus vulgaris]
 gb|ESW10960.1| hypothetical protein PHAVU_009G253500g [Phaseolus vulgaris]
Length=529

 Score =   296 bits (759),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 167/203 (82%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVIEA +I PLV LLQNAEFDIKKEAA
Sbjct  332  LLSLLTHNHKKSIKKEACWTISNITAGNREQIQAVIEAGLIAPLVNLLQNAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  392  WAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKSLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+ID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W E++++    GD    
Sbjct  452  NTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEDDDDTLPTGD----  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG   P VP GGF F 
Sbjct  508  GAQPGFNFGNELP-VPSGGFNFS  529



>ref|XP_009338212.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=530

 Score =   296 bits (759),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 168/204 (82%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QI+AV+EANII PLV LLQNAEFDIKKEAA
Sbjct  331  LLNLLTNNYKKSIKKEACWTISNITAGNKDQIRAVVEANIIGPLVNLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ I++ +G +K+E LQ+HDN EIYEKAVK+LE +W E+++E    GD    
Sbjct  451  TTGGVNLYAQAIEDADGLEKIESLQSHDNTEIYEKAVKMLETYWLEDDDETMPPGDAAPA  510

Query  319  NQQQAFSF-GENQPNVPPGGFKFG  251
                AF+F G + P VP GGF FG
Sbjct  511  ----AFNFVGNDVPTVPSGGFNFG  530



>gb|EYU46779.1| hypothetical protein MIMGU_mgv1a0058492mg, partial [Erythranthe 
guttata]
Length=364

 Score =   291 bits (744),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 169/203 (83%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L+ LLTQN+KKSIKKEACWTISNITAGNR QIQAVIEA II PLV LLQ AEF+IKKEAA
Sbjct  166  LHNLLTQNYKKSIKKEACWTISNITAGNRDQIQAVIEAGIIAPLVALLQTAEFEIKKEAA  225

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WA+SNATSGG+++QI+FLV +GCIKPLCDLLVCPDPRI+TV LEGLENILKVGEADK  G
Sbjct  226  WALSNATSGGTNDQIKFLVREGCIKPLCDLLVCPDPRIVTVSLEGLENILKVGEADKSQG  285

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N++AQ+ID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EE++ +   GD    
Sbjct  286  NTGDVNVFAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEDDGELASGDA---  342

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG +   VPPGGFKFG
Sbjct  343  -SQSGFNFGGSDLPVPPGGFKFG  364



>ref|XP_010684628.1| PREDICTED: importin subunit alpha [Beta vulgaris subsp. vulgaris]
Length=531

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 170/203 (84%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL Q++KKSIKKEACWTISNITAG + QIQAVIEA II PLV+LLQNAEFDIKKEAA
Sbjct  333  LLNLLNQSYKKSIKKEACWTISNITAGTKEQIQAVIEAGIIAPLVHLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS +QI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILK+GEA+K  G
Sbjct  393  WAISNATSGGSPDQIKFLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKIGEAEKNLG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             + GIN+YAQ++++ EG DK+E+LQ+HDN+EIYEKAVKILE +W ++E+E     +    
Sbjct  453  TSGGINVYAQMVEDAEGLDKIENLQSHDNNEIYEKAVKILETYWVDDEDEALPSAE----  508

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG N+ NVP GGFKFG
Sbjct  509  GAQNGFEFGGNELNVPQGGFKFG  531



>ref|XP_007051048.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
 ref|XP_007051049.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
 gb|EOX95205.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
 gb|EOX95206.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
Length=534

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 166/203 (82%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN  QIQAVIEA II PLV+LLQNAEF+IKKEAA
Sbjct  336  LLNLLTNNYKKSIKKEACWTISNITAGNVDQIQAVIEAGIIAPLVHLLQNAEFEIKKEAA  395

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  396  WAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKVGEAEKNLG  455

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W E+E+E    GD    
Sbjct  456  HTGEVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEDEDEPLPPGDA---  512

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG NQ  VP GGF F 
Sbjct  513  -SQSGFQFGANQHPVPSGGFNFS  534



>ref|XP_002282816.1| PREDICTED: importin subunit alpha-1 [Vitis vinifera]
 emb|CBI39567.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 166/203 (82%), Gaps = 6/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIEANII PLV+LLQNAEFDIKKEAA
Sbjct  331  LLNLLTNNHKKSIKKEACWTISNITAGNKEQIQAVIEANIIGPLVHLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV+Q  IKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHEQIKYLVSQASIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD    
Sbjct  451  STREVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEEDETMPPGD----  506

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            + Q  F FGE    VP GGF F 
Sbjct  507  SSQPGFRFGEVP--VPTGGFNFS  527



>ref|XP_004244944.1| PREDICTED: importin subunit alpha-1 [Solanum lycopersicum]
Length=529

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 166/202 (82%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL+ +HKKSIKKEACWTISNITAGNR QIQ V++A II PLV LLQNAEF+IKKEAA
Sbjct  331  LLNLLSGSHKKSIKKEACWTISNITAGNREQIQCVVDAGIIGPLVNLLQNAEFEIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKSLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                INLYAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  451  RTSDINLYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILETYWLEEDDETMPPGDAA--  508

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              QQ F FG  + +VP GGF F
Sbjct  509  --QQGFQFGGGEVSVPSGGFSF  528



>ref|XP_006407910.1| hypothetical protein EUTSA_v10020480mg [Eutrema salsugineum]
 gb|ESQ49363.1| hypothetical protein EUTSA_v10020480mg [Eutrema salsugineum]
Length=536

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 1/203 (0%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAGN+ QIQ V+EAN+I PLV LLQNAEFDIKKEAA
Sbjct  335  LANLLTQNYKKSIKKEACWTISNITAGNKEQIQKVVEANLIPPLVNLLQNAEFDIKKEAA  394

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI +LV QGCIKPLCDLL+CPDPRIITVCLEGLENILKVGE++K  G
Sbjct  395  WAISNATSGGSHDQIIYLVEQGCIKPLCDLLICPDPRIITVCLEGLENILKVGESEKTLG  454

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                 N YAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E+       DG
Sbjct  455  NTGETNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDEETQQAPGGDG  514

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            + Q  F FG NQ +VP GGF F 
Sbjct  515  S-QAGFQFGGNQASVPSGGFNFS  536



>ref|XP_009402512.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=531

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 164/204 (80%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI A II PLV+LLQ+AEFDIKKEAA
Sbjct  332  LLNLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIAAGIIGPLVHLLQSAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI+FLV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K   
Sbjct  392  WAISNATSGGSHDQIKFLVDQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNQV  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+N+YAQ+IDE EG +K+E+LQ+HDN EIYEKAVKILE FW EEE++    GD    
Sbjct  452  TTGGVNVYAQMIDEAEGLEKIENLQSHDNTEIYEKAVKILETFWLEEEDDAMPTGDAAP-  510

Query  319  NQQQAFSFGEN-QPNVPPGGFKFG  251
                 F FG N Q   P GGF F 
Sbjct  511  ---TGFHFGNNGQNTAPSGGFNFS  531



>gb|KJB41861.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
Length=453

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT  +KKSIKKEACWTISNITAGN  QIQAVIEA II PLV+LLQNAEF+IKKEAA
Sbjct  255  LLNLLTNTYKKSIKKEACWTISNITAGNVDQIQAVIEAGIIAPLVHLLQNAEFEIKKEAA  314

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  315  WAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKVGEAEKNLG  374

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W E+E+E    GD    
Sbjct  375  HTGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEDEDEALPTGDA---  431

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q  F FG NQ  VP GGF F
Sbjct  432  -SQPGFQFGGNQLPVPSGGFNF  452



>ref|XP_011079596.1| PREDICTED: importin subunit alpha-like [Sesamum indicum]
Length=529

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 166/203 (82%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAGNR QIQAVIEA II PLV LLQNAEF+IKKEAA
Sbjct  331  LLNLLTQNYKKSIKKEACWTISNITAGNRDQIQAVIEAGIISPLVVLLQNAEFEIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+ +QI+FLV +GCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGTSDQIKFLVREGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNQG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N+YAQ+ID  EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+EQ   GD    
Sbjct  451  NTGDVNVYAQMIDSAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDEQLVSGDA---  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG     VP GGFKF 
Sbjct  508  -PQSGFNFGGGDLPVPSGGFKFS  529



>ref|XP_001778004.1| predicted protein [Physcomitrella patens]
 gb|EDQ57217.1| predicted protein [Physcomitrella patens]
Length=534

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 167/204 (82%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI+ANII PLV LL  AEFDIKKEAA
Sbjct  335  LLALLTNNHKKSIKKEACWTISNITAGNKDQIQAVIDANIIPPLVSLLATAEFDIKKEAA  394

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LVNQGCIKPLCDLL CPDPRI+TV LEGLENILKVGE +K+ G
Sbjct  395  WAISNATSGGTHDQIKYLVNQGCIKPLCDLLTCPDPRIVTVSLEGLENILKVGEQEKDLG  454

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               GIN YA+ IDE EG +K+E+LQTHDN+EIYEKAVKILE +W EE+ E+QN     DG
Sbjct  455  KTGGINEYARYIDEAEGLEKIENLQTHDNNEIYEKAVKILETYWLEED-EEQNTAPGTDG  513

Query  319  NQQQAFSFG-ENQPNVPPGGFKFG  251
               Q+F+FG  N    PPGGF FG
Sbjct  514  ---QSFAFGSSNVAGAPPGGFNFG  534



>ref|XP_007205032.1| hypothetical protein PRUPE_ppa004091mg [Prunus persica]
 gb|EMJ06231.1| hypothetical protein PRUPE_ppa004091mg [Prunus persica]
Length=530

 Score =   295 bits (754),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 165/203 (81%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QI+AVI+A II PLV LLQ AEFDIKKEAA
Sbjct  331  LLTLLTNNYKKSIKKEACWTISNITAGNKDQIKAVIDAGIIGPLVSLLQGAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+ LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHEQIKILVDQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W E+E+E    GD    
Sbjct  451  TTGGVNLYAQAIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWVEDEDETMPPGDA---  507

Query  319  NQQQAFSFGEN-QPNVPPGGFKF  254
              Q  F+FG N  P VP GGF F
Sbjct  508  -SQTGFNFGGNGMPTVPSGGFNF  529



>ref|XP_008245768.1| PREDICTED: importin subunit alpha-1 [Prunus mume]
Length=530

 Score =   294 bits (753),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 164/203 (81%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QI+AVI+A II PLV LLQ AEFDIKKEAA
Sbjct  331  LLTLLTNNYKKSIKKEACWTISNITAGNKDQIKAVIDAGIIAPLVSLLQGAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+ LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHEQIKILVDQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W E+E+E    GD    
Sbjct  451  TTGGVNLYAQAIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWVEDEDETMPPGDA---  507

Query  319  NQQQAFSF-GENQPNVPPGGFKF  254
              Q  F+F G   P VP GGF F
Sbjct  508  -SQTGFNFGGSGMPTVPSGGFNF  529



>gb|KHG01621.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
 gb|KJB41859.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
 gb|KJB41860.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
 gb|KJB41864.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
 gb|KJB41865.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
Length=534

 Score =   294 bits (753),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT  +KKSIKKEACWTISNITAGN  QIQAVIEA II PLV+LLQNAEF+IKKEAA
Sbjct  336  LLNLLTNTYKKSIKKEACWTISNITAGNVDQIQAVIEAGIIAPLVHLLQNAEFEIKKEAA  395

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  396  WAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKVGEAEKNLG  455

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W E+E+E    GD    
Sbjct  456  HTGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEDEDEALPTGDA---  512

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q  F FG NQ  VP GGF F
Sbjct  513  -SQPGFQFGGNQLPVPSGGFNF  533



>ref|XP_004295110.1| PREDICTED: importin subunit alpha-1-like [Fragaria vesca subsp. 
vesca]
Length=528

 Score =   294 bits (753),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 164/203 (81%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQ VIEA +I PLV LLQ AEF+IKKEAA
Sbjct  331  LLSLLTHNHKKSIKKEACWTISNITAGNREQIQHVIEAGLIGPLVNLLQTAEFEIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+ LV +GCIKPL DLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGTHEQIKVLVTEGCIKPLSDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N G NLYAQLIDE +G +K+E+LQTHDN+EIYEKAVKILE +W E+E+E    GD    
Sbjct  451  -NSGTNLYAQLIDEADGLEKIENLQTHDNNEIYEKAVKILETYWLEDEDETLPAGDAA--  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG N P VP GGF F 
Sbjct  508  --QPGFNFGGNGPQVPTGGFNFS  528



>gb|KJB41862.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
Length=535

 Score =   294 bits (753),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT  +KKSIKKEACWTISNITAGN  QIQAVIEA II PLV+LLQNAEF+IKKEAA
Sbjct  337  LLNLLTNTYKKSIKKEACWTISNITAGNVDQIQAVIEAGIIAPLVHLLQNAEFEIKKEAA  396

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  397  WAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKVGEAEKNLG  456

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W E+E+E    GD    
Sbjct  457  HTGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEDEDEALPTGDA---  513

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q  F FG NQ  VP GGF F
Sbjct  514  -SQPGFQFGGNQLPVPSGGFNF  534



>ref|XP_011082432.1| PREDICTED: importin subunit alpha-like [Sesamum indicum]
Length=529

 Score =   294 bits (753),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 169/203 (83%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAGNR QIQAVIEA II PLV LLQNAEF+IKKEAA
Sbjct  331  LLNLLTQNYKKSIKKEACWTISNITAGNRDQIQAVIEAGIISPLVVLLQNAEFEIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+++QI+ LV +GCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGTNDQIKLLVREGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNQG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N++AQ+ID+ +G +K+E+LQ+HDN+EIYEKAVK+LE +W EE++EQ   GD    
Sbjct  451  NTGDVNVFAQMIDDAQGLEKIENLQSHDNNEIYEKAVKVLETYWLEEDDEQLVSGD----  506

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
             QQ  F+FG     VP GGFKFG
Sbjct  507  TQQSGFNFGGGDLPVPSGGFKFG  529



>gb|EYU25627.1| hypothetical protein MIMGU_mgv1a004356mg [Erythranthe guttata]
 gb|EYU42202.1| hypothetical protein MIMGU_mgv1a004354mg [Erythranthe guttata]
Length=531

 Score =   294 bits (753),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 167/202 (83%), Gaps = 3/202 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT  HKKSIKKE+CWTISNITAGNR QIQ+VIEANII PL+ LLQNAEFD+KKEAA
Sbjct  332  LLNLLTGGHKKSIKKESCWTISNITAGNRDQIQSVIEANIIGPLIQLLQNAEFDVKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+Q CIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  392  WAISNATSGGTHEQIKYLVSQQCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+ID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EE++E    G   D 
Sbjct  452  KTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEDDEPAPPG---DA  508

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              QQ F FG +  ++P GGF F
Sbjct  509  AAQQGFQFGGSDVSLPSGGFSF  530



>ref|XP_011023747.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Populus 
euphratica]
Length=529

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 164/203 (81%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL  N+KKSIKKEACWTISNITAGN+ QIQAVIEANII PLV LLQ+AEFDIKKEAA
Sbjct  332  LLNLLANNYKKSIKKEACWTISNITAGNKEQIQAVIEANIIGPLVNLLQSAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK   
Sbjct  392  WAISNATSGGAHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNVS  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W  EE+E    GD    
Sbjct  452  ETGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWL-EEDETMPPGDA---  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG   P VP GGF F 
Sbjct  508  -SQSGFQFGGEAPAVPSGGFNFS  529



>ref|XP_003550530.1| PREDICTED: importin subunit alpha-1-like [Glycine max]
Length=530

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 165/203 (81%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQ VIEA ++ PLV LLQNAEFDIKKEAA
Sbjct  332  LLNLLTNNHKKSIKKEACWTISNITAGNKEQIQTVIEAGLVAPLVNLLQNAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG HEQI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  392  WAISNATSGGIHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKSLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N YAQ+ID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    GD    
Sbjct  452  NTGDVNEYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDETLPSGD----  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG N+  VP GGF F 
Sbjct  508  GAQPGFNFGNNELPVPSGGFNFS  530



>ref|XP_011023748.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Populus 
euphratica]
Length=528

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 164/203 (81%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL  N+KKSIKKEACWTISNITAGN+ QIQAVIEANII PLV LLQ+AEFDIKKEAA
Sbjct  331  LLNLLANNYKKSIKKEACWTISNITAGNKEQIQAVIEANIIGPLVNLLQSAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK   
Sbjct  391  WAISNATSGGAHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKNVS  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W  EE+E    GD    
Sbjct  451  ETGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWL-EEDETMPPGDA---  506

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG   P VP GGF F 
Sbjct  507  -SQSGFQFGGEAPAVPSGGFNFS  528



>ref|XP_009412111.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009412112.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009412113.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=531

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 163/204 (80%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI A II PLV+LLQ AEFDIKKEAA
Sbjct  332  LLNLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIAAGIIAPLVHLLQTAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI+++V QGCIKPLCDLLVCPDPRI+TVCLEGLENILK+GEA+K  G
Sbjct  392  WAISNATSGGTHDQIKYIVGQGCIKPLCDLLVCPDPRIVTVCLEGLENILKIGEAEKNLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N YAQLIDE EG +K+E+LQ+HDN EIYEKAVKILE +W EEE++    GD    
Sbjct  452  ATGAVNSYAQLIDEAEGLEKIENLQSHDNTEIYEKAVKILETYWMEEEDDAMPTGDAA--  509

Query  319  NQQQAFSFGEN-QPNVPPGGFKFG  251
              Q  F FG + Q  VP GGF F 
Sbjct  510  --QTGFQFGNSGQNTVPSGGFNFS  531



>ref|XP_001763761.1| predicted protein [Physcomitrella patens]
 gb|EDQ71403.1| predicted protein [Physcomitrella patens]
Length=531

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 169/204 (83%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI+ANII PLV LL +AEFDIKKEAA
Sbjct  332  LLALLTNNHKKSIKKEACWTISNITAGNKEQIQAVIDANIIPPLVSLLASAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WA+SNATSGG+ EQI+ LVNQGCIKPLCDLL CPDPRI+TV LEGLENILKVGE DK++G
Sbjct  392  WAVSNATSGGTSEQIKHLVNQGCIKPLCDLLTCPDPRIVTVSLEGLENILKVGEQDKDSG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N+G+N+YA+ IDE EG +K+E+LQTHDN+EIYEKAVKILE +W EE+ E QN+     G
Sbjct  452  NNNGVNIYARYIDEAEGLEKIENLQTHDNNEIYEKAVKILETYWLEED-EDQNVA---PG  507

Query  319  NQQQAFSFGENQ-PNVPPGGFKFG  251
             + Q F+FG +     PPGGF FG
Sbjct  508  TEGQNFAFGSSTAAGAPPGGFNFG  531



>ref|XP_006345634.1| PREDICTED: importin subunit alpha-1-like [Solanum tuberosum]
Length=529

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL  +HKKSIKKEACWTISNITAGNR QIQ V++A II PLV LLQNAEF+IKKEAA
Sbjct  331  LLNLLNGSHKKSIKKEACWTISNITAGNREQIQCVVDAGIIGPLVNLLQNAEFEIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                INLYAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  451  RTSDINLYAQLIDDAEGLEKIENLQSHDNQEIYEKAVKILETYWLEEDDETMPPGDA---  507

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              QQ F FG  + +VP GGF F
Sbjct  508  -PQQGFQFGGGEVSVPSGGFSF  528



>ref|XP_010043209.1| PREDICTED: importin subunit alpha-1a-like [Eucalyptus grandis]
 ref|XP_010043210.1| PREDICTED: importin subunit alpha-1a-like [Eucalyptus grandis]
 ref|XP_010043211.1| PREDICTED: importin subunit alpha-1a-like [Eucalyptus grandis]
 gb|KCW85236.1| hypothetical protein EUGRSUZ_B02080 [Eucalyptus grandis]
 gb|KCW85237.1| hypothetical protein EUGRSUZ_B02080 [Eucalyptus grandis]
Length=530

 Score =   294 bits (752),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 168/203 (83%), Gaps = 3/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQAV+EA+II P+V LLQNAEFDIKKEAA
Sbjct  331  LLNLLTGNYKKSIKKEACWTISNITAGNKEQIQAVVEADIIGPMVQLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLVNQGC+KPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGSHEQIKFLVNQGCVKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N+YAQ++++ EG +K+E LQ+HDN+EIYEKAVKILE +W EE+++    GD    
Sbjct  451  NTGDVNVYAQMVEDVEGLEKIESLQSHDNNEIYEKAVKILEAYWLEEDDDAMPPGDAPQP  510

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            + Q     G N P +P GGFKFG
Sbjct  511  DMQFG---GNNLPPMPSGGFKFG  530



>ref|XP_007163337.1| hypothetical protein PHAVU_001G226400g [Phaseolus vulgaris]
 gb|ESW35331.1| hypothetical protein PHAVU_001G226400g [Phaseolus vulgaris]
Length=531

 Score =   293 bits (751),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 169/203 (83%), Gaps = 6/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT+N+KKSIKKEACWTISNITAGN+ QIQ VI+A +I PLV+LLQNAEFDIKKEAA
Sbjct  333  LLNLLTKNYKKSIKKEACWTISNITAGNKQQIQDVIDAGLIAPLVHLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQ++FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGE++K   
Sbjct  393  WAISNATSGGSHEQVKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGESEKNVS  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              DG+NLY  +ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  453  NADGVNLYGAMIDDVEGLEKIENLQSHDNTEIYEKAVKILETYWMEEDDETVPPGD----  508

Query  319  NQQQAFSFGENQ-PNVPPGGFKF  254
               Q F+FG ++ P+VP GGF F
Sbjct  509  -ASQGFNFGGHKFPSVPSGGFNF  530



>ref|XP_001773628.1| predicted protein [Physcomitrella patens]
 gb|EDQ61516.1| predicted protein [Physcomitrella patens]
Length=531

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 167/204 (82%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI+ANII P+V LL  AEFDIKKEAA
Sbjct  332  LLALLTNNHKKSIKKEACWTISNITAGNKEQIQAVIDANIIPPVVALLATAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+ EQI+FLVNQGCIKPLCDLL CPDPRI+TV LEGLENILKVGE  K++G
Sbjct  392  WAISNATSGGTPEQIKFLVNQGCIKPLCDLLTCPDPRIVTVSLEGLENILKVGEQVKDSG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N  +NLYA+ IDE EG +K+E+LQTHDN+EIYEKAVKILE +W  EE+E QN     +G
Sbjct  452  SNGDVNLYARYIDEAEGLEKIENLQTHDNNEIYEKAVKILETYWL-EEDEDQNTAPVTEG  510

Query  319  NQQQAFSFGENQPN-VPPGGFKFG  251
               Q F+FG + P+  PPGGF FG
Sbjct  511  ---QNFAFGSSNPSGAPPGGFNFG  531



>gb|KHG15238.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
Length=534

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT  +KKSIKKEACWTISNITAGN  QIQAVIEA II PLV+LLQNAEF+IKKEAA
Sbjct  336  LLNLLTNTYKKSIKKEACWTISNITAGNVDQIQAVIEAGIIAPLVHLLQNAEFEIKKEAA  395

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  396  WAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKVGEAEKNLG  455

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W E+E+E   +GD    
Sbjct  456  HTGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEDEDEPLPLGDAA--  513

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q    FG NQ  VP GGF F
Sbjct  514  --QSGLQFGGNQLPVPSGGFNF  533



>ref|XP_007222489.1| hypothetical protein PRUPE_ppa004118mg [Prunus persica]
 gb|EMJ23688.1| hypothetical protein PRUPE_ppa004118mg [Prunus persica]
Length=529

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQ+VI+A++I PLV LLQNAEFDIKKEAA
Sbjct  331  LLSLLTHNHKKSIKKEACWTISNITAGNREQIQSVIDASLIGPLVNLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+ EQI++LV +GCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGTPEQIKYLVGEGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNAG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  451  NTGEVNLYAQLIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWVEEDDETLPSGD----  506

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q  F FG N+  VP GGF F
Sbjct  507  GSQPGFHFGGNELQVPSGGFNF  528



>ref|XP_009401503.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=528

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 165/203 (81%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI A II PLV+LLQ AEF+IKKEAA
Sbjct  331  LLNLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIAAGIIGPLVHLLQTAEFEIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLL+CPDPRIITVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGAHEQIKYLVSQGCIKPLCDLLLCPDPRIITVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +  G N YAQLI++ EG DK+E+ Q+HDN EIYEK+VKILE +W EEE++    GD    
Sbjct  451  VPGGTNPYAQLIEDAEGLDKIENFQSHDNTEIYEKSVKILETYWLEEEDDAMP-GD----  505

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG N  +VP GGF FG
Sbjct  506  TTQTGFDFGNNDQSVPSGGFNFG  528



>gb|AAK38727.1|AF369707_1 importin alpha 2 [Capsicum annuum]
Length=529

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 165/203 (81%), Gaps = 6/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI A +I PLV LLQ+AEFDIKKEAA
Sbjct  333  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIAAGLISPLVNLLQSAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+Q CIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K   
Sbjct  393  WAISNATSGGTHEQIKFLVSQNCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKAN-  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               GIN YAQL D+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    GD    
Sbjct  452  -TGGINYYAQLTDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDETLPAGD----  506

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG N   +P GGFKFG
Sbjct  507  GTQNEFNFGGNDIQLPSGGFKFG  529



>ref|XP_011046400.1| PREDICTED: LOW QUALITY PROTEIN: importin subunit alpha-1-like 
[Populus euphratica]
Length=529

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 164/202 (81%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIE  +I PLV LLQNAEFDIKKEAA
Sbjct  332  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIENGLIGPLVNLLQNAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WA+SNATSGG+HEQI+FLV+QGCIKPLCDLLVCPDPRI+TV LEGLENILKVGEA+K  G
Sbjct  392  WAVSNATSGGTHEQIKFLVSQGCIKPLCDLLVCPDPRIVTVSLEGLENILKVGEAEKNLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +   N YAQ+ID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EE++E    GD    
Sbjct  452  NSGDANFYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEDDETLPSGD----  507

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              QQ F FG N   VP GGF F
Sbjct  508  GAQQGFQFGGNDVQVPSGGFNF  529



>ref|XP_009393195.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=530

 Score =   292 bits (747),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 166/204 (81%), Gaps = 6/204 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI A II PLV+LLQ AEFDIKKEAA
Sbjct  332  LLNLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIAAGIIGPLVHLLQTAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV+QGC+KPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  392  WAISNATSGGNHDQIKYLVSQGCVKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +NLYAQ+I+E EG +K+E+LQ+HDN EIYEKAVKILE +W EE++     GD    
Sbjct  452  ASGDVNLYAQMIEEAEGLEKIENLQSHDNTEIYEKAVKILETYWLEEDDAMPT-GDAA--  508

Query  319  NQQQAFSFGEN-QPNVPPGGFKFG  251
              Q  F FG N Q   PPGGF FG
Sbjct  509  --QTGFHFGNNGQNTAPPGGFNFG  530



>gb|EPS62504.1| hypothetical protein M569_12283, partial [Genlisea aurea]
Length=535

 Score =   292 bits (747),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 165/203 (81%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAGNR QIQAVIE+ II PLV LLQNAEF+IKKEAA
Sbjct  337  LLNLLTQNYKKSIKKEACWTISNITAGNRDQIQAVIESGIISPLVSLLQNAEFEIKKEAA  396

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+ +QI+FLV +GCIKPLCDLLVCPDPRI+TVCLEGLENILKVGE++K  G
Sbjct  397  WAISNATSGGTPDQIKFLVGEGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGESEKNQG  456

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N++AQ+IDE EG +K+E LQ HDN+EIYEK VKILE +W EE++EQ   GD    
Sbjct  457  NTGDVNVFAQMIDEAEGLEKIESLQNHDNNEIYEKVVKILETYWLEEDDEQLASGDA---  513

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
             QQ  F+FG     VP GGFKF 
Sbjct  514  -QQSGFNFGGGDNAVPSGGFKFA  535



>ref|XP_004302255.1| PREDICTED: importin subunit alpha-1 [Fragaria vesca subsp. vesca]
Length=532

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 166/204 (81%), Gaps = 3/204 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAV++AN+I PLV LL +AEFDIKKEAA
Sbjct  329  LLTLLTNNHKKSIKKEACWTISNITAGNKDQIQAVVDANLIGPLVQLLSSAEFDIKKEAA  388

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WA+SNATSGGSH+QI+ LVN GCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  389  WAVSNATSGGSHDQIKILVNHGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  448

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNI--GDEV  326
            +  G+NL+AQ IDE EG +K+E+LQTHDN EIYEKAVK+LE +W E+++  + +  GD  
Sbjct  449  MTGGVNLFAQAIDEAEGLEKIENLQTHDNAEIYEKAVKLLETYWLEDDDGDETMPPGDAA  508

Query  325  DGNQQQAFSFGENQPNVPPGGFKF  254
                   F+FG N P VP GGF F
Sbjct  509  T-VPTGGFNFGGNAPTVPSGGFNF  531



>ref|XP_008223291.1| PREDICTED: importin subunit alpha-1-like [Prunus mume]
Length=529

 Score =   291 bits (745),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQ+VI+A++I PLV LLQNAEFDIKKEAA
Sbjct  331  LLSLLTHNHKKSIKKEACWTISNITAGNREQIQSVIDASLIGPLVNLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+ EQI++LV +GCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGTPEQIKYLVGEGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNAG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NL+AQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    GD    
Sbjct  451  NTGEVNLFAQLIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWVEEDDETLPSGD----  506

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q  F FG N+  VP GGF F
Sbjct  507  GSQPGFHFGGNELQVPSGGFNF  528



>ref|XP_010268071.1| PREDICTED: importin subunit alpha-1-like [Nelumbo nucifera]
Length=529

 Score =   291 bits (744),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 162/202 (80%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL  NHKKSIKKEACWTISNITAGN+ QIQAVI+A II PLV LL  AEFDIKKEAA
Sbjct  331  LLNLLNHNHKKSIKKEACWTISNITAGNKDQIQAVIDAQIIGPLVQLLHTAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LVNQGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGE++K  G
Sbjct  391  WAISNATSGGSHDQIKYLVNQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGESEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+N+YAQLIDE EG DK+E+LQ HDN EIYEKAVKILE +W EE++E     D    
Sbjct  451  NTGGVNVYAQLIDEAEGLDKIENLQIHDNSEIYEKAVKILETYWLEEQDEILAPADA---  507

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q  F FG ++  VP GGF F
Sbjct  508  -SQPGFQFGGSELQVPSGGFNF  528



>ref|XP_003626176.1| Importin subunit alpha [Medicago truncatula]
Length=563

 Score =   292 bits (747),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 166/203 (82%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL  ++KKSIKKEACWTISNITAGN+ QIQ VI+ANII PLV LLQNAEFDIKKEAA
Sbjct  333  LTNLLINSYKKSIKKEACWTISNITAGNKQQIQDVIDANIIAPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQ+++LV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  393  WAISNATSGGSHEQLKYLVSQGCIKPLCDLLTCPDPRIVTVCLEGLENILKVGEADKNAG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            + DG+N YA+LIDE EG +K+E+LQ+HDN+EIYEKAVKILE +W EE++E    GD    
Sbjct  453  ITDGVNRYAELIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEDDEAMPPGDA---  509

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG ++    P GF  G
Sbjct  510  -SQSGFNFGGSEVPAVPSGFLAG  531



>gb|KHN02923.1| Importin subunit alpha-1 [Glycine soja]
Length=530

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 166/203 (82%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQ VIEA ++ PLV LLQ+AEFDIKKEA+
Sbjct  332  LLNLLTNNHKKSIKKEACWTISNITAGNKEQIQTVIEAGLVAPLVNLLQSAEFDIKKEAS  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV+QGC+KPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  392  WAISNATSGGTHDQIKYLVSQGCVKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKSLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N+YAQ+IDE EG +K+E+LQ+HDN+EIYEK VKILE +W EEE+E    G+    
Sbjct  452  NTGDVNVYAQMIDEAEGLEKIENLQSHDNNEIYEKVVKILETYWLEEEDETLPSGN----  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG N+  VP GGF F 
Sbjct  508  GAQPGFNFGNNELPVPSGGFNFS  530



>ref|XP_001773629.1| predicted protein [Physcomitrella patens]
 gb|EDQ61517.1| predicted protein [Physcomitrella patens]
Length=532

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 164/204 (80%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI+ANII PLV LL  AEFDIKKEAA
Sbjct  333  LLALLTNNHKKSIKKEACWTISNITAGNKDQIQAVIDANIIPPLVSLLATAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LV QGCIKPLCDLL CPDPRI+TV LEGLENILKVGE +K+ G
Sbjct  393  WAISNATSGGSHDQIKYLVTQGCIKPLCDLLTCPDPRIVTVSLEGLENILKVGEQEKDLG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             + GINLYA+ IDE EG +K+E+LQTHDN+EIYEKAVKILE +W EE+ +     +   G
Sbjct  453  QSGGINLYARYIDEAEGLEKIENLQTHDNNEIYEKAVKILETYWLEEDED----SNAAPG  508

Query  319  NQQQAFSFG-ENQPNVPPGGFKFG  251
             + Q F+FG  N    P GGF FG
Sbjct  509  TEGQTFAFGSSNAAGAPAGGFHFG  532



>ref|XP_010546997.1| PREDICTED: importin subunit alpha-1 [Tarenaya hassleriana]
Length=535

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 170/203 (84%), Gaps = 2/203 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAGN+ QIQAVIEA ++ PLV LLQNAEFDIKKEAA
Sbjct  335  LANLLTQNYKKSIKKEACWTISNITAGNKEQIQAVIEAGLVAPLVNLLQNAEFDIKKEAA  394

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI+++V QGC+KPLCDLLVCPDPRIITVCLEGLENILKVGEA+K  G
Sbjct  395  WAISNATSGGSHDQIKYMVEQGCVKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKNLG  454

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +   N YAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EE+ E + +    DG
Sbjct  455  HSGDTNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEDEEDETLPPG-DG  513

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
            + Q  F FG NQ  VP GGFKFG
Sbjct  514  S-QPGFQFGGNQVPVPSGGFKFG  535



>ref|XP_011092122.1| PREDICTED: importin subunit alpha-1 [Sesamum indicum]
Length=530

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 167/202 (83%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL+ +HKKSIKKEACWTISNITAGNR QIQ VIEANII PLV LLQNAEFD+KKEAA
Sbjct  332  LLNLLSGSHKKSIKKEACWTISNITAGNREQIQGVIEANIIGPLVQLLQNAEFDVKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+Q CIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  392  WAISNATSGGTHEQIKYLVSQQCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKNLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLY Q+I++ EG +K+E+LQ+HDN EIYEKAVKILE +W EE++E    G   D 
Sbjct  452  RTGDVNLYGQMIEDAEGLEKIENLQSHDNIEIYEKAVKILETYWLEEDDEPAPPG---DA  508

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
            +QQQ F FG  + +VP GGF F
Sbjct  509  SQQQGFQFG-GEVSVPSGGFSF  529



>gb|KJB24392.1| hypothetical protein B456_004G143100 [Gossypium raimondii]
Length=534

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 163/202 (81%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN  QIQAVI A I  PLV+LLQNAEF+IKKEAA
Sbjct  336  LLNLLTSNYKKSIKKEACWTISNITAGNVDQIQAVISAGIFAPLVHLLQNAEFEIKKEAA  395

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVG A+K  G
Sbjct  396  WAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKVGVAEKNLG  455

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    GD    
Sbjct  456  HTGEVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEEEDEPLPPGDA---  512

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q  F FG NQ  VP GGF F
Sbjct  513  -SQSGFQFGGNQLPVPSGGFNF  533



>emb|CDY34430.1| BnaC01g22030D [Brassica napus]
Length=530

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 160/197 (81%), Gaps = 4/197 (2%)
 Frame = -1

Query  844  TQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAAWAISN  665
            TQNHKKSIKKEACWTISNITAGNR QIQAV EA +I PLV LLQNAEFDIKKEAAWA+SN
Sbjct  337  TQNHKKSIKKEACWTISNITAGNRDQIQAVCEAGLIAPLVNLLQNAEFDIKKEAAWAVSN  396

Query  664  ATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETGLNDGI  485
            ATSGGS +QI+++V+QG +KPLCDLLVCPDPRIITVCLEGLENILKVGEA+K TG     
Sbjct  397  ATSGGSADQIKYMVDQGVVKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKVTGNTGDA  456

Query  484  NLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDGNQQQA  305
            N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GDE      Q 
Sbjct  457  NYYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEEDETLPPGDE----SAQG  512

Query  304  FSFGENQPNVPPGGFKF  254
            F FG +    PPGGF F
Sbjct  513  FQFGGSDAAAPPGGFNF  529



>gb|KHG28859.1| Importin subunit alpha-1 [Gossypium arboreum]
Length=534

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 163/202 (81%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN  QIQAVI A I  PLV+LLQNAEF+IKKEAA
Sbjct  336  LLNLLTSNYKKSIKKEACWTISNITAGNVDQIQAVISAGIFAPLVHLLQNAEFEIKKEAA  395

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVG A+K  G
Sbjct  396  WAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKVGVAEKNLG  455

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    GD    
Sbjct  456  HTREVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEEEDEPLPPGDA---  512

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q  F FG NQ  VP GGF F
Sbjct  513  -SQSGFQFGGNQLPVPSGGFNF  533



>ref|XP_010094336.1| Importin subunit alpha-1 [Morus notabilis]
 gb|EXB55756.1| Importin subunit alpha-1 [Morus notabilis]
Length=529

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVIEA +I PLV LLQNAEFDIKKEAA
Sbjct  331  LLSLLTHNHKKSIKKEACWTISNITAGNREQIQAVIEAGLIGPLVNLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG++EQI++LV+Q CIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGTNEQIKYLVSQQCIKPLCDLLLCPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +NLYAQ+ID+ EG +K+E+LQ+HDN+EIYEK VKILE +W EE++E    GD    
Sbjct  451  NSGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYEKTVKILETYWLEEDDETLPPGD----  506

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q  F FG N   VP GGF F
Sbjct  507  GSQSGFRFGGNDLPVPSGGFNF  528



>gb|KJB24393.1| hypothetical protein B456_004G143100 [Gossypium raimondii]
Length=535

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 163/202 (81%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN  QIQAVI A I  PLV+LLQNAEF+IKKEAA
Sbjct  337  LLNLLTSNYKKSIKKEACWTISNITAGNVDQIQAVISAGIFAPLVHLLQNAEFEIKKEAA  396

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVG A+K  G
Sbjct  397  WAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKVGVAEKNLG  456

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    GD    
Sbjct  457  HTGEVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEEEDEPLPPGDA---  513

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q  F FG NQ  VP GGF F
Sbjct  514  -SQSGFQFGGNQLPVPSGGFNF  534



>ref|XP_012082851.1| PREDICTED: importin subunit alpha-like [Jatropha curcas]
 gb|KDP28222.1| hypothetical protein JCGZ_13993 [Jatropha curcas]
Length=535

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 167/204 (82%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN  QIQA+I+A II PLV LLQ AEF+IKKEAA
Sbjct  336  LLNLLTHNYKKSIKKEACWTISNITAGNVNQIQAIIDAGIIGPLVQLLQIAEFEIKKEAA  395

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI+FLV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  396  WAISNATSGGSHEQIKFLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  455

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEE-ENEQQNIGDEVD  323
             +   NLYAQLID+ EG +K+E+LQ+HDNH+IYEKAVKILE +W EE E+E    GD   
Sbjct  456  NSGETNLYAQLIDDAEGLEKIENLQSHDNHDIYEKAVKILETYWLEEDEDETLPSGDA--  513

Query  322  GNQQQAFSFGENQPNVPPGGFKFG  251
               Q  F FG N+  VP GGFKFG
Sbjct  514  --SQSGFHFGGNEVPVPSGGFKFG  535



>ref|XP_010558435.1| PREDICTED: importin subunit alpha-1-like [Tarenaya hassleriana]
Length=526

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 165/203 (81%), Gaps = 7/203 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT+N KKSIKKEACWTISNITAGN+ QIQAVI+A ++ PLV LLQNAEFDIKKEAA
Sbjct  331  LANLLTENSKKSIKKEACWTISNITAGNKEQIQAVIQAGLVAPLVNLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LV QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGE +K +G
Sbjct  391  WAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGETEKNSG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N Y QLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE +    GD    
Sbjct  451  ---RVNYYTQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEEEEDTVPPGD----  503

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG NQ ++P GGF FG
Sbjct  504  GSQPGFEFGGNQVHIPSGGFNFG  526



>gb|AAM96997.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15476.1| unknown protein [Arabidopsis thaliana]
Length=314

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = -1

Query  844  TQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAAWAISN  665
            T NHKKSIKKEACWTISNITAGNR QIQAV EA +I PLV LLQNAEFDIKKEAAWAISN
Sbjct  120  THNHKKSIKKEACWTISNITAGNRDQIQAVCEAGLICPLVNLLQNAEFDIKKEAAWAISN  179

Query  664  ATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETGLNDGI  485
            ATSGGS +QI+++V QG +KPLCDLLVCPDPRIITVCLEGLENILKVGEA+K TG    +
Sbjct  180  ATSGGSPDQIKYMVEQGVVKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKVTGNTGDV  239

Query  484  NLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDGNQQQA  305
            N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD       Q 
Sbjct  240  NFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEEDETLPPGDP----SAQG  295

Query  304  FSF-GENQPNVPPGGFKF  254
            F F G N   VPPGGF F
Sbjct  296  FQFGGGNDAAVPPGGFNF  313



>emb|CAA74965.1| Importin alpha-like protein [Arabidopsis thaliana]
Length=535

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 162/203 (80%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAV EA +I PLV LLQNAEFDIKKEAA
Sbjct  336  LLGLLTHNHKKSIKKEACWTISNITAGNRDQIQAVCEAGLICPLVNLLQNAEFDIKKEAA  395

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS +QI+++V QG +KPLCDLLVCPDPRIITVCLEGLENILKVGEA+K TG
Sbjct  396  WAISNATSGGSPDQIKYMVEQGVVKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKVTG  455

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD    
Sbjct  456  NTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEEDETLPPGDP---  512

Query  319  NQQQAFSF-GENQPNVPPGGFKF  254
               Q F F G N   VPPGGF F
Sbjct  513  -SAQGFQFGGGNDAAVPPGGFNF  534



>ref|XP_010489893.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
Length=544

 Score =   290 bits (742),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 170/209 (81%), Gaps = 9/209 (4%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKE--  686
            LY LLTQNHKKSIKKEACWTISNITAGN+ QI+ VIE   +   V LL +A  D++++  
Sbjct  339  LYNLLTQNHKKSIKKEACWTISNITAGNKVQIEVVIEQGAVPIFVQLLSSASDDVREQDT  398

Query  685  --AAWAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAD  512
              +    SNATSGGSHEQI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKV EAD
Sbjct  399  CLSYLVXSNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVSEAD  458

Query  511  KETGLNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQ--QNI  338
            KE GLNDG+NLYA +I+E +G DK+E+LQ+HDN+EIYEKAVKILE++W+E+E EQ  Q+ 
Sbjct  459  KEMGLNDGVNLYAHIIEESDGLDKIENLQSHDNNEIYEKAVKILERYWAEDEEEQILQDG  518

Query  337  GDEVDGNQQQAFSFGENQPNVPPGGFKFG  251
            G+E   N QQ F+FG NQP  PPGGFKFG
Sbjct  519  GNE---NSQQTFNFGTNQPAAPPGGFKFG  544



>gb|KJB49857.1| hypothetical protein B456_008G142000 [Gossypium raimondii]
 gb|KJB49858.1| hypothetical protein B456_008G142000 [Gossypium raimondii]
Length=534

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 164/202 (81%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT  +KKSIKKEACWTISNITAGN  QIQAVI+A II PLV+LLQNAEF+IKKEAA
Sbjct  336  LLNLLTNTYKKSIKKEACWTISNITAGNVDQIQAVIKAGIIAPLVHLLQNAEFEIKKEAA  395

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  396  WAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKVGEAEKNLG  455

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W E+E+E    GD    
Sbjct  456  HTGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEDEDEPLPPGDAA--  513

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q    FG NQ  VP GGF F
Sbjct  514  --QSGLQFGGNQLPVPSGGFNF  533



>ref|XP_002274422.1| PREDICTED: importin subunit alpha [Vitis vinifera]
 emb|CAN75951.1| hypothetical protein VITISV_028605 [Vitis vinifera]
 emb|CBI36918.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 166/204 (81%), Gaps = 6/204 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL+ N+KKSIKKEACWTISNITAGN+ QIQ+VIEA II PL+YLLQNAEF+IKKEAA
Sbjct  331  LLNLLSHNYKKSIKKEACWTISNITAGNKDQIQSVIEAGIIPPLIYLLQNAEFEIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI+ LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  391  WAISNATSGGTHDQIKLLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKSLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              D +N +AQ ID+ +G +K+E+LQ+HDN EIYEKAVKILE +W EE+ E    GD    
Sbjct  451  HTD-VNQFAQAIDDADGLEKIENLQSHDNTEIYEKAVKILETYWLEEDEEPLPPGDA---  506

Query  319  NQQQAFSFGEN-QPNVPPGGFKFG  251
              Q  F FG N  P VPPGGF FG
Sbjct  507  -SQSEFHFGGNDHPPVPPGGFNFG  529



>ref|XP_003594812.1| Importin subunit alpha-1 [Medicago truncatula]
Length=561

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 168/216 (78%), Gaps = 17/216 (8%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQ-------------AVIEANIILPLVYL  719
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQ             AVIEA +I PLV L
Sbjct  350  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQVTCKSHVYNNSIDAVIEAGLIAPLVNL  409

Query  718  LQNAEFDIKKEAAWAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLE  539
            LQNAEFDIKKEAAWA+SNATSGG+HEQI++LV+QGCIKPLCDLLVCPDPRI+TVCLEGLE
Sbjct  410  LQNAEFDIKKEAAWALSNATSGGTHEQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLE  469

Query  538  NILKVGEADKETGLNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEE  359
            NILK+GEA+K  G    +NLYAQ+IDE EG +K+E+LQ+HDN+EIYEKAVKILE +W E+
Sbjct  470  NILKIGEAEKSFGNAGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLED  529

Query  358  ENEQQNIGDEVDGNQQQAFSFGENQPNVPPGGFKFG  251
            E+E    GD      Q  F+FG N   VP GGF FG
Sbjct  530  EDETLPPGD----GSQPGFNFGGNDLPVPSGGFNFG  561



>emb|CDP17235.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   289 bits (739),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 167/202 (83%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL  N+KKSIKKEACWTISNITAGNR QIQAVIE+ I+ PL+ LLQN EF+IKKEAA
Sbjct  330  LLNLLAGNYKKSIKKEACWTISNITAGNRDQIQAVIESGIMSPLIDLLQNGEFEIKKEAA  389

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV+Q CIKPLCDLLVCPDPRI++VCLEGLENILKVGEA+K  G
Sbjct  390  WAISNATSGGSHEQIKYLVSQACIKPLCDLLVCPDPRIVSVCLEGLENILKVGEAEKNLG  449

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
            +   +NLYAQ+ID+ EG +K+E+LQ+HDN++IYEKAVKILE +W EE+++    GD    
Sbjct  450  ITGDVNLYAQMIDDAEGLEKIENLQSHDNNDIYEKAVKILETYWLEEDDDTMPPGDA---  506

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              QQ+F  G +Q +VP GGF F
Sbjct  507  -SQQSFQLGGSQISVPSGGFNF  527



>ref|XP_009146474.1| PREDICTED: importin subunit alpha-1-like [Brassica rapa]
 emb|CDY32215.1| BnaA01g17690D [Brassica napus]
Length=530

 Score =   289 bits (739),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 160/197 (81%), Gaps = 4/197 (2%)
 Frame = -1

Query  844  TQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAAWAISN  665
            TQNHKKSIKKEACWTISNITAGNR QIQAV EA +I PL+ LLQNAEFDIKKEAAWA+SN
Sbjct  337  TQNHKKSIKKEACWTISNITAGNRDQIQAVCEAGLIGPLINLLQNAEFDIKKEAAWAVSN  396

Query  664  ATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETGLNDGI  485
            ATSGGS +QI+++V+QG +KPLCDLLVCPDPRIITVCLEGLENILKVGEA+K TG     
Sbjct  397  ATSGGSADQIKYMVDQGVVKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKVTGNTGDA  456

Query  484  NLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDGNQQQA  305
            N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GDE      Q 
Sbjct  457  NYYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEEDETLPPGDE----SAQG  512

Query  304  FSFGENQPNVPPGGFKF  254
            F FG +    PPGGF F
Sbjct  513  FQFGGSDAAAPPGGFNF  529



>ref|XP_001760522.1| predicted protein [Physcomitrella patens]
 gb|EDQ74597.1| predicted protein [Physcomitrella patens]
Length=532

 Score =   289 bits (739),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 164/204 (80%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QI AVI+ANII PLV LL  AEFDIKKEAA
Sbjct  333  LLALLTNNHKKSIKKEACWTISNITAGNKDQIMAVIDANIIPPLVSLLATAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS EQI++LV QGCIKPLCDLL CPDPRI+TV LEGLENILKVGE +K+ G
Sbjct  393  WAISNATSGGSPEQIKYLVTQGCIKPLCDLLTCPDPRIVTVSLEGLENILKVGEQEKDLG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             + GINLYA+ IDE EG +K+E+LQTHDN+EIYEKAVKILE +W EE+ E QN      G
Sbjct  453  NSGGINLYARYIDEAEGLEKIENLQTHDNNEIYEKAVKILETYWLEED-EDQNFA---PG  508

Query  319  NQQQAFSFGENQ-PNVPPGGFKFG  251
             + Q F+FG +     PPGGF FG
Sbjct  509  TEGQGFAFGTSSAAGAPPGGFNFG  532



>gb|AIU34461.1| putative importin subunit alpha-2, partial [Taraxacum brevicorniculatum]
Length=531

 Score =   289 bits (739),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 165/202 (82%), Gaps = 3/202 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI A +I PLV LLQ AEFDIKKEAA
Sbjct  333  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIIAGLISPLVNLLQTAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG++EQI++LV QGCIKPLCDLL CPDPRI+TVCLEGLENILKVGE +K +G
Sbjct  393  WAISNATSGGNNEQIKYLVAQGCIKPLCDLLACPDPRIVTVCLEGLENILKVGEIEKNSG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +N YAQLIDE EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E   +GD   G
Sbjct  453  QSGDVNFYAQLIDEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDEA--VGDAA-G  509

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              Q  F+FG N   +P GGF F
Sbjct  510  QGQPGFNFGGNNVQLPSGGFNF  531



>emb|CDY22779.1| BnaA08g06090D [Brassica napus]
Length=534

 Score =   289 bits (739),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 159/197 (81%), Gaps = 4/197 (2%)
 Frame = -1

Query  844  TQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAAWAISN  665
            T NHKKSIKKEACWTISNITAGNR QIQAV EA +I PLV LLQNAEFDIKKEAAWA+SN
Sbjct  341  THNHKKSIKKEACWTISNITAGNRDQIQAVCEAGLIFPLVNLLQNAEFDIKKEAAWAVSN  400

Query  664  ATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETGLNDGI  485
            ATSGGS +QI+++V+QG +KPLCDLL+CPDPRIITVCLEGLENILKVGEA+K TG    +
Sbjct  401  ATSGGSPDQIKYMVDQGVVKPLCDLLICPDPRIITVCLEGLENILKVGEAEKLTGNTGDV  460

Query  484  NLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDGNQQQA  305
            N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD       Q 
Sbjct  461  NFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEEDETLPPGDV----SAQG  516

Query  304  FSFGENQPNVPPGGFKF  254
            F FG N    PPGGF F
Sbjct  517  FQFGGNDAAAPPGGFNF  533



>ref|XP_009107883.1| PREDICTED: importin subunit alpha-1-like [Brassica rapa]
Length=534

 Score =   288 bits (738),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 159/197 (81%), Gaps = 4/197 (2%)
 Frame = -1

Query  844  TQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAAWAISN  665
            T NHKKSIKKEACWTISNITAGNR QIQAV EA +I PLV LLQNAEFDIKKEAAWA+SN
Sbjct  341  THNHKKSIKKEACWTISNITAGNRDQIQAVCEAGLIFPLVNLLQNAEFDIKKEAAWAVSN  400

Query  664  ATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETGLNDGI  485
            ATSGGS +QI+++V+QG +KPLCDLL+CPDPRIITVCLEGLENILKVGEA+K TG    +
Sbjct  401  ATSGGSPDQIKYMVDQGVVKPLCDLLICPDPRIITVCLEGLENILKVGEAEKLTGNTGDV  460

Query  484  NLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDGNQQQA  305
            N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD       Q 
Sbjct  461  NFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEEDETLPPGDV----SAQG  516

Query  304  FSFGENQPNVPPGGFKF  254
            F FG N    PPGGF F
Sbjct  517  FQFGGNDAAAPPGGFNF  533



>gb|EMT29219.1| Importin subunit alpha-1b [Aegilops tauschii]
Length=537

 Score =   288 bits (738),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 164/196 (84%), Gaps = 5/196 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVI+ANII PLV+LLQ AEFDIKKEAA
Sbjct  195  LLNLLTTNHKKSIKKEACWTISNITAGNRDQIQAVIQANIIGPLVHLLQGAEFDIKKEAA  254

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI++LV QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  255  WAISNATSGGTHDQIKYLVAQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  314

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              D +N YAQ+ID+ EG +K+E+LQ+HDN EIYEKAVK+LE +W EEE+E    GD    
Sbjct  315  AGD-VNNYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKMLESYWLEEEDEVMPSGD----  369

Query  319  NQQQAFSFGENQPNVP  272
            N Q  F+FG  Q +VP
Sbjct  370  NAQNGFNFGSQQNSVP  385



>ref|XP_006414387.1| hypothetical protein EUTSA_v10024884mg [Eutrema salsugineum]
 gb|ESQ55840.1| hypothetical protein EUTSA_v10024884mg [Eutrema salsugineum]
Length=534

 Score =   288 bits (738),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 158/197 (80%), Gaps = 4/197 (2%)
 Frame = -1

Query  844  TQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAAWAISN  665
            T NHKKSIKKEACWTISNITAGNR QIQAV EA +I PLV LLQNAEFDIKKEAAWAISN
Sbjct  341  THNHKKSIKKEACWTISNITAGNRDQIQAVCEAGLICPLVNLLQNAEFDIKKEAAWAISN  400

Query  664  ATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETGLNDGI  485
            ATSGGS +QI+++V QG +KPLCDLL+CPDPRIITVCLEGLENILKVGEA+K TG    +
Sbjct  401  ATSGGSPDQIKYMVEQGVVKPLCDLLICPDPRIITVCLEGLENILKVGEAEKVTGNTGDV  460

Query  484  NLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDGNQQQA  305
            N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD       Q 
Sbjct  461  NFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEEDEALPPGD----GSAQG  516

Query  304  FSFGENQPNVPPGGFKF  254
            F FG N    PPGGF F
Sbjct  517  FQFGGNDAAAPPGGFNF  533



>ref|XP_007154341.1| hypothetical protein PHAVU_003G110500g [Phaseolus vulgaris]
 gb|ESW26335.1| hypothetical protein PHAVU_003G110500g [Phaseolus vulgaris]
Length=529

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 165/203 (81%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL  NHKKSIKKEACWTISNITAGN+ QIQ+VIEA ++ PLV LLQNAEFDIKKEAA
Sbjct  332  LLNLLNHNHKKSIKKEACWTISNITAGNKEQIQSVIEAGLVAPLVNLLQNAEFDIKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WA+SNATSGG+H+QI++LV QGCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  392  WAVSNATSGGTHDQIKYLVAQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKSLG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQ+ID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W E+E+E    G+    
Sbjct  452  NTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEDEDETLPSGE----  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG   P VP GGF F 
Sbjct  508  GAQPDFAFGSELP-VPSGGFNFS  529



>emb|CDY09716.1| BnaC07g33450D [Brassica napus]
Length=535

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 158/197 (80%), Gaps = 4/197 (2%)
 Frame = -1

Query  844  TQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAAWAISN  665
            T NHKKSIKKEACWTISNITAGNR QIQAV EA +I PLV LLQNAEFDIKKEAAWA+SN
Sbjct  342  THNHKKSIKKEACWTISNITAGNREQIQAVCEAGVICPLVNLLQNAEFDIKKEAAWAVSN  401

Query  664  ATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETGLNDGI  485
            ATSGGS +QI+++V QG +KPLCDLL+CPDPRIITVCLEGLENILKVGEA+K TG    +
Sbjct  402  ATSGGSPDQIKYMVEQGVVKPLCDLLICPDPRIITVCLEGLENILKVGEAEKVTGNTGDV  461

Query  484  NLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDGNQQQA  305
            N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD       Q 
Sbjct  462  NFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEEDETLPHGD----GSAQG  517

Query  304  FSFGENQPNVPPGGFKF  254
            F FG N    PPGGF F
Sbjct  518  FQFGGNDAAAPPGGFNF  534



>ref|XP_010434881.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
 ref|XP_010440203.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
 ref|XP_010449846.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
Length=534

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 158/197 (80%), Gaps = 4/197 (2%)
 Frame = -1

Query  844  TQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAAWAISN  665
            T NHKKSIKKEACWTISNITAGNR QIQAV EA +I PLV LLQNAEFDIKKEAAWA+SN
Sbjct  341  THNHKKSIKKEACWTISNITAGNRDQIQAVCEAGLICPLVNLLQNAEFDIKKEAAWAVSN  400

Query  664  ATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETGLNDGI  485
            ATSGGS +QI+++V QG +KPLCDLLVCPDPRIITVCLEGLENILKVGEA+K TG    +
Sbjct  401  ATSGGSPDQIKYMVEQGVVKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKVTGNTGDV  460

Query  484  NLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDGNQQQA  305
            N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD       Q 
Sbjct  461  NFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEEDETLPPGDAA----AQG  516

Query  304  FSFGENQPNVPPGGFKF  254
            F FG     +PPGGF F
Sbjct  517  FQFGGTDAAIPPGGFNF  533



>ref|XP_009136744.1| PREDICTED: importin subunit alpha-1 [Brassica rapa]
 emb|CDX90544.1| BnaA03g42370D [Brassica napus]
Length=540

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 158/197 (80%), Gaps = 4/197 (2%)
 Frame = -1

Query  844  TQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAAWAISN  665
            T NHKKSIKKEACWTISNITAGNR QIQAV EA +I PLV LLQNAEFDIKKEAAWA+SN
Sbjct  347  THNHKKSIKKEACWTISNITAGNRDQIQAVCEAGVICPLVNLLQNAEFDIKKEAAWAVSN  406

Query  664  ATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETGLNDGI  485
            ATSGGS +QI+++V QG +KPLCDLL+CPDPRIITVCLEGLENILKVGEA+K TG    +
Sbjct  407  ATSGGSPDQIKYMVEQGVVKPLCDLLICPDPRIITVCLEGLENILKVGEAEKVTGNTGDV  466

Query  484  NLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDGNQQQA  305
            N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD       Q 
Sbjct  467  NFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEEDETLPHGD----GSAQG  522

Query  304  FSFGENQPNVPPGGFKF  254
            F FG N    PPGGF F
Sbjct  523  FQFGGNDAAAPPGGFNF  539



>emb|CDY52043.1| BnaC08g48070D [Brassica napus]
Length=534

 Score =   287 bits (735),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 159/197 (81%), Gaps = 4/197 (2%)
 Frame = -1

Query  844  TQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAAWAISN  665
            T NHKKSIKKEACWTISNITAGN+ QIQAV EA +I PLV LLQNAEFDIKKEAAWA+SN
Sbjct  341  THNHKKSIKKEACWTISNITAGNKDQIQAVCEAGLIFPLVNLLQNAEFDIKKEAAWAVSN  400

Query  664  ATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETGLNDGI  485
            ATSGGS +QI+++V+QG +KPLCDLL+CPDPRIITVCLEGLENILKVGEA+K TG    +
Sbjct  401  ATSGGSPDQIKYMVDQGVVKPLCDLLICPDPRIITVCLEGLENILKVGEAEKLTGNTGDV  460

Query  484  NLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDGNQQQA  305
            N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD       Q 
Sbjct  461  NFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEEDETLPPGDV----SAQG  516

Query  304  FSFGENQPNVPPGGFKF  254
            F FG N    PPGGF F
Sbjct  517  FQFGGNDAAAPPGGFNF  533



>gb|AHJ25927.1| importin subunit alpha-1 [Senecio scandens]
Length=529

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 167/203 (82%), Gaps = 4/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWT+SNITAGNR QIQ+V+EA I+ PLV LLQ+AEF+IKKEAA
Sbjct  331  LLSLLTQNYKKSIKKEACWTVSNITAGNRDQIQSVVEAGIVSPLVALLQSAEFEIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+ +QI+FLV +GCIKPLCDLLV PDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGTSDQIKFLVREGCIKPLCDLLVSPDPRIVTVCLEGLENILKVGEAEKNLG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +N++AQ+ID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+EQ    D    
Sbjct  451  NTGDVNVFAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDEQLVSSD----  506

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F+FG  +  VP GGFKFG
Sbjct  507  GPQAGFNFGGGELPVPSGGFKFG  529



>ref|XP_009369966.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=528

 Score =   286 bits (733),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 164/203 (81%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQ+VIEA +I PLV LLQ+AEFDIKKEAA
Sbjct  331  LLSLLTHNHKKSIKKEACWTISNITAGNRDQIQSVIEAGLIGPLVNLLQHAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+ +QI++LV +GCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGTPDQIKYLVGEGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKAVG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N  +NLYAQL+D+ EG +K+E+LQ+HDN EIYEK+VKILE +W EE+ E    GD    
Sbjct  451  -NSEVNLYAQLVDDAEGLEKIENLQSHDNTEIYEKSVKILETYWLEEDEETLPAGD----  505

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG ++  VP GGF F 
Sbjct  506  GTQPGFRFGGSEVQVPSGGFNFS  528



>ref|XP_007031098.1| Importin alpha, alpha,aimp alpha,impa-1,impa1 isoform 1 [Theobroma 
cacao]
 gb|EOY11600.1| Importin alpha, alpha,aimp alpha,impa-1,impa1 isoform 1 [Theobroma 
cacao]
Length=599

 Score =   288 bits (738),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 160/192 (83%), Gaps = 4/192 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N KKSIKKEACWTISNITAGN+ QIQAVIEANII PLV+LLQNAEFDIKKEAA
Sbjct  331  LLNLLTNNFKKSIKKEACWTISNITAGNKEQIQAVIEANIIAPLVHLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+H+QI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVGEADK  G
Sbjct  391  WAISNATSGGTHDQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKVGEADKNQG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
               G+NLYAQ+ID+ EG +K+E+LQ+HDN EIYEKAVK+LE +W EEE+E    GD    
Sbjct  451  NTGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYEKAVKVLETYWLEEEDETMPPGDA---  507

Query  319  NQQQAFSFGENQ  284
              Q  F FG  +
Sbjct  508  -SQTGFQFGPGE  518



>gb|AAK32824.1|AF361811_1 AT3g06720/F3E22_14 [Arabidopsis thaliana]
 gb|AAL31160.1| AT3g06720/F3E22_14 [Arabidopsis thaliana]
Length=535

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = -1

Query  844  TQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAAWAISN  665
            T NHKKSIKKEACWTISNITAGNR QIQAV EA +I PLV LLQNAEFDIKKEAAWAISN
Sbjct  341  THNHKKSIKKEACWTISNITAGNRDQIQAVCEAGLICPLVNLLQNAEFDIKKEAAWAISN  400

Query  664  ATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETGLNDGI  485
            ATSGGS +QI+++V QG +KPLCDLLVCPDPRIITVCLEGLENILKVGEA+K TG    +
Sbjct  401  ATSGGSPDQIKYMVEQGVVKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKVTGNTGDV  460

Query  484  NLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDGNQQQA  305
            N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD       Q 
Sbjct  461  NFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEEDETLPPGDP----SAQG  516

Query  304  FSF-GENQPNVPPGGFKF  254
            F F G N   VPPGGF F
Sbjct  517  FQFGGGNDAAVPPGGFNF  534



>gb|KJB28705.1| hypothetical protein B456_005G065400 [Gossypium raimondii]
Length=528

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 162/202 (80%), Gaps = 5/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVI A II PLV LLQNAEFDIKKEAA
Sbjct  331  LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVINAGIIGPLVSLLQNAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV++GCIKPLCDLL CPDPRIITVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGTHEQIKYLVSEGCIKPLCDLLACPDPRIITVCLEGLENILKVGEAEKAAG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              +  N  AQLI++ EG +K+E+LQ+HDN+EIYEKAVKILE +W EE+ E    GD    
Sbjct  451  AGE-FNYCAQLIEDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEDEETLPPGD----  505

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              QQ F FG N   VP GGF F
Sbjct  506  GTQQNFHFGGNDVKVPTGGFNF  527



>ref|NP_001154239.1| importin alpha isoform 2 [Arabidopsis thaliana]
 ref|NP_567485.4| importin alpha isoform 2 [Arabidopsis thaliana]
 sp|F4JL11.1|IMPA2_ARATH RecName: Full=Importin subunit alpha-2; Short=IMPa-2 [Arabidopsis 
thaliana]
 gb|AEE83699.1| importin alpha isoform 2 [Arabidopsis thaliana]
 gb|AEE83700.1| importin alpha isoform 2 [Arabidopsis thaliana]
Length=535

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 159/198 (80%), Gaps = 5/198 (3%)
 Frame = -1

Query  844  TQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAAWAISN  665
            T NHKKSIKKEACWTISNITAGNR QIQAV EA +I PLV LLQNAEFDIKKEAAWAISN
Sbjct  341  THNHKKSIKKEACWTISNITAGNRDQIQAVCEAGLICPLVNLLQNAEFDIKKEAAWAISN  400

Query  664  ATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETGLNDGI  485
            ATSGGS +QI+++V QG +KPLCDLLVCPDPRIITVCLEGLENILKVGEA+K TG    +
Sbjct  401  ATSGGSPDQIKYMVEQGVVKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKVTGNTGDV  460

Query  484  NLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDGNQQQA  305
            N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E    GD       Q 
Sbjct  461  NFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEEDETLPPGDP----SAQG  516

Query  304  FSF-GENQPNVPPGGFKF  254
            F F G N   VPPGGF F
Sbjct  517  FQFGGGNDAAVPPGGFNF  534



>gb|KDO71825.1| hypothetical protein CISIN_1g009544mg [Citrus sinensis]
Length=454

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 163/203 (80%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT +HKKSIKKEACWTISNITAGNR QIQAVI+A ++ PLV LLQNAEFDIKKEAA
Sbjct  255  LLGLLTHSHKKSIKKEACWTISNITAGNRDQIQAVIDAGLVGPLVNLLQNAEFDIKKEAA  314

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV +GCIKPLCDL VCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  315  WAISNATSGGTHEQIKYLVREGCIKPLCDLFVCPDPRIVTVCLEGLENILKVGEAEKNMG  374

Query  499  LNDG-INLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVD  323
                 +N YAQL++E EG +K+E+LQ+HDN+EIYEKAVKILE +W EE++E    GD   
Sbjct  375  TATADVNQYAQLVEEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEDDETIAAGD---  431

Query  322  GNQQQAFSFGENQPNVPPGGFKF  254
               Q  F +  N+  VP GGF F
Sbjct  432  -GPQPGFPYAGNEVQVPSGGFNF  453



>ref|XP_008360251.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Malus domestica]
Length=528

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 163/203 (80%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQ+ IEA +I PLV LLQ+AEFDIKKEAA
Sbjct  331  LLSLLTHNHKKSIKKEACWTISNITAGNRDQIQSXIEAGLIGPLVNLLQHAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+ +QI++LV +GCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGTPDQIKYLVGEGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKAAG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N  +NLYAQL+D+ EG +K+E+LQ+HDN EIYEK+VKILE +W EE+ E    GD    
Sbjct  451  -NSEVNLYAQLVDDAEGLEKIENLQSHDNTEIYEKSVKILETYWLEEDEETLPAGD----  505

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q  F FG ++  VP GGF F 
Sbjct  506  GSQPGFRFGGSEVQVPSGGFNFS  528



>ref|XP_006285325.1| hypothetical protein CARUB_v10006712mg [Capsella rubella]
 gb|EOA18223.1| hypothetical protein CARUB_v10006712mg [Capsella rubella]
Length=533

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 157/197 (80%), Gaps = 5/197 (3%)
 Frame = -1

Query  844  TQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAAWAISN  665
            T NHKKSIKKEACWTISNITAGNR QIQAV EA +I PLV LLQNAEFDIKKEAAWA+SN
Sbjct  341  THNHKKSIKKEACWTISNITAGNRDQIQAVCEAGLICPLVNLLQNAEFDIKKEAAWAVSN  400

Query  664  ATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETGLNDGI  485
            ATSGGS +QI+++V QG +KPLCDLLVCPDPRIITVCLEGLENILKVGEA+K TG    +
Sbjct  401  ATSGGSPDQIKYMVEQGVVKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKVTGNTGDV  460

Query  484  NLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDGNQQQA  305
            N YAQLID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EEE+E         G   Q 
Sbjct  461  NFYAQLIDDAEGLEKIENLQSHDNSEIYEKAVKILETYWLEEEDETLP-----PGASAQG  515

Query  304  FSFGENQPNVPPGGFKF  254
            F FG     +PPGGF F
Sbjct  516  FQFGGTDGAIPPGGFNF  532



>ref|XP_009347771.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009347772.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=528

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 163/203 (80%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQ+VIEA +I PLV LLQ+AEFDIKKEAA
Sbjct  331  LLSLLTHNHKKSIKKEACWTISNITAGNRDQIQSVIEAGLIGPLVNLLQHAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+ +QI++LV +GCIKPLCDLLVCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  391  WAISNATSGGTPDQIKYLVGEGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKAAG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N  +NLYAQL+D+ EG +K+E+LQ+HDN EIYEK+VKILE +W EE+ E    GD    
Sbjct  451  -NSEVNLYAQLVDDAEGLEKIENLQSHDNTEIYEKSVKILETYWLEEDEETLPAGD----  505

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              Q    FG ++  VP GGF F 
Sbjct  506  GTQPGLRFGGSEVQVPSGGFNFS  528



>ref|XP_010551087.1| PREDICTED: importin subunit alpha-1-like [Tarenaya hassleriana]
 ref|XP_010551088.1| PREDICTED: importin subunit alpha-1-like [Tarenaya hassleriana]
Length=534

 Score =   284 bits (726),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 165/202 (82%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQAVIEA +I PLV LLQ AEFDIKKEA+
Sbjct  336  LLSLLTHNHKKSIKKEACWTISNITAGNREQIQAVIEAGLIGPLVNLLQTAEFDIKKEAS  395

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WA+SNATSGGSHEQI++LV QGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEA+K  G
Sbjct  396  WAVSNATSGGSHEQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKTMG  455

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +N YAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    G+    
Sbjct  456  NSGDVNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDETVPPGE----  511

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
               Q F FG N+  +P GGF F
Sbjct  512  GSGQGFQFGGNEVPLPSGGFNF  533



>gb|KDO71823.1| hypothetical protein CISIN_1g009544mg [Citrus sinensis]
 gb|KDO71824.1| hypothetical protein CISIN_1g009544mg [Citrus sinensis]
Length=532

 Score =   283 bits (725),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 163/204 (80%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT +HKKSIKKEACWTISNITAGNR QIQAVI+A ++ PLV LLQNAEFDIKKEAA
Sbjct  333  LLGLLTHSHKKSIKKEACWTISNITAGNRDQIQAVIDAGLVGPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV +GCIKPLCDL VCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  393  WAISNATSGGTHEQIKYLVREGCIKPLCDLFVCPDPRIVTVCLEGLENILKVGEAEKNMG  452

Query  499  LNDG-INLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVD  323
                 +N YAQL++E EG +K+E+LQ+HDN+EIYEKAVKILE +W EE++E    GD   
Sbjct  453  TATADVNQYAQLVEEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEDDETIAAGD---  509

Query  322  GNQQQAFSFGENQPNVPPGGFKFG  251
               Q  F +  N+  VP GGF F 
Sbjct  510  -GPQPGFPYAGNEVQVPSGGFNFS  532



>ref|XP_006488879.1| PREDICTED: importin subunit alpha-1-like [Citrus sinensis]
Length=532

 Score =   283 bits (725),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 163/204 (80%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT +HKKSIKKEACWTISNITAGNR QIQAVI+A ++ PLV LLQNAEFDIKKEAA
Sbjct  333  LLGLLTHSHKKSIKKEACWTISNITAGNRDQIQAVIDAGLVGPLVNLLQNAEFDIKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV +GCIKPLCDL VCPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  393  WAISNATSGGTHEQIKYLVREGCIKPLCDLFVCPDPRIVTVCLEGLENILKVGEAEKNMG  452

Query  499  LNDG-INLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVD  323
                 +N YAQL++E EG +K+E+LQ+HDN+EIYEKAVKILE +W EE++E    GD   
Sbjct  453  TATADVNQYAQLVEEAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEDDETIAAGD---  509

Query  322  GNQQQAFSFGENQPNVPPGGFKFG  251
               Q  F +  N+  VP GGF F 
Sbjct  510  -GPQPGFPYAGNEVQVPSGGFNFS  532



>ref|XP_008340751.1| PREDICTED: importin subunit alpha-1 [Malus domestica]
Length=529

 Score =   283 bits (724),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 162/202 (80%), Gaps = 4/202 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGNR QIQ+VIEA +I PLV LLQ+AEFDIKKEAA
Sbjct  331  LLSLLTHNHKKSIKKEACWTISNITAGNRDQIQSVIEAGLIGPLVNLLQHAEFDIKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+ +QI++LV +GCIKPLCDLLVCPDPRI+TVCLEG ENILKVGEA+K  G
Sbjct  391  WAISNATSGGTADQIKYLVGEGCIKPLCDLLVCPDPRIVTVCLEGXENILKVGEAEKAAG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +  +NLYAQLID+ EG +K+E+LQ+HDN EIYEK+VKILE +W EE+ E    GD    
Sbjct  451  NSGEVNLYAQLIDDAEGLEKIENLQSHDNTEIYEKSVKILETYWLEEDEETLPAGD----  506

Query  319  NQQQAFSFGENQPNVPPGGFKF  254
              QQ   F  N+  VP GGF F
Sbjct  507  GTQQGIRFEGNEVQVPXGGFNF  528



>ref|XP_006378029.1| hypothetical protein POPTR_0010s00370g, partial [Populus trichocarpa]
 gb|ERP55826.1| hypothetical protein POPTR_0010s00370g, partial [Populus trichocarpa]
Length=285

 Score =   275 bits (704),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 157/191 (82%), Gaps = 4/191 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT NHKKSIKKEACWTISNITAGN+ QIQAVIE  +I PLV LLQNAEFDIKKEAA
Sbjct  35   LLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIENGLIGPLVNLLQNAEFDIKKEAA  94

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WA+SNATSGG+HEQI+FLV+QGCIKPLCDLLV PDPRI+TV LEGLENILKVGEA+K  G
Sbjct  95   WAVSNATSGGTHEQIKFLVSQGCIKPLCDLLVSPDPRIVTVSLEGLENILKVGEAEKNLG  154

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +   N YAQ+ID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EE++E    GD    
Sbjct  155  NSGDANFYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEDDETLPSGD----  210

Query  319  NQQQAFSFGEN  287
              QQ F FG N
Sbjct  211  GAQQGFQFGGN  221



>gb|KHG28860.1| Importin subunit alpha-1 [Gossypium arboreum]
Length=557

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 160/198 (81%), Gaps = 4/198 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN  QIQAVI A I  PLV+LLQNAEF+IKKEAA
Sbjct  336  LLNLLTSNYKKSIKKEACWTISNITAGNVDQIQAVISAGIFAPLVHLLQNAEFEIKKEAA  395

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILKVG A+K  G
Sbjct  396  WAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKVGVAEKNLG  455

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                +NLYAQLID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    GD    
Sbjct  456  HTREVNLYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEEEDEPLPPGDA---  512

Query  319  NQQQAFSFGENQPNVPPG  266
              Q  F FG NQ  VP G
Sbjct  513  -SQSGFQFGGNQLPVPSG  529



>ref|XP_004967840.1| PREDICTED: importin subunit alpha-1a-like [Setaria italica]
Length=523

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 162/201 (81%), Gaps = 7/201 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQNHKKSIKKEACWTISNITAGN+ QIQAVI A II PL+ LLQ AEFDIKKEAA
Sbjct  328  LLNLLTQNHKKSIKKEACWTISNITAGNKDQIQAVINAGIIAPLLQLLQTAEFDIKKEAA  387

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV++GCIKPLCDLLVCPDPRI+TVCLEGLENILKVGE DK  G
Sbjct  388  WAISNATSGGSHEQIKYLVSEGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGEHDKTAG  447

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENE-QQNIGDEVD  323
                IN++AQ+IDE EG +K+E+LQ+HDN+EIYEKAVK+LE +W EEE++    +G+   
Sbjct  448  ATGDINVFAQMIDEHEGLEKIENLQSHDNNEIYEKAVKLLEAYWMEEEDDAMATVGEAAP  507

Query  322  GNQQQAFSFGENQPNVPPGGF  260
                  F FG  Q   PP GF
Sbjct  508  A----VFDFG--QGGNPPAGF  522



>ref|XP_002515324.1| importin alpha, putative [Ricinus communis]
 gb|EEF47308.1| importin alpha, putative [Ricinus communis]
Length=454

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 165/204 (81%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN  QIQA+I+A++I PL+ LLQ AEF+IKKEAA
Sbjct  255  LLNLLTHNYKKSIKKEACWTISNITAGNVNQIQAIIDADLIGPLIQLLQIAEFEIKKEAA  314

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI++LV+QGCIKPLCDLL+CPDPRI+TVCLEGLENILKVGEA+K  G
Sbjct  315  WAISNATSGGTHEQIKYLVSQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEAEKNLG  374

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEE-ENEQQNIGDEVD  323
                 NLYAQ+IDE EG +K+E+LQ+HDN++IYEKAVKILE +W EE E+E     D   
Sbjct  375  NTGDANLYAQMIDEAEGLEKIENLQSHDNNDIYEKAVKILETYWLEEDEDEALAPADA--  432

Query  322  GNQQQAFSFGENQPNVPPGGFKFG  251
               Q  F FG N+   P GGFKFG
Sbjct  433  --SQSGFHFGGNEVPAPSGGFKFG  454



>gb|KDO87079.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
Length=431

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 162/204 (79%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAGN  QIQA+IEA II PLV LL NAEF+IKKEAA
Sbjct  232  LLDLLTQNYKKSIKKEACWTISNITAGNVNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAA  291

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS+EQI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILK GEA+K  G
Sbjct  292  WAISNATSGGSNEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKAGEAEKNMG  351

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEE-ENEQQNIGDEVD  323
               G+NL+AQ ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE E+E    GD   
Sbjct  352  NTGGVNLFAQAIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWVEEDEDEPLPPGDAT-  410

Query  322  GNQQQAFSFGENQPNVPPGGFKFG  251
               Q  F F  N   VP GGF FG
Sbjct  411  ---QAGFGFAGNGLPVPSGGFNFG  431



>gb|EMS47918.1| Importin subunit alpha-1a [Triticum urartu]
 gb|EMT16831.1| Importin subunit alpha-1a [Aegilops tauschii]
 emb|CDM82485.1| unnamed protein product [Triticum aestivum]
Length=524

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 161/190 (85%), Gaps = 2/190 (1%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQNHKKSIKKEACWT+SNITAGN+ QIQAVI A II PLV+LLQ AEFDIKKEAA
Sbjct  328  LLSLLTQNHKKSIKKEACWTVSNITAGNKDQIQAVITAGIIGPLVHLLQTAEFDIKKEAA  387

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI++LV++GCIKPLCDLL+CPDPRI+TVCLEGLENILKVGE DK  G
Sbjct  388  WAISNATSGGSHDQIKYLVSEGCIKPLCDLLLCPDPRIVTVCLEGLENILKVGETDKNLG  447

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             +   N+YAQ+IDE EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE++   +G  ++ 
Sbjct  448  ASGEGNVYAQMIDEAEGLEKIENLQSHDNNEIYEKAVKILEAYWMEEEDDA--MGATMEA  505

Query  319  NQQQAFSFGE  290
                AF FG+
Sbjct  506  PTGVAFDFGQ  515



>gb|AFW79686.1| importin alpha-1b subunit, mRNA [Zea mays]
Length=328

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 159/204 (78%), Gaps = 7/204 (3%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQNHKKSIKKEACWTISNITAGN+ QIQAVI A II PL+ LLQ AEFDIKKEAA
Sbjct  129  LLNLLTQNHKKSIKKEACWTISNITAGNKDQIQAVISAGIIAPLLQLLQTAEFDIKKEAA  188

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSHEQI++LV++GCIKPLCDLLVCPDPRI+TVCLEGLENILKVG+ DK  G
Sbjct  189  WAISNATSGGSHEQIKYLVSEGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGQHDKTMG  248

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
                 N+ AQ+IDE EG +K+E+LQ+HDN+EIYEKAVK+LE +W EEE++      E   
Sbjct  249  ATGDTNVLAQMIDEAEGLEKIENLQSHDNNEIYEKAVKLLETYWMEEEDDAMATAGEA--  306

Query  319  NQQQAFSFGENQPNVPP--GGFKF  254
                 F F  NQ   PP  GG  F
Sbjct  307  -APAVFDF--NQGGNPPAAGGLNF  327



>ref|XP_010024770.1| PREDICTED: importin subunit alpha-1 [Eucalyptus grandis]
 gb|KCW61262.1| hypothetical protein EUGRSUZ_H04025 [Eucalyptus grandis]
Length=523

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 167/203 (82%), Gaps = 8/203 (4%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LL  NHKKSIKKEACWTISN+TAGN  QIQAVIEA +I PL+ LLQNAEFDIKKEAA
Sbjct  327  LLSLLAHNHKKSIKKEACWTISNVTAGNSEQIQAVIEAGLIGPLLNLLQNAEFDIKKEAA  386

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGSH+QI+++V+QGCIKPLCDLLVCPDPRI+TVCLE LENILK+G+A+KE G
Sbjct  387  WAISNATSGGSHDQIKYIVSQGCIKPLCDLLVCPDPRIVTVCLEALENILKIGQAEKECG  446

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
             N G N+YA++ID+ EG +K+E+LQ+HDN+EIYEKAVKILE +W EEE+E    GD    
Sbjct  447  -NTGDNVYARMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWVEEEDEIVPPGD----  501

Query  319  NQQQAFSFGENQPNVPPG-GFKF  254
            N Q  F+FG N   +PP  GF F
Sbjct  502  NTQPGFNFGGN--GLPPSDGFNF  522



>ref|XP_006480039.1| PREDICTED: importin subunit alpha-like [Citrus sinensis]
 gb|KDO87073.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
 gb|KDO87074.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
Length=529

 Score =   281 bits (719),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 162/204 (79%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAGN  QIQA+IEA II PLV LL NAEF+IKKEAA
Sbjct  330  LLDLLTQNYKKSIKKEACWTISNITAGNVNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAA  389

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS+EQI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILK GEA+K  G
Sbjct  390  WAISNATSGGSNEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKAGEAEKNMG  449

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEE-ENEQQNIGDEVD  323
               G+NL+AQ ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE E+E    GD   
Sbjct  450  NTGGVNLFAQAIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWVEEDEDEPLPPGDAT-  508

Query  322  GNQQQAFSFGENQPNVPPGGFKFG  251
               Q  F F  N   VP GGF FG
Sbjct  509  ---QAGFGFAGNGLPVPSGGFNFG  529



>gb|KJB12655.1| hypothetical protein B456_002G029800 [Gossypium raimondii]
Length=529

 Score =   281 bits (718),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 161/203 (79%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQAVI A +I PLV LLQNAEFD+KKEAA
Sbjct  332  LMNLLTNNYKKSIKKEACWTISNITAGNKEQIQAVINAGLIGPLVNLLQNAEFDVKKEAA  391

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+++V+QGCIKPLCDLL CPDPRII VCLEGLEN LKVGEA+K TG
Sbjct  392  WAISNATSGGAHEQIKYMVSQGCIKPLCDLLACPDPRIIMVCLEGLENFLKVGEAEKATG  451

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              +  N  AQLI++ +G +K+E+LQTHDN EIYEKAVKILE +W EE+ E     D    
Sbjct  452  AVE-FNFCAQLIEDADGLEKIENLQTHDNSEIYEKAVKILETYWLEEDEETLPPAD----  506

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              QQ+F FGEN   VP GGF F 
Sbjct  507  GTQQSFQFGENGLQVPSGGFNFS  529



>gb|KJB12653.1| hypothetical protein B456_002G029800 [Gossypium raimondii]
 gb|KJB12654.1| hypothetical protein B456_002G029800 [Gossypium raimondii]
Length=528

 Score =   280 bits (717),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 161/203 (79%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQAVI A +I PLV LLQNAEFD+KKEAA
Sbjct  331  LMNLLTNNYKKSIKKEACWTISNITAGNKEQIQAVINAGLIGPLVNLLQNAEFDVKKEAA  390

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+++V+QGCIKPLCDLL CPDPRII VCLEGLEN LKVGEA+K TG
Sbjct  391  WAISNATSGGAHEQIKYMVSQGCIKPLCDLLACPDPRIIMVCLEGLENFLKVGEAEKATG  450

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              +  N  AQLI++ +G +K+E+LQTHDN EIYEKAVKILE +W EE+ E     D    
Sbjct  451  AVE-FNFCAQLIEDADGLEKIENLQTHDNSEIYEKAVKILETYWLEEDEETLPPAD----  505

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              QQ+F FGEN   VP GGF F 
Sbjct  506  GTQQSFQFGENGLQVPSGGFNFS  528



>gb|KHG26190.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
Length=530

 Score =   280 bits (717),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 161/203 (79%), Gaps = 5/203 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLT N+KKSIKKEACWTISNITAGN+ QIQAVI A +I PLV LLQNAEFD+KKEAA
Sbjct  333  LMNLLTNNYKKSIKKEACWTISNITAGNKEQIQAVINAGLIGPLVNLLQNAEFDVKKEAA  392

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGG+HEQI+++V+QGCIKPLCDLL CPDPRII VCLEGLEN LKVGEA+K TG
Sbjct  393  WAISNATSGGAHEQIKYMVSQGCIKPLCDLLACPDPRIIMVCLEGLENFLKVGEAEKATG  452

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEEENEQQNIGDEVDG  320
              +  N  AQLI++ +G +K+E+LQTHDN EIYEKAVKILE +W EE+ E     D    
Sbjct  453  AVE-FNFCAQLIEDADGLEKIENLQTHDNSEIYEKAVKILETYWLEEDEETLPPAD----  507

Query  319  NQQQAFSFGENQPNVPPGGFKFG  251
              QQ+F FGEN   VP GGF F 
Sbjct  508  GTQQSFQFGENGLQVPSGGFNFS  530



>gb|KDO87077.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
 gb|KDO87078.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
Length=488

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 162/204 (79%), Gaps = 5/204 (2%)
 Frame = -1

Query  859  LYQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVYLLQNAEFDIKKEAA  680
            L  LLTQN+KKSIKKEACWTISNITAGN  QIQA+IEA II PLV LL NAEF+IKKEAA
Sbjct  289  LLDLLTQNYKKSIKKEACWTISNITAGNVNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAA  348

Query  679  WAISNATSGGSHEQIRFLVNQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEADKETG  500
            WAISNATSGGS+EQI+FLV+QGCIKPLCDLL CPDPRI+TVCLEGLENILK GEA+K  G
Sbjct  349  WAISNATSGGSNEQIKFLVSQGCIKPLCDLLNCPDPRIVTVCLEGLENILKAGEAEKNMG  408

Query  499  LNDGINLYAQLIDECEGSDKLEHLQTHDNHEIYEKAVKILEKFWSEE-ENEQQNIGDEVD  323
               G+NL+AQ ID+ EG +K+E+LQ+HDN EIYEKAVKILE +W EE E+E    GD   
Sbjct  409  NTGGVNLFAQAIDDAEGLEKIENLQSHDNTEIYEKAVKILETYWVEEDEDEPLPPGDAT-  467

Query  322  GNQQQAFSFGENQPNVPPGGFKFG  251
               Q  F F  N   VP GGF FG
Sbjct  468  ---QAGFGFAGNGLPVPSGGFNFG  488



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1894952386554