BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9662

Length=939
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009758209.1|  PREDICTED: WD repeat-containing protein 26-l...    216   5e-86   Nicotiana sylvestris
ref|XP_009758206.1|  PREDICTED: WD repeat-containing protein 26-l...    216   5e-86   Nicotiana sylvestris
ref|XP_009631029.1|  PREDICTED: WD repeat-containing protein 26-l...    214   1e-85   Nicotiana tomentosiformis
ref|XP_009631025.1|  PREDICTED: WD repeat-containing protein 26-l...    214   1e-85   Nicotiana tomentosiformis
emb|CDP17860.1|  unnamed protein product                                219   2e-85   Coffea canephora [robusta coffee]
ref|XP_009618673.1|  PREDICTED: WD repeat-containing protein 26-like    213   8e-85   Nicotiana tomentosiformis
ref|XP_004239310.1|  PREDICTED: WD repeat-containing protein 26 i...    199   6e-81   Solanum lycopersicum
ref|XP_004239311.1|  PREDICTED: WD repeat-containing protein 26 i...    199   1e-80   Solanum lycopersicum
ref|XP_009608371.1|  PREDICTED: WD repeat-containing protein 26-l...    203   2e-79   Nicotiana tomentosiformis
ref|XP_009608368.1|  PREDICTED: WD repeat-containing protein 26-l...    202   3e-79   Nicotiana tomentosiformis
ref|XP_009780908.1|  PREDICTED: WD repeat-containing protein 26-like    204   1e-78   Nicotiana sylvestris
ref|XP_011100492.1|  PREDICTED: WD repeat-containing protein 26-l...    190   4e-78   Sesamum indicum [beniseed]
ref|XP_011100498.1|  PREDICTED: WD repeat-containing protein 26-l...    190   5e-78   Sesamum indicum [beniseed]
ref|XP_010321118.1|  PREDICTED: WD repeat-containing protein 26 i...    200   3e-76   Solanum lycopersicum
ref|XP_011085429.1|  PREDICTED: WD repeat-containing protein 26-like    194   4e-76   Sesamum indicum [beniseed]
gb|EYU42800.1|  hypothetical protein MIMGU_mgv1a003351mg                188   3e-73   Erythranthe guttata [common monkey flower]
ref|XP_003532075.1|  PREDICTED: WD repeat-containing protein 26-like    206   7e-73   Glycine max [soybeans]
gb|EYU42813.1|  hypothetical protein MIMGU_mgv1a003386mg                182   1e-71   Erythranthe guttata [common monkey flower]
gb|EYU42814.1|  hypothetical protein MIMGU_mgv1a003386mg                182   3e-71   Erythranthe guttata [common monkey flower]
ref|XP_006602271.1|  PREDICTED: WD repeat-containing protein 26-l...    201   7e-71   Glycine max [soybeans]
ref|XP_006602270.1|  PREDICTED: WD repeat-containing protein 26-l...    201   7e-71   Glycine max [soybeans]
gb|EPS60063.1|  hypothetical protein M569_14740                         183   2e-70   Genlisea aurea
ref|XP_004303899.1|  PREDICTED: WD repeat-containing protein 26         195   2e-69   Fragaria vesca subsp. vesca
ref|XP_006351997.1|  PREDICTED: WD repeat-containing protein 26-l...    177   6e-69   Solanum tuberosum [potatoes]
ref|XP_002513152.1|  WD-repeat protein, putative                        181   4e-67   Ricinus communis
ref|XP_007146281.1|  hypothetical protein PHAVU_006G027500g             189   5e-67   Phaseolus vulgaris [French bean]
ref|XP_008775985.1|  PREDICTED: WD repeat-containing protein 26-like    186   6e-67   Phoenix dactylifera
ref|XP_008790475.1|  PREDICTED: WD repeat-containing protein 26-like    177   7e-66   Phoenix dactylifera
ref|XP_004253388.2|  PREDICTED: WD repeat-containing protein 26-like    166   3e-65   Solanum lycopersicum
ref|XP_006399358.1|  hypothetical protein EUTSA_v10013060mg             172   6e-63   Eutrema salsugineum [saltwater cress]
ref|XP_010908947.1|  PREDICTED: uncharacterized WD repeat-contain...    171   3e-62   
ref|XP_006845990.1|  PREDICTED: WD repeat-containing protein 26         167   3e-62   Amborella trichopoda
ref|NP_196473.1|  WD40 domain-containing protein                        171   7e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003578602.1|  PREDICTED: WD repeat-containing protein 26         169   2e-61   Brachypodium distachyon [annual false brome]
ref|XP_009412042.1|  PREDICTED: WD repeat-containing protein 26-like    169   5e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010491500.1|  PREDICTED: WD repeat-containing protein 26-like    167   6e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006287344.1|  hypothetical protein CARUB_v10000543mg             166   6e-61   Capsella rubella
ref|XP_010423053.1|  PREDICTED: WD repeat-containing protein 26-like    166   9e-61   Camelina sativa [gold-of-pleasure]
dbj|BAK03563.1|  predicted protein                                      170   2e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT24581.1|  hypothetical protein F775_29927                         169   3e-60   
emb|CDY21550.1|  BnaC09g47420D                                          165   4e-60   Brassica napus [oilseed rape]
ref|XP_011032764.1|  PREDICTED: WD repeat-containing protein 26-like    154   6e-60   Populus euphratica
ref|XP_010456450.1|  PREDICTED: WD repeat-containing protein 26-like    163   8e-60   
ref|XP_009131082.1|  PREDICTED: WD repeat-containing protein 26-like    166   1e-59   Brassica rapa
ref|XP_008676635.1|  PREDICTED: hypothetical protein isoform X1         171   1e-59   Zea mays [maize]
emb|CDX78343.1|  BnaA03g02550D                                          166   1e-59   
ref|XP_009122471.1|  PREDICTED: WD repeat-containing protein 26         164   1e-59   Brassica rapa
ref|XP_009765608.1|  PREDICTED: WD repeat-containing protein 26-l...    209   4e-59   Nicotiana sylvestris
ref|XP_008676636.1|  PREDICTED: hypothetical protein isoform X2         170   5e-59   
ref|XP_010657105.1|  PREDICTED: WD repeat-containing protein 26-like    210   5e-59   
gb|KDO44760.1|  hypothetical protein CISIN_1g009188mg                   209   5e-59   Citrus sinensis [apfelsine]
emb|CBI22069.3|  unnamed protein product                                207   5e-59   Vitis vinifera
ref|XP_006484997.1|  PREDICTED: WD repeat-containing protein 26-l...    210   6e-59   Citrus sinensis [apfelsine]
ref|XP_009765607.1|  PREDICTED: WD repeat-containing protein 26-l...    210   6e-59   Nicotiana sylvestris
ref|XP_006437085.1|  hypothetical protein CICLE_v10031058mg             209   6e-59   
ref|XP_008647995.1|  PREDICTED: uncharacterized protein LOC100304...    168   9e-59   
ref|NP_001132804.1|  hypothetical protein                               169   1e-58   
emb|CDX81113.1|  BnaC03g03670D                                          163   1e-58   
gb|EMT06242.1|  hypothetical protein F775_31507                         157   2e-58   
ref|XP_006354306.1|  PREDICTED: WD repeat-containing protein 26-like    206   2e-57   Solanum tuberosum [potatoes]
gb|EMS67128.1|  WD repeat-containing protein 26                         155   2e-57   Triticum urartu
ref|XP_004149517.1|  PREDICTED: WD repeat-containing protein 26         203   2e-56   Cucumis sativus [cucumbers]
ref|XP_012081590.1|  PREDICTED: WD repeat-containing protein 26-like    203   2e-56   Jatropha curcas
ref|XP_008342331.1|  PREDICTED: WD repeat-containing protein 26-like    202   3e-56   Malus domestica [apple tree]
ref|XP_002306758.1|  hypothetical protein POPTR_0005s22820g             202   3e-56   Populus trichocarpa [western balsam poplar]
gb|KHG12711.1|  wdr26                                                   201   7e-56   Gossypium arboreum [tree cotton]
ref|XP_004243618.1|  PREDICTED: WD repeat-containing protein 26         201   9e-56   Solanum lycopersicum
ref|XP_008229590.1|  PREDICTED: WD repeat-containing protein 26-like    201   1e-55   Prunus mume [ume]
ref|XP_004491280.1|  PREDICTED: WD repeat-containing protein 26-like    200   1e-55   Cicer arietinum [garbanzo]
gb|KJB33386.1|  hypothetical protein B456_006G008900                    199   2e-55   Gossypium raimondii
ref|XP_009377000.1|  PREDICTED: WD repeat-containing protein 26-like    200   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_007048928.1|  Transducin family protein / WD-40 repeat fam...    200   3e-55   Theobroma cacao [chocolate]
ref|XP_006366633.1|  PREDICTED: WD repeat-containing protein 26-like    199   3e-55   Solanum tuberosum [potatoes]
gb|KJB33387.1|  hypothetical protein B456_006G008900                    199   4e-55   Gossypium raimondii
ref|XP_011026207.1|  PREDICTED: WD repeat-containing protein 26-like    199   4e-55   Populus euphratica
ref|XP_007048927.1|  Transducin family protein / WD-40 repeat fam...    199   6e-55   
ref|XP_003617329.1|  WD-repeat protein-like protein                     198   1e-54   Medicago truncatula
ref|XP_003545311.1|  PREDICTED: WD repeat-containing protein 26-like    197   2e-54   Glycine max [soybeans]
ref|XP_002302127.1|  hypothetical protein POPTR_0002s05670g             197   2e-54   Populus trichocarpa [western balsam poplar]
ref|XP_003519528.1|  PREDICTED: WD repeat-containing protein 26-like    197   2e-54   Glycine max [soybeans]
ref|XP_001770300.1|  predicted protein                                  153   4e-54   
ref|XP_008380168.1|  PREDICTED: WD repeat-containing protein 26-like    195   1e-53   
ref|XP_001771286.1|  predicted protein                                  152   2e-53   
gb|KHG30817.1|  WD repeat-containing 26                                 194   3e-53   Gossypium arboreum [tree cotton]
ref|XP_010256452.1|  PREDICTED: WD repeat-containing protein 26 i...    194   3e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010256454.1|  PREDICTED: WD repeat-containing protein 26 i...    194   3e-53   Nelumbo nucifera [Indian lotus]
ref|XP_009356585.1|  PREDICTED: WD repeat-containing protein 26-like    194   4e-53   Pyrus x bretschneideri [bai li]
gb|KHN38353.1|  WD repeat-containing protein 26                         192   1e-52   Glycine soja [wild soybean]
ref|XP_009405376.1|  PREDICTED: WD repeat-containing protein 26-like    192   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH33653.1|  transducin/WD40 repeat protein                          190   8e-52   Medicago truncatula
ref|XP_009419551.1|  PREDICTED: WD repeat-containing protein 26-like    189   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010054068.1|  PREDICTED: WD repeat-containing protein 26         189   2e-51   Eucalyptus grandis [rose gum]
gb|KJB48956.1|  hypothetical protein B456_008G095100                    189   2e-51   Gossypium raimondii
ref|XP_006468682.1|  PREDICTED: WD repeat-containing protein 26-l...    188   4e-51   Citrus sinensis [apfelsine]
ref|XP_006448496.1|  hypothetical protein CICLE_v10014731mg             188   4e-51   Citrus clementina [clementine]
ref|XP_007141447.1|  hypothetical protein PHAVU_008G196400g             188   6e-51   Phaseolus vulgaris [French bean]
ref|XP_006854396.1|  PREDICTED: WD repeat-containing protein 26         156   7e-51   Amborella trichopoda
ref|XP_010680145.1|  PREDICTED: uncharacterized WD repeat-contain...    187   1e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007043170.1|  Transducin family protein / WD-40 repeat fam...    186   3e-50   
ref|XP_004499533.1|  PREDICTED: WD repeat-containing protein 26-l...    185   5e-50   Cicer arietinum [garbanzo]
ref|XP_010093188.1|  WD repeat-containing protein 26                    185   6e-50   
ref|XP_004499532.1|  PREDICTED: WD repeat-containing protein 26-l...    184   1e-49   Cicer arietinum [garbanzo]
ref|XP_010943696.1|  PREDICTED: uncharacterized WD repeat-contain...    183   4e-49   Elaeis guineensis
gb|KJB47106.1|  hypothetical protein B456_008G011600                    182   9e-49   Gossypium raimondii
gb|KJB47107.1|  hypothetical protein B456_008G011600                    182   1e-48   Gossypium raimondii
ref|XP_004149516.2|  PREDICTED: uncharacterized WD repeat-contain...    182   1e-48   Cucumis sativus [cucumbers]
ref|XP_008466801.1|  PREDICTED: uncharacterized WD repeat-contain...    181   2e-48   Cucumis melo [Oriental melon]
gb|KHG19792.1|  WD repeat-containing 26                                 179   6e-48   Gossypium arboreum [tree cotton]
gb|KDP40461.1|  hypothetical protein JCGZ_24460                         174   2e-47   Jatropha curcas
ref|XP_008221109.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    178   2e-47   Prunus mume [ume]
ref|XP_010103563.1|  WD repeat-containing protein 26                    179   2e-47   
ref|XP_007222293.1|  hypothetical protein PRUPE_ppa003324mg             178   3e-47   
ref|XP_010906218.1|  PREDICTED: WD repeat-containing protein 26-like    178   3e-47   Elaeis guineensis
ref|XP_006280295.1|  hypothetical protein CARUB_v10026218mg             144   4e-47   
ref|XP_006280294.1|  hypothetical protein CARUB_v10026218mg             143   4e-47   Capsella rubella
ref|XP_002865396.1|  transducin family protein                          144   7e-47   
ref|XP_012068553.1|  PREDICTED: WD repeat-containing protein 26 i...    176   8e-47   Jatropha curcas
ref|XP_012068544.1|  PREDICTED: uncharacterized WD repeat-contain...    177   8e-47   Jatropha curcas
ref|XP_012068552.1|  PREDICTED: uncharacterized WD repeat-contain...    177   8e-47   Jatropha curcas
emb|CDY13140.1|  BnaA09g16770D                                          142   1e-46   Brassica napus [oilseed rape]
gb|EYU42858.1|  hypothetical protein MIMGU_mgv1a022069mg                155   1e-46   Erythranthe guttata [common monkey flower]
gb|EAY85451.1|  hypothetical protein OsI_06831                          175   2e-46   Oryza sativa Indica Group [Indian rice]
gb|EAZ22671.1|  hypothetical protein OsJ_06341                          175   3e-46   Oryza sativa Japonica Group [Japonica rice]
emb|CDY36957.1|  BnaC09g17730D                                          140   6e-46   Brassica napus [oilseed rape]
ref|NP_199205.1|  transducin/WD40 domain-containing protein             141   7e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403164.1|  hypothetical protein EUTSA_v10003179mg             144   7e-46   Eutrema salsugineum [saltwater cress]
ref|XP_010441956.1|  PREDICTED: WD repeat-containing protein 26         141   8e-46   
ref|XP_010494383.1|  PREDICTED: WD repeat-containing protein 26-l...    141   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010494385.1|  PREDICTED: WD repeat-containing protein 26-l...    141   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009113968.1|  PREDICTED: WD repeat-containing protein 26         142   1e-45   Brassica rapa
ref|XP_009370775.1|  PREDICTED: WD repeat-containing protein 26         140   1e-45   Pyrus x bretschneideri [bai li]
ref|XP_010481799.1|  PREDICTED: WD repeat-containing protein 26-l...    140   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_008382686.1|  PREDICTED: WD repeat-containing protein 26         137   2e-45   
ref|XP_006647187.1|  PREDICTED: WD repeat-containing protein 26-like    173   2e-45   Oryza brachyantha
emb|CBI35349.3|  unnamed protein product                                172   4e-45   Vitis vinifera
ref|XP_002270103.1|  PREDICTED: WD repeat-containing protein 26         172   4e-45   Vitis vinifera
ref|XP_004972947.1|  PREDICTED: WD repeat-containing protein 26-like    172   5e-45   Setaria italica
ref|NP_001159293.1|  hypothetical protein                               165   8e-45   
ref|XP_002866568.1|  hypothetical protein ARALYDRAFT_919661             139   9e-45   Arabidopsis lyrata subsp. lyrata
ref|XP_008447357.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    138   9e-45   Cucumis melo [Oriental melon]
ref|XP_010264796.1|  PREDICTED: WD repeat-containing protein 26 i...    130   2e-44   Nelumbo nucifera [Indian lotus]
ref|XP_009792756.1|  PREDICTED: WD repeat-containing protein 26 i...    141   2e-44   Nicotiana sylvestris
ref|XP_010264797.1|  PREDICTED: WD repeat-containing protein 26 i...    130   2e-44   Nelumbo nucifera [Indian lotus]
ref|XP_010264794.1|  PREDICTED: WD repeat-containing protein 26 i...    130   2e-44   Nelumbo nucifera [Indian lotus]
ref|XP_010522523.1|  PREDICTED: WD repeat-containing protein 26         145   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_010264795.1|  PREDICTED: WD repeat-containing protein 26 i...    130   2e-44   Nelumbo nucifera [Indian lotus]
ref|XP_011651627.1|  PREDICTED: WD repeat-containing protein 26         139   5e-44   Cucumis sativus [cucumbers]
ref|XP_006355901.1|  PREDICTED: WD repeat-containing protein 26-like    142   6e-44   Solanum tuberosum [potatoes]
ref|XP_006281895.1|  hypothetical protein CARUB_v10028093mg             139   1e-43   
gb|KJB26051.1|  hypothetical protein B456_004G222700                    132   1e-43   Gossypium raimondii
ref|XP_007201159.1|  hypothetical protein PRUPE_ppa004283mg             131   2e-43   
emb|CDP03813.1|  unnamed protein product                                132   2e-43   Coffea canephora [robusta coffee]
ref|XP_002873372.1|  transducin family protein                          166   4e-43   
ref|XP_011083080.1|  PREDICTED: WD repeat-containing protein 26         133   4e-43   Sesamum indicum [beniseed]
gb|KHF98324.1|  WD repeat-containing 26                                 132   6e-43   Gossypium arboreum [tree cotton]
ref|XP_008235562.1|  PREDICTED: WD repeat-containing protein 26         131   6e-43   Prunus mume [ume]
gb|EYU42820.1|  hypothetical protein MIMGU_mgv1a018113mg                118   6e-43   Erythranthe guttata [common monkey flower]
ref|XP_009629554.1|  PREDICTED: WD repeat-containing protein 26 i...    139   7e-43   Nicotiana tomentosiformis
ref|XP_010245142.1|  PREDICTED: uncharacterized WD repeat-contain...    111   8e-43   
ref|XP_006443707.1|  hypothetical protein CICLE_v10019514mg             137   1e-42   Citrus clementina [clementine]
gb|EYU17955.1|  hypothetical protein MIMGU_mgv1a004677mg                130   1e-42   Erythranthe guttata [common monkey flower]
gb|KDO60331.1|  hypothetical protein CISIN_1g042434mg                   136   1e-42   Citrus sinensis [apfelsine]
emb|CDX84431.1|  BnaC03g50690D                                          140   2e-42   
ref|XP_009792757.1|  PREDICTED: WD repeat-containing protein 26 i...    142   2e-42   Nicotiana sylvestris
ref|XP_007162638.1|  hypothetical protein PHAVU_001G167600g             140   2e-42   Phaseolus vulgaris [French bean]
gb|KGN58314.1|  hypothetical protein Csa_3G611390                       140   3e-42   Cucumis sativus [cucumbers]
ref|XP_004247123.1|  PREDICTED: WD repeat-containing protein 26         137   3e-42   Solanum lycopersicum
emb|CDY41528.1|  BnaA06g22810D                                          141   5e-42   Brassica napus [oilseed rape]
ref|XP_009150419.1|  PREDICTED: WD repeat-containing protein 26-like    141   7e-42   
gb|EYU42862.1|  hypothetical protein MIMGU_mgv1a021742mg                118   1e-41   Erythranthe guttata [common monkey flower]
ref|XP_004495043.1|  PREDICTED: WD repeat-containing protein 26-like    137   3e-41   Cicer arietinum [garbanzo]
ref|XP_002268789.2|  PREDICTED: WD repeat-containing protein 26         123   3e-41   Vitis vinifera
ref|XP_011035629.1|  PREDICTED: WD repeat-containing protein 26 i...    127   4e-41   Populus euphratica
emb|CBI37215.3|  unnamed protein product                                122   5e-41   Vitis vinifera
ref|XP_010069704.1|  PREDICTED: WD repeat-containing protein 26-like    131   5e-41   Eucalyptus grandis [rose gum]
ref|XP_009629555.1|  PREDICTED: WD repeat-containing protein 26 i...    139   9e-41   Nicotiana tomentosiformis
ref|XP_010481800.1|  PREDICTED: WD repeat-containing protein 26-l...    124   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010040357.1|  PREDICTED: WD repeat-containing protein 26-like    131   1e-40   
gb|ABR16581.1|  unknown                                                 159   2e-40   Picea sitchensis
ref|XP_010091833.1|  WD repeat-containing protein 26                    130   2e-40   Morus notabilis
ref|XP_011035628.1|  PREDICTED: WD repeat-containing protein 26 i...    124   3e-40   Populus euphratica
gb|KHN02443.1|  WD repeat-containing protein 26                         131   4e-40   Glycine soja [wild soybean]
ref|XP_003554312.1|  PREDICTED: WD repeat-containing protein 26-like    131   4e-40   
ref|XP_009386572.1|  PREDICTED: WD repeat-containing protein 26         136   5e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010546278.1|  PREDICTED: WD repeat-containing protein 26-like    157   7e-40   Tarenaya hassleriana [spider flower]
ref|XP_002982745.1|  hypothetical protein SELMODRAFT_268628             157   8e-40   
ref|XP_011033097.1|  PREDICTED: WD repeat-containing protein 26-like    156   1e-39   Populus euphratica
ref|XP_002311889.2|  hypothetical protein POPTR_0008s00330g             155   2e-39   
ref|XP_002990891.1|  hypothetical protein SELMODRAFT_161256             155   2e-39   
gb|KJE91550.1|  hypothetical protein CAOG_009572                        133   7e-39   Capsaspora owczarzaki ATCC 30864
ref|XP_002464509.1|  hypothetical protein SORBIDRAFT_01g019860          147   3e-38   Sorghum bicolor [broomcorn]
gb|KHN09401.1|  WD repeat-containing protein 26                         127   6e-38   Glycine soja [wild soybean]
ref|XP_010918959.1|  PREDICTED: WD repeat-containing protein 26         134   1e-37   Elaeis guineensis
ref|XP_008775134.1|  PREDICTED: WD repeat-containing protein 26         132   1e-37   Phoenix dactylifera
gb|EYU42861.1|  hypothetical protein MIMGU_mgv1a020302mg                116   1e-37   Erythranthe guttata [common monkey flower]
ref|XP_003574020.1|  PREDICTED: WD repeat-containing protein 26         140   2e-37   Brachypodium distachyon [annual false brome]
ref|XP_004982941.1|  PREDICTED: WD repeat-containing protein 26-like    143   2e-37   Setaria italica
ref|XP_004349429.2|  WD repeat-containing protein                       128   3e-37   Capsaspora owczarzaki ATCC 30864
gb|EFA80856.1|  hypothetical protein PPL_06445                          134   8e-37   Heterostelium album PN500
tpg|DAA49690.1|  TPA: hypothetical protein ZEAMMB73_458845              142   1e-36   
ref|XP_008664896.1|  PREDICTED: WD repeat-containing protein 26-l...    143   2e-36   Zea mays [maize]
ref|XP_008664897.1|  PREDICTED: WD repeat-containing protein 26-l...    143   2e-36   Zea mays [maize]
gb|EYU42819.1|  hypothetical protein MIMGU_mgv1a005559mg                145   6e-36   Erythranthe guttata [common monkey flower]
ref|XP_011046605.1|  PREDICTED: WD repeat-containing protein 26         120   1e-35   Populus euphratica
gb|AAP54181.2|  WD-repeat protein 26, putative, expressed               138   6e-35   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD22174.1|  putative WD repeat protein                           99.0    7e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004356287.1|  WD repeat protein                                  126   1e-34   Cavenderia fasciculata
ref|XP_002315365.1|  hypothetical protein POPTR_0010s26090g             120   3e-34   Populus trichocarpa [western balsam poplar]
gb|KFK31679.1|  hypothetical protein AALP_AA6G145100                    141   3e-34   Arabis alpina [alpine rockcress]
ref|XP_011118606.1|  hypothetical protein AOL_s00007g403                122   3e-34   Arthrobotrys oligospora ATCC 24927
ref|XP_011111734.1|  hypothetical protein H072_5931                     120   4e-34   
ref|NP_001064796.1|  Os10g0465000                                       137   5e-34   
ref|XP_003286147.1|  hypothetical protein DICPUDRAFT_46602              131   8e-34   Dictyostelium purpureum
ref|XP_010684801.1|  PREDICTED: WD repeat-containing protein 26         139   1e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004345356.1|  hypothetical protein ACA1_355860                   138   3e-33   Acanthamoeba castellanii str. Neff
dbj|GAM21975.1|  hypothetical protein SAMD00019534_051500               119   4e-33   Acytostelium subglobosum LB1
gb|EEC67126.1|  hypothetical protein OsI_33942                          137   4e-33   Oryza sativa Indica Group [Indian rice]
gb|EEE51100.1|  hypothetical protein OsJ_31819                          137   4e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_636788.1|  hypothetical protein DDB_G0288313                     139   9e-33   Dictyostelium discoideum AX4
ref|XP_006681031.1|  hypothetical protein BATDEDRAFT_20488              127   2e-32   Batrachochytrium dendrobatidis JAM81
ref|XP_002835107.1|  hypothetical protein                               120   2e-32   Tuber melanosporum Mel28
ref|XP_008647998.1|  PREDICTED: uncharacterized protein LOC100304...  87.4    2e-31   Zea mays [maize]
emb|CDS03587.1|  hypothetical protein LRAMOSA00989                      115   5e-31   Lichtheimia ramosa
ref|XP_002131526.2|  PREDICTED: WD repeat-containing protein 26         112   5e-31   Ciona intestinalis [sea vase]
ref|XP_002533626.1|  WD-repeat protein, putative                        131   5e-31   Ricinus communis
gb|KEH42443.1|  transducin/WD40 repeat protein                          131   7e-31   Medicago truncatula
gb|EXX54855.1|  glucose-induced degradation complex subunit GID7        131   8e-31   Rhizophagus irregularis DAOM 197198w
ref|XP_005765500.1|  hypothetical protein EMIHUDRAFT_452007             124   9e-31   Emiliania huxleyi CCMP1516
ref|XP_005763815.1|  hypothetical protein EMIHUDRAFT_452457             124   9e-31   Emiliania huxleyi CCMP1516
ref|XP_007873440.1|  hypothetical protein PNEG_01500                    120   1e-30   Pneumocystis murina B123
ref|XP_008294937.1|  PREDICTED: WD repeat-containing protein 26 i...    114   1e-30   Stegastes partitus
ref|XP_011483295.1|  PREDICTED: WD repeat-containing protein 26-like    112   1e-30   
ref|XP_002321301.2|  hypothetical protein POPTR_0014s18590g             128   3e-30   
ref|XP_004904369.1|  PREDICTED: WD repeat-containing protein 26 i...    113   3e-30   
gb|KDP26444.1|  hypothetical protein JCGZ_17602                         128   3e-30   Jatropha curcas
gb|EYU42822.1|  hypothetical protein MIMGU_mgv1a024382mg                129   3e-30   Erythranthe guttata [common monkey flower]
ref|XP_004292253.1|  PREDICTED: WD repeat-containing protein 26         129   4e-30   Fragaria vesca subsp. vesca
ref|XP_012085197.1|  PREDICTED: WD repeat-containing protein 26         128   6e-30   
ref|XP_007530227.1|  PREDICTED: WD repeat-containing protein 26 i...    112   7e-30   Erinaceus europaeus [common hedgehog]
ref|XP_007530226.1|  PREDICTED: WD repeat-containing protein 26 i...    112   7e-30   Erinaceus europaeus [common hedgehog]
emb|CDH48456.1|  wd repeat protein                                      114   8e-30   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_003410986.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    111   1e-29   Loxodonta africana [African bush elephant]
ref|XP_004805459.1|  PREDICTED: WD repeat-containing protein 26 i...    111   1e-29   
ref|XP_006157333.1|  PREDICTED: WD repeat-containing protein 26         111   1e-29   
ref|XP_004805457.1|  PREDICTED: WD repeat-containing protein 26 i...    111   1e-29   
ref|XP_007670666.1|  PREDICTED: WD repeat-containing protein 26         111   1e-29   
ref|XP_006806085.1|  PREDICTED: WD repeat-containing protein 26-like    112   1e-29   Neolamprologus brichardi [lyretail cichlid]
ref|XP_008294938.1|  PREDICTED: WD repeat-containing protein 26 i...    110   1e-29   Stegastes partitus
ref|XP_005078282.1|  PREDICTED: WD repeat-containing protein 26         110   1e-29   
ref|XP_005851148.1|  hypothetical protein CHLNCDRAFT_7805               116   2e-29   Chlorella variabilis
ref|XP_007111534.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Physeter catodon
ref|XP_010021553.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    111   2e-29   Nestor notabilis
gb|ELK08887.1|  WD repeat-containing protein 26                         110   2e-29   Pteropus alecto
gb|KFO25370.1|  WD repeat-containing protein 26                         110   2e-29   Fukomys damarensis [Damara mole rat]
ref|XP_011359153.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Pteropus vampyrus
ref|XP_004761945.1|  PREDICTED: WD repeat-containing protein 26 i...    111   2e-29   
ref|XP_011359154.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Pteropus vampyrus
ref|XP_419389.3|  PREDICTED: WD repeat-containing protein 26            110   2e-29   
ref|XP_005349003.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Microtus ochrogaster [prairie voles]
ref|XP_008148023.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Eptesicus fuscus
ref|XP_008148024.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Eptesicus fuscus
ref|XP_007481538.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Monodelphis domestica
ref|XP_005349004.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Microtus ochrogaster [prairie voles]
ref|XP_007111533.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Physeter catodon
ref|XP_006898109.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_007481539.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Monodelphis domestica
ref|XP_003775467.2|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    110   2e-29   
ref|XP_012010023.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Ovis aries musimon
ref|XP_004271043.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Orcinus orca [Orca]
ref|XP_005216910.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Bos taurus [bovine]
ref|XP_007454539.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Lipotes vexillifer [baiji]
ref|XP_006198904.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Vicugna pacos
ref|XP_005667990.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_006871201.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Chrysochloris asiatica
ref|XP_004393591.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Odobenus rosmarus divergens
ref|XP_007167286.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Balaenoptera acutorostrata scammoni
ref|XP_007481541.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Monodelphis domestica
ref|XP_008124159.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   Anolis carolinensis [Carolina anole]
ref|XP_004693094.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   Condylura cristata
ref|XP_004439605.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|NP_001108585.2|  WD repeat-containing protein 26 isoform b          110   2e-29   
ref|XP_010380555.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_004375954.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_004393592.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_002760516.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_004805458.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_007481537.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_012010024.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005216911.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_003735262.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_004805460.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_004578664.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_004693093.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005541014.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_007481540.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_004578665.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
gb|KFV42219.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_004271042.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_007454538.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_006198903.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005667991.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_006871202.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_004439604.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_007167287.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_004375953.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_006898110.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
gb|KFQ19813.1|  WD repeat-containing protein 26                         110   2e-29   
ref|NP_079436.4|  WD repeat-containing protein 26 isoform a             110   2e-29   
gb|EAW69720.1|  WD repeat domain 26, isoform CRA_a                      110   2e-29   
ref|XP_010380554.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005289642.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
gb|EPQ07946.1|  WD repeat-containing protein 26                         110   2e-29   
gb|EHB15308.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_006133474.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
gb|ELR50564.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_007071777.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
gb|KFU87472.1|  WD repeat-containing protein 26                         110   2e-29   
gb|EOB04346.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_004867523.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
dbj|BAD93124.1|  WD repeat domain 26 variant                            110   2e-29   
ref|XP_006276699.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
gb|KFZ48679.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_005866575.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
ref|XP_009993069.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
ref|XP_009923318.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
gb|KFV16166.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_008942903.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
gb|KFQ82009.1|  WD repeat-containing protein 26                         110   2e-29   
gb|KFV74169.1|  WD repeat-containing protein 26                         110   2e-29   
gb|KFQ36019.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_005015555.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_006916263.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_009808864.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
ref|XP_003767791.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
gb|KFR12935.1|  WD repeat-containing protein 26                         110   2e-29   
gb|KFM03858.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_005005635.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_010141755.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
ref|XP_008695650.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
gb|KFW03020.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_004461978.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_007626433.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_011227222.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
gb|KFQ02931.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_005523355.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
gb|KFP26429.1|  WD repeat-containing protein 26                         110   2e-29   
gb|KFP09265.1|  WD repeat-containing protein 26                         110   2e-29   
gb|EMC90349.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_006033426.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005289641.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005015553.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_011583956.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_002801964.1|  PREDICTED: WD repeat-containing protein 26-like    110   2e-29   
ref|XP_006133476.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005488548.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005015554.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
gb|KFW08396.1|  WD repeat-containing protein 26                         110   2e-29   
gb|KFW92969.1|  WD repeat-containing protein 26                         110   2e-29   
gb|KFQ44907.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_009272115.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_004904370.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_004904371.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
gb|KFZ49189.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_008266576.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
ref|XP_006033427.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005005634.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_006133475.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_004626952.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_010082833.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
ref|XP_005690574.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005511389.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
ref|NP_001070527.1|  WD repeat-containing protein 26                    110   2e-29   
ref|XP_009272118.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005459453.1|  PREDICTED: WD repeat-containing protein 26-l...    111   2e-29   
gb|KFV39116.1|  WD repeat-containing protein 26                         110   2e-29   
gb|KFO56720.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_006105167.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
gb|EFB14150.1|  hypothetical protein PANDA_011419                       110   2e-29   
ref|XP_007647767.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|NP_001102551.1|  WD repeat-containing protein 26                    110   2e-29   
ref|XP_005289643.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005409277.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
gb|ERE72965.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_009684905.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
ref|XP_006916264.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_006105168.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005241902.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
ref|XP_004461977.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_003364597.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005409276.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|NP_663489.4|  WD repeat-containing protein 26                       110   2e-29   
ref|XP_009272117.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_001489885.3|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005690573.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_009935639.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
ref|XP_004626953.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_002197206.2|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
ref|XP_003275121.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
dbj|BAG61262.1|  unnamed protein product                                110   2e-29   
ref|XP_004761946.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
gb|KFP42228.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_006080989.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat do...    110   2e-29   
ref|XP_009975342.1|  PREDICTED: WD repeat-containing protein 26         110   2e-29   
gb|EGW07609.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_011542583.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
gb|KGL79088.1|  WD repeat-containing protein 26                         110   2e-29   
gb|KFV67910.1|  WD repeat-containing protein 26                         110   2e-29   
ref|XP_006496879.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005043087.1|  PREDICTED: WD repeat-containing protein 26 i...    110   2e-29   
ref|XP_005427079.1|  PREDICTED: WD repeat-containing protein 26         110   3e-29   
ref|XP_005488549.1|  PREDICTED: WD repeat-containing protein 26 i...    110   3e-29   
ref|XP_006496880.1|  PREDICTED: WD repeat-containing protein 26 i...    110   3e-29   
gb|KFO09193.1|  WD repeat-containing protein 26                         110   3e-29   
ref|XP_005043088.1|  PREDICTED: WD repeat-containing protein 26 i...    110   3e-29   
ref|XP_005690575.1|  PREDICTED: WD repeat-containing protein 26 i...    110   3e-29   
ref|XP_005947327.1|  PREDICTED: WD repeat-containing protein 26-like    111   3e-29   
ref|XP_001640620.1|  predicted protein                                  107   3e-29   
ref|XP_003893114.2|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    110   3e-29   
ref|XP_010215569.1|  PREDICTED: WD repeat-containing protein 26         110   3e-29   
gb|AAI68527.1|  LOC100037096 protein                                    110   3e-29   
gb|AAH58601.1|  Wdr26 protein                                           110   3e-29   
ref|XP_006625750.1|  PREDICTED: WD repeat-containing protein 26-like    110   3e-29   
gb|EDL13128.1|  WD repeat domain 26                                     110   3e-29   
gb|AAH63817.2|  WDR26 protein                                           110   3e-29   
gb|EAW69722.1|  WD repeat domain 26, isoform CRA_c                      110   3e-29   
dbj|BAC35923.1|  unnamed protein product                                110   3e-29   
gb|AAI30198.1|  LOC100037096 protein                                    109   3e-29   
ref|XP_004569176.1|  PREDICTED: WD repeat-containing protein 26-like    111   3e-29   
gb|AAH31471.2|  WDR26 protein                                           110   3e-29   
ref|XP_005959135.1|  PREDICTED: WD repeat-containing protein 26 i...    110   3e-29   
ref|XP_005959134.1|  PREDICTED: WD repeat-containing protein 26 i...    110   3e-29   
ref|XP_011542584.1|  PREDICTED: WD repeat-containing protein 26 i...    110   4e-29   
dbj|BAB14955.1|  unnamed protein product                                109   4e-29   
gb|AAI36093.1|  LOC733878 protein                                       109   4e-29   
ref|XP_010745088.1|  PREDICTED: WD repeat-containing protein 26-like    110   4e-29   
ref|XP_005800310.1|  PREDICTED: WD repeat-containing protein 26-like    109   4e-29   
sp|Q28D01.2|WDR26_XENTR  RecName: Full=WD repeat-containing prote...    109   5e-29   
ref|XP_006761318.1|  PREDICTED: WD repeat-containing protein 26 i...    109   5e-29   
ref|XP_007560994.1|  PREDICTED: WD repeat-containing protein 26         109   5e-29   
ref|XP_006761319.1|  PREDICTED: WD repeat-containing protein 26 i...    109   5e-29   
ref|XP_006746504.1|  PREDICTED: WD repeat-containing protein 26         109   5e-29   
ref|XP_008396247.1|  PREDICTED: WD repeat-containing protein 26         109   5e-29   
gb|KFP02006.1|  WD repeat-containing protein 26                         109   5e-29   
gb|AAH20044.2|  Wdr26 protein                                           110   5e-29   
ref|NP_001039080.1|  WD repeat-containing protein 26                    109   5e-29   
ref|XP_008493536.1|  PREDICTED: WD repeat-containing protein 26         109   6e-29   
ref|XP_007097571.1|  PREDICTED: WD repeat-containing protein 26 i...    108   6e-29   
ref|XP_004699996.1|  PREDICTED: WD repeat-containing protein 26 i...    108   6e-29   
ref|XP_004699997.1|  PREDICTED: WD repeat-containing protein 26 i...    109   6e-29   
ref|XP_003999134.1|  PREDICTED: WD repeat-containing protein 26 i...    108   6e-29   
ref|XP_007097572.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-29   
ref|XP_004083763.1|  PREDICTED: WD repeat-containing protein 26         111   7e-29   
ref|XP_010704966.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    108   7e-29   
ref|XP_010880640.1|  PREDICTED: WD repeat-containing protein 26 i...    110   7e-29   
ref|XP_003999135.2|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-29   
ref|XP_010880641.1|  PREDICTED: WD repeat-containing protein 26 i...    110   7e-29   
ref|XP_007896408.1|  PREDICTED: WD repeat-containing protein 26 i...    111   8e-29   
ref|XP_010737585.1|  PREDICTED: WD repeat-containing protein 26         109   8e-29   
ref|XP_003965790.1|  PREDICTED: WD repeat-containing protein 26         109   9e-29   
ref|XP_007896407.1|  PREDICTED: WD repeat-containing protein 26 i...    110   1e-28   
ref|XP_008288907.1|  PREDICTED: WD repeat-containing protein 26         108   1e-28   
ref|XP_005449665.1|  PREDICTED: WD repeat-containing protein 26-like    110   1e-28   
ref|XP_006797280.1|  PREDICTED: WD repeat-containing protein 26-like    110   1e-28   
ref|XP_006009002.1|  PREDICTED: WD repeat-containing protein 26         111   1e-28   
ref|XP_008322096.1|  PREDICTED: WD repeat-containing protein 26         109   1e-28   
ref|XP_004542033.1|  PREDICTED: WD repeat-containing protein 26-like    110   1e-28   
ref|XP_008311107.1|  PREDICTED: WD repeat-containing protein 26 i...    109   1e-28   
ref|XP_008311108.1|  PREDICTED: WD repeat-containing protein 26 i...    109   2e-28   
gb|ESA15537.1|  hypothetical protein GLOINDRAFT_65155                   124   2e-28   
emb|CAG14617.1|  unnamed protein product                                108   2e-28   
ref|XP_007259932.1|  PREDICTED: WD repeat-containing protein 26-like    109   2e-28   
ref|XP_002399371.1|  guanine nucleotide bionding protein beta sub...    117   2e-28   
ref|NP_001189371.1|  WD repeat-containing protein 26                    107   2e-28   
ref|XP_001921656.4|  PREDICTED: WD repeat-containing protein 26-like    109   2e-28   
ref|XP_002544451.1|  conserved hypothetical protein                     107   2e-28   
gb|AAI60602.1|  Si:ch211-153j24.6 protein                               107   2e-28   
emb|CCJ31009.1|  unnamed protein product                                114   3e-28   
emb|CDQ56821.1|  unnamed protein product                                108   3e-28   
emb|CEG79669.1|  hypothetical protein RMATCC62417_14109                 108   4e-28   
ref|XP_010765695.1|  PREDICTED: WD repeat-containing protein 26 i...    108   4e-28   
ref|XP_010765694.1|  PREDICTED: WD repeat-containing protein 26 i...    108   4e-28   
ref|XP_011669447.1|  PREDICTED: WD repeat-containing protein 26         112   4e-28   
gb|KII88044.1|  hypothetical protein PLICRDRAFT_30507                   109   4e-28   
ref|XP_003791057.1|  PREDICTED: WD repeat-containing protein 26         112   4e-28   
emb|CEG62983.1|  hypothetical protein RMATCC62417_00203                 109   5e-28   
emb|CAG14614.1|  unnamed protein product                                106   5e-28   
ref|XP_784365.3|  PREDICTED: WD repeat-containing protein 26            112   6e-28   
emb|CAG12246.1|  unnamed protein product                                107   6e-28   
emb|CDQ82966.1|  unnamed protein product                                110   7e-28   
ref|XP_007251867.1|  PREDICTED: WD repeat-containing protein 26-l...    108   8e-28   
emb|CEG62984.1|  hypothetical protein RMATCC62417_00203                 109   8e-28   
ref|XP_007251868.1|  PREDICTED: WD repeat-containing protein 26-l...    108   8e-28   
emb|CDQ83866.1|  unnamed protein product                                110   1e-27   
emb|CEI97303.1|  hypothetical protein RMCBS344292_11439                 107   1e-27   
ref|XP_010862550.1|  PREDICTED: WD repeat-containing protein 26-l...    109   1e-27   
ref|XP_003971689.2|  PREDICTED: WD repeat-containing protein 26         104   2e-27   
ref|XP_007407038.1|  hypothetical protein MELLADRAFT_47296              114   2e-27   
ref|XP_005646513.1|  WD40 repeat-like protein                           121   2e-27   
ref|XP_006818835.1|  PREDICTED: WD repeat-containing protein 26-like    111   2e-27   
ref|XP_002848850.1|  WD domain-containing protein                       106   2e-27   



>ref|XP_009758209.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Nicotiana 
sylvestris]
Length=547

 Score =   216 bits (550),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LVSL NQEIHLWNI+G+V  I+K+KGHKR+RFVVRSCFGGLD+AF+ASGSEDSQVYIWH
Sbjct  422  LLVSLWNQEIHLWNIEGTVKLISKYKGHKRSRFVVRSCFGGLDQAFVASGSEDSQVYIWH  481

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            RSSGEL+ T+ GHSGTVNCVSWN ANPHMLASASDD TIRIWGL QVN+K   T  NGVH
Sbjct  482  RSSGELIETMAGHSGTVNCVSWNPANPHMLASASDDHTIRIWGLNQVNMKHYDTFSNGVH  541

Query  312  HCNGGS  295
            +CNGG+
Sbjct  542  YCNGGT  547


 Score =   130 bits (327),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKRI  GVTDKSISMWDL+G ELECWKG RTIR SD+GIT+DG+ +VSV K+  ILL
Sbjct  334  APDGKRILCGVTDKSISMWDLEGKELECWKGHRTIRISDLGITSDGQHVVSVCKDNMILL  393

Query  758  FGWESKAEKSIKEDQVITSFCI  693
            FGWESKAEK I+EDQ ITSF +
Sbjct  394  FGWESKAEKVIQEDQTITSFVL  415



>ref|XP_009758206.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009758207.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009758208.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
sylvestris]
Length=581

 Score =   216 bits (550),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LVSL NQEIHLWNI+G+V  I+K+KGHKR+RFVVRSCFGGLD+AF+ASGSEDSQVYIWH
Sbjct  456  LLVSLWNQEIHLWNIEGTVKLISKYKGHKRSRFVVRSCFGGLDQAFVASGSEDSQVYIWH  515

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            RSSGEL+ T+ GHSGTVNCVSWN ANPHMLASASDD TIRIWGL QVN+K   T  NGVH
Sbjct  516  RSSGELIETMAGHSGTVNCVSWNPANPHMLASASDDHTIRIWGLNQVNMKHYDTFSNGVH  575

Query  312  HCNGGS  295
            +CNGG+
Sbjct  576  YCNGGT  581


 Score =   130 bits (327),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKRI  GVTDKSISMWDL+G ELECWKG RTIR SD+GIT+DG+ +VSV K+  ILL
Sbjct  368  APDGKRILCGVTDKSISMWDLEGKELECWKGHRTIRISDLGITSDGQHVVSVCKDNMILL  427

Query  758  FGWESKAEKSIKEDQVITSFCI  693
            FGWESKAEK I+EDQ ITSF +
Sbjct  428  FGWESKAEKVIQEDQTITSFVL  449



>ref|XP_009631029.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Nicotiana 
tomentosiformis]
Length=547

 Score =   214 bits (546),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LVSL NQEIHLWNI+G+V  I+K+KGHKR+RFVVRSCFGGL +AF+ASGSEDSQVYIWH
Sbjct  422  LLVSLWNQEIHLWNIEGTVKLISKYKGHKRSRFVVRSCFGGLGQAFVASGSEDSQVYIWH  481

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            RSSGEL+ TL GHSGTVNCVSWN ANPHMLASASDD TIRIWG+ QVN+K   TV NGVH
Sbjct  482  RSSGELIETLAGHSGTVNCVSWNPANPHMLASASDDHTIRIWGMNQVNMKHYDTVSNGVH  541

Query  312  HCNGGS  295
            +CNGG+
Sbjct  542  YCNGGT  547


 Score =   130 bits (328),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKRI  GVTDKSISMWDL+G ELECWKG RTIR SD+GIT+DG+ IVSV K+  ILL
Sbjct  334  APDGKRILCGVTDKSISMWDLEGKELECWKGHRTIRISDLGITSDGQHIVSVCKDNMILL  393

Query  758  FGWESKAEKSIKEDQVITSFCI  693
            FGWESKAEK I+EDQ ITSF +
Sbjct  394  FGWESKAEKVIQEDQTITSFVL  415



>ref|XP_009631025.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631026.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631027.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631028.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
Length=581

 Score =   214 bits (545),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LVSL NQEIHLWNI+G+V  I+K+KGHKR+RFVVRSCFGGL +AF+ASGSEDSQVYIWH
Sbjct  456  LLVSLWNQEIHLWNIEGTVKLISKYKGHKRSRFVVRSCFGGLGQAFVASGSEDSQVYIWH  515

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            RSSGEL+ TL GHSGTVNCVSWN ANPHMLASASDD TIRIWG+ QVN+K   TV NGVH
Sbjct  516  RSSGELIETLAGHSGTVNCVSWNPANPHMLASASDDHTIRIWGMNQVNMKHYDTVSNGVH  575

Query  312  HCNGGS  295
            +CNGG+
Sbjct  576  YCNGGT  581


 Score =   130 bits (328),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKRI  GVTDKSISMWDL+G ELECWKG RTIR SD+GIT+DG+ IVSV K+  ILL
Sbjct  368  APDGKRILCGVTDKSISMWDLEGKELECWKGHRTIRISDLGITSDGQHIVSVCKDNMILL  427

Query  758  FGWESKAEKSIKEDQVITSFCI  693
            FGWESKAEK I+EDQ ITSF +
Sbjct  428  FGWESKAEKVIQEDQTITSFVL  449



>emb|CDP17860.1| unnamed protein product [Coffea canephora]
Length=588

 Score =   219 bits (557),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R   + LVSLLN+EIHLWNI+G V  +AK+KGHKR+RFV+RSCFGGL++AF+ASGSEDSQ
Sbjct  458  RDGKSLLVSLLNEEIHLWNIEGHVRLLAKYKGHKRSRFVIRSCFGGLEQAFVASGSEDSQ  517

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHRSSGELV TL GHSGTVNCVSWN +NPHMLASASDDRTIRIWGLK+V +K N   
Sbjct  518  VYIWHRSSGELVMTLPGHSGTVNCVSWNPSNPHMLASASDDRTIRIWGLKEVKMKHNGAH  577

Query  327  CNGVHHCNGGS  295
             NGVH+CNGGS
Sbjct  578  TNGVHYCNGGS  588


 Score =   125 bits (314),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDG+ +FTG+ DKS+ MWD+DG ELECWKGQRT + SD+GIT+DGKQIVSV K+ TILL
Sbjct  375  APDGRTVFTGLADKSLIMWDIDGKELECWKGQRTSKMSDLGITSDGKQIVSVCKDTTILL  434

Query  758  FGWESKAEKSIKEDQVITSFCI  693
            FGWESKAEK I+EDQ I SF +
Sbjct  435  FGWESKAEKIIEEDQTIISFAL  456



>ref|XP_009618673.1| PREDICTED: WD repeat-containing protein 26-like [Nicotiana tomentosiformis]
Length=581

 Score =   213 bits (542),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            LVSL NQEIHLW+I G+V  IAK+KGHKR+RFVVRSCFGGLD+AF+ASGSEDSQVYIWHR
Sbjct  457  LVSLWNQEIHLWDIQGTVKLIAKYKGHKRSRFVVRSCFGGLDQAFVASGSEDSQVYIWHR  516

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHH  310
             SGELVGTL GHSGTVNCVSWN ANPHMLASASDDR+IRIWGL +VN+KQ+ TV NGV+ 
Sbjct  517  GSGELVGTLAGHSGTVNCVSWNPANPHMLASASDDRSIRIWGLNRVNMKQHGTVTNGVNC  576

Query  309  CNGGS  295
            CNG S
Sbjct  577  CNGRS  581


 Score =   129 bits (324),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKRIF GVTDKSISMWDL+G ELECWKG RTIR SD+GIT+DGK +VSV KE TI+L
Sbjct  368  APDGKRIFCGVTDKSISMWDLEGKELECWKGNRTIRISDLGITSDGKHVVSVCKENTIVL  427

Query  758  FGWESKAEKSIKEDQVITSFCI  693
            F WES+ EK I+EDQ ITSF +
Sbjct  428  FEWESRTEKVIQEDQAITSFVL  449



>ref|XP_004239310.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Solanum 
lycopersicum]
Length=580

 Score =   199 bits (507),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LVSL NQEIHLW+I+G+   ++K+ GHKR+RFV+RSCFGGL++ FI+SGSEDSQVYIWH
Sbjct  455  LLVSLWNQEIHLWDIEGTAKLLSKYNGHKRSRFVIRSCFGGLNQEFISSGSEDSQVYIWH  514

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
             SSGELV TL GHSGTVNCVSWN A+PHMLASASDD TIRIWGL QV ++ N TV N VH
Sbjct  515  ISSGELVETLAGHSGTVNCVSWNPADPHMLASASDDHTIRIWGLNQVKMEHNDTVSNDVH  574

Query  312  HCNGGS  295
            +CNGG+
Sbjct  575  YCNGGT  580


 Score =   130 bits (326),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDG RI  GVTDKSISMWDL+G ELECWKG RTIR SD+GIT+DGK +VSV K+  ILL
Sbjct  367  APDGNRILCGVTDKSISMWDLEGKELECWKGHRTIRISDLGITSDGKHVVSVCKDNMILL  426

Query  758  FGWESKAEKSIKEDQVITSFCI  693
            FGWESKAEK I+EDQ +TSF +
Sbjct  427  FGWESKAEKVIQEDQTVTSFVL  448



>ref|XP_004239311.1| PREDICTED: WD repeat-containing protein 26 isoform X3 [Solanum 
lycopersicum]
Length=540

 Score =   199 bits (505),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LVSL NQEIHLW+I+G+   ++K+ GHKR+RFV+RSCFGGL++ FI+SGSEDSQVYIWH
Sbjct  415  LLVSLWNQEIHLWDIEGTAKLLSKYNGHKRSRFVIRSCFGGLNQEFISSGSEDSQVYIWH  474

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
             SSGELV TL GHSGTVNCVSWN A+PHMLASASDD TIRIWGL QV ++ N TV N VH
Sbjct  475  ISSGELVETLAGHSGTVNCVSWNPADPHMLASASDDHTIRIWGLNQVKMEHNDTVSNDVH  534

Query  312  HCNGGS  295
            +CNGG+
Sbjct  535  YCNGGT  540


 Score =   130 bits (326),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDG RI  GVTDKSISMWDL+G ELECWKG RTIR SD+GIT+DGK +VSV K+  ILL
Sbjct  327  APDGNRILCGVTDKSISMWDLEGKELECWKGHRTIRISDLGITSDGKHVVSVCKDNMILL  386

Query  758  FGWESKAEKSIKEDQVITSFCI  693
            FGWESKAEK I+EDQ +TSF +
Sbjct  387  FGWESKAEKVIQEDQTVTSFVL  408



>ref|XP_009608371.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score =   203 bits (516),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 108/127 (85%), Gaps = 2/127 (2%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            LVSL NQEIHLW I+GSV  +AK+KGHKR RFVVRSCFGGLD++FIASGSEDSQVYIWH+
Sbjct  419  LVSLWNQEIHLWYIEGSVKLVAKYKGHKRFRFVVRSCFGGLDQSFIASGSEDSQVYIWHK  478

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ--NSTVCNGV  316
             S  L+ TL GHSGTVNCVSWN ANPHMLASASDDRTIRIWGL Q N+K   N  + NGV
Sbjct  479  CSQALLATLAGHSGTVNCVSWNPANPHMLASASDDRTIRIWGLNQANMKHNVNGAISNGV  538

Query  315  HHCNGGS  295
            H+CNGG+
Sbjct  539  HYCNGGT  545


 Score =   121 bits (304),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKRIF G TDKSISMWDL+G ELECWKG R  R +D+GIT+DGK +VSV K+  ILL
Sbjct  330  APDGKRIFCGFTDKSISMWDLEGKELECWKGHRISRIADLGITSDGKHMVSVCKDNMILL  389

Query  758  FGWESKAEKSIKEDQVITSF  699
            FG ESKAE+ I+EDQ ITSF
Sbjct  390  FGLESKAERIIQEDQTITSF  409



>ref|XP_009608368.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009608369.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
Length=579

 Score =   202 bits (515),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 108/127 (85%), Gaps = 2/127 (2%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            LVSL NQEIHLW I+GSV  +AK+KGHKR RFVVRSCFGGLD++FIASGSEDSQVYIWH+
Sbjct  453  LVSLWNQEIHLWYIEGSVKLVAKYKGHKRFRFVVRSCFGGLDQSFIASGSEDSQVYIWHK  512

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ--NSTVCNGV  316
             S  L+ TL GHSGTVNCVSWN ANPHMLASASDDRTIRIWGL Q N+K   N  + NGV
Sbjct  513  CSQALLATLAGHSGTVNCVSWNPANPHMLASASDDRTIRIWGLNQANMKHNVNGAISNGV  572

Query  315  HHCNGGS  295
            H+CNGG+
Sbjct  573  HYCNGGT  579


 Score =   121 bits (303),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKRIF G TDKSISMWDL+G ELECWKG R  R +D+GIT+DGK +VSV K+  ILL
Sbjct  364  APDGKRIFCGFTDKSISMWDLEGKELECWKGHRISRIADLGITSDGKHMVSVCKDNMILL  423

Query  758  FGWESKAEKSIKEDQVITSF  699
            FG ESKAE+ I+EDQ ITSF
Sbjct  424  FGLESKAERIIQEDQTITSF  443



>ref|XP_009780908.1| PREDICTED: WD repeat-containing protein 26-like [Nicotiana sylvestris]
 ref|XP_009780909.1| PREDICTED: WD repeat-containing protein 26-like [Nicotiana sylvestris]
Length=579

 Score =   204 bits (519),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 109/127 (86%), Gaps = 2/127 (2%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            LVSL NQEIHLW I+GSV  +AK+KGHKR+RFVVRSCFGGLD++FIASGSEDSQVYIWH+
Sbjct  453  LVSLWNQEIHLWYIEGSVKLVAKYKGHKRSRFVVRSCFGGLDQSFIASGSEDSQVYIWHK  512

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ--NSTVCNGV  316
             S  L+ TL GHSGTVNCVSWN ANPHMLASASDDRTIRIWGL Q N+K   N  + NGV
Sbjct  513  CSQALLATLAGHSGTVNCVSWNPANPHMLASASDDRTIRIWGLNQANMKHNGNGAISNGV  572

Query  315  HHCNGGS  295
            H+CNGG+
Sbjct  573  HYCNGGT  579


 Score =   117 bits (293),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGKRIF G TDKSISMWDL+G ELECWKG R  R +D+GIT+DGK +VSV K+  ILLF
Sbjct  365  PDGKRIFCGFTDKSISMWDLEGKELECWKGHRISRIADLGITSDGKHMVSVCKDNMILLF  424

Query  755  GWESKAEKSIKEDQVITSF  699
              ESKAE+ I+EDQ ITSF
Sbjct  425  ELESKAERIIQEDQTITSF  443



>ref|XP_011100492.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Sesamum 
indicum]
 ref|XP_011100493.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Sesamum 
indicum]
 ref|XP_011100494.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Sesamum 
indicum]
 ref|XP_011100495.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Sesamum 
indicum]
 ref|XP_011100497.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Sesamum 
indicum]
Length=585

 Score =   190 bits (483),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LVSL N+E+HLWNIDG +  IAK+KGHKR+RFVVRSCFGGL++AFIASGSEDSQV+IWH
Sbjct  455  LLVSLFNEELHLWNIDGCIRLIAKYKGHKRSRFVVRSCFGGLEQAFIASGSEDSQVHIWH  514

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            + SGEL+ TL GHSG VNCVSWN ANPHMLASASDDRTIRIWGL Q N+  +    NG+H
Sbjct  515  KVSGELILTLAGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNQDNMNCSGRHSNGIH  574


 Score =   130 bits (326),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 78/95 (82%), Gaps = 2/95 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGK IF+GVTDKSISMWDL+GNELECW+GQRT R +D+GI+TDGK++V+V KE TILL
Sbjct  367  APDGKSIFSGVTDKSISMWDLEGNELECWEGQRTTRIADLGISTDGKELVTVCKETTILL  426

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCL  654
            FGWE+ +EK I+EDQ ITSF +    +  F LV L
Sbjct  427  FGWETVSEKFIREDQFITSFALSADSK--FLLVSL  459



>ref|XP_011100498.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Sesamum 
indicum]
Length=544

 Score =   190 bits (482),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LVSL N+E+HLWNIDG +  IAK+KGHKR+RFVVRSCFGGL++AFIASGSEDSQV+IWH
Sbjct  414  LLVSLFNEELHLWNIDGCIRLIAKYKGHKRSRFVVRSCFGGLEQAFIASGSEDSQVHIWH  473

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            + SGEL+ TL GHSG VNCVSWN ANPHMLASASDDRTIRIWGL Q N+  +    NG+H
Sbjct  474  KVSGELILTLAGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNQDNMNCSGRHSNGIH  533


 Score =   130 bits (326),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 78/95 (82%), Gaps = 2/95 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGK IF+GVTDKSISMWDL+GNELECW+GQRT R +D+GI+TDGK++V+V KE TILL
Sbjct  326  APDGKSIFSGVTDKSISMWDLEGNELECWEGQRTTRIADLGISTDGKELVTVCKETTILL  385

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCL  654
            FGWE+ +EK I+EDQ ITSF +    +  F LV L
Sbjct  386  FGWETVSEKFIREDQFITSFALSADSK--FLLVSL  418



>ref|XP_010321118.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Solanum 
lycopersicum]
Length=549

 Score =   200 bits (509),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LVSL NQEIHLW+I+G+   ++K+ GHKR+RFV+RSCFGGL++ FI+SGSEDSQVYIWH
Sbjct  424  LLVSLWNQEIHLWDIEGTAKLLSKYNGHKRSRFVIRSCFGGLNQEFISSGSEDSQVYIWH  483

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
             SSGELV TL GHSGTVNCVSWN A+PHMLASASDD TIRIWGL QV ++ N TV N VH
Sbjct  484  ISSGELVETLAGHSGTVNCVSWNPADPHMLASASDDHTIRIWGLNQVKMEHNDTVSNDVH  543

Query  312  HCNGGS  295
            +CNGG+
Sbjct  544  YCNGGT  549


 Score =   113 bits (283),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 69/93 (74%), Gaps = 11/93 (12%)
 Frame = -2

Query  938  SPDGKRIFT-GV----------TDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQI  792
            SPD  ++ T GV          +DKSISMWDL+G ELECWKG RTIR SD+GIT+DGK +
Sbjct  325  SPDDHQLLTCGVEEVVRRWDVESDKSISMWDLEGKELECWKGHRTIRISDLGITSDGKHV  384

Query  791  VSVHKEKTILLFGWESKAEKSIKEDQVITSFCI  693
            VSV K+  ILLFGWESKAEK I+EDQ +TSF +
Sbjct  385  VSVCKDNMILLFGWESKAEKVIQEDQTVTSFVL  417



>ref|XP_011085429.1| PREDICTED: WD repeat-containing protein 26-like [Sesamum indicum]
 ref|XP_011085430.1| PREDICTED: WD repeat-containing protein 26-like [Sesamum indicum]
Length=580

 Score =   194 bits (493),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             L+SL N+E+HLWNIDG+   +AK+KGHKR+RF+VRSCFGGL++AFIASGSEDSQVYIWH
Sbjct  455  LLISLSNEELHLWNIDGTAKLVAKYKGHKRSRFIVRSCFGGLNQAFIASGSEDSQVYIWH  514

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R SGEL+ TL GHSG VNCVSWN  NPHMLASASDDRTIRIWGL +VN+  N     GV+
Sbjct  515  RLSGELILTLAGHSGAVNCVSWNPTNPHMLASASDDRTIRIWGLSRVNMNFNGRHSTGVN  574

Query  312  HCNG  301
             CNG
Sbjct  575  CCNG  578


 Score =   119 bits (298),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            + DGK IF+GVTDKSISMWD DG E+ECWKGQ+T R +D+GIT +GK++++V KE TILL
Sbjct  367  AADGKSIFSGVTDKSISMWDQDGKEIECWKGQKTSRIADLGITANGKELITVCKESTILL  426

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKK  645
            FGWE+K+EK I+EDQ I SF +   ++  F L+ L+ +
Sbjct  427  FGWETKSEKFIEEDQTIISFALSSDRK--FLLISLSNE  462



>gb|EYU42800.1| hypothetical protein MIMGU_mgv1a003351mg [Erythranthe guttata]
Length=590

 Score =   188 bits (477),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 108/140 (77%), Gaps = 14/140 (10%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LVSLLN+E+H+WNIDG    +AK+KGHKR+RFVVRSCFGGL++AFIASGSEDSQVYIWH
Sbjct  448  LLVSLLNEELHVWNIDGCTKLVAKYKGHKRSRFVVRSCFGGLEQAFIASGSEDSQVYIWH  507

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN--------  337
            R S EL+ TL GHS TVNCVSWN  NP+MLASASDDRTIRIWGL QVN+ +N        
Sbjct  508  RLSKELILTLAGHSATVNCVSWNPVNPYMLASASDDRTIRIWGLNQVNMNKNGGQYSHNN  567

Query  336  ------STVCNGVHHCNGGS  295
                   +  NGV++CNG S
Sbjct  568  NNNNNSRSNSNGVNYCNGVS  587


 Score =   116 bits (290),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDG+ IF+GV+DKSISMWDL+G EL+CW+GQ+T   +DIGITTDGK++++V KE  ILL
Sbjct  360  APDGRSIFSGVSDKSISMWDLEGKELKCWRGQKTTMIADIGITTDGKELITVCKETIILL  419

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKK  645
            FGWE+K+EK I ED  I SF + + ++  F LV L  +
Sbjct  420  FGWETKSEKIIVEDHPIISFALSEDKK--FLLVSLLNE  455



>ref|XP_003532075.1| PREDICTED: WD repeat-containing protein 26-like [Glycine max]
 gb|KHM99675.1| WD repeat-containing protein 26 [Glycine soja]
Length=581

 Score =   206 bits (523),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            + +   LV+LLNQEIHLWNI+G    + K++ HKR+RFV+RSCFGGL+++FIASGSEDSQ
Sbjct  449  KDSRLLLVNLLNQEIHLWNIEGDPKLVGKYRSHKRSRFVIRSCFGGLEQSFIASGSEDSQ  508

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHRSSG+L+ TL GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK++N+K  +  
Sbjct  509  VYIWHRSSGDLIETLPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKRLNVKYPNVR  568

Query  327  CNGVHHCNGG  298
             NGVH+CNGG
Sbjct  569  TNGVHYCNGG  578


 Score = 97.1 bits (240),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P GK I +G++DKSI MWDLDG E+E WKGQRT++ SD+ IT DG+ ++S+ K+ +IL F
Sbjct  367  PSGKYILSGLSDKSICMWDLDGKEVESWKGQRTLKISDLEITGDGEHMLSICKDNSILYF  426

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E++ E+ I EDQ ITSF +
Sbjct  427  NKETRDERYIDEDQTITSFSL  447



>gb|EYU42813.1| hypothetical protein MIMGU_mgv1a003386mg [Erythranthe guttata]
 gb|EYU42815.1| hypothetical protein MIMGU_mgv1a003386mg [Erythranthe guttata]
Length=588

 Score =   182 bits (462),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LVSLLN E+H+WNIDG    +AK+KGHKR RFVVRSCFGGL++AFIASGSEDSQVYIWH
Sbjct  453  LLVSLLNGELHVWNIDGCTRLVAKYKGHKRTRFVVRSCFGGLEQAFIASGSEDSQVYIWH  512

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL  346
            R S EL+ TL GH+  VNCVSWN ANP+MLASASDDRTIRIWGL QVN+
Sbjct  513  RLSKELILTLAGHTAAVNCVSWNPANPYMLASASDDRTIRIWGLNQVNM  561


 Score =   116 bits (290),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGK IF+GV+DKSISMWDL+G EL+CW+GQ+T   +DIG+T DGK++V+V KE  ILL
Sbjct  365  APDGKSIFSGVSDKSISMWDLEGKELKCWRGQKTTMIADIGMTADGKELVTVCKETVILL  424

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCL  654
            FGWE+++EK+I ED  I SF + + ++  F LV L
Sbjct  425  FGWETESEKTIVEDHPIISFALSEDKK--FLLVSL  457



>gb|EYU42814.1| hypothetical protein MIMGU_mgv1a003386mg [Erythranthe guttata]
 gb|EYU42816.1| hypothetical protein MIMGU_mgv1a003386mg [Erythranthe guttata]
Length=489

 Score =   182 bits (461),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LVSLLN E+H+WNIDG    +AK+KGHKR RFVVRSCFGGL++AFIASGSEDSQVYIWH
Sbjct  354  LLVSLLNGELHVWNIDGCTRLVAKYKGHKRTRFVVRSCFGGLEQAFIASGSEDSQVYIWH  413

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL  346
            R S EL+ TL GH+  VNCVSWN ANP+MLASASDDRTIRIWGL QVN+
Sbjct  414  RLSKELILTLAGHTAAVNCVSWNPANPYMLASASDDRTIRIWGLNQVNM  462


 Score =   115 bits (288),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGK IF+GV+DKSISMWDL+G EL+CW+GQ+T   +DIG+T DGK++V+V KE  ILL
Sbjct  266  APDGKSIFSGVSDKSISMWDLEGKELKCWRGQKTTMIADIGMTADGKELVTVCKETVILL  325

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCL  654
            FGWE+++EK+I ED  I SF + + ++  F LV L
Sbjct  326  FGWETESEKTIVEDHPIISFALSEDKK--FLLVSL  358



>ref|XP_006602271.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Glycine 
max]
 gb|KHN28541.1| WD repeat-containing protein 26 [Glycine soja]
Length=546

 Score =   201 bits (511),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            + +   LV+LLNQEIHLWNI+G    + K++ HKR RFV+RSC GGL ++FIASGSEDSQ
Sbjct  414  KDSRLLLVNLLNQEIHLWNIEGDPKLVGKYRSHKRTRFVIRSCLGGLKQSFIASGSEDSQ  473

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHRSSG+LV  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK++N+K  +  
Sbjct  474  VYIWHRSSGDLVEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKRLNVKYPNVR  533

Query  327  CNGVHHCNGG  298
             NGVH+CNGG
Sbjct  534  TNGVHYCNGG  543


 Score = 95.1 bits (235),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P GK I +G++DKSI MWDLDG E+E WKGQRT++ SD+ IT DG+ ++S+ K+  IL F
Sbjct  332  PSGKYILSGLSDKSICMWDLDGKEVESWKGQRTLKISDLEITGDGEHMLSICKDNAILYF  391

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+  E+ I EDQ ITSF +
Sbjct  392  NKETGDERYIDEDQTITSFSL  412



>ref|XP_006602270.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Glycine 
max]
Length=580

 Score =   201 bits (511),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            + +   LV+LLNQEIHLWNI+G    + K++ HKR RFV+RSC GGL ++FIASGSEDSQ
Sbjct  448  KDSRLLLVNLLNQEIHLWNIEGDPKLVGKYRSHKRTRFVIRSCLGGLKQSFIASGSEDSQ  507

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHRSSG+LV  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK++N+K  +  
Sbjct  508  VYIWHRSSGDLVEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKRLNVKYPNVR  567

Query  327  CNGVHHCNGG  298
             NGVH+CNGG
Sbjct  568  TNGVHYCNGG  577


 Score = 95.1 bits (235),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P GK I +G++DKSI MWDLDG E+E WKGQRT++ SD+ IT DG+ ++S+ K+  IL F
Sbjct  366  PSGKYILSGLSDKSICMWDLDGKEVESWKGQRTLKISDLEITGDGEHMLSICKDNAILYF  425

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+  E+ I EDQ ITSF +
Sbjct  426  NKETGDERYIDEDQTITSFSL  446



>gb|EPS60063.1| hypothetical protein M569_14740 [Genlisea aurea]
Length=622

 Score =   183 bits (464),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LVSLLN+E+HLWNIDG    I+K+KGHKR+RFVVRSCFGGLDEAFI SGSEDSQVYIWH
Sbjct  478  LLVSLLNEELHLWNIDGVPKVISKYKGHKRSRFVVRSCFGGLDEAFIGSGSEDSQVYIWH  537

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVN  349
            R SGEL+ TL GHSG VNCVSWN  NPHMLAS SDDRTIRIWGL +++
Sbjct  538  RVSGELILTLGGHSGAVNCVSWNPTNPHMLASGSDDRTIRIWGLNRMD  585


 Score =   111 bits (278),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            + DG+ +F+GV+DKSI MWD +G E+ECWKGQ+TIR +D+G+T DGK++++V KE +ILL
Sbjct  390  AADGQSVFSGVSDKSICMWDTEGKEMECWKGQKTIRIADMGVTKDGKELITVCKETSILL  449

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKK  645
            F WE  +EK I+EDQ+ITSF +   ++  F LV L  +
Sbjct  450  FEWERNSEKFIEEDQIITSFTVSDDRK--FLLVSLLNE  485



>ref|XP_004303899.1| PREDICTED: WD repeat-containing protein 26 [Fragaria vesca subsp. 
vesca]
Length=578

 Score =   195 bits (495),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLW+I G V  +AK++GHKR RFV+RSCFGGL+EAFIASGSEDSQVY+WH
Sbjct  453  LLVNLLNQEIHLWSIAGEVKLVAKYQGHKRTRFVIRSCFGGLEEAFIASGSEDSQVYVWH  512

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R SGEL+  L GHSG VN VSWN  NPHMLASASDDRTIRIWGL ++ +K      NG+H
Sbjct  513  RCSGELIEVLPGHSGAVNSVSWNPKNPHMLASASDDRTIRIWGLNELKVKHKDAHSNGIH  572

Query  312  HCNGGS  295
             CNGGS
Sbjct  573  CCNGGS  578


 Score = 95.9 bits (237),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK IF+GVTDKSI  W+L+G E+ECWKGQRT + SD+ IT+DGK+I+S  +E  ILL 
Sbjct  366  PDGKWIFSGVTDKSICTWELEGKEVECWKGQRTSKISDLEITSDGKKILSTCRENAILLL  425

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+K +  ++ED+ ITSF +
Sbjct  426  DREAKVDILLEEDKPITSFSL  446



>ref|XP_006351997.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006351998.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Solanum 
tuberosum]
Length=584

 Score =   177 bits (450),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 100/126 (79%), Gaps = 3/126 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             L+SLLNQEIHLW+IDG +  +  +KGHK+ RF+VR CFGGL +AFIASGSEDSQ+YIWH
Sbjct  456  ILISLLNQEIHLWSIDGIIKLLHIYKGHKQKRFIVRPCFGGLRQAFIASGSEDSQIYIWH  515

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNS---TVCN  322
            R S +L+G L GH+GTVNCVSWN ANPHMLAS  DDRTIRIWGL   N+ +++    V N
Sbjct  516  RCSQQLLGKLAGHTGTVNCVSWNPANPHMLASGGDDRTIRIWGLNPANVMKHNDEGAVSN  575

Query  321  GVHHCN  304
            GV+ CN
Sbjct  576  GVNDCN  581


 Score =   112 bits (279),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDG+RIF  VTDKSISMWDL+G EL+CWKG R  + +D+GIT+DGK +VSV K+  ILL
Sbjct  368  APDGERIFCAVTDKSISMWDLEGKELQCWKGHRVTKIADLGITSDGKHMVSVCKDNVILL  427

Query  758  FGWESKAEKSIKEDQVITSFCI  693
             G ESK E+ I ED+VITSF +
Sbjct  428  VGLESKTEQIILEDEVITSFVL  449



>ref|XP_002513152.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF49655.1| WD-repeat protein, putative [Ricinus communis]
Length=578

 Score =   181 bits (459),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQE+HLWNI+GS   ++ +KGH R RF++RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  453  LLVNLINQELHLWNIEGSPKIVSTYKGHTRTRFIIRSCFGGFEQAFIASGSEDSQVYIWH  512

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R SGEL+  L GHSG VNCVSWN  N HMLAS SDDRTIRIWGL   +LKQ       VH
Sbjct  513  RGSGELLLALPGHSGAVNCVSWNPENLHMLASGSDDRTIRIWGLNHYSLKQREQSNGTVH  572

Query  312  HCNGGS  295
             CNG S
Sbjct  573  RCNGRS  578


 Score =   102 bits (254),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 70/97 (72%), Gaps = 2/97 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ IF G+TD+SI +WDLDG ELECWK Q+T+R SD+ IT DGK+I+S+ KE +ILL 
Sbjct  366  PDGRGIFAGMTDRSICLWDLDGKELECWKEQKTLRISDMAITDDGKKIISMCKENSILLL  425

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKK  645
              E+K E  I+E++ ITSF + +  +  F LV L  +
Sbjct  426  DREAKFESLIEEEETITSFSLSKDNK--FLLVNLINQ  460



>ref|XP_007146281.1| hypothetical protein PHAVU_006G027500g [Phaseolus vulgaris]
 gb|ESW18275.1| hypothetical protein PHAVU_006G027500g [Phaseolus vulgaris]
Length=586

 Score =   189 bits (479),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 104/128 (81%), Gaps = 3/128 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             L +LL+QEIHLWNI+G    I K++ HKR R +VRSCFGGL ++FIASGSEDSQVYIWH
Sbjct  455  LLANLLDQEIHLWNIEGDPKLIGKYRSHKRTRLIVRSCFGGLKQSFIASGSEDSQVYIWH  514

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLK--QNSTVCNG  319
            R+SG+LV  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK++N+K   N    NG
Sbjct  515  RNSGDLVEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKRLNVKYPPNLLRTNG  574

Query  318  -VHHCNGG  298
             VH+CNGG
Sbjct  575  VVHYCNGG  582


 Score = 94.4 bits (233),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P GK I +G++DKSI MWDLDG E+E WKGQRT++ SD+ IT DG+  +S+ K+  IL F
Sbjct  368  PSGKYILSGLSDKSICMWDLDGKEVESWKGQRTLKISDLEITGDGEHFLSICKDNAILFF  427

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+K E  I+E+Q ITSF +
Sbjct  428  NRETKEEIFIEEEQTITSFSL  448



>ref|XP_008775985.1| PREDICTED: WD repeat-containing protein 26-like [Phoenix dactylifera]
Length=582

 Score =   186 bits (473),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             L++LLNQEIHLW++      + ++ GHKR+RF++RSCFGG +EAFIASGSEDSQVYIWH
Sbjct  455  LLINLLNQEIHLWSVTDDPILVTRYTGHKRSRFLIRSCFGGYEEAFIASGSEDSQVYIWH  514

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGV-  316
            R +G+L+  L GHSG VNCVSWN ANPHMLASASDD TIRIWGLK+  LK+     NGV 
Sbjct  515  RGTGDLIEALPGHSGAVNCVSWNPANPHMLASASDDHTIRIWGLKKATLKRKEAYSNGVI  574

Query  315  HHCNG  301
            HHCNG
Sbjct  575  HHCNG  579


 Score = 96.3 bits (238),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG++IF+ V DKS  +WDLDG ELE WKGQR  R+S++ +T DG+ I+S+ +E  ILL 
Sbjct  368  PDGRQIFSCVEDKSTCLWDLDGKELESWKGQRNTRSSEMAVTKDGRWIISICRETAILLL  427

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+K EK I+EDQ +TSF +
Sbjct  428  DREAKLEKLIEEDQTVTSFSL  448



>ref|XP_008790475.1| PREDICTED: WD repeat-containing protein 26-like [Phoenix dactylifera]
Length=582

 Score =   177 bits (448),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             L++L+NQEIHLW+I     C+ +++GHKR+RF++RSCFGG  +AFIASGSEDSQVYIWH
Sbjct  455  LLLNLVNQEIHLWSIKDDPVCVTRYRGHKRSRFLIRSCFGGYKQAFIASGSEDSQVYIWH  514

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGV-  316
            R +G+L+  L GHSG VNCVSWN A+PHMLASASDD TIRIWGL + +LK      NGV 
Sbjct  515  RGTGDLIKALPGHSGAVNCVSWNPADPHMLASASDDHTIRIWGLNRAHLKCKEAYSNGVA  574

Query  315  HHCNG  301
              CNG
Sbjct  575  DQCNG  579


 Score =   102 bits (254),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG++IF+G TDKS  +WDLDG E+E WKGQRT RTSD+ +T DG+ I+S+ +E  ILL 
Sbjct  368  PDGRQIFSGATDKSTCLWDLDGKEVESWKGQRTTRTSDMAVTKDGRWIISICRETAILLV  427

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+K EK I+EDQ ITSF +
Sbjct  428  DREAKLEKLIEEDQTITSFSL  448



>ref|XP_004253388.2| PREDICTED: WD repeat-containing protein 26-like [Solanum lycopersicum]
Length=460

 Score =   166 bits (419),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            LVSLLNQEIHLW+IDG +  +  +KGHK+ RF+++ CFGGL +AFIASGSEDSQVYIW R
Sbjct  333  LVSLLNQEIHLWSIDGVIKLVHIYKGHKQERFIIKPCFGGLRQAFIASGSEDSQVYIWDR  392

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNS-----TVC  325
             S +L+  L GHSGTVNCVSWN ANPHMLAS SDD+TIRIWGL   N+ +++     + C
Sbjct  393  CSQQLLRKLAGHSGTVNCVSWNPANPHMLASGSDDQTIRIWGLNPANVMKHNDEGAVSNC  452

Query  324  NGVHHC  307
             G  HC
Sbjct  453  VGDCHC  458


 Score =   111 bits (278),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDG+RIF GVT+KSISMWDL G EL CWKG R  + +D+GIT+DGKQ+VS+ K   ILL
Sbjct  244  APDGERIFCGVTNKSISMWDLQGKELRCWKGHRITKIADLGITSDGKQMVSLCKNNVILL  303

Query  758  FGWESKAEKSIKEDQVITSFCI  693
             G ESK EK I ED+VITSF +
Sbjct  304  VGLESKTEKIIVEDEVITSFVL  325



>ref|XP_006399358.1| hypothetical protein EUTSA_v10013060mg [Eutrema salsugineum]
 ref|XP_006399359.1| hypothetical protein EUTSA_v10013060mg [Eutrema salsugineum]
 gb|ESQ40811.1| hypothetical protein EUTSA_v10013060mg [Eutrema salsugineum]
 gb|ESQ40812.1| hypothetical protein EUTSA_v10013060mg [Eutrema salsugineum]
Length=587

 Score =   172 bits (435),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 98/130 (75%), Gaps = 6/130 (5%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEI LWNI+G    +A++KGHKR+RF++RSCFGG  +AFIASGSEDSQVYIWH
Sbjct  457  LLVNLLNQEIRLWNIEGDPKIVARYKGHKRSRFIIRSCFGGYKQAFIASGSEDSQVYIWH  516

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG--  319
            RS+G+L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++N +       G  
Sbjct  517  RSTGKLILELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDRINPQNQRKQVQGSS  576

Query  318  ----VHHCNG  301
                +H CNG
Sbjct  577  SNGVIHRCNG  586


 Score = 97.4 bits (241),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ I  G+TD+SI MWDLDG E+ECWKGQRT + SDI +T DGK +VSV K+  I LF
Sbjct  370  PDGQGIIAGMTDRSICMWDLDGREMECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLF  429

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+  EK I+E+ +ITSF +
Sbjct  430  DREATVEKLIEEEDMITSFSL  450



>ref|XP_010908947.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c-like 
[Elaeis guineensis]
Length=272

 Score =   171 bits (433),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             L++L+NQEIHLW+I      + +++GHKR+RF++RSCFGG ++ FIASGSEDSQVYIW+
Sbjct  145  LLINLVNQEIHLWSIKDDPILVTRYRGHKRSRFLIRSCFGGYEQTFIASGSEDSQVYIWY  204

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGV-  316
            R +G+L+  L GHSG VNCVSWN  N HMLASASDD TIRIWGL + NLK+     NGV 
Sbjct  205  RETGDLIRALPGHSGAVNCVSWNPTNLHMLASASDDHTIRIWGLNRANLKRKEAYSNGVA  264

Query  315  HHCNG  301
            H CNG
Sbjct  265  HQCNG  269


 Score = 96.3 bits (238),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG++IF+G TD S  +WDLDG ELE WKGQRT R+S++  T DG+ ++S+ +E  ILL 
Sbjct  58   PDGRQIFSGGTDNSTCLWDLDGKELESWKGQRTTRSSEMAFTKDGRWVISICRETAILLL  117

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+K EK I+EDQ +TSF +
Sbjct  118  DREAKLEKLIEEDQTVTSFSL  138



>ref|XP_006845990.1| PREDICTED: WD repeat-containing protein 26 [Amborella trichopoda]
 gb|ERN07665.1| hypothetical protein AMTR_s00155p00039520 [Amborella trichopoda]
Length=579

 Score =   167 bits (422),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 99/127 (78%), Gaps = 2/127 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             L++L+N+EIHLW+I+G    + +++GHKR+R V+RSCFGGL++AFIASGSEDSQVY+WH
Sbjct  453  LLMNLVNEEIHLWSINGEPKLVGRYRGHKRSRLVIRSCFGGLEQAFIASGSEDSQVYLWH  512

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN-STVCNG-  319
            R + EL   L GHSG VNCVSWN  N HM ASASDD TIRIWG++ V  K+  +   NG 
Sbjct  513  RGTRELFEVLPGHSGAVNCVSWNPVNAHMFASASDDSTIRIWGVEGVGSKRKGACSSNGT  572

Query  318  VHHCNGG  298
            +HHCNGG
Sbjct  573  IHHCNGG  579


 Score =   100 bits (249),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK +  GV+DKSI MWDLDG E++CWKGQR ++ SD+ +T+DGK I+S+ +   ++L+
Sbjct  366  PDGKHLIGGVSDKSICMWDLDGKEIDCWKGQRVLKVSDMAVTSDGKTIISICRYSAVMLY  425

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E K E+ I+EDQ ITSF +
Sbjct  426  DREGKRERLIEEDQSITSFSL  446



>ref|NP_196473.1| WD40 domain-containing protein [Arabidopsis thaliana]
 ref|NP_001078546.1| WD40 domain-containing protein [Arabidopsis thaliana]
 dbj|BAB10005.1| WD-repeat protein-like [Arabidopsis thaliana]
 gb|AAK96726.1| WD-repeat protein-like [Arabidopsis thaliana]
 gb|AAL47352.1| WD-repeat protein-like [Arabidopsis thaliana]
 gb|AED91320.1| WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AED91321.1| WD40 domain-containing protein [Arabidopsis thaliana]
Length=589

 Score =   171 bits (434),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 100/131 (76%), Gaps = 7/131 (5%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEI LWNI+G    ++++KGHKR+RF++RSCFGG  +AFIASGSEDSQVYIWH
Sbjct  458  ILVNLLNQEIRLWNIEGDPKIVSRYKGHKRSRFIIRSCFGGYKQAFIASGSEDSQVYIWH  517

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVN-------LKQNS  334
            RS+G+L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++N       L Q S
Sbjct  518  RSTGKLIVELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDRINQQNQKKKLVQGS  577

Query  333  TVCNGVHHCNG  301
            +    +H CNG
Sbjct  578  SSNGVIHRCNG  588


 Score = 94.7 bits (234),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ I  G+TD+SI MWDLDG E ECWKGQRT + SDI +T DGK +VSV K+  I LF
Sbjct  371  PDGQGIIAGMTDRSICMWDLDGREKECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLF  430

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+  E+ I+E+ +ITSF +
Sbjct  431  DREATVERLIEEEDMITSFSL  451



>ref|XP_003578602.1| PREDICTED: WD repeat-containing protein 26 [Brachypodium distachyon]
Length=595

 Score =   169 bits (427),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 101/138 (73%), Gaps = 14/138 (10%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+ +EIHLWNI        ++ GHKR+RFV+RSCFGG +++FIASGSEDS+VYIWH
Sbjct  454  LLVNLMTEEIHLWNIRNDPIRCKRYTGHKRSRFVIRSCFGGSEQSFIASGSEDSKVYIWH  513

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ-------NS  334
            R++G+++ TL GHSG VNCVSWN  NPHMLASASDD TIRIWGLK+ ++K+       N 
Sbjct  514  RATGDVIETLSGHSGAVNCVSWNPTNPHMLASASDDHTIRIWGLKKASMKRKDVGSSSNG  573

Query  333  TVCNG-------VHHCNG  301
            T  NG       VH CNG
Sbjct  574  TCMNGSANGNGFVHQCNG  591


 Score = 95.9 bits (237),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK+I +G++D+S+ +WDLDG E +CWKGQR+ +T D  +  DGK I+S++++ TILLF
Sbjct  367  PDGKQILSGLSDQSLCLWDLDGKEADCWKGQRSSKTLDFAVAKDGKLIISMNRDCTILLF  426

Query  755  GWESKAEKSIKEDQVITSFCI  693
              ++K E+ I+ED  ITSF +
Sbjct  427  NRDTKQERLIEEDNTITSFSL  447



>ref|XP_009412042.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
Length=586

 Score =   169 bits (428),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 100/129 (78%), Gaps = 5/129 (4%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLW I      I ++KGH+R+R+++RSCFGG+ +AFIASGSEDSQVYIWH
Sbjct  455  LLVNLINQEIHLWCIKDDPRLITRYKGHRRSRYLIRSCFGGIKQAFIASGSEDSQVYIWH  514

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL-KQVNLKQNSTV-CNG  319
            R SG+LV  L GHSG VNCVSWN +NPHMLASASDD TIR+WGL K+V+LK  S    NG
Sbjct  515  RGSGDLVEALPGHSGAVNCVSWNPSNPHMLASASDDHTIRVWGLSKKVDLKPTSEGHSNG  574

Query  318  V---HHCNG  301
            V     CNG
Sbjct  575  VVAHRQCNG  583


 Score = 94.0 bits (232),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGKR+F+GVTDKSI +WDLDG E++ W G RT  TSDI IT DG+ I++  K   I+L 
Sbjct  368  PDGKRLFSGVTDKSICIWDLDGKEIDSWNGLRTSMTSDISITKDGRHIINTCKGNVIMLL  427

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E K EK ++E+Q ITSF +
Sbjct  428  DREMKMEKLVEEEQPITSFTL  448



>ref|XP_010491500.1| PREDICTED: WD repeat-containing protein 26-like [Camelina sativa]
Length=587

 Score =   167 bits (422),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 6/130 (5%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEI LWNI+G    ++++KGH+R+RF++RSCFGG  +AFIASGSEDSQVYIWH
Sbjct  457  LLVNLLNQEIRLWNIEGDPKIVSRYKGHRRSRFIIRSCFGGYKQAFIASGSEDSQVYIWH  516

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG--  319
            RS+G+L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL+++N +       G  
Sbjct  517  RSTGKLIIELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLERINQQNQKKQVQGSS  576

Query  318  ----VHHCNG  301
                +H CNG
Sbjct  577  SNGVIHRCNG  586


 Score = 96.3 bits (238),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ I  G+TD+SI MWDLDG E+ECWKGQRT + SDI +T DGK +VSV K+  I LF
Sbjct  370  PDGQGIIAGMTDRSICMWDLDGREIECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLF  429

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+  E+ I+E+ +ITSF +
Sbjct  430  DREATVERLIEEEDMITSFSL  450



>ref|XP_006287344.1| hypothetical protein CARUB_v10000543mg [Capsella rubella]
 gb|EOA20242.1| hypothetical protein CARUB_v10000543mg [Capsella rubella]
Length=587

 Score =   166 bits (421),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 98/130 (75%), Gaps = 6/130 (5%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEI LWNI+G    ++++KGH+R+RF++RSCFGG  +AFIASGSEDSQVYIWH
Sbjct  457  LLVNLLNQEIRLWNIEGDPKIVSRYKGHRRSRFIIRSCFGGYKQAFIASGSEDSQVYIWH  516

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG--  319
            RS+G+L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++N +       G  
Sbjct  517  RSTGKLIIELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDRINQQNQKKQVQGSS  576

Query  318  ----VHHCNG  301
                +H CNG
Sbjct  577  SNGVIHRCNG  586


 Score = 96.3 bits (238),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ I  G+TD+SI MWDLDG E+ECWKGQRT + SDI +T DGK +VSV K+  I LF
Sbjct  370  PDGQGIIAGMTDRSICMWDLDGREIECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLF  429

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+  E+ I+E+ +ITSF +
Sbjct  430  DREATVERLIEEEDMITSFSL  450



>ref|XP_010423053.1| PREDICTED: WD repeat-containing protein 26-like [Camelina sativa]
Length=587

 Score =   166 bits (419),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 98/130 (75%), Gaps = 6/130 (5%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEI LWNI+G    ++ +KGH+R+RF++RSCFGG  +AFIASGSEDSQVYIWH
Sbjct  457  LLVNLLNQEIRLWNIEGDPKIVSSYKGHRRSRFIIRSCFGGYKQAFIASGSEDSQVYIWH  516

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG--  319
            RS+G+L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL+++N +       G  
Sbjct  517  RSTGKLIIELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLERINQQNQKKQVQGSS  576

Query  318  ----VHHCNG  301
                +H CNG
Sbjct  577  SNGVIHRCNG  586


 Score = 96.3 bits (238),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ I  G+TD+SI MWDLDG E+ECWKGQRT + SDI +T DGK +VSV K+  I LF
Sbjct  370  PDGQGIIAGMTDRSICMWDLDGREIECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLF  429

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+  E+ I+E+ +ITSF +
Sbjct  430  DREATVERLIEEEDMITSFSL  450



>dbj|BAK03563.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   170 bits (430),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 98/122 (80%), Gaps = 2/122 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+N++IHLWNI      + ++ GHKR+RFV+RSCFGG ++AFIASGSED++VYIWH
Sbjct  454  LLVNLINEQIHLWNIRNDPIRVKRYTGHKRSRFVIRSCFGGSEQAFIASGSEDAKVYIWH  513

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNS--TVCNG  319
            R+SG+++ TL GHSG VNCVSWN ANPHMLASASDD TIRIWGLK+   K+    +  NG
Sbjct  514  RASGDVIETLSGHSGAVNCVSWNPANPHMLASASDDHTIRIWGLKKATAKRRDAGSSSNG  573

Query  318  VH  313
            +H
Sbjct  574  IH  575


 Score = 90.9 bits (224),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK+I +G++D+ + +WDLDG + +CW+GQR+ +TSD  ++ DGK I+S  ++  ILLF
Sbjct  367  PDGKQILSGLSDQRLCLWDLDGKQADCWEGQRSTKTSDFAVSKDGKLIISTSRDSAILLF  426

Query  755  GWESKAEKSIKEDQVITSFCI  693
              ++K E+ I+E++ +TSF +
Sbjct  427  NRDTKQERLIEEEETVTSFSL  447



>gb|EMT24581.1| hypothetical protein F775_29927 [Aegilops tauschii]
Length=557

 Score =   169 bits (427),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 100/124 (81%), Gaps = 4/124 (3%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+N++IHLWNI      + ++ GHKR+RFV+RSCFGG ++AFIASGSED++VYIWH
Sbjct  414  LLVNLINEQIHLWNIRTDPIRVKRYTGHKRSRFVIRSCFGGSEQAFIASGSEDAKVYIWH  473

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ----NSTVC  325
            R+SG+++ TL GHSG VNCVSWN  NPHMLASASDD TIRIWGLK+  +K+    +S+  
Sbjct  474  RASGDVIETLSGHSGAVNCVSWNPTNPHMLASASDDHTIRIWGLKKATVKRRDAGSSSGS  533

Query  324  NGVH  313
            NG+H
Sbjct  534  NGIH  537


 Score = 92.0 bits (227),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK+I +G+ D+S+ +WDLDG + +CW+GQR+ +TSD  ++ DGK I+S  ++  ILLF
Sbjct  327  PDGKQILSGLNDQSLCLWDLDGKQADCWEGQRSTKTSDFAVSKDGKLIISTSRDSAILLF  386

Query  755  GWESKAEKSIKEDQVITSFCI  693
              ++K E+ I+E+  +TSF +
Sbjct  387  NRDTKQERLIEEEHTVTSFSL  407



>emb|CDY21550.1| BnaC09g47420D [Brassica napus]
Length=578

 Score =   165 bits (418),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 100/129 (78%), Gaps = 6/129 (5%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            LV+LLNQEI LW+I+G    + ++KGHKR+RF++RSCFGG ++ FIASGSEDSQVYIWHR
Sbjct  449  LVNLLNQEIRLWSIEGDPKIVTRYKGHKRSRFLIRSCFGGYEQGFIASGSEDSQVYIWHR  508

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL-KQNSTV----C  325
            S+G+L+  L GH+G VNCVSW+  N H++ASASDD TIRIWGL ++N  KQ   V     
Sbjct  509  STGKLITELPGHAGAVNCVSWSPTNLHVMASASDDGTIRIWGLDRINPHKQEKQVQGSSS  568

Query  324  NGV-HHCNG  301
            NGV H CNG
Sbjct  569  NGVLHQCNG  577


 Score = 94.7 bits (234),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFG  753
            DGK I  G+TD+SI MWDLDG E+ECWKGQRT + SDI +T DGK +VSV K+  I LF 
Sbjct  362  DGKGIIAGMTDRSICMWDLDGREMECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLFD  421

Query  752  WESKAEKSIKEDQVITSFCI  693
             E+  E+ I+E++ ITSF +
Sbjct  422  REATVERLIEEEETITSFSL  441



>ref|XP_011032764.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011032766.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011032767.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011032768.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011032769.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011032770.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
Length=558

 Score =   154 bits (389),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLWNIDG +  +A +KGHKR+RFV+RSCFGG ++AFIASGSEDSQ+Y+WH
Sbjct  456  LLVNLLNQEIHLWNIDGDIRLVATYKGHKRSRFVIRSCFGGHEQAFIASGSEDSQIYLWH  515

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLAS  397
            R+S ELV  L GHSG VNCVSWN ANPHMLAS
Sbjct  516  RASRELVEALPGHSGAVNCVSWNPANPHMLAS  547


 Score =   105 bits (262),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK IF+G+ DKSI MW+LDG E+ECWKGQRT++ SD+ IT+DGKQI+S+ +   +LL 
Sbjct  369  PDGKWIFSGINDKSICMWELDGKEVECWKGQRTLKISDLEITSDGKQIISMCRGTALLLL  428

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+K E+ I+EDQ ITSF +
Sbjct  429  DREAKVERVIEEDQAITSFSL  449



>ref|XP_010456450.1| PREDICTED: WD repeat-containing protein 26-like, partial [Camelina 
sativa]
Length=441

 Score =   163 bits (412),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 99/131 (76%), Gaps = 7/131 (5%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEI LWNI+G    ++++KGH+R+RF++RSCFGG  +AFIASGSEDSQVYIWH
Sbjct  310  LLVNLLNQEIRLWNIEGDPKIVSRYKGHRRSRFIIRSCFGGYKQAFIASGSEDSQVYIWH  369

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLK-------QNS  334
            RS+G+L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++N +       Q S
Sbjct  370  RSTGKLITELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDKINQQNQKKKQVQGS  429

Query  333  TVCNGVHHCNG  301
                 +H CNG
Sbjct  430  NSNGVIHRCNG  440


 Score = 96.3 bits (238),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ I  G+TD+SI MWDLDG E+ECWKGQRT + SDI +T DGK +VSV K+  I LF
Sbjct  223  PDGQGIIAGMTDRSICMWDLDGREIECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLF  282

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+  E+ I+E+ +ITSF +
Sbjct  283  DREATVERLIEEEDMITSFSL  303



>ref|XP_009131082.1| PREDICTED: WD repeat-containing protein 26-like [Brassica rapa]
 ref|XP_009131084.1| PREDICTED: WD repeat-containing protein 26-like [Brassica rapa]
Length=589

 Score =   166 bits (421),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 99/130 (76%), Gaps = 6/130 (5%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEI LWNI+G    + ++KGHKR+RF++RSCFGG  +AFIASGSEDSQVYIWH
Sbjct  459  LLVNLLNQEIRLWNIEGEPKIVMRYKGHKRSRFLIRSCFGGYKQAFIASGSEDSQVYIWH  518

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQV-----NLKQNSTV  328
            RS+G+L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++       +  ++ 
Sbjct  519  RSTGKLIIELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDKINQQNQKKQVQASS  578

Query  327  CNGV-HHCNG  301
             NGV H CNG
Sbjct  579  SNGVLHRCNG  588


 Score = 92.4 bits (228),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFG  753
            DG+ I  G+TD+SI MWDLDG E+ECWKGQRT + SDI +T DGK +VSV K   I LF 
Sbjct  373  DGQGIIAGMTDRSICMWDLDGREMECWKGQRTQKVSDIAMTDDGKWVVSVCKGSVISLFD  432

Query  752  WESKAEKSIKEDQVITSFCI  693
             E+  E+ I+E+ +ITSF +
Sbjct  433  REATVERLIEEEDMITSFSL  452



>ref|XP_008676635.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW61288.1| hypothetical protein ZEAMMB73_320588 [Zea mays]
Length=598

 Score =   171 bits (433),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+++EIHLWNI      + ++ GHKR RFV+RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  454  LLVNLVSEEIHLWNIRNDPVRVNRYNGHKRTRFVIRSCFGGFEQAFIASGSEDSQVYIWH  513

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R++G+L+ TL GHSGTVNCVSWN ANPHMLASASDD T+RIWG K+ +LK+      G  
Sbjct  514  RATGDLIETLAGHSGTVNCVSWNPANPHMLASASDDHTVRIWGAKKSSLKRKDV---GSS  570

Query  312  HCN  304
            +CN
Sbjct  571  NCN  573


 Score = 87.0 bits (214),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK++ +G+ D++  +WDLDG E++CWKGQ +  TSD  +  DG  I+S+ K+ TILLF
Sbjct  368  PDGKQL-SGLADQNFCIWDLDGKEVDCWKGQGSTGTSDFAVAKDGNLIISMSKQNTILLF  426

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+K E+ I+E   ITSFC+
Sbjct  427  DRETKQERIIEEGSTITSFCL  447



>emb|CDX78343.1| BnaA03g02550D [Brassica napus]
Length=589

 Score =   166 bits (420),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 99/130 (76%), Gaps = 6/130 (5%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEI LWNI+G    + ++KGHKR+RF++RSCFGG  +AFIASGSEDSQVYIWH
Sbjct  459  LLVNLLNQEIRLWNIEGEPKIVMRYKGHKRSRFLIRSCFGGYKQAFIASGSEDSQVYIWH  518

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQV-----NLKQNSTV  328
            RS+G+L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++       +  ++ 
Sbjct  519  RSTGKLIIELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDKINQQNQKKQVQASS  578

Query  327  CNGV-HHCNG  301
             NGV H CNG
Sbjct  579  SNGVLHRCNG  588


 Score = 92.0 bits (227),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFG  753
            DG+ I  G+TD+SI MWDLDG E+ECWKGQRT + SDI +T DGK +VSV K   I LF 
Sbjct  373  DGQGIIAGMTDRSICMWDLDGREMECWKGQRTQKVSDIAMTDDGKWVVSVCKGSVISLFD  432

Query  752  WESKAEKSIKEDQVITSFCI  693
             E+  E+ I+E+ +ITSF +
Sbjct  433  REATVERLIEEEDMITSFSL  452



>ref|XP_009122471.1| PREDICTED: WD repeat-containing protein 26 [Brassica rapa]
 emb|CDX69939.1| BnaA10g22880D [Brassica napus]
Length=580

 Score =   164 bits (416),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 99/129 (77%), Gaps = 6/129 (5%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            LV+LLNQEI LW+I+G    + ++KGHKR+RF++RSCFGG ++ FIASGSEDSQVYIWHR
Sbjct  451  LVNLLNQEIRLWSIEGDPKIVTRYKGHKRSRFLIRSCFGGYEQGFIASGSEDSQVYIWHR  510

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL-KQNSTV----C  325
            S+G+L+  L GH+G VNCVSW+  N  M+ASASDD TIRIWGL ++N  KQ   V     
Sbjct  511  STGKLIIELPGHAGAVNCVSWSPTNLQMMASASDDGTIRIWGLNRINPHKQEKQVQGSSS  570

Query  324  NGV-HHCNG  301
            NGV H CNG
Sbjct  571  NGVLHQCNG  579


 Score = 94.0 bits (232),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFG  753
            DGK I  G+TD+SI MWDLDG E+ECWKGQRT + SDI +T DGK +VSV K+  I LF 
Sbjct  364  DGKGIIAGMTDRSICMWDLDGREMECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLFD  423

Query  752  WESKAEKSIKEDQVITSFCI  693
             E+  E+ I+E+  ITSF +
Sbjct  424  REATVERLIEEEDTITSFSL  443



>ref|XP_009765608.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Nicotiana 
sylvestris]
Length=540

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            LVSL NQEIHLW++ G+V  I+K+KGHKR+RFVVRSCFGGLD+AF+ASGSEDSQVYIWHR
Sbjct  416  LVSLCNQEIHLWDVQGTVKLISKYKGHKRSRFVVRSCFGGLDQAFVASGSEDSQVYIWHR  475

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHH  310
             SGELVGTL GHSGTVNCVSWN ANPHMLASASDDR+IRIWGL +VN+KQ+ TV NG   
Sbjct  476  GSGELVGTLAGHSGTVNCVSWNPANPHMLASASDDRSIRIWGLNRVNMKQHGTVTNGASC  535

Query  309  CNGGS  295
            CNG S
Sbjct  536  CNGRS  540


 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 79/110 (72%), Gaps = 10/110 (9%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKRIF GVTDKSISMWDL+G ELECWKG RTIR SD+GIT+DGK +VSV KE TI+L
Sbjct  327  APDGKRIFCGVTDKSISMWDLEGKELECWKGNRTIRMSDLGITSDGKHVVSVCKENTIVL  386

Query  758  FGWESKAEKSIKEDQVITSFCI----------IQGQQVPFWLVCLTKKFI  639
            F WES+ EK I+EDQ ITSF +          +  Q++  W V  T K I
Sbjct  387  FEWESRTEKVIQEDQAITSFVLSMDNKYVLVSLCNQEIHLWDVQGTVKLI  436



>ref|XP_008676636.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=421

 Score =   170 bits (430),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+++EIHLWNI      + ++ GHKR RFV+RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  277  LLVNLVSEEIHLWNIRNDPVRVNRYNGHKRTRFVIRSCFGGFEQAFIASGSEDSQVYIWH  336

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R++G+L+ TL GHSGTVNCVSWN ANPHMLASASDD T+RIWG K+ +LK+      G  
Sbjct  337  RATGDLIETLAGHSGTVNCVSWNPANPHMLASASDDHTVRIWGAKKSSLKRKDV---GSS  393

Query  312  HCN  304
            +CN
Sbjct  394  NCN  396


 Score = 86.7 bits (213),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK++ +G+ D++  +WDLDG E++CWKGQ +  TSD  +  DG  I+S+ K+ TILLF
Sbjct  191  PDGKQL-SGLADQNFCIWDLDGKEVDCWKGQGSTGTSDFAVAKDGNLIISMSKQNTILLF  249

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+K E+ I+E   ITSFC+
Sbjct  250  DRETKQERIIEEGSTITSFCL  270



>ref|XP_010657105.1| PREDICTED: WD repeat-containing protein 26-like [Vitis vinifera]
Length=581

 Score =   210 bits (534),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLWNI+G    IAK+KGHKR RF++RSCFGG +EAFIASGSEDSQ
Sbjct  451  RDCRFLLVNLLNQEIHLWNIEGEAKFIAKYKGHKRERFIIRSCFGGFEEAFIASGSEDSQ  510

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWH+SSGEL+  L GHSG+VNCVSWN ANPHMLASASDDRTIRIWGL ++N+K+  T 
Sbjct  511  VYIWHKSSGELIEVLPGHSGSVNCVSWNPANPHMLASASDDRTIRIWGLNKINMKRKGTH  570

Query  327  CNGVHHCNGGS  295
             NG H+CNGG+
Sbjct  571  PNGTHYCNGGT  581


 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 74/110 (67%), Gaps = 10/110 (9%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            SPDGK +F G+TD+SI MWDLDG ELECWKGQRT++ SD+ I ++G QI+S+ K+  ILL
Sbjct  368  SPDGKWVFAGITDRSICMWDLDGKELECWKGQRTLQISDLEIASNGNQIMSICKDTAILL  427

Query  758  FGWESKAEKSIKEDQVITSFCI----------IQGQQVPFWLVCLTKKFI  639
            F  E+KAEK I+ED  ITSF +          +  Q++  W +    KFI
Sbjct  428  FDREAKAEKFIEEDHTITSFSLSRDCRFLLVNLLNQEIHLWNIEGEAKFI  477



>gb|KDO44760.1| hypothetical protein CISIN_1g009188mg [Citrus sinensis]
Length=540

 Score =   209 bits (532),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLWNI+G V  +AK+KGHKR+RFV+RSCFGGL++AFIASGSEDSQ
Sbjct  410  RDNKFLLVNLLNQEIHLWNIEGEVKLVAKYKGHKRSRFVIRSCFGGLEQAFIASGSEDSQ  469

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHR+S +L+G L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK +N+K+    
Sbjct  470  VYIWHRASCDLIGALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKDLNVKRKDCH  529

Query  327  CNGVHHCNGGS  295
             NGVH+CNGG+
Sbjct  530  SNGVHYCNGGT  540


 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PD K IF+G  DKSI MW+L G ELECWKGQRT++ SD+ +T+DGKQI+++ KE  +LL 
Sbjct  328  PDRKWIFSGANDKSICMWELGGKELECWKGQRTLKISDLEVTSDGKQIITMCKESALLLL  387

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+EDQ ITSF + +  +  F LV L  + I
Sbjct  388  DREAKVERYIEEDQTITSFSLSRDNK--FLLVNLLNQEI  424



>emb|CBI22069.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLWNI+G    IAK+KGHKR RF++RSCFGG +EAFIASGSEDSQ
Sbjct  337  RDCRFLLVNLLNQEIHLWNIEGEAKFIAKYKGHKRERFIIRSCFGGFEEAFIASGSEDSQ  396

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWH+SSGEL+  L GHSG+VNCVSWN ANPHMLASASDDRTIRIWGL ++N+K+  T 
Sbjct  397  VYIWHKSSGELIEVLPGHSGSVNCVSWNPANPHMLASASDDRTIRIWGLNKINMKRKGTH  456

Query  327  CNGVHHCNGGS  295
             NG H+CNGG+
Sbjct  457  PNGTHYCNGGT  467


 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 74/110 (67%), Gaps = 10/110 (9%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            SPDGK +F G+TD+SI MWDLDG ELECWKGQRT++ SD+ I ++G QI+S+ K+  ILL
Sbjct  254  SPDGKWVFAGITDRSICMWDLDGKELECWKGQRTLQISDLEIASNGNQIMSICKDTAILL  313

Query  758  FGWESKAEKSIKEDQVITSFCI----------IQGQQVPFWLVCLTKKFI  639
            F  E+KAEK I+ED  ITSF +          +  Q++  W +    KFI
Sbjct  314  FDREAKAEKFIEEDHTITSFSLSRDCRFLLVNLLNQEIHLWNIEGEAKFI  363



>ref|XP_006484997.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Citrus 
sinensis]
 ref|XP_006484998.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Citrus 
sinensis]
 ref|XP_006484999.1| PREDICTED: WD repeat-containing protein 26-like isoform X3 [Citrus 
sinensis]
 ref|XP_006485000.1| PREDICTED: WD repeat-containing protein 26-like isoform X4 [Citrus 
sinensis]
Length=581

 Score =   210 bits (534),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLWNI+G V  +AK+KGHKR+RFV+RSCFGGL++AFIASGSEDSQ
Sbjct  451  RDNKFLLVNLLNQEIHLWNIEGEVKLVAKYKGHKRSRFVIRSCFGGLEQAFIASGSEDSQ  510

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHR+S +L+G L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK +N+K+    
Sbjct  511  VYIWHRASCDLIGALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKDLNVKRKDCH  570

Query  327  CNGVHHCNGGS  295
             NGVH+CNGG+
Sbjct  571  SNGVHYCNGGT  581


 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PD K IF+G  DKSI MW+L G ELECWKGQRT++ SD+ +T+DGKQI+++ KE  +LL 
Sbjct  369  PDRKWIFSGANDKSICMWELGGKELECWKGQRTLKISDLEVTSDGKQIITMCKESALLLL  428

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+EDQ ITSF + +  +  F LV L  + I
Sbjct  429  DREAKVERYIEEDQTITSFSLSRDNK--FLLVNLLNQEI  465



>ref|XP_009765607.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
sylvestris]
Length=581

 Score =   210 bits (534),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            LVSL NQEIHLW++ G+V  I+K+KGHKR+RFVVRSCFGGLD+AF+ASGSEDSQVYIWHR
Sbjct  457  LVSLCNQEIHLWDVQGTVKLISKYKGHKRSRFVVRSCFGGLDQAFVASGSEDSQVYIWHR  516

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHH  310
             SGELVGTL GHSGTVNCVSWN ANPHMLASASDDR+IRIWGL +VN+KQ+ TV NG   
Sbjct  517  GSGELVGTLAGHSGTVNCVSWNPANPHMLASASDDRSIRIWGLNRVNMKQHGTVTNGASC  576

Query  309  CNGGS  295
            CNG S
Sbjct  577  CNGRS  581


 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 79/110 (72%), Gaps = 10/110 (9%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKRIF GVTDKSISMWDL+G ELECWKG RTIR SD+GIT+DGK +VSV KE TI+L
Sbjct  368  APDGKRIFCGVTDKSISMWDLEGKELECWKGNRTIRMSDLGITSDGKHVVSVCKENTIVL  427

Query  758  FGWESKAEKSIKEDQVITSFCI----------IQGQQVPFWLVCLTKKFI  639
            F WES+ EK I+EDQ ITSF +          +  Q++  W V  T K I
Sbjct  428  FEWESRTEKVIQEDQAITSFVLSMDNKYVLVSLCNQEIHLWDVQGTVKLI  477



>ref|XP_006437085.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 ref|XP_006437086.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 ref|XP_006437087.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 ref|XP_006437088.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 gb|ESR50325.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 gb|ESR50326.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 gb|ESR50327.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 gb|ESR50328.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
Length=581

 Score =   209 bits (533),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLWNI+G V  +AK+KGHKR+RFV+RSCFGGL++AFIASGSEDSQ
Sbjct  451  RDNKFLLVNLLNQEIHLWNIEGEVKLVAKYKGHKRSRFVIRSCFGGLEQAFIASGSEDSQ  510

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHR+S +L+G L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK +N+K+    
Sbjct  511  VYIWHRASCDLIGALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKDLNVKRKDCH  570

Query  327  CNGVHHCNGGS  295
             NGVH+CNGG+
Sbjct  571  SNGVHYCNGGT  581


 Score =   103 bits (257),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PD K IF+G  DKSI MW+L G ELECWKGQRT++ SD+ +T+DGKQI+++ KE  +LL 
Sbjct  369  PDRKWIFSGANDKSICMWELGGKELECWKGQRTLKISDLEVTSDGKQIITMCKESALLLL  428

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+EDQ ITSF + +  +  F LV L  + I
Sbjct  429  DREAKVERYIEEDQTITSFSLSRDNK--FLLVNLLNQEI  465



>ref|XP_008647995.1| PREDICTED: uncharacterized protein LOC100304385 isoform X1 [Zea 
mays]
 ref|XP_008647996.1| PREDICTED: uncharacterized protein LOC100304385 isoform X1 [Zea 
mays]
 ref|XP_008647997.1| PREDICTED: uncharacterized protein LOC100304385 isoform X1 [Zea 
mays]
 gb|AFW74459.1| hypothetical protein ZEAMMB73_133126 [Zea mays]
Length=599

 Score =   168 bits (426),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 103/131 (79%), Gaps = 6/131 (5%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+++EIHLWNI      + ++ GHK +RFV+RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  455  LLVNLVSEEIHLWNIRNDPVRVNRYNGHKHSRFVIRSCFGGSEQAFIASGSEDSQVYIWH  514

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN---STVC-  325
            R++G+L+ TL GHSGTVNCVSWN  NPHMLASASDD T+RIWG K V+LK+    S+ C 
Sbjct  515  RATGDLIETLAGHSGTVNCVSWNPVNPHMLASASDDHTVRIWGAK-VSLKRKDVGSSNCN  573

Query  324  -NGVHHCNGGS  295
             NG HH NG +
Sbjct  574  SNGFHHSNGNA  584


 Score = 87.0 bits (214),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFG  753
            DGK+I +G+ D++  +WDLDG E++CWKGQR+  TSD  +  DG  I+S+ ++  ILLF 
Sbjct  369  DGKQILSGLADQTFCIWDLDGKEVDCWKGQRSATTSDFAVAKDGNLIISLSRDNAILLFD  428

Query  752  WESKAEKSIKEDQVITSFCI  693
             E+K E+ I+E   ITSF +
Sbjct  429  RETKHERIIEEGSTITSFSL  448



>ref|NP_001132804.1| hypothetical protein [Zea mays]
 gb|ACF81801.1| unknown [Zea mays]
 gb|AFW61289.1| hypothetical protein ZEAMMB73_320588 [Zea mays]
Length=279

 Score =   169 bits (428),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+++EIHLWNI      + ++ GHKR RFV+RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  135  LLVNLVSEEIHLWNIRNDPVRVNRYNGHKRTRFVIRSCFGGFEQAFIASGSEDSQVYIWH  194

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R++G+L+ TL GHSGTVNCVSWN ANPHMLASASDD T+RIWG K+ +LK+      G  
Sbjct  195  RATGDLIETLAGHSGTVNCVSWNPANPHMLASASDDHTVRIWGAKKSSLKRKDV---GSS  251

Query  312  HCN  304
            +CN
Sbjct  252  NCN  254


 Score = 86.3 bits (212),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK++ +G+ D++  +WDLDG E++CWKGQ +  TSD  +  DG  I+S+ K+ TILLF
Sbjct  49   PDGKQL-SGLADQNFCIWDLDGKEVDCWKGQGSTGTSDFAVAKDGNLIISMSKQNTILLF  107

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+K E+ I+E   ITSFC+
Sbjct  108  DRETKQERIIEEGSTITSFCL  128



>emb|CDX81113.1| BnaC03g03670D [Brassica napus]
Length=589

 Score =   163 bits (413),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 98/130 (75%), Gaps = 6/130 (5%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEI LWNI+G    + ++KGHKR+RF++RSCFGG  +AFIASGSEDS VYIWH
Sbjct  459  LLVNLLNQEIRLWNIEGDPKIVMRYKGHKRSRFLIRSCFGGYQQAFIASGSEDSLVYIWH  518

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQV-----NLKQNSTV  328
            RS+G+L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++       +  ++ 
Sbjct  519  RSTGKLIIELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDRINQQNQKKQVQASS  578

Query  327  CNGV-HHCNG  301
             NGV H CNG
Sbjct  579  SNGVLHRCNG  588


 Score = 92.0 bits (227),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFG  753
            DG+ I  G+TD+SI MWDLDG E+ECWKGQRT + SDI +T DGK +VSV K   I LF 
Sbjct  373  DGQGIIAGMTDRSICMWDLDGREIECWKGQRTQKVSDIAMTDDGKWVVSVCKGSVISLFD  432

Query  752  WESKAEKSIKEDQVITSFCI  693
             E+  E+ I+E+ +ITSF +
Sbjct  433  REATVERLIEEEDMITSFSL  452



>gb|EMT06242.1| hypothetical protein F775_31507 [Aegilops tauschii]
Length=590

 Score =   157 bits (396),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 102/151 (68%), Gaps = 27/151 (18%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQV----  505
             LV+L++++IHLWNI    + + ++ GHKR+RFV+RSCFGG D+AFIASGSEDS+V    
Sbjct  436  LLVNLISEKIHLWNIRNDPSRVKQYIGHKRSRFVIRSCFGGSDQAFIASGSEDSKVFSAR  495

Query  504  -------YIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL  346
                   YIWHR++ +++ TL GHSG VNCVSWN  NPHMLASASDD TIRIWGLK+ + 
Sbjct  496  FCSEYLVYIWHRATEDVIETLSGHSGAVNCVSWNPTNPHMLASASDDHTIRIWGLKKAST  555

Query  345  KQ---------NSTVCNG-------VHHCNG  301
            K+         N T  NG       VH CNG
Sbjct  556  KRKDIGSSSSSNGTHMNGSANGNGFVHQCNG  586


 Score = 97.4 bits (241),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK+I  G++D+S+ +WDLDG E +CWKGQR+ +TSD  +T DGK I+ ++++ TILLF
Sbjct  349  PDGKQILCGLSDQSLCLWDLDGKEADCWKGQRSSKTSDFAVTKDGKVIIIMNRDSTILLF  408

Query  755  GWESKAEKSIKEDQVITSFCI  693
              ++K E+ I+ED  ITSF +
Sbjct  409  NRDTKQERLIEEDNTITSFSL  429



>ref|XP_006354306.1| PREDICTED: WD repeat-containing protein 26-like [Solanum tuberosum]
Length=581

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LVSL NQEIHLW+I+G+   I+K+ GHKR+RFVVRSCFGGL++AFIASGSEDSQVYIWH
Sbjct  456  LLVSLWNQEIHLWDIEGTAKLISKYNGHKRSRFVVRSCFGGLNQAFIASGSEDSQVYIWH  515

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
             SSGELV TL GHSGTVNCVSWN A+PHMLASASDD TIRIWGL QV +K   TV NGVH
Sbjct  516  ISSGELVETLAGHSGTVNCVSWNPADPHMLASASDDHTIRIWGLNQVKMKHTDTVSNGVH  575

Query  312  HCNGGS  295
            +CNGG+
Sbjct  576  YCNGGT  581


 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 78/110 (71%), Gaps = 10/110 (9%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDG RI  GVTDKSISMWDL+G ELECWKG RTIR SD+GIT+DGK +VSV K+  ILL
Sbjct  368  APDGNRILCGVTDKSISMWDLEGKELECWKGHRTIRISDLGITSDGKHVVSVCKDNMILL  427

Query  758  FGWESKAEKSIKEDQVITSFCI----------IQGQQVPFWLVCLTKKFI  639
            FGWESKAEK I+EDQ ITSF +          +  Q++  W +  T K I
Sbjct  428  FGWESKAEKVIQEDQTITSFVLSTDNKYLLVSLWNQEIHLWDIEGTAKLI  477



>gb|EMS67128.1| WD repeat-containing protein 26 [Triticum urartu]
Length=590

 Score =   155 bits (393),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 102/151 (68%), Gaps = 27/151 (18%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQV----  505
             LV+L++++IHLWNI    + + ++ GHKR+RFV+RSCFGG D+AFIASGSEDS+V    
Sbjct  436  LLVNLISEKIHLWNIRNDPSRVKQYIGHKRSRFVIRSCFGGSDQAFIASGSEDSKVFSAS  495

Query  504  -------YIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL  346
                   YIWHR++ +++ TL GHSG VNCVSWN  NPHMLASASDD TIRIWG+K+ + 
Sbjct  496  FCSEYLVYIWHRATEDVIETLSGHSGAVNCVSWNPTNPHMLASASDDHTIRIWGVKKAST  555

Query  345  KQ---------NSTVCNG-------VHHCNG  301
            K+         N T  NG       VH CNG
Sbjct  556  KRKDIGSSSSSNGTHMNGSANGNGFVHQCNG  586


 Score = 95.1 bits (235),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK+I  G++D+S+ +WDLDG E +CWKGQR+ + SD  +T DGK I+ ++++ TILLF
Sbjct  349  PDGKQILCGLSDQSLCLWDLDGKEADCWKGQRSSKISDFAVTKDGKVIIIMNRDSTILLF  408

Query  755  GWESKAEKSIKEDQVITSFCI  693
              ++K E+ I+ED  ITSF +
Sbjct  409  NRDTKQERLIEEDNTITSFSL  429



>ref|XP_004149517.1| PREDICTED: WD repeat-containing protein 26 [Cucumis sativus]
 gb|KGN54949.1| hypothetical protein Csa_4G614220 [Cucumis sativus]
Length=584

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLW++ G    ++K+KGH+R RFV+RSCFGGL+EAFIASGSEDSQVYIWH
Sbjct  457  LLVNLLNQEIHLWSLVGEPNLVSKYKGHRRTRFVIRSCFGGLEEAFIASGSEDSQVYIWH  516

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R SGEL+ +L GHSG+VNCVSWN  NPHMLASASDD TIRIWGLK +N+K+N+   NGVH
Sbjct  517  RGSGELIESLPGHSGSVNCVSWNPTNPHMLASASDDHTIRIWGLKGLNIKRNNAYSNGVH  576

Query  312  HCNGGS  295
            +CNGG+
Sbjct  577  YCNGGT  582


 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 68/100 (68%), Gaps = 2/100 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK I  G+ DKSI MW LDG EL+ WKGQR ++ SD+ IT DGK+I+++ +E  ILL 
Sbjct  370  PDGKSILAGINDKSICMWALDGKELDSWKGQRILKISDLEITDDGKKIITICRENAILLL  429

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIF  636
              E+K +K I+EDQ+ITSF + +  +  F LV L  + I 
Sbjct  430  DREAKIDKWIEEDQIITSFRLSKDNK--FLLVNLLNQEIH  467



>ref|XP_012081590.1| PREDICTED: WD repeat-containing protein 26-like [Jatropha curcas]
 ref|XP_012081591.1| PREDICTED: WD repeat-containing protein 26-like [Jatropha curcas]
 gb|KDP29808.1| hypothetical protein JCGZ_19323 [Jatropha curcas]
Length=581

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLWNIDG +  IAK+KGHKR RFV+RSCFGGL++ FIASGSEDSQ
Sbjct  451  RDDKFLLVNLLNQEIHLWNIDGGIKLIAKYKGHKRTRFVIRSCFGGLEQTFIASGSEDSQ  510

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWH+ S EL+  L GHSG VNCVSWN  NPHMLASASDDRTIRIWGL  + +KQ  T 
Sbjct  511  VYIWHKCSRELIEALPGHSGAVNCVSWNPKNPHMLASASDDRTIRIWGLNALCMKQKGTH  570

Query  327  CNGVHHCNGGS  295
             NG+H+CNGG+
Sbjct  571  SNGIHYCNGGT  581


 Score =   109 bits (272),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+R+ TG+ DKSI MWDLDG ELECWKG RT++ SD+ IT+DGKQI+S+ KE  ILL 
Sbjct  369  PDGRRVCTGINDKSICMWDLDGKELECWKGPRTLKISDLEITSDGKQIISMCKETAILLL  428

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+E+Q ITSF + +  +  F LV L  + I
Sbjct  429  DIEAKNERVIEENQTITSFSLSRDDK--FLLVNLLNQEI  465



>ref|XP_008342331.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
 ref|XP_008342332.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
Length=578

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLWNI+G +  +AK+KGHKR RFV+RSCFGGL+EAF+ASGSEDSQ
Sbjct  448  RDNRFLLVNLLNQEIHLWNIEGEIKPVAKYKGHKRTRFVIRSCFGGLEEAFVASGSEDSQ  507

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VY+W RSSGEL+  L GHSG VNCVSWN ANPHM ASASDDRTIRIWGL +  +K     
Sbjct  508  VYVWQRSSGELIEALPGHSGAVNCVSWNPANPHMFASASDDRTIRIWGLSEQTVKHRGAH  567

Query  327  CNGVHHCNGGS  295
             NG+H+CNGG+
Sbjct  568  SNGIHYCNGGT  578


 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK IF+GV+DKSI MW+LDG ELECWKGQRT+R SD+ ITTDGKQ++S  ++  ILL 
Sbjct  366  PDGKCIFSGVSDKSICMWELDGKELECWKGQRTLRISDLEITTDGKQLISTCRDNAILLL  425

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E  I+E+Q ITSF + +  +  F LV L  + I
Sbjct  426  DREAKVETLIEENQAITSFSLSRDNR--FLLVNLLNQEI  462



>ref|XP_002306758.1| hypothetical protein POPTR_0005s22820g [Populus trichocarpa]
 gb|EEE93754.1| hypothetical protein POPTR_0005s22820g [Populus trichocarpa]
Length=581

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLWNIDG +  +A +KGHKR RFV+RSCFGG ++AFIASGSEDSQ
Sbjct  451  RDNRFLLVNLLNQEIHLWNIDGDIRLVATYKGHKRTRFVIRSCFGGHEQAFIASGSEDSQ  510

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            +Y+WHR+S ELV  L GHSG VNCVSWN ANPHMLASASDDRTIRIWG+  + +K  S  
Sbjct  511  IYLWHRASRELVEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGVNALQVKHKSAH  570

Query  327  CNGVHHCNGGS  295
            CNG+H+CNGGS
Sbjct  571  CNGIHYCNGGS  581


 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK IF+G+ DKSI MW+LDG E+ECWKGQRT++ SD+ IT+DGKQI+S+ +   +LL 
Sbjct  369  PDGKWIFSGINDKSICMWELDGKEVECWKGQRTLKISDLEITSDGKQIISMCRGTALLLL  428

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+EDQ ITSF + +  +  F LV L  + I
Sbjct  429  DREAKVERVIEEDQAITSFSLSRDNR--FLLVNLLNQEI  465



>gb|KHG12711.1| wdr26 [Gossypium arboreum]
 gb|KHG12712.1| wdr26 [Gossypium arboreum]
Length=580

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R +   L++LLNQEIHLWNI+G    ++K++GHKR RF++RSCFGGL++AFIASGSEDS 
Sbjct  450  RDSRFLLINLLNQEIHLWNIEGDPKLVSKYRGHKRTRFIIRSCFGGLEQAFIASGSEDSL  509

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHR +GEL+ TL GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  ++ K+    
Sbjct  510  VYIWHRGTGELIETLPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNNLSTKRKEPC  569

Query  327  CNGVHHCNGG  298
             NG+H+CNGG
Sbjct  570  SNGIHYCNGG  579


 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 2/100 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            SPDGK IF+G+ DKSI MW+LDG ELECWKGQRT++ SD+ IT DGKQI+S+ +E  ILL
Sbjct  367  SPDGKWIFSGLNDKSICMWELDGKELECWKGQRTLKISDLEITGDGKQIISICRETAILL  426

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
               E+K E+ I+EDQ ITSF + +  +  F L+ L  + I
Sbjct  427  LDREAKVERFIEEDQPITSFSLSRDSR--FLLINLLNQEI  464



>ref|XP_004243618.1| PREDICTED: WD repeat-containing protein 26 [Solanum lycopersicum]
 ref|XP_010323928.1| PREDICTED: WD repeat-containing protein 26 [Solanum lycopersicum]
 ref|XP_010323929.1| PREDICTED: WD repeat-containing protein 26 [Solanum lycopersicum]
Length=580

 Score =   201 bits (511),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            LVSL NQEIHLWNI+G+V  +AK+KGHKR+RFVVRSCFGGLD+AFIASGSEDSQVYIWHR
Sbjct  457  LVSLSNQEIHLWNIEGTVKLVAKYKGHKRSRFVVRSCFGGLDQAFIASGSEDSQVYIWHR  516

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHH  310
             SGELV TL GHSG VNCVSWN  NPHMLASASDD TIRIWG  +VN KQ+ T  NGV++
Sbjct  517  GSGELVATLAGHSGAVNCVSWNPTNPHMLASASDDGTIRIWGDNRVNTKQHDT-ANGVNY  575

Query  309  CNGGS  295
            CNG S
Sbjct  576  CNGRS  580


 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 76/110 (69%), Gaps = 10/110 (9%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKRIF GVTDKSISMWDL+G ELECWKG R  R SD+GIT+DGK ++SV KE  I+L
Sbjct  368  APDGKRIFCGVTDKSISMWDLEGKELECWKGHRATRISDLGITSDGKHVISVCKENMIVL  427

Query  758  FGWESKAEKSIKEDQVITSFCI----------IQGQQVPFWLVCLTKKFI  639
             GWESK E+ I+EDQ ITSF +          +  Q++  W +  T K +
Sbjct  428  VGWESKVERVIQEDQAITSFVLSMDSKYVLVSLSNQEIHLWNIEGTVKLV  477



>ref|XP_008229590.1| PREDICTED: WD repeat-containing protein 26-like [Prunus mume]
 ref|XP_008229591.1| PREDICTED: WD repeat-containing protein 26-like [Prunus mume]
Length=578

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLW+I+G +  +AK+KGHKR RFV+RSCFGGL++AFIASGSEDSQ
Sbjct  448  RDNRFLLVNLLNQEIHLWSIEGEIKLVAKYKGHKRTRFVIRSCFGGLEQAFIASGSEDSQ  507

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VY+WHR SGEL+  L GHSG VNCVSWN  N HMLASASDDRTIRIWGLK++ +K     
Sbjct  508  VYVWHRGSGELIEALPGHSGAVNCVSWNPTNTHMLASASDDRTIRIWGLKELKVKHRDAH  567

Query  327  CNGVHHCNGGS  295
             NGVH+CNGG+
Sbjct  568  SNGVHYCNGGT  578


 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 2/105 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK IF+GV+DKSI MW+LDG ELECWKGQRT+R SD+ IT+DGKQI+S  ++  ILL 
Sbjct  366  PDGKWIFSGVSDKSICMWELDGKELECWKGQRTLRISDLEITSDGKQIISTCRDNAILLL  425

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
              E+K E  I+EDQ ITSF + +  +  F LV L  + I   S+E
Sbjct  426  DREAKVEILIEEDQTITSFSLSRDNR--FLLVNLLNQEIHLWSIE  468



>ref|XP_004491280.1| PREDICTED: WD repeat-containing protein 26-like [Cicer arietinum]
Length=572

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLWNI+G    + K+KGH+R RFV+RSCFGGL +AFIASGSEDSQVYIWH
Sbjct  447  LLVNLLNQEIHLWNIEGDPKLVGKYKGHRRARFVIRSCFGGLKQAFIASGSEDSQVYIWH  506

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            RSSGE +  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  +N K  +   NGVH
Sbjct  507  RSSGEPIEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNSLNRKYQNAHSNGVH  566

Query  312  HCNGGS  295
            +CNGG+
Sbjct  567  YCNGGT  572


 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P GK I +G++DKSI MW+LDG E+E WKGQ++++ SD+ IT DG++I+S+ K  T+LLF
Sbjct  360  PSGKHILSGLSDKSICMWELDGKEVESWKGQKSLKISDLDITDDGEEILSICKTNTVLLF  419

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+E Q ITSF + +  +  F LV L  + I
Sbjct  420  NRETKDERYIEEHQTITSFSLSKDNK--FLLVNLLNQEI  456



>gb|KJB33386.1| hypothetical protein B456_006G008900 [Gossypium raimondii]
Length=546

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R +   L++LLNQEIHLWNI+G    ++K++GHKR RF++RSCFGGL++AFIASGSEDS 
Sbjct  416  RDSRFLLINLLNQEIHLWNIEGDPKLVSKYRGHKRTRFIIRSCFGGLEQAFIASGSEDSL  475

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHR +GEL+ TL GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  ++ K+    
Sbjct  476  VYIWHRGTGELIETLPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNNLSTKRKEPC  535

Query  327  CNGVHHCNG  301
             NG+H+CNG
Sbjct  536  SNGIHYCNG  544


 Score =   111 bits (277),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 2/100 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            SPDGK IF+G+ DKSI MW+LDG ELECWKGQRT++ SD+ IT DGKQI+S+ +E  ILL
Sbjct  333  SPDGKWIFSGLNDKSICMWELDGKELECWKGQRTLKISDLEITGDGKQIISICRETAILL  392

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
               E+K E+ I+EDQ ITSF + +  +  F L+ L  + I
Sbjct  393  LDREAKVERFIEEDQTITSFSLSRDSR--FLLINLLNQEI  430



>ref|XP_009377000.1| PREDICTED: WD repeat-containing protein 26-like [Pyrus x bretschneideri]
 ref|XP_009377004.1| PREDICTED: WD repeat-containing protein 26-like [Pyrus x bretschneideri]
Length=578

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLWNI+G +  +AK+KGHKR RFV+RSCFGGL+EAF+ASGSEDSQ
Sbjct  448  RDNRFLLVTLLNQEIHLWNIEGEIKPVAKYKGHKRTRFVIRSCFGGLEEAFVASGSEDSQ  507

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VY+W R SGEL+  L GHSG VNCVSWN ANPHM ASASDDRTIRIWGL +  +K     
Sbjct  508  VYVWRRGSGELIEALPGHSGAVNCVSWNPANPHMFASASDDRTIRIWGLGEQTVKHRGAH  567

Query  327  CNGVHHCNGGS  295
             NG+H+CNGG+
Sbjct  568  SNGIHYCNGGT  578


 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 72/100 (72%), Gaps = 2/100 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK IF+GV+DKSI MW+LDG ELECWKGQRT+R SD+ IT+DGKQ++S  ++  ILL 
Sbjct  366  PDGKCIFSGVSDKSICMWELDGKELECWKGQRTLRISDLEITSDGKQLISTCRDNAILLL  425

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIF  636
              E+K E  I+E+Q ITSF + +  +  F LV L  + I 
Sbjct  426  DREAKVETLIEENQTITSFSLSRDNR--FLLVTLLNQEIH  463



>ref|XP_007048928.1| Transducin family protein / WD-40 repeat family protein isoform 
2 [Theobroma cacao]
 ref|XP_007048929.1| Transducin family protein / WD-40 repeat family protein isoform 
2 [Theobroma cacao]
 gb|EOX93085.1| Transducin family protein / WD-40 repeat family protein isoform 
2 [Theobroma cacao]
 gb|EOX93086.1| Transducin family protein / WD-40 repeat family protein isoform 
2 [Theobroma cacao]
Length=580

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLWNI+G +  ++K+KGHKR RF++RSCFGGL++AFIASGSEDS 
Sbjct  450  RDNRFLLVNLLNQEIHLWNIEGDLKLVSKYKGHKRTRFIIRSCFGGLEQAFIASGSEDSL  509

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHR +GEL+  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  ++ K   T 
Sbjct  510  VYIWHRGTGELIEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNNLSTKLKDTH  569

Query  327  CNGVHHCNGGS  295
             NG+H+CNGG+
Sbjct  570  SNGIHYCNGGT  580


 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 74/100 (74%), Gaps = 2/100 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            SPDGK IF+GV DKSI MW+L+G ELECWKGQRT++ SD+ IT+DGKQI+S+ +E  ILL
Sbjct  367  SPDGKWIFSGVNDKSICMWELEGKELECWKGQRTLKISDLEITSDGKQIISICRETAILL  426

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
               E+K E+ I+EDQ ITSF + +  +  F LV L  + I
Sbjct  427  LDREAKVERLIEEDQTITSFSLSRDNR--FLLVNLLNQEI  464



>ref|XP_006366633.1| PREDICTED: WD repeat-containing protein 26-like [Solanum tuberosum]
Length=580

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            LVSL NQEIHLWNI+G+V  +AK+KGHKR+RFVVRSCFGGL +AFIASGSEDSQVYIWHR
Sbjct  457  LVSLSNQEIHLWNIEGTVKLVAKYKGHKRSRFVVRSCFGGLHQAFIASGSEDSQVYIWHR  516

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHH  310
             SGELVGTL GHSGTVNCVSWN  NPHMLASASDD TIR+WG  +VN KQ+ T  NGV++
Sbjct  517  GSGELVGTLAGHSGTVNCVSWNPRNPHMLASASDDGTIRVWGYNRVNTKQHDT-DNGVNY  575

Query  309  CNGGS  295
            CNG S
Sbjct  576  CNGRS  580


 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 79/110 (72%), Gaps = 10/110 (9%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKRIF GVTDKSI+MWDL+G ELECWKG RTIR SD+GIT+DGK +VSV KE  I+L
Sbjct  368  APDGKRIFCGVTDKSITMWDLEGKELECWKGHRTIRMSDLGITSDGKHVVSVCKENMIVL  427

Query  758  FGWESKAEKSIKEDQVITSFCI----------IQGQQVPFWLVCLTKKFI  639
            FGWESK E+ I+EDQ ITSF +          +  Q++  W +  T K +
Sbjct  428  FGWESKVERVIQEDQAITSFVLSMDSKYVLVSLSNQEIHLWNIEGTVKLV  477



>gb|KJB33387.1| hypothetical protein B456_006G008900 [Gossypium raimondii]
 gb|KJB33388.1| hypothetical protein B456_006G008900 [Gossypium raimondii]
Length=580

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R +   L++LLNQEIHLWNI+G    ++K++GHKR RF++RSCFGGL++AFIASGSEDS 
Sbjct  450  RDSRFLLINLLNQEIHLWNIEGDPKLVSKYRGHKRTRFIIRSCFGGLEQAFIASGSEDSL  509

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHR +GEL+ TL GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  ++ K+    
Sbjct  510  VYIWHRGTGELIETLPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNNLSTKRKEPC  569

Query  327  CNGVHHCNG  301
             NG+H+CNG
Sbjct  570  SNGIHYCNG  578


 Score =   110 bits (276),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 2/100 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            SPDGK IF+G+ DKSI MW+LDG ELECWKGQRT++ SD+ IT DGKQI+S+ +E  ILL
Sbjct  367  SPDGKWIFSGLNDKSICMWELDGKELECWKGQRTLKISDLEITGDGKQIISICRETAILL  426

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
               E+K E+ I+EDQ ITSF + +  +  F L+ L  + I
Sbjct  427  LDREAKVERFIEEDQTITSFSLSRDSR--FLLINLLNQEI  464



>ref|XP_011026207.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
Length=580

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLW+IDG++  +AK+KGH+R RFV+RSCFGGL++AFIA GSEDSQ
Sbjct  450  RDNRFLLVNLLNQEIHLWSIDGNIRLVAKYKGHRRTRFVIRSCFGGLEQAFIACGSEDSQ  509

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHR SG+LV  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  +++K  S  
Sbjct  510  VYIWHRGSGDLVEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNSLHVKHKSAH  569

Query  327  CNGVHHCNGGS  295
             NG H+CNGG+
Sbjct  570  SNGTHYCNGGT  580


 Score =   109 bits (273),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK IF+G+ DKSI MW+LDG E+ECWKGQRT++ SD+ IT+DGKQI+S+ +   ILL 
Sbjct  368  PDGKWIFSGINDKSICMWELDGKEVECWKGQRTLKISDLEITSDGKQIISMCRPTAILLL  427

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+KAE+ I+EDQ ITSF + +  +  F LV L  + I
Sbjct  428  DREAKAERVIEEDQTITSFSLSRDNR--FLLVNLLNQEI  464



>ref|XP_007048927.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 gb|EOX93084.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
Length=619

 Score =   199 bits (507),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLWNI+G +  ++K+KGHKR RF++RSCFGGL++AFIASGSEDS VYIWH
Sbjct  494  LLVNLLNQEIHLWNIEGDLKLVSKYKGHKRTRFIIRSCFGGLEQAFIASGSEDSLVYIWH  553

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R +GEL+  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  ++ K   T  NG+H
Sbjct  554  RGTGELIEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNNLSTKLKDTHSNGIH  613

Query  312  HCNGGS  295
            +CNGG+
Sbjct  614  YCNGGT  619


 Score =   112 bits (279),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 74/100 (74%), Gaps = 2/100 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            SPDGK IF+GV DKSI MW+L+G ELECWKGQRT++ SD+ IT+DGKQI+S+ +E  ILL
Sbjct  406  SPDGKWIFSGVNDKSICMWELEGKELECWKGQRTLKISDLEITSDGKQIISICRETAILL  465

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
               E+K E+ I+EDQ ITSF + +  +  F LV L  + I
Sbjct  466  LDREAKVERLIEEDQTITSFSLSRDNR--FLLVNLLNQEI  503



>ref|XP_003617329.1| WD-repeat protein-like protein [Medicago truncatula]
 gb|AET00288.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=572

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEI+LWNI+G+   I K+KGH+R+RF++RSCFGGL++AFIASGSEDSQVYIWH
Sbjct  447  LLVNLLNQEINLWNIEGNPKLIGKYKGHRRSRFIIRSCFGGLEQAFIASGSEDSQVYIWH  506

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            RSSGE +  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  +N K      NG+H
Sbjct  507  RSSGEPIEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNSLNKKYQHAHSNGIH  566

Query  312  HCNGGS  295
            +CNGG+
Sbjct  567  YCNGGT  572


 Score = 97.1 bits (240),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P GK I +G++DKSI MW+LDG E+E WKGQ++++ SD+ IT DG++I+S+ K  T+LLF
Sbjct  360  PSGKHILSGLSDKSICMWELDGKEVESWKGQKSLKISDLDITADGEEIISICKPNTVLLF  419

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+E Q ITSF + +  +  F LV L  + I
Sbjct  420  NKETKDERFIEERQTITSFSLSKDNK--FLLVNLLNQEI  456



>ref|XP_003545311.1| PREDICTED: WD repeat-containing protein 26-like [Glycine max]
 gb|KHN11996.1| WD repeat-containing protein 26 [Glycine soja]
Length=572

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLWNI+G    + K+KGHKR RF++RSCFGGL +AFIASGSEDSQVYIWH
Sbjct  447  LLVNLLNQEIHLWNIEGDPKLVGKYKGHKRARFIIRSCFGGLKQAFIASGSEDSQVYIWH  506

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            RSSGEL+  L GHSG+VNCVSWN ANPHMLASASDDRTIR+WGL  ++ K  +   NG+H
Sbjct  507  RSSGELIEALAGHSGSVNCVSWNPANPHMLASASDDRTIRVWGLNCLHNKYQNVHSNGIH  566

Query  312  HCNGGS  295
            +CNGG+
Sbjct  567  YCNGGT  572


 Score = 90.9 bits (224),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P GK I  G++DKSI MW+LDG E+E WKGQ+T++ SD+ IT DG++I+S+ K   +LLF
Sbjct  360  PCGKYILCGLSDKSICMWELDGKEVESWKGQKTLKISDLEITDDGEEILSICKANVVLLF  419

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+E + ITSF +    +  F LV L  + I
Sbjct  420  NRETKDERFIEEYETITSFSLSNDNK--FLLVNLLNQEI  456



>ref|XP_002302127.1| hypothetical protein POPTR_0002s05670g [Populus trichocarpa]
 gb|EEE81400.1| hypothetical protein POPTR_0002s05670g [Populus trichocarpa]
Length=580

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLW+IDG++  +AK+KGH+R RFV+RSCFGGL++AFIA GSEDSQ
Sbjct  450  RDNRFLLVNLLNQEIHLWSIDGNIRLVAKYKGHRRTRFVIRSCFGGLEQAFIACGSEDSQ  509

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHR SG+LV  L GHSG VNCVSWN ANP+MLASASDDRTIRIWGL  +++K  S  
Sbjct  510  VYIWHRGSGDLVEALPGHSGAVNCVSWNPANPYMLASASDDRTIRIWGLNSLHVKHKSAH  569

Query  327  CNGVHHCNGGS  295
             NG H+CNGG+
Sbjct  570  SNGTHYCNGGT  580


 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK IF+G+ DKSI MW+LDG E+ECWKGQ+T++ SD+ IT+DGKQI+S+ +   ILL 
Sbjct  368  PDGKWIFSGINDKSICMWELDGKEVECWKGQKTLKISDLEITSDGKQIISMCRPTAILLL  427

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+KAE+ I+EDQ ITSF + +  +  F LV L  + I
Sbjct  428  DREAKAERVIEEDQTITSFSLSRDNR--FLLVNLLNQEI  464



>ref|XP_003519528.1| PREDICTED: WD repeat-containing protein 26-like [Glycine max]
Length=573

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLWNI+G    + K+KGHKR RF++RSCFGGL +AFIASGSEDSQVYIWH
Sbjct  448  LLVNLLNQEIHLWNIEGDPKLVGKYKGHKRARFIIRSCFGGLKQAFIASGSEDSQVYIWH  507

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            RSSGEL+  L GHSG+VNCVSWN ANPHMLASASDDRTIR+WGL  ++ K  +   NG+H
Sbjct  508  RSSGELIEALTGHSGSVNCVSWNPANPHMLASASDDRTIRVWGLNCMHNKYQNVHSNGIH  567

Query  312  HCNGGS  295
            +CNGG+
Sbjct  568  YCNGGT  573


 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P GK I  G++DKSI MW+LDG E+E WKGQ+T++ SD+ IT DG++I+S+ K   +LLF
Sbjct  361  PCGKYILCGLSDKSICMWELDGKEVESWKGQKTLKISDLEITDDGEEILSICKANVVLLF  420

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+E + ITSF + +  +  F LV L  + I
Sbjct  421  NRETKDERFIEEYETITSFSLSKDNK--FLLVNLLNQEI  457



>ref|XP_001770300.1| predicted protein [Physcomitrella patens]
 gb|EDQ64975.1| predicted protein [Physcomitrella patens]
Length=559

 Score =   153 bits (386),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 93/132 (70%), Gaps = 6/132 (5%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAK-FKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIW  496
             LV+L++QEIHLW+I  +   + K ++GHK+ R+V+RSCFGG D AFI SGSEDSQVYIW
Sbjct  413  LLVNLVSQEIHLWDISAATKDLPKKYRGHKQGRYVIRSCFGGTDYAFIVSGSEDSQVYIW  472

Query  495  HRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLK----QNSTV  328
            HR +GEL+  L GHSGTVN VSWN  NPHM ASASDD TIRIWGL    +     +    
Sbjct  473  HRWNGELLDVLSGHSGTVNSVSWNPVNPHMFASASDDHTIRIWGLSNRPMPKKHDEKPGS  532

Query  327  CNGVHH-CNGGS  295
             NG  H  NGG+
Sbjct  533  SNGFDHLVNGGT  544


 Score = 87.0 bits (214),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGKR  +G  DK I MWDL+G+ELE WKG R  R +D+ ITTDG  +VS+   K I ++
Sbjct  326  PDGKRFVSGGGDKCIYMWDLEGHELEAWKGARMPRINDLAITTDGSHMVSICDHKNIRIY  385

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E K E+ I+E++ ITS  +
Sbjct  386  NLEEKTERVIEEEKPITSLSV  406



>ref|XP_008380168.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
 ref|XP_008380169.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
 ref|XP_008380170.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
 ref|XP_008380171.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
Length=579

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLWNI+G    +AK+KGHKR RFV+RSCFGGL+EAF+ASGSEDSQ
Sbjct  448  RDNRFLLVNLLNQEIHLWNIEGENKLVAKYKGHKRTRFVIRSCFGGLEEAFVASGSEDSQ  507

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VY+WHR SGEL+  L GHSG VNCVSWN ANPHM ASASDDRTIRIWGL +  +K     
Sbjct  508  VYVWHRGSGELIEALPGHSGAVNCVSWNPANPHMFASASDDRTIRIWGLSEQKVKHRGAH  567

Query  327  CNGVH-HCNGGS  295
             NG+H +CNGG+
Sbjct  568  SNGIHLNCNGGT  579


 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK IF+GV+DKSI MW+LDG ELECWKGQRT+R SD+ IT+DGKQ++S  +E  ILL 
Sbjct  366  PDGKCIFSGVSDKSICMWELDGKELECWKGQRTLRISDLEITSDGKQLISTCRENAILLL  425

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E K E  I+EDQ ITSF + +  +  F LV L  + I
Sbjct  426  DREVKVETFIEEDQTITSFSLSRDNR--FLLVNLLNQEI  462



>ref|XP_001771286.1| predicted protein [Physcomitrella patens]
 gb|EDQ63846.1| predicted protein [Physcomitrella patens]
Length=559

 Score =   152 bits (385),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 97/132 (73%), Gaps = 6/132 (5%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAK-FKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIW  496
             LV+L++QEIHLW+I  +   + K ++GH++ R+V+RSCFGG D AFI SGSEDSQVYIW
Sbjct  413  LLVNLVSQEIHLWDISAATRDLPKKYRGHRQGRYVIRSCFGGTDYAFIVSGSEDSQVYIW  472

Query  495  HRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK-QVNLKQNSTVC--  325
            HR +GEL+  L GHSGTVN VSWN  NPHM ASASDD TIRIWGL  +  +K++      
Sbjct  473  HRWNGELLDVLSGHSGTVNSVSWNPVNPHMFASASDDHTIRIWGLSNRPKIKKHDEKAGS  532

Query  324  -NGVHH-CNGGS  295
             NG+ H  NGG+
Sbjct  533  SNGIDHLVNGGT  544


 Score = 85.5 bits (210),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+R  +G  DK I MWDL+G+ELE WKG R  R +D+ ITTDG  +VS+   K I ++
Sbjct  326  PDGQRFVSGGGDKCIYMWDLEGHELEAWKGARMPRINDLAITTDGSHMVSICDHKNIRIY  385

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E K E+ I+E++ ITS  +
Sbjct  386  NLEEKTERVIEEEKPITSLSV  406



>gb|KHG30817.1| WD repeat-containing 26 [Gossypium arboreum]
Length=546

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLW+I+  +  ++K++GHKR RF++RSCFGGL++AF+ASGSEDS 
Sbjct  416  RDNRFLLVNLLNQEIHLWSIEDDLKLVSKYRGHKRTRFIIRSCFGGLEQAFVASGSEDSL  475

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHR +GEL+  L GHSG VNCVSWN  NPHMLASASDDRTIRIWGL  ++ KQ  T 
Sbjct  476  VYIWHRGTGELIEALPGHSGAVNCVSWNPTNPHMLASASDDRTIRIWGLNNLSAKQKDTH  535

Query  327  CNGVHHCNGGS  295
             NG+H+CNGG+
Sbjct  536  GNGIHYCNGGT  546


 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 77/106 (73%), Gaps = 2/106 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            SPDGK IF+GV DKSIS+W+LDG ELECWKGQ T++ SD+ IT+DGKQI+S+ +E  ILL
Sbjct  333  SPDGKWIFSGVNDKSISLWELDGRELECWKGQHTLKISDLEITSDGKQIISICRETAILL  392

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
               E+K E+ I+EDQ ITSF + +  +  F LV L  + I   S+E
Sbjct  393  LDREAKVERFIEEDQTITSFSLSRDNR--FLLVNLLNQEIHLWSIE  436



>ref|XP_010256452.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010256453.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Nelumbo 
nucifera]
Length=584

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 107/133 (80%), Gaps = 3/133 (2%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R +   LV+LLNQEIHLW+I+G    IAK+KGHKR RFV+RSC GG ++ FIASGSEDSQ
Sbjct  451  RDSKFLLVNLLNQEIHLWSIEGDPKLIAKYKGHKRTRFVIRSCLGGFNQTFIASGSEDSQ  510

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNS--  334
            VYIWHR + EL+  L GHSGTVNCVSWN A+PHMLASASDDRTIRIWGL +VNLK+    
Sbjct  511  VYIWHRGTAELLEVLPGHSGTVNCVSWNPADPHMLASASDDRTIRIWGLNRVNLKRKDIH  570

Query  333  TVCNG-VHHCNGG  298
            +  NG VHHCNGG
Sbjct  571  SHSNGVVHHCNGG  583


 Score =   111 bits (278),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 76/106 (72%), Gaps = 2/106 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            SPDGK +F+G+TDKSI MWDLDGNELECWKGQR ++ SD+ IT DGKQI+++ +E  ILL
Sbjct  368  SPDGKWVFSGMTDKSICMWDLDGNELECWKGQRILKISDMAITNDGKQIITMCRETVILL  427

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
               E+K E+ I+E Q ITSF + +  +  F LV L  + I   S+E
Sbjct  428  LDREAKVERLIEESQPITSFSLSRDSK--FLLVNLLNQEIHLWSIE  471



>ref|XP_010256454.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Nelumbo 
nucifera]
Length=543

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 107/133 (80%), Gaps = 3/133 (2%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R +   LV+LLNQEIHLW+I+G    IAK+KGHKR RFV+RSC GG ++ FIASGSEDSQ
Sbjct  410  RDSKFLLVNLLNQEIHLWSIEGDPKLIAKYKGHKRTRFVIRSCLGGFNQTFIASGSEDSQ  469

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNS--  334
            VYIWHR + EL+  L GHSGTVNCVSWN A+PHMLASASDDRTIRIWGL +VNLK+    
Sbjct  470  VYIWHRGTAELLEVLPGHSGTVNCVSWNPADPHMLASASDDRTIRIWGLNRVNLKRKDIH  529

Query  333  TVCNG-VHHCNGG  298
            +  NG VHHCNGG
Sbjct  530  SHSNGVVHHCNGG  542


 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 76/106 (72%), Gaps = 2/106 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            SPDGK +F+G+TDKSI MWDLDGNELECWKGQR ++ SD+ IT DGKQI+++ +E  ILL
Sbjct  327  SPDGKWVFSGMTDKSICMWDLDGNELECWKGQRILKISDMAITNDGKQIITMCRETVILL  386

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
               E+K E+ I+E Q ITSF + +  +  F LV L  + I   S+E
Sbjct  387  LDREAKVERLIEESQPITSFSLSRDSK--FLLVNLLNQEIHLWSIE  430



>ref|XP_009356585.1| PREDICTED: WD repeat-containing protein 26-like [Pyrus x bretschneideri]
 ref|XP_009356586.1| PREDICTED: WD repeat-containing protein 26-like [Pyrus x bretschneideri]
 ref|XP_009356587.1| PREDICTED: WD repeat-containing protein 26-like [Pyrus x bretschneideri]
Length=579

 Score =   194 bits (493),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+LLNQEIHLWNI+G    +AK+KGHKR RFV+RSCFGGL+EAF+ASGSEDSQ
Sbjct  448  RDNRFLLVNLLNQEIHLWNIEGENKLVAKYKGHKRTRFVIRSCFGGLEEAFVASGSEDSQ  507

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHR SGEL+  L GHSG VNCVSWN ANPHM ASASDDRTIRIWGL    +K     
Sbjct  508  VYIWHRGSGELIEALPGHSGAVNCVSWNPANPHMFASASDDRTIRIWGLSGQKVKHRGAH  567

Query  327  CNGVH-HCNGGS  295
             NGVH +CNGG+
Sbjct  568  SNGVHLNCNGGT  579


 Score =   108 bits (271),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK +F+GV+DKSI MW+LDG ELECWKGQR++R SD+ IT+DGKQ++S  +E  ILL 
Sbjct  366  PDGKCLFSGVSDKSICMWELDGKELECWKGQRSLRISDLEITSDGKQLISNCRENAILLL  425

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E  I+EDQ ITSF + +  +  F LV L  + I
Sbjct  426  DREAKVETFIEEDQTITSFSLSRDNR--FLLVNLLNQEI  462



>gb|KHN38353.1| WD repeat-containing protein 26 [Glycine soja]
Length=570

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLWNI+G    + K+KGHKR RF++RSCFGGL +AFIASGSEDSQVYIWH
Sbjct  448  LLVNLLNQEIHLWNIEGDPKLVGKYKGHKRARFIIRSCFGGLKQAFIASGSEDSQVYIWH  507

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            RSSGEL+  L GHSG+VNCVSWN ANPHMLASASDDRTIR+WGL  ++ K  +   NG+H
Sbjct  508  RSSGELIEALTGHSGSVNCVSWNPANPHMLASASDDRTIRVWGLNCMHNKYQNVHSNGIH  567

Query  312  HCN  304
            +CN
Sbjct  568  YCN  570


 Score = 91.3 bits (225),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P GK I  G++DKSI MW+LDG E+E WKGQ+T++ SD+ IT DG++I+S+ K   +LLF
Sbjct  361  PCGKYILCGLSDKSICMWELDGKEVESWKGQKTLKISDLEITDDGEEILSICKANVVLLF  420

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+E + ITSF + +  +  F LV L  + I
Sbjct  421  NRETKDERFIEEYETITSFSLSKDNK--FLLVNLLNQEI  457



>ref|XP_009405376.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405377.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405378.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405379.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405380.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
Length=582

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 1/125 (1%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLWNI      + ++KGHKR+RF++RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  455  LLVNLINQEIHLWNIKDDPKLVTRYKGHKRSRFLIRSCFGGTEQAFIASGSEDSQVYIWH  514

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG-V  316
            RSSG+L+ TL GHSGTVNCVSWN +NPHMLASASDD TIRIWGL +VNLK+     NG V
Sbjct  515  RSSGDLIQTLPGHSGTVNCVSWNPSNPHMLASASDDHTIRIWGLNRVNLKRKEIYSNGTV  574

Query  315  HHCNG  301
            H CNG
Sbjct  575  HLCNG  579


 Score =   100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK +F+GVTD++I  WDLDG EL+ WKGQRT +TSD+ +T DG+ ++S+ +E  ILL 
Sbjct  368  PDGKELFSGVTDRTICFWDLDGKELDSWKGQRTSKTSDVAVTKDGRHMISLCRETVILLL  427

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+E+Q ITSF + +  +  F LV L  + I
Sbjct  428  DRETKTERLIEEEQTITSFSLSKDDK--FLLVNLINQEI  464



>gb|KEH33653.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=581

 Score =   190 bits (483),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLWNI+G +  + K+K H+R+RFV+RSCFGGL ++FIASGSEDSQVYIWH
Sbjct  454  LLVNLLNQEIHLWNIEGDLKLVGKYKSHRRSRFVIRSCFGGLKQSFIASGSEDSQVYIWH  513

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG-V  316
            RSSG+LV  L GHSG VNCVSWN ANPHMLASASDDRT+RIWGLK ++ K  +   NG  
Sbjct  514  RSSGDLVDALPGHSGAVNCVSWNPANPHMLASASDDRTVRIWGLKCLDAKYPNAYSNGNS  573

Query  315  HHCNGG  298
            HHCN G
Sbjct  574  HHCNCG  579


 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P GK I +G++DKSI MW+LDG E+E WKGQ+T++ SD+ IT DG+ I+S+ KE  ILLF
Sbjct  367  PCGKYILSGLSDKSICMWELDGKEVESWKGQKTLKISDLEITGDGEHILSICKENAILLF  426

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+EDQ ITSF + +  +  F LV L  + I
Sbjct  427  NKETKVERFIEEDQTITSFSLSKDSR--FLLVNLLNQEI  463



>ref|XP_009419551.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419552.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419553.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419554.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 104/128 (81%), Gaps = 2/128 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLWNI      +  +KGHKR+RF++RSCFGGL++AFIASGSEDSQVYIWH
Sbjct  415  LLVNLINQEIHLWNIRNDPKLVTTYKGHKRSRFLIRSCFGGLEQAFIASGSEDSQVYIWH  474

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG--  319
            RS+G+L+  L GHSGTVNCVSWN +NPHMLASASDD TIRIWGL +VN K+  T  NG  
Sbjct  475  RSTGDLLEALPGHSGTVNCVSWNPSNPHMLASASDDHTIRIWGLSKVNRKRKETYSNGTV  534

Query  318  VHHCNGGS  295
            +H CNG S
Sbjct  535  LHLCNGSS  542


 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = -2

Query  929  GKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFGW  750
            GK++F+GVTDK+I  WDLDG EL+CWKGQRT +TSD+ +T DG+QI+S+ +E  ILL   
Sbjct  330  GKQLFSGVTDKTICFWDLDGKELDCWKGQRTSKTSDVAVTKDGRQIISMCQETVILLLDK  389

Query  749  ESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
            E+K +  I+E+Q ITSF + +     F LV L  + I
Sbjct  390  ETKIQTLIEEEQTITSFSLSEDDN--FLLVNLINQEI  424



>ref|XP_010054068.1| PREDICTED: WD repeat-containing protein 26 [Eucalyptus grandis]
 gb|KCW89786.1| hypothetical protein EUGRSUZ_A02037 [Eucalyptus grandis]
 gb|KCW89787.1| hypothetical protein EUGRSUZ_A02037 [Eucalyptus grandis]
 gb|KCW89788.1| hypothetical protein EUGRSUZ_A02037 [Eucalyptus grandis]
Length=584

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLW+I G    +AK+KG KR+RFV+RSCFGGL +AF+ASGSEDSQVYIWH
Sbjct  457  LLVNLLNQEIHLWDIKGDFRLVAKYKGLKRSRFVIRSCFGGLKQAFVASGSEDSQVYIWH  516

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            + SGEL+  L GHSG VNCVSWN AN HMLASASDDRTIRIWGL ++N +      NGVH
Sbjct  517  KGSGELIEPLPGHSGAVNCVSWNPANHHMLASASDDRTIRIWGLNELNTRHKGARPNGVH  576

Query  312  HCNG  301
            +CNG
Sbjct  577  YCNG  580


 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK I  GV+D+SI M DL+G E+ECWKGQRT+  SD+ IT+DGKQI+S+ +E  ILL 
Sbjct  370  PDGKWICYGVSDRSICMCDLEGKEIECWKGQRTLSISDLEITSDGKQIISICRETAILLL  429

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIF  636
              E+K E+ I+E+Q ITSF + +  +  + LV L  + I 
Sbjct  430  DREAKYERMIEENQTITSFSLSKDNR--YLLVNLLNQEIH  467



>gb|KJB48956.1| hypothetical protein B456_008G095100 [Gossypium raimondii]
 gb|KJB48957.1| hypothetical protein B456_008G095100 [Gossypium raimondii]
 gb|KJB48958.1| hypothetical protein B456_008G095100 [Gossypium raimondii]
Length=580

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLW+I+  +  ++K++GHKR RF++RSCFGGL++AF+ASGSEDS VYIWH
Sbjct  455  LLVNLLNQEIHLWSIEDDLKLVSKYRGHKRTRFIIRSCFGGLEQAFVASGSEDSLVYIWH  514

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R +GEL+  L GHSG VNCVSWN  NPHMLASASDDRTIRIWGL  ++ KQ  T  NG H
Sbjct  515  RGTGELIEALPGHSGAVNCVSWNPTNPHMLASASDDRTIRIWGLNNLSAKQKDTHGNGFH  574

Query  312  HCNGGS  295
            + NGG+
Sbjct  575  YSNGGT  580


 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            SPDGK IF+GV DKSISMW+LDG ELECWKGQRT++ SD+ IT+DGKQI+S+ +E  ILL
Sbjct  367  SPDGKWIFSGVNDKSISMWELDGRELECWKGQRTLKISDLEITSDGKQIISICRETAILL  426

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
               E+K E+ I+EDQ ITSF + +  +  F LV L  + I   S+E
Sbjct  427  LDREAKVERFIEEDQTITSFSLSRDNR--FLLVNLLNQEIHLWSIE  470



>ref|XP_006468682.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Citrus 
sinensis]
 ref|XP_006468683.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Citrus 
sinensis]
 gb|KDO77040.1| hypothetical protein CISIN_1g008011mg [Citrus sinensis]
 gb|KDO77041.1| hypothetical protein CISIN_1g008011mg [Citrus sinensis]
Length=581

 Score =   188 bits (478),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLW+I+     ++++KGHKR RFV+RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  456  LLVNLINQEIHLWSIESDPKLVSRYKGHKRARFVIRSCFGGFEQAFIASGSEDSQVYIWH  515

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R +GELV  L GHSG+VNCVSWN AN HMLASASDDRTIRIWGL Q+N+K        VH
Sbjct  516  RYTGELVLALAGHSGSVNCVSWNPANLHMLASASDDRTIRIWGLDQINMKHRDQSNGIVH  575

Query  312  HCNG  301
            HCNG
Sbjct  576  HCNG  579


 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFG  753
            DG  IF G+TDKSI +WDLDG ELE WKGQ+T+R SD+ IT DGK+I+S+ +E  ILL  
Sbjct  370  DGGGIFAGMTDKSICLWDLDGRELESWKGQKTLRISDMAITDDGKRIISICREAAILLLD  429

Query  752  WESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
             E+  E+ I+E++VITSF + +  +  + LV L  + I   S+E
Sbjct  430  REANFERWIEEEEVITSFSLSKDNK--YLLVNLINQEIHLWSIE  471



>ref|XP_006448496.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 ref|XP_006448497.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 ref|XP_006448498.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 ref|XP_006448499.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 gb|ESR61736.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 gb|ESR61737.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 gb|ESR61738.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 gb|ESR61739.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
Length=581

 Score =   188 bits (478),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLW+I+     ++++KGHKR RFV+RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  456  LLVNLINQEIHLWSIESDPKLVSRYKGHKRARFVIRSCFGGFEQAFIASGSEDSQVYIWH  515

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R +GELV  L GHSG+VNCVSWN AN HMLASASDDRTIRIWGL Q+N+K        VH
Sbjct  516  RYTGELVLALAGHSGSVNCVSWNPANLHMLASASDDRTIRIWGLDQINMKHRDQSNGIVH  575

Query  312  HCNG  301
            HCNG
Sbjct  576  HCNG  579


 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFG  753
            DG  IF G+TDKSI +WDLDG ELE WKGQ+T+R SD+ IT DGK+I+S+ +E  ILL  
Sbjct  370  DGGGIFAGMTDKSICLWDLDGRELESWKGQKTLRISDMAITDDGKRIISICREAAILLLD  429

Query  752  WESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
             E+  E+ I+E++VITSF + +  +  + LV L  + I   S+E
Sbjct  430  REANFERWIEEEEVITSFSLSKDNK--YLLVNLINQEIHLWSIE  471



>ref|XP_007141447.1| hypothetical protein PHAVU_008G196400g [Phaseolus vulgaris]
 gb|ESW13441.1| hypothetical protein PHAVU_008G196400g [Phaseolus vulgaris]
Length=573

 Score =   188 bits (477),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 102/125 (82%), Gaps = 1/125 (1%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLWNI+G    + K+KGH+  RF++RSCFGGL +AFIASGSEDSQVYIWH
Sbjct  447  LLVNLLNQEIHLWNIEGDPRLVGKYKGHRSARFIIRSCFGGLKQAFIASGSEDSQVYIWH  506

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGV-  316
            RSSGEL+  L GHSG+VNCVSWN ANPHMLASASDDRTIRIWGL  ++    +   NG+ 
Sbjct  507  RSSGELIEALPGHSGSVNCVSWNPANPHMLASASDDRTIRIWGLNCLHNNYQNVPSNGIH  566

Query  315  HHCNG  301
            HHCNG
Sbjct  567  HHCNG  571


 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P GK I  G +DKSI MWDLDG E+E WKG++T++ SD+ I  +GK+I+S+ K   +LLF
Sbjct  360  PCGKYILCGFSDKSICMWDLDGKEVESWKGKKTLKISDLEIMDNGKEILSICKSNAVLLF  419

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+  E+ I+E + IT+F + +  +  F LV L  + I
Sbjct  420  NRETNNERFIEEYESITAFSLSKDNK--FLLVNLLNQEI  456



>ref|XP_006854396.1| PREDICTED: WD repeat-containing protein 26 [Amborella trichopoda]
 gb|ERN15863.1| hypothetical protein AMTR_s00039p00186000 [Amborella trichopoda]
Length=541

 Score =   156 bits (395),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     LV+L NQEIH+W++ G +   ++F+GH+++R+V+RSCFGGLD AFIASGSEDSQ
Sbjct  428  RDGEFILVNLNNQEIHMWDLAGRLGDPSRFRGHRQSRYVIRSCFGGLDHAFIASGSEDSQ  487

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQ  355
            +YIWHR + EL+  L GHS TVNCVSWN  NP M ASASDDRTIRIWG+ +
Sbjct  488  IYIWHRRNCELIEVLGGHSSTVNCVSWNPMNPQMFASASDDRTIRIWGVSR  538


 Score = 72.8 bits (177),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PD +R F+G  D  I  WD++G EL+ W+G R  + SD+ +T DG  +V +  EK I ++
Sbjct  347  PDSRR-FSGGCDNCIYTWDIEGRELDAWRGPRMPKVSDLAVTPDGAHLVGICAEKDIRIY  405

Query  755  GWESKAEKSIKEDQVITSFCI  693
               SK+E+ I+E+Q ITS  +
Sbjct  406  ALGSKSERVIEEEQPITSLSV  426



>ref|XP_010680145.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c 
[Beta vulgaris subsp. vulgaris]
Length=582

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             L++L NQEIHLW IDG +  +A++KGHKR+RFVVRSCFGGL+++FIASGSEDSQVYIWH
Sbjct  457  LLLNLANQEIHLWTIDGDIKLVAQYKGHKRSRFVVRSCFGGLEQSFIASGSEDSQVYIWH  516

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            RSSG+LV  L GHSG VNCVSWN  + HMLA+ASDDRTIRIWGL   N+++     NG H
Sbjct  517  RSSGQLVDILPGHSGVVNCVSWNPVDHHMLATASDDRTIRIWGLNGANMRRRVCQSNGSH  576

Query  312  HCNGGS  295
            +CNG S
Sbjct  577  NCNGKS  582


 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 10/103 (10%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            SPDG+ +F G +DKSI MWDL+G EL CWKGQRT++ SD+ IT DGKQI+S+ KE  I L
Sbjct  369  SPDGESVFAGFSDKSIGMWDLNGKELHCWKGQRTLKISDLEITLDGKQIISICKETAISL  428

Query  758  FGWESKAEKSIKEDQVITSFCI----------IQGQQVPFWLV  660
               E+K E  ++EDQ ITSF +          +  Q++  W +
Sbjct  429  LDRETKVENLVEEDQAITSFSLSNDGKFLLLNLANQEIHLWTI  471



>ref|XP_007043170.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 ref|XP_007043171.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 ref|XP_007043172.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 gb|EOX99001.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 gb|EOX99002.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 gb|EOX99003.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
Length=581

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLW+I+G    ++K+KGHKR RFV+RSCFGGL +AFIASGSEDSQVYIWH
Sbjct  456  LLVNLINQEIHLWSIEGDPKLVSKYKGHKRTRFVIRSCFGGLGQAFIASGSEDSQVYIWH  515

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R S EL+  L GHSG VNCVSWN AN HMLASASDDRTIRIWGL   NLK        +H
Sbjct  516  RCSRELLLALPGHSGAVNCVSWNPANLHMLASASDDRTIRIWGLDHFNLKHRDQNNGAIH  575

Query  312  HCNGGS  295
            HCNG S
Sbjct  576  HCNGRS  581


 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ IF G+TD+SI +WD+DG ELECWKGQRT++ SD+ +T DGK+I+S+ +E  ILL 
Sbjct  369  PDGRGIFAGMTDRSICLWDMDGRELECWKGQRTLKISDMAVTDDGKRIISICRESAILLL  428

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
              E+K E+ I+E  +ITSF + +  +  F LV L  + I   S+E
Sbjct  429  DREAKFERLIEEVDMITSFSLSKDNK--FLLVNLINQEIHLWSIE  471



>ref|XP_004499533.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Cicer 
arietinum]
Length=540

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             L++LLNQEIHLWNI G +  + K+K HKR RFV+RSCFGG  ++FIASGSEDSQVYIWH
Sbjct  414  LLINLLNQEIHLWNI-GDLQLVRKYKSHKRARFVIRSCFGGFRQSFIASGSEDSQVYIWH  472

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R+S +LV  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK +N+K  +   NG H
Sbjct  473  RNSEDLVDVLPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKCLNVKYPNAYSNGNH  532

Query  312  HCNGGS  295
            H NGG 
Sbjct  533  HSNGGE  538


 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P G  I +G+ DKSI MW+LDG E+E WK ++T++ SD+ IT DG+ I+S+ KE  ILLF
Sbjct  327  PCGNYILSGLNDKSICMWELDGKEVESWKEEKTLKISDLEITGDGEHIISICKENVILLF  386

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+  E+ I+ED++ITSFC+ +  +  F L+ L  + I
Sbjct  387  NKETNDERFIEEDEIITSFCLSKDSR--FLLINLLNQEI  423



>ref|XP_010093188.1| WD repeat-containing protein 26 [Morus notabilis]
 gb|EXB53676.1| WD repeat-containing protein 26 [Morus notabilis]
Length=588

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 102/137 (74%), Gaps = 11/137 (8%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQV----  505
             LV+LLNQEIHLWNI G +  + K+KGHKR RFV+RSCFGG ++AFIASGSEDSQV    
Sbjct  452  LLVNLLNQEIHLWNIQGEIKLVTKYKGHKRTRFVIRSCFGGTEQAFIASGSEDSQVTNLA  511

Query  504  -----YIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ  340
                 YIWHR +GEL+  L GHSG VNCVSWN  NPHMLASASDDRTIRIWGL  +N+K 
Sbjct  512  MPIQVYIWHRGTGELIEALPGHSGAVNCVSWNPVNPHMLASASDDRTIRIWGLNNLNVKS  571

Query  339  NSTVC--NGVHHCNGGS  295
                   NG+H+CNG +
Sbjct  572  KGKDAHSNGIHYCNGKT  588


 Score =   112 bits (281),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK IF+GV DKSI MW+LDG E+ECWKGQRT+R SD+ IT+DGKQ++S+  E  ILL 
Sbjct  365  PDGKLIFSGVNDKSICMWELDGKEMECWKGQRTLRISDLEITSDGKQVISISGETAILLL  424

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+EDQ ITSF + +  +  F LV L  + I
Sbjct  425  DREAKVERLIEEDQTITSFSMSKDNR--FLLVNLLNQEI  461



>ref|XP_004499532.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Cicer 
arietinum]
Length=574

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 103/131 (79%), Gaps = 1/131 (1%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            + +   L++LLNQEIHLWNI G +  + K+K HKR RFV+RSCFGG  ++FIASGSEDSQ
Sbjct  443  KDSRFLLINLLNQEIHLWNI-GDLQLVRKYKSHKRARFVIRSCFGGFRQSFIASGSEDSQ  501

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  328
            VYIWHR+S +LV  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK +N+K  +  
Sbjct  502  VYIWHRNSEDLVDVLPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKCLNVKYPNAY  561

Query  327  CNGVHHCNGGS  295
             NG HH NGG 
Sbjct  562  SNGNHHSNGGE  572


 Score = 93.6 bits (231),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P G  I +G+ DKSI MW+LDG E+E WK ++T++ SD+ IT DG+ I+S+ KE  ILLF
Sbjct  361  PCGNYILSGLNDKSICMWELDGKEVESWKEEKTLKISDLEITGDGEHIISICKENVILLF  420

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+  E+ I+ED++ITSFC+ +  +  F L+ L  + I
Sbjct  421  NKETNDERFIEEDEIITSFCLSKDSR--FLLINLLNQEI  457



>ref|XP_010943696.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c-like 
[Elaeis guineensis]
 ref|XP_010943697.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c-like 
[Elaeis guineensis]
Length=582

 Score =   183 bits (465),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLW+I      + +++GHKR+RF++RSCFGG ++ FIASGSEDSQVYIWH
Sbjct  455  LLVNLVNQEIHLWSIKDDPGLVTRYRGHKRSRFLIRSCFGGYEQTFIASGSEDSQVYIWH  514

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGV-  316
            R +GEL+  L GHSG VNCVSWN ANPHMLASASDD TIRIWGL + NLK+     NGV 
Sbjct  515  RETGELIKALPGHSGAVNCVSWNPANPHMLASASDDHTIRIWGLNRANLKRKEAYSNGVT  574

Query  315  HHCNG  301
            H CNG
Sbjct  575  HQCNG  579


 Score =   103 bits (256),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG++IF+GVTDKS  +WDLDG ELE WK QRT RTSD+ IT DG+ I+S+ +E  I+L 
Sbjct  368  PDGRQIFSGVTDKSTCLWDLDGKELESWKEQRTTRTSDVAITKDGRWIISICRETAIMLV  427

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K EK I+EDQ ITSF +    +  F LV L  + I
Sbjct  428  DREAKLEKLIQEDQTITSFSLSSDDK--FLLVNLVNQEI  464



>gb|KJB47106.1| hypothetical protein B456_008G011600 [Gossypium raimondii]
 gb|KJB47109.1| hypothetical protein B456_008G011600 [Gossypium raimondii]
 gb|KJB47110.1| hypothetical protein B456_008G011600 [Gossypium raimondii]
Length=580

 Score =   182 bits (462),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLW+I+G    I+++KGHKR RFV+RSCFGGLD++FIASGSEDSQVYIWH
Sbjct  455  LLVNLMNQEIHLWSIEGDPKLISEYKGHKRTRFVIRSCFGGLDQSFIASGSEDSQVYIWH  514

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R SGEL+  L GHSG VNCVSWN  N HMLASASDD TIRIWGL + NLK         H
Sbjct  515  RCSGELLLALPGHSGAVNCVSWNPGNLHMLASASDDGTIRIWGLDRFNLKGGEQSNGSNH  574

Query  312  HCNGGS  295
            HCNG S
Sbjct  575  HCNGRS  580


 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ IF G+TDKSI +WDLDG +LECWKGQRT+R SD+ IT DGK+I+SV +E  ILL 
Sbjct  368  PDGRGIFAGMTDKSICLWDLDGRDLECWKGQRTLRISDMAITDDGKRIISVCRESAILLL  427

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
              E+K ++ I+E  +ITSF + +  +  F LV L  + I   S+E
Sbjct  428  DREAKFDRLIEEVDMITSFSLSKDNK--FLLVNLMNQEIHLWSIE  470



>gb|KJB47107.1| hypothetical protein B456_008G011600 [Gossypium raimondii]
Length=574

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLW+I+G    I+++KGHKR RFV+RSCFGGLD++FIASGSEDSQVYIWH
Sbjct  449  LLVNLMNQEIHLWSIEGDPKLISEYKGHKRTRFVIRSCFGGLDQSFIASGSEDSQVYIWH  508

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R SGEL+  L GHSG VNCVSWN  N HMLASASDD TIRIWGL + NLK         H
Sbjct  509  RCSGELLLALPGHSGAVNCVSWNPGNLHMLASASDDGTIRIWGLDRFNLKGGEQSNGSNH  568

Query  312  HCNGGS  295
            HCNG S
Sbjct  569  HCNGRS  574


 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ IF G+TDKSI +WDLDG +LECWKGQRT+R SD+ IT DGK+I+SV +E  ILL 
Sbjct  362  PDGRGIFAGMTDKSICLWDLDGRDLECWKGQRTLRISDMAITDDGKRIISVCRESAILLL  421

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
              E+K ++ I+E  +ITSF + +  +  F LV L  + I   S+E
Sbjct  422  DREAKFDRLIEEVDMITSFSLSKDNK--FLLVNLMNQEIHLWSIE  464



>ref|XP_004149516.2| PREDICTED: uncharacterized WD repeat-containing protein C343.04c-like 
[Cucumis sativus]
 gb|KGN54948.1| hypothetical protein Csa_4G614210 [Cucumis sativus]
Length=591

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 105/134 (78%), Gaps = 8/134 (6%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLWN++G    +  + GHKR RFV+RSCFGGLD+AFIASGSEDS VYIWH
Sbjct  457  LLVNLLNQEIHLWNLEGEAEIVTTYTGHKRTRFVIRSCFGGLDQAFIASGSEDSLVYIWH  516

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQV-------NLKQNS  334
            R +GE++  L GHSG+VNCVSWN  NPHMLASASDD TIRIWGL+++       N +Q+S
Sbjct  517  RGTGEVIEALAGHSGSVNCVSWNPTNPHMLASASDDHTIRIWGLRELDDVVKFKNTEQHS  576

Query  333  TV-CNGVHHCNGGS  295
            +   NGVH+ NGG+
Sbjct  577  SSNGNGVHYTNGGT  590


 Score =   103 bits (257),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 2/105 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK I  GV DKSI MW+LDGNELE WKGQRT++ SD+ IT DGK+I+S+ ++  ILL 
Sbjct  370  PDGKHILAGVNDKSICMWELDGNELEGWKGQRTLKISDLEITNDGKKIISICRDTAILLL  429

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
              E   +K I+EDQ+ITSF + +  +  F LV L  + I   ++E
Sbjct  430  DRELNVDKLIEEDQIITSFQLSKDNK--FLLVNLLNQEIHLWNLE  472



>ref|XP_008466801.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c-like 
[Cucumis melo]
Length=594

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 104/137 (76%), Gaps = 11/137 (8%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLWN++G    +  + GHKR RFV+RSCFGGLD+AFIASGSEDS VYIWH
Sbjct  457  LLVNLLNQEIHLWNLEGEAEIVTTYTGHKRTRFVIRSCFGGLDQAFIASGSEDSLVYIWH  516

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQV-------NLKQNS  334
            R +GE++  L GHSG+VNCVSWN  NPHMLASASDD TIRIWGL+++       N +Q S
Sbjct  517  RGTGEVIEALEGHSGSVNCVSWNPTNPHMLASASDDHTIRIWGLRELDDVVKFKNTEQYS  576

Query  333  TV----CNGVHHCNGGS  295
            +      NGVH+ NGG+
Sbjct  577  SSNGNGPNGVHYSNGGT  593


 Score =   103 bits (257),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 2/105 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK I  GV DKSI MW+LDGNELE WKGQRT++ SD+ IT DGK+I+S+ ++  ILL 
Sbjct  370  PDGKHILAGVNDKSICMWELDGNELEGWKGQRTLKISDLEITNDGKKIISICRDTAILLL  429

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
              E   +K I+EDQ+ITSF + +  +  F LV L  + I   ++E
Sbjct  430  DRELNVDKLIEEDQIITSFQLSKDNK--FLLVNLLNQEIHLWNLE  472



>gb|KHG19792.1| WD repeat-containing 26 [Gossypium arboreum]
Length=539

 Score =   179 bits (455),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLW+I+G    I+++KGHKR RFV+RSCFGGLD++FIASGSEDSQVYIWH
Sbjct  414  LLVNLMNQEIHLWSIEGDPKLISEYKGHKRTRFVIRSCFGGLDQSFIASGSEDSQVYIWH  473

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R SGEL+  L GHSG VNCVSWN  N HMLASASDD TIRIWGL + NLK         H
Sbjct  474  RCSGELLLALPGHSGAVNCVSWNPGNLHMLASASDDGTIRIWGLDRFNLKGGEQSNGSNH  533

Query  312  HCNGGS  295
             CNG S
Sbjct  534  QCNGRS  539


 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ IF G+TDKSI +WDLDG +LECWKGQRT+R SD+ IT DGK+I+SV +E  ILL 
Sbjct  327  PDGRGIFAGMTDKSICLWDLDGRDLECWKGQRTLRISDMAITDDGKRIISVCRESAILLL  386

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
              E+K ++ I+E  +ITSF + +  +  F LV L  + I   S+E
Sbjct  387  DREAKFDRLIEEVDMITSFSLSKDNK--FLLVNLMNQEIHLWSIE  429



>gb|KDP40461.1| hypothetical protein JCGZ_24460 [Jatropha curcas]
Length=366

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLW+I+G+   ++K+KGH R RFV+RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  241  LLVNLINQEIHLWSIEGNPKIVSKYKGHTRARFVIRSCFGGFEQAFIASGSEDSQVYIWH  300

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R SGEL+  L GHSG VNCVSWN AN HMLAS SDDRTIRIWGL   +L+Q +      H
Sbjct  301  RGSGELLLALPGHSGAVNCVSWNPANLHMLASGSDDRTIRIWGLNHHSLEQRNQSNGITH  360

Query  312  HCNGGS  295
             CNG S
Sbjct  361  ACNGRS  366


 Score =   106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ IF G+TDKSI +WDLDG ELECW+GQR ++ SD  IT DGK+I+S+ ++  ILL 
Sbjct  154  PDGRGIFAGMTDKSICLWDLDGKELECWRGQRAVKISDTAITDDGKRIISICRDTAILLL  213

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
              E K E+ I+E+Q+ITSFC+ +  +  F LV L  + I   S+E
Sbjct  214  DREVKFERLIEEEQMITSFCLSKDNK--FLLVNLINQEIHLWSIE  256



>ref|XP_008221109.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized WD repeat-containing 
protein C343.04c [Prunus mume]
Length=562

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLW+I+     ++K+KGHKR RFV+RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  433  LLVNLINQEIHLWSIESEPKVVSKYKGHKRARFVIRSCFGGFEQAFIASGSEDSQVYIWH  492

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R SG+L+  L GHSG VNCVSWN  N HMLASASDDRTIR+WGL  +NL++  +  NG+ 
Sbjct  493  RGSGKLLLALPGHSGAVNCVSWNPVNLHMLASASDDRTIRVWGLDHLNLRRKVSQSNGIA  552

Query  312  H  310
            H
Sbjct  553  H  553


 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 78/105 (74%), Gaps = 2/105 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ IF+G+TDKSI +WDLDG ELECWKGQ+T++ SD+ IT DGK+I+++ +E TILL 
Sbjct  346  PDGRGIFSGMTDKSICLWDLDGVELECWKGQQTLKISDMAITDDGKRIINICRETTILLL  405

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
              E+K E+ I+ED+VITSF + +  +  F LV L  + I   S+E
Sbjct  406  DREAKFERLIEEDEVITSFSLSKDNK--FLLVNLINQEIHLWSIE  448



>ref|XP_010103563.1| WD repeat-containing protein 26 [Morus notabilis]
 gb|EXB96340.1| WD repeat-containing protein 26 [Morus notabilis]
Length=721

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 105/132 (80%), Gaps = 3/132 (2%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            + +   LV+L+NQEIHLWNI+G +  +AK+KGHKR RFV+RSCFGGL +AF+ASGSEDSQ
Sbjct  450  KDSKFLLVNLINQEIHLWNIEGEIKVVAKYKGHKRARFVIRSCFGGLGQAFVASGSEDSQ  509

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL-KQVNLKQNST  331
            VYIWHR SGEL+ +L GHSG VNCVSW+ +N HMLASASDDRTIRIWGL KQ+N  +   
Sbjct  510  VYIWHRDSGELIMSLPGHSGAVNCVSWSPSNLHMLASASDDRTIRIWGLKKQLNSMRGEK  569

Query  330  VCNGVHH--CNG  301
            V + +    CNG
Sbjct  570  VRHALAEALCNG  581


 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 69/98 (70%), Gaps = 3/98 (3%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFG  753
            DG+ IF+G++DKSI +W LDG ELECWKGQRT++ SD+ +T DGK I+SV +E  ILL  
Sbjct  370  DGRGIFSGMSDKSICLWHLDGRELECWKGQRTLKISDMAVTGDGK-IISVCRETAILLLD  428

Query  752  WESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
             E+  E+ I+E++ ITSF + +  +  F LV L  + I
Sbjct  429  REANFERVIEEEETITSFSLSKDSK--FLLVNLINQEI  464



>ref|XP_007222293.1| hypothetical protein PRUPE_ppa003324mg [Prunus persica]
 gb|EMJ23492.1| hypothetical protein PRUPE_ppa003324mg [Prunus persica]
Length=585

 Score =   178 bits (451),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLW+I+     ++K+KGHKR RFV+RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  456  LLVNLINQEIHLWSIESEPKVVSKYKGHKRARFVIRSCFGGFEQAFIASGSEDSQVYIWH  515

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R SGEL+  L GHSG VNCVSWN  N HMLASASDDRTIR+WGL  +NL++  +  N + 
Sbjct  516  RGSGELLLALPGHSGAVNCVSWNPVNLHMLASASDDRTIRVWGLDHLNLRRKVSQSNDIA  575

Query  312  H  310
            H
Sbjct  576  H  576


 Score =   109 bits (272),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 77/105 (73%), Gaps = 2/105 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ IF+G+ DKSI +WDLDG ELECWKGQRT++ SD+ IT DGK+I+++ +E TILL 
Sbjct  369  PDGRGIFSGMADKSICLWDLDGVELECWKGQRTLKISDMAITDDGKRIINICRETTILLL  428

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
              E+K E+ I+ED+VITSF + +  +  F LV L  + I   S+E
Sbjct  429  DREAKFERLIEEDEVITSFSLSKDNK--FLLVNLINQEIHLWSIE  471



>ref|XP_010906218.1| PREDICTED: WD repeat-containing protein 26-like [Elaeis guineensis]
 ref|XP_010906219.1| PREDICTED: WD repeat-containing protein 26-like [Elaeis guineensis]
Length=584

 Score =   178 bits (451),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 100/129 (78%), Gaps = 3/129 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLW+I      I K+KGHKR+R V+RSCFGG ++AF+ASGSEDSQVYIWH
Sbjct  455  LLVNLINQEIHLWSIVDEPMLITKYKGHKRSRLVIRSCFGGFEQAFVASGSEDSQVYIWH  514

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNST--VCNG  319
            R  G+LV  L GH+G VNCVSWN  N HMLASASDD TIR+WGL +VNLK+  +   CNG
Sbjct  515  RDGGDLVRALPGHAGAVNCVSWNPTNHHMLASASDDHTIRVWGLNRVNLKRKDSGYYCNG  574

Query  318  -VHHCNGGS  295
             VH CNG S
Sbjct  575  VVHQCNGNS  583


 Score = 97.1 bits (240),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK++  GVTD++IS+WDLDG ELE WKG R  RTSDI +T DGK I+S+ +E  I L 
Sbjct  368  PDGKQLLCGVTDQNISLWDLDGKELESWKGLRATRTSDIAVTKDGKWIISLCRETAISLL  427

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K EK I+E+Q IT+F + +  +  F LV L  + I
Sbjct  428  DREAKREKLIEEEQTITTFSLSKHDK--FLLVNLINQEI  464



>ref|XP_006280295.1| hypothetical protein CARUB_v10026218mg [Capsella rubella]
 gb|EOA13193.1| hypothetical protein CARUB_v10026218mg [Capsella rubella]
Length=437

 Score =   144 bits (362),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVY+W+
Sbjct  292  FIVNLSSQEIHLWDLAGEWKQPLKFSGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYLWN  351

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN  337
                + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N  +N
Sbjct  352  LKKAKPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPNRPEN  403


 Score = 73.2 bits (178),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  R+  G +D  + I MWD DGNE++ W+G R  +  D+ +T DG+ +++V  +K I 
Sbjct  203  PDSTRLVCGSSDPERGIVMWDTDGNEIKAWRGTRIPKVVDLAVTPDGESMITVFSDKEIR  262

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +F  E+K E+ I E+Q ITS  I
Sbjct  263  IFNLETKVERIISEEQPITSLSI  285



>ref|XP_006280294.1| hypothetical protein CARUB_v10026218mg [Capsella rubella]
 gb|EOA13192.1| hypothetical protein CARUB_v10026218mg [Capsella rubella]
Length=531

 Score =   143 bits (361),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVY+W+
Sbjct  413  FIVNLSSQEIHLWDLAGEWKQPLKFSGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYLWN  472

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN  337
                + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N  +N
Sbjct  473  LKKAKPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPNRPEN  524


 Score = 73.2 bits (178),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  R+  G +D  + I MWD DGNE++ W+G R  +  D+ +T DG+ +++V  +K I 
Sbjct  324  PDSTRLVCGSSDPERGIVMWDTDGNEIKAWRGTRIPKVVDLAVTPDGESMITVFSDKEIR  383

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +F  E+K E+ I E+Q ITS  I
Sbjct  384  IFNLETKVERIISEEQPITSLSI  406



>ref|XP_002865396.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41655.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=523

 Score =   144 bits (364),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L  QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVYIW+
Sbjct  412  FIVNLSCQEIHLWDLAGEWKLPLKFSGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYIWN  471

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN  337
              + + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N  +N
Sbjct  472  LKNAKPLEVLSGHSMTVNCVSWNPKNPRMLASASDDQTIRIWGPGKPNKPEN  523


 Score = 71.2 bits (173),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  R+  G +D  + I MWD DGNE++ W+G R  +  D+ +T DG+ +++V  +K I 
Sbjct  323  PDSTRLVCGSSDPERGIVMWDTDGNEIKAWRGTRIPKVVDLAVTPDGESMITVFSDKEIR  382

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +   E+K E+ I E+Q ITS  I
Sbjct  383  ILNLETKVERVIPEEQPITSLSI  405



>ref|XP_012068553.1| PREDICTED: WD repeat-containing protein 26 isoform X3 [Jatropha 
curcas]
 ref|XP_012068554.1| PREDICTED: WD repeat-containing protein 26 isoform X3 [Jatropha 
curcas]
Length=537

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLW+I+G+   ++K+KGH R RFV+RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  412  LLVNLINQEIHLWSIEGNPKIVSKYKGHTRARFVIRSCFGGFEQAFIASGSEDSQVYIWH  471

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R SGEL+  L GHSG VNCVSWN AN HMLAS SDDRTIRIWGL   +L+Q +      H
Sbjct  472  RGSGELLLALPGHSGAVNCVSWNPANLHMLASGSDDRTIRIWGLNHHSLEQRNQSNGITH  531

Query  312  HCNGGS  295
             CNG S
Sbjct  532  ACNGRS  537


 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ IF G+TDKSI +WDLDG ELECW+GQR ++ SD  IT DGK+I+S+ ++  ILL 
Sbjct  325  PDGRGIFAGMTDKSICLWDLDGKELECWRGQRAVKISDTAITDDGKRIISICRDTAILLL  384

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
              E K E+ I+E+Q+ITSFC+ +  +  F LV L  + I   S+E
Sbjct  385  DREVKFERLIEEEQMITSFCLSKDNK--FLLVNLINQEIHLWSIE  427



>ref|XP_012068544.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c 
isoform X1 [Jatropha curcas]
 ref|XP_012068545.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c 
isoform X1 [Jatropha curcas]
 ref|XP_012068546.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c 
isoform X1 [Jatropha curcas]
 ref|XP_012068548.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c 
isoform X1 [Jatropha curcas]
 ref|XP_012068549.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c 
isoform X1 [Jatropha curcas]
 ref|XP_012068550.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c 
isoform X1 [Jatropha curcas]
 ref|XP_012068551.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c 
isoform X1 [Jatropha curcas]
Length=578

 Score =   177 bits (448),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLW+I+G+   ++K+KGH R RFV+RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  453  LLVNLINQEIHLWSIEGNPKIVSKYKGHTRARFVIRSCFGGFEQAFIASGSEDSQVYIWH  512

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R SGEL+  L GHSG VNCVSWN AN HMLAS SDDRTIRIWGL   +L+Q +      H
Sbjct  513  RGSGELLLALPGHSGAVNCVSWNPANLHMLASGSDDRTIRIWGLNHHSLEQRNQSNGITH  572

Query  312  HCNGGS  295
             CNG S
Sbjct  573  ACNGRS  578


 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ IF G+TDKSI +WDLDG ELECW+GQR ++ SD  IT DGK+I+S+ ++  ILL 
Sbjct  366  PDGRGIFAGMTDKSICLWDLDGKELECWRGQRAVKISDTAITDDGKRIISICRDTAILLL  425

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
              E K E+ I+E+Q+ITSFC+ +  +  F LV L  + I   S+E
Sbjct  426  DREVKFERLIEEEQMITSFCLSKDNK--FLLVNLINQEIHLWSIE  468



>ref|XP_012068552.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c 
isoform X2 [Jatropha curcas]
Length=577

 Score =   177 bits (448),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEIHLW+I+G+   ++K+KGH R RFV+RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  452  LLVNLINQEIHLWSIEGNPKIVSKYKGHTRARFVIRSCFGGFEQAFIASGSEDSQVYIWH  511

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R SGEL+  L GHSG VNCVSWN AN HMLAS SDDRTIRIWGL   +L+Q +      H
Sbjct  512  RGSGELLLALPGHSGAVNCVSWNPANLHMLASGSDDRTIRIWGLNHHSLEQRNQSNGITH  571

Query  312  HCNGGS  295
             CNG S
Sbjct  572  ACNGRS  577


 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ IF G+TDKSI +WDLDG ELECW+GQR ++ SD  IT DGK+I+S+ ++  ILL 
Sbjct  365  PDGRGIFAGMTDKSICLWDLDGKELECWRGQRAVKISDTAITDDGKRIISICRDTAILLL  424

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
              E K E+ I+E+Q+ITSFC+ +  +  F LV L  + I   S+E
Sbjct  425  DREVKFERLIEEEQMITSFCLSKDNK--FLLVNLINQEIHLWSIE  467



>emb|CDY13140.1| BnaA09g16770D [Brassica napus]
Length=1106

 Score =   142 bits (359),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVYIW+
Sbjct  411  FIVNLSSQEIHLWDLAGEWKQPLKFTGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYIWN  470

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVN  349
              + + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N
Sbjct  471  VKNKKPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPN  518


 Score = 72.0 bits (175),  Expect(2) = 1e-46, Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  R+  G +D  + I MWD DGNE++ W+G R  +  D+ +T DG+ +++V  +K I 
Sbjct  322  PDSARLVCGSSDPERGIVMWDTDGNEIKAWRGTRIPKVVDLAVTPDGESMITVFSDKEIR  381

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +   ES  E+ + E+Q ITS  +
Sbjct  382  ILNLESLVERVVTEEQAITSLSV  404



>gb|EYU42858.1| hypothetical protein MIMGU_mgv1a022069mg, partial [Erythranthe 
guttata]
Length=372

 Score =   155 bits (392),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 86/105 (82%), Gaps = 2/105 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSV--TCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYI  499
             LVS+LN+EIHLWNI+ S     + K+KGH+R R VV++CFGG+ + FIASGSEDS+VYI
Sbjct  264  LLVSMLNEEIHLWNIEDSAFPVMVMKYKGHRRRRLVVKACFGGIGQGFIASGSEDSKVYI  323

Query  498  WHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            W+R SGEL+ TL GHS  VNCVSWN ANPHMLASASDDR IRIWG
Sbjct  324  WNRWSGELICTLEGHSAVVNCVSWNPANPHMLASASDDRAIRIWG  368


 Score = 59.3 bits (142),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFG  753
            +G+ IF   TD  I  W+L G     W+  +  R +D+ +T DG +I++  K   IL F 
Sbjct  178  NGESIFVSFTDGIIVRWNLQGTMGRQWRPMKPTRIADLAMTRDGSEIIAPFKGNRILFFD  237

Query  752  WESKAEKSIKEDQVITSFCI  693
            W  +  K IKED  I SF +
Sbjct  238  WRWECAKFIKEDGAIVSFTL  257



>gb|EAY85451.1| hypothetical protein OsI_06831 [Oryza sativa Indica Group]
Length=554

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 104/139 (75%), Gaps = 13/139 (9%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+++ IHLWNI      + ++ GHKR+RFV+RSCFGG ++AFIASGSEDSQ+YIWH
Sbjct  414  LLVNLISEAIHLWNIRNCPIRVNRYAGHKRSRFVIRSCFGGSEQAFIASGSEDSQIYIWH  473

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ------NST  331
            R++G+L+ TL GH+GTVNCVSWN ANPHMLASASDD TIRIWGLK+ NLK+      N  
Sbjct  474  RATGDLIETLPGHTGTVNCVSWNPANPHMLASASDDHTIRIWGLKKANLKRKDVGSSNGI  533

Query  330  VCNG-------VHHCNGGS  295
              NG       VH CNG S
Sbjct  534  YANGNTPSNGVVHQCNGNS  552


 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK I +G+TD +  +WDLDG E++CWKGQR+ +TSD  ++ DGK I+S+++E TI LF
Sbjct  327  PDGKHILSGLTDHNFCLWDLDGKEVDCWKGQRSSKTSDFAVSNDGKLIISMNRESTIRLF  386

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+ED  ITSF +   +   F LV L  + I
Sbjct  387  DRETKQERLIEEDNTITSFSL--SEDGDFLLVNLISEAI  423



>gb|EAZ22671.1| hypothetical protein OsJ_06341 [Oryza sativa Japonica Group]
Length=554

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 104/139 (75%), Gaps = 13/139 (9%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+++ IHLWNI      + ++ GHKR+RFV+RSCFGG ++AFIASGSEDSQ+YIWH
Sbjct  414  LLVNLISEAIHLWNIRNCPIRVNRYAGHKRSRFVIRSCFGGSEQAFIASGSEDSQIYIWH  473

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ------NST  331
            R++G+L+ TL GH+GTVNCVSWN ANPHMLASASDD TIRIWGLK+ NLK+      N  
Sbjct  474  RATGDLIETLPGHTGTVNCVSWNPANPHMLASASDDHTIRIWGLKKANLKRKDVGSSNGI  533

Query  330  VCNG-------VHHCNGGS  295
              NG       VH CNG S
Sbjct  534  YANGNTPSNGVVHQCNGNS  552


 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK I +G+TD +  +WDLDG E++CWKGQR+ +TSD  ++ DGK I+S+++E TI LF
Sbjct  327  PDGKHILSGLTDHNFCLWDLDGKEVDCWKGQRSSKTSDFAVSNDGKLIISMNRESTIRLF  386

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+ED  ITSF +   +   F LV L  + I
Sbjct  387  DRETKQERLIEEDNTITSFSL--SEDGDFLLVNLISEAI  423



>emb|CDY36957.1| BnaC09g17730D [Brassica napus]
Length=1092

 Score =   140 bits (354),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVYIW+
Sbjct  411  FIVNLSSQEIHLWDLAGEWKQPLKFTGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYIWN  470

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
              + + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG
Sbjct  471  VKNKKPLEVLSGHSMTVNCVSWNPRNPLMLASASDDQTIRIWG  513


 Score = 71.6 bits (174),  Expect(2) = 6e-46, Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  R+  G +D  + I MWD DGNE++ W+G R  +  D+ +T DG+ +++V  +K I 
Sbjct  322  PDSTRLVCGSSDPERGIVMWDTDGNEIKAWRGTRIPKVVDLAVTPDGESMITVFSDKEIR  381

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +   ES  E+ + E+Q ITS  +
Sbjct  382  ILNLESLVERVVTEEQAITSLSV  404



>ref|NP_199205.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 dbj|BAB09052.1| WD-repeat protein-like [Arabidopsis thaliana]
 dbj|BAE99272.1| WD-repeat protein-like [Arabidopsis thaliana]
 gb|ABQ85545.1| will die slowly [Arabidopsis thaliana]
 gb|AED95028.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=523

 Score =   141 bits (356),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L  QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVYIW+
Sbjct  412  FIVNLSCQEIHLWDLAGEWKQPLKFSGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYIWN  471

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN  337
              + + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N   N
Sbjct  472  LKNTKPLEVLSGHSMTVNCVSWNPKNPRMLASASDDQTIRIWGPGKPNKPLN  523


 Score = 71.2 bits (173),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  R+  G +D  + I MWD DGNE++ W+G R  +  D+ +T DG+ +++V  +K I 
Sbjct  323  PDSTRLVCGSSDPERGIVMWDTDGNEIKAWRGTRIPKVVDLAVTPDGESMITVFSDKEIR  382

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +   E+K E+ I E+Q ITS  I
Sbjct  383  ILNLETKVERVISEEQPITSLSI  405



>ref|XP_006403164.1| hypothetical protein EUTSA_v10003179mg [Eutrema salsugineum]
 gb|ESQ44617.1| hypothetical protein EUTSA_v10003179mg [Eutrema salsugineum]
Length=530

 Score =   144 bits (363),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G      KF GHK++++V+RSCFGGLD +FIASGSEDSQVYIW+
Sbjct  412  FIVNLSSQEIHLWDLAGEWKQPLKFSGHKQSKYVIRSCFGGLDSSFIASGSEDSQVYIWN  471

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
               G+ +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG
Sbjct  472  LKKGKPLEVLSGHSMTVNCVSWNPRNPLMLASASDDQTIRIWG  514


 Score = 68.6 bits (166),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  R+  G +D  + I MWD DGNE++ W+G R  +  D+ +T DG+ +++V  +K I 
Sbjct  323  PDSTRLVCGSSDPERGIVMWDTDGNEIKAWRGTRIPKVVDLAVTPDGESMITVFSDKEIR  382

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +   E+  E+ I E+Q ITS  +
Sbjct  383  ILNLETLVERVISEEQPITSLSV  405



>ref|XP_010441956.1| PREDICTED: WD repeat-containing protein 26 [Camelina sativa]
Length=531

 Score =   141 bits (356),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVY+W+
Sbjct  412  FIVNLSSQEIHLWDLAGEWNQPLKFSGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYLWN  471

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVN  349
              + + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N
Sbjct  472  LKNAKPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPN  519


 Score = 70.9 bits (172),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  R+  G +D  + I MWD DGNE++ W+G R  +  D+ +T DG+ +++V  +K I 
Sbjct  323  PDSTRLVCGSSDPERGIVMWDTDGNEIKAWRGTRIPKVVDLAVTPDGESMITVFSDKEIR  382

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +   E+K E+ I E+Q ITS  +
Sbjct  383  ILHLETKVERVISEEQAITSLSV  405



>ref|XP_010494383.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Camelina 
sativa]
Length=533

 Score =   141 bits (356),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVY+W+
Sbjct  414  FIVNLSSQEIHLWDLAGEWKQPLKFSGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYLWN  473

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVN  349
              + + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N
Sbjct  474  LKNAKPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPN  521


 Score = 70.5 bits (171),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  R+  G +D  + I MWD DGNE++ W+G R  +  D+ +T DG+ +++V  +K I 
Sbjct  325  PDSARLVCGSSDPERGIVMWDTDGNEIKAWRGTRIPKVVDLAVTPDGESMITVFSDKEIR  384

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +   E+K E+ I E+Q ITS  +
Sbjct  385  ILHLETKVERVISEEQPITSLSV  407



>ref|XP_010494385.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Camelina 
sativa]
Length=531

 Score =   141 bits (356),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVY+W+
Sbjct  412  FIVNLSSQEIHLWDLAGEWKQPLKFSGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYLWN  471

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVN  349
              + + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N
Sbjct  472  LKNAKPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPN  519


 Score = 70.5 bits (171),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  R+  G +D  + I MWD DGNE++ W+G R  +  D+ +T DG+ +++V  +K I 
Sbjct  323  PDSARLVCGSSDPERGIVMWDTDGNEIKAWRGTRIPKVVDLAVTPDGESMITVFSDKEIR  382

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +   E+K E+ I E+Q ITS  +
Sbjct  383  ILHLETKVERVISEEQPITSLSV  405



>ref|XP_009113968.1| PREDICTED: WD repeat-containing protein 26 [Brassica rapa]
Length=526

 Score =   142 bits (358),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVYIW+
Sbjct  412  FIVNLSSQEIHLWDLAGEWKQPLKFTGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYIWN  471

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVN  349
              + + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N
Sbjct  472  VKNKKPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPN  519


 Score = 69.7 bits (169),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  R+  G +D  + I MWD DGNE++ W+G R  +  D+ +T DG+ +++V  +K I 
Sbjct  323  PDSTRLVCGSSDPERGIVMWDTDGNEIKAWRGTRIPKVVDLAVTPDGESMITVFSDKEIR  382

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +   ES  E+ + E+Q ITS  +
Sbjct  383  ILNLESLVERVVTEEQAITSLSV  405



>ref|XP_009370775.1| PREDICTED: WD repeat-containing protein 26 [Pyrus x bretschneideri]
 ref|XP_009370783.1| PREDICTED: WD repeat-containing protein 26 [Pyrus x bretschneideri]
 ref|XP_009370792.1| PREDICTED: WD repeat-containing protein 26 [Pyrus x bretschneideri]
 ref|XP_009370800.1| PREDICTED: WD repeat-containing protein 26 [Pyrus x bretschneideri]
Length=522

 Score =   140 bits (354),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G      KF GHK++++V+RSCFGGL+ AFIASGSE+SQVYIW+
Sbjct  407  FIVNLNSQEIHMWDVAGKWEKPLKFTGHKQSKYVIRSCFGGLNSAFIASGSENSQVYIWN  466

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ  340
            R + + +  LHGHS TV CVSWN   P MLASASDD TIRIWG  + N  Q
Sbjct  467  RRNSKPIEVLHGHSMTVKCVSWNHKRPQMLASASDDHTIRIWGSSRPNKIQ  517


 Score = 70.9 bits (172),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G ++  K I MWD DGNEL+ W+G R  +  D+ +T DG+ ++S+  +K I 
Sbjct  318  PDSKRLVCGSSEPEKGIYMWDCDGNELKAWRGMRMPKILDLAVTPDGENLISIFSDKEIR  377

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ + ED  ITS  I
Sbjct  378  ILNVGTNAERVVSEDNSITSLSI  400



>ref|XP_010481799.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Camelina 
sativa]
Length=531

 Score =   140 bits (354),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G      KF GH+++++V+RSCFGGL+ +FIASGSEDSQVY+W+
Sbjct  412  FIVNLSSQEIHLWDLAGDWKQPLKFSGHRQSKYVIRSCFGGLNSSFIASGSEDSQVYLWN  471

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN  337
              + + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N  +N
Sbjct  472  LKNAKPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPNNPEN  523


 Score = 70.5 bits (171),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  R+  G +D  + I MWD DGNE++ W+G R  +  D+ +T DG+ +++V  +K I 
Sbjct  323  PDSARLVCGSSDPERGIVMWDTDGNEIKAWRGTRIPKVVDLAVTPDGESMITVFSDKEIR  382

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +   E+K E+ I E+Q ITS  +
Sbjct  383  ILHLETKVERVISEEQPITSLSV  405



>ref|XP_008382686.1| PREDICTED: WD repeat-containing protein 26 [Malus domestica]
 ref|XP_008382687.1| PREDICTED: WD repeat-containing protein 26 [Malus domestica]
 ref|XP_008382688.1| PREDICTED: WD repeat-containing protein 26 [Malus domestica]
Length=522

 Score =   137 bits (346),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G      K+ GHK++++V+RSCFGGL+  FIASGSE+SQVYIW+
Sbjct  407  FIVNLNSQEIHMWDVAGEWEKPLKYMGHKQSKYVIRSCFGGLNSTFIASGSENSQVYIWN  466

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVC  325
            R +   +  L GH  TVNCVSWN   P MLASASDD TIRIWG  + N  Q   +C
Sbjct  467  RRNSRPIEVLRGHLMTVNCVSWNLKRPQMLASASDDHTIRIWGSSRPNKIQPQKLC  522


 Score = 73.6 bits (179),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G +D  K I MWD DGNEL+ W+G R  +  D+ +T DG+ ++S+  +K I 
Sbjct  318  PDSKRLVCGSSDPEKGIYMWDCDGNELKAWRGMRMPKILDLAVTPDGENLISIFSDKEIR  377

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I ED  ITS  I
Sbjct  378  ILNVGTNAERVISEDHSITSLSI  400



>ref|XP_006647187.1| PREDICTED: WD repeat-containing protein 26-like [Oryza brachyantha]
Length=592

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 104/139 (75%), Gaps = 13/139 (9%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L ++ IHLWNI      ++++ GHKR+RFV+RSCFGG ++AFIASGSEDSQ+YIWH
Sbjct  452  LLVNLTSEAIHLWNIRSCPLRVSRYSGHKRSRFVIRSCFGGSEQAFIASGSEDSQIYIWH  511

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN--------  337
            R++G+L+ TL GH+GTVNCVSWN  NPHMLASASDD TIRIWGLK+ +LK+         
Sbjct  512  RATGDLIETLSGHTGTVNCVSWNPVNPHMLASASDDHTIRIWGLKKASLKRKDVGSSNGI  571

Query  336  ----STVCNG-VHHCNGGS  295
                +T  NG VH CNG S
Sbjct  572  YANGNTPSNGVVHQCNGNS  590


 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 66/100 (66%), Gaps = 2/100 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK I +G+ D    +WDLDG E++ WKGQR+ +TSD  ++ DGK I+S+++E TI L+
Sbjct  365  PDGKHILSGLIDHKFCLWDLDGKEVDSWKGQRSSKTSDFAVSKDGKLIISMNRESTIRLY  424

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIF  636
              E+K E+ I+E+  ITSF +   +   F LV LT + I 
Sbjct  425  DRETKQERLIEEESTITSFSL--SEDGDFLLVNLTSEAIH  462



>emb|CBI35349.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLW + G    +++++GHKR RF++RSCFGGL++AFIASGSEDS+VY+WH
Sbjct  415  LLVNLLNQEIHLWRLGGDPDVVSRYRGHKRTRFLIRSCFGGLEQAFIASGSEDSKVYVWH  474

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R + E +  L GHSG VNCVSW+  NPHMLAS SDD TIRIWGL QV LK      NG++
Sbjct  475  RDTPEPLFALPGHSGAVNCVSWSPTNPHMLASGSDDYTIRIWGLDQVKLKNRDNQRNGIN  534

Query  312  HCNGG  298
            H + G
Sbjct  535  HHSKG  539


 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P GK +F+G+TDKSI +WDLDG ELECWKGQRT++ SDI IT DGK+I+++ +E  ILL 
Sbjct  328  PGGKGVFSGMTDKSICLWDLDGRELECWKGQRTLKISDIAITDDGKRIITMCRENAILLL  387

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+E+Q+ITSF + +  +  F LV L  + I
Sbjct  388  DREAKCERLIRENQMITSFSLSKDNK--FLLVNLLNQEI  424



>ref|XP_002270103.1| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
 ref|XP_010655963.1| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
 ref|XP_010655964.1| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
 ref|XP_010655965.1| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
 ref|XP_010655966.1| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
Length=586

 Score =   172 bits (436),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+LLNQEIHLW + G    +++++GHKR RF++RSCFGGL++AFIASGSEDS+VY+WH
Sbjct  460  LLVNLLNQEIHLWRLGGDPDVVSRYRGHKRTRFLIRSCFGGLEQAFIASGSEDSKVYVWH  519

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
            R + E +  L GHSG VNCVSW+  NPHMLAS SDD TIRIWGL QV LK      NG++
Sbjct  520  RDTPEPLFALPGHSGAVNCVSWSPTNPHMLASGSDDYTIRIWGLDQVKLKNRDNQRNGIN  579

Query  312  HCNGG  298
            H + G
Sbjct  580  HHSKG  584


 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P GK +F+G+TDKSI +WDLDG ELECWKGQRT++ SDI IT DGK+I+++ +E  ILL 
Sbjct  373  PGGKGVFSGMTDKSICLWDLDGRELECWKGQRTLKISDIAITDDGKRIITMCRENAILLL  432

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E+K E+ I+E+Q+ITSF + +  +  F LV L  + I
Sbjct  433  DREAKCERLIRENQMITSFSLSKDNK--FLLVNLLNQEI  469



>ref|XP_004972947.1| PREDICTED: WD repeat-containing protein 26-like [Setaria italica]
Length=599

 Score =   172 bits (435),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 105/143 (73%), Gaps = 17/143 (12%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+N+ IHLWNI      ++++ GHKR+RFV+RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  455  LLVNLVNEVIHLWNIRNGPIRVSRYSGHKRSRFVIRSCFGGSEQAFIASGSEDSQVYIWH  514

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN---STVCN  322
            R++G+L+ TL GHSGTVNCVSWN ANPHMLASASDD TIRIWG K+ +LK+    S+ C+
Sbjct  515  RATGDLIETLAGHSGTVNCVSWNPANPHMLASASDDHTIRIWGAKKASLKRKDVGSSSCS  574

Query  321  G--------------VHHCNGGS  295
                           +H CNG S
Sbjct  575  SNGIHANGNTHGNGFIHQCNGNS  597


 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 67/100 (67%), Gaps = 2/100 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK+I +G+ D+   +WDLDG E++CWKGQR+ +T D+ +  DGK I+S+++E TILL 
Sbjct  368  PDGKQILSGLADQHFCIWDLDGTEVDCWKGQRSTKTPDLTVGKDGKVIISMNRENTILLL  427

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIF  636
              E+K E+ I+ED  ITSF +   +   F LV L  + I 
Sbjct  428  DRETKQERLIEEDHTITSFSL--SEDGDFLLVNLVNEVIH  465



>ref|NP_001159293.1| hypothetical protein [Zea mays]
 gb|ACN25711.1| unknown [Zea mays]
Length=280

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 103/131 (79%), Gaps = 6/131 (5%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+++EIHLWNI      + ++ GHK +RFV+RSCFGG ++AFIASGSEDSQVYIWH
Sbjct  136  LLVNLVSEEIHLWNIRNDPVRVNRYNGHKHSRFVIRSCFGGSEQAFIASGSEDSQVYIWH  195

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN---STVC-  325
            R++G+L+ TL GHSGTVNCVSWN  NPHMLASASDD T+RIWG K V+LK+    S+ C 
Sbjct  196  RATGDLIETLAGHSGTVNCVSWNPVNPHMLASASDDHTVRIWGAK-VSLKRKDVGSSNCN  254

Query  324  -NGVHHCNGGS  295
             NG HH NG +
Sbjct  255  SNGFHHSNGNA  265


 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFG  753
            DGK+I +G+ D++  +WDLDG E++CWKGQR+  TSD  +  DG  I+S+ ++  ILLF 
Sbjct  50   DGKQILSGLADQTFCIWDLDGKEVDCWKGQRSATTSDFAVAKDGNLIISLSRDNAILLFD  109

Query  752  WESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
             E+K E+ I+E   ITSF +   +   F LV L  + I
Sbjct  110  RETKHERIIEEGSTITSFSL--SEDGDFLLVNLVSEEI  145



>ref|XP_002866568.1| hypothetical protein ARALYDRAFT_919661 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42827.1| hypothetical protein ARALYDRAFT_919661 [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score =   139 bits (350),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 80/106 (75%), Gaps = 2/106 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIW-  496
             L++L+ Q+IH+WNI+G      ++ GHKR+RF++RSCFGG +++FIASGSEDSQVYIW 
Sbjct  403  LLINLITQKIHVWNIEGQPYKCFEYNGHKRSRFIIRSCFGGYEDSFIASGSEDSQVYIWI  462

Query  495  -HRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL  361
              R   E    L GHSG VNCVSWN  N HMLASASDD TIRIWGL
Sbjct  463  IRRLQKEPCIVLRGHSGAVNCVSWNPINLHMLASASDDGTIRIWGL  508


 Score = 69.7 bits (169),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFG  753
            DG  I  G+TD+SI +W+LDG EL   +G R  + SD+ +T DGK +VSV     I LF 
Sbjct  317  DGSGIIAGMTDRSICLWNLDGTELVHEQGPREQKLSDVAMTNDGKWLVSVDSVHVISLFN  376

Query  752  WESKAEKSIKEDQVITSFCI  693
             E++A + I E+ +ITSF +
Sbjct  377  RETRAVRLITEEDMITSFSL  396



>ref|XP_008447357.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
26 [Cucumis melo]
Length=522

 Score =   138 bits (348),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L NQEIH+W++ G      K+ GH++N++V+RSCFGG + AFIASGSE+S+VYIW 
Sbjct  408  FIVNLNNQEIHMWDVAGEWQQPLKYTGHQQNKYVIRSCFGGXNSAFIASGSENSEVYIWS  467

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R S + +  L GHS TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  468  RHSSKPIEVLSGHSTTVNCVSWNPKRPKMLASASDDQTIRIWG  510


 Score = 70.1 bits (170),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKS--ISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G  D    I +WD +GNE++ W+G R  +  D+ +T DG+ ++S+  +K I 
Sbjct  319  PDSKRLVCGSADPEMGIHLWDCEGNEIKAWRGSRMPKILDLAVTPDGENLISIFLDKEIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +   ES AE+ I ED  I+S  I
Sbjct  379  ILNLESNAERVISEDHSISSLSI  401



>ref|XP_010264796.1| PREDICTED: WD repeat-containing protein 26 isoform X3 [Nelumbo 
nucifera]
Length=519

 Score =   130 bits (328),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -1

Query  699  LYYPRTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGS  520
            L   R     +V+L +QEIHLW +        K+ GH++ ++V+RSCFGGL+  FIASGS
Sbjct  400  LSVSRDGRFLIVNLNSQEIHLWGVAEKWDKPLKYVGHRQGKYVIRSCFGGLNCMFIASGS  459

Query  519  EDSQVYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            EDSQVYIW+R S + +  L GH  TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  460  EDSQVYIWNRKSCKPIEVLPGHRMTVNCVSWNPRRPQMLASASDDQTIRIWG  511


 Score = 77.4 bits (189),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+ +G +D    I  WDL+GNELE WKG R  + SD+ +T DG  ++SV  EK I 
Sbjct  320  PDSKRLVSGSSDPKNCIYTWDLNGNELEAWKGGRLPKVSDLAVTPDGDHLISVFHEKEIR  379

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            ++   +K+E+ I E+  ITS  +
Sbjct  380  IYNXRTKSEQXISEENAITSLSV  402



>ref|XP_009792756.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Nicotiana 
sylvestris]
Length=516

 Score =   141 bits (356),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G      K+KGH+++++V+RSCFGGLD  FIASGSEDS+VYIW+
Sbjct  408  FIVNLNSQEIHMWDVAGEWLSPMKYKGHRQHKYVIRSCFGGLDSTFIASGSEDSKVYIWN  467

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R   + +  L GH+ TVNCVSWN   PHMLASASDD+TIRIWG
Sbjct  468  RRGSKPIEILCGHTMTVNCVSWNPKRPHMLASASDDQTIRIWG  510


 Score = 66.2 bits (160),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR   G +D  K I MWD +G E++ W+GQR  +  D+ +T DG++++S+  +K I 
Sbjct  319  PDSKRFVCGSSDPEKGIYMWDCEGKEIKSWRGQRMPKVLDLAVTPDGEKLISIFSDKDIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  +
Sbjct  379  ILNVGTGAERVIPEEHPITSLSL  401



>ref|XP_010264797.1| PREDICTED: WD repeat-containing protein 26 isoform X4 [Nelumbo 
nucifera]
Length=518

 Score =   130 bits (328),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -1

Query  699  LYYPRTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGS  520
            L   R     +V+L +QEIHLW +        K+ GH++ ++V+RSCFGGL+  FIASGS
Sbjct  399  LSVSRDGRFLIVNLNSQEIHLWGVAEKWDKPLKYVGHRQGKYVIRSCFGGLNCMFIASGS  458

Query  519  EDSQVYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            EDSQVYIW+R S + +  L GH  TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  459  EDSQVYIWNRKSCKPIEVLPGHRMTVNCVSWNPRRPQMLASASDDQTIRIWG  510


 Score = 77.4 bits (189),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+ +G +D    I  WDL+GNELE WKG R  + SD+ +T DG  ++SV  EK I 
Sbjct  319  PDSKRLVSGSSDPKNCIYTWDLNGNELEAWKGGRLPKVSDLAVTPDGDHLISVFHEKEIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            ++   +K+E+ I E+  ITS  +
Sbjct  379  IYNXRTKSEQXISEENAITSLSV  401



>ref|XP_010264794.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Nelumbo 
nucifera]
Length=528

 Score =   130 bits (327),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     +V+L +QEIHLW +        K+ GH++ ++V+RSCFGGL+  FIASGSEDSQ
Sbjct  413  RDGRFLIVNLNSQEIHLWGVAEKWDKPLKYVGHRQGKYVIRSCFGGLNCMFIASGSEDSQ  472

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            VYIW+R S + +  L GH  TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  473  VYIWNRKSCKPIEVLPGHRMTVNCVSWNPRRPQMLASASDDQTIRIWG  520


 Score = 77.4 bits (189),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+ +G +D    I  WDL+GNELE WKG R  + SD+ +T DG  ++SV  EK I 
Sbjct  329  PDSKRLVSGSSDPKNCIYTWDLNGNELEAWKGGRLPKVSDLAVTPDGDHLISVFHEKEIR  388

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            ++   +K+E+ I E+  ITS  +
Sbjct  389  IYNXRTKSEQXISEENAITSLSV  411



>ref|XP_010522523.1| PREDICTED: WD repeat-containing protein 26 [Tarenaya hassleriana]
Length=524

 Score =   145 bits (366),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+++L ++EIHLW+++G      KF GHK++++V+RSCFGGL+ +FIASGSEDSQVYIW+
Sbjct  408  FIINLNSEEIHLWDVEGENEQPVKFTGHKQSKYVIRSCFGGLNSSFIASGSEDSQVYIWN  467

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R S + +  L GHS TVNCVSWN   P MLASASDDRTIRIWG
Sbjct  468  RKSSKPLEVLSGHSMTVNCVSWNPKKPRMLASASDDRTIRIWG  510


 Score = 62.4 bits (150),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  ++  G +D  K I MWD DGN+++ W+G R  +  D+ +T DG+ +++V  +K I 
Sbjct  319  PDSAKLICGSSDPEKGIIMWDTDGNKIKAWRGARIPKVLDLAVTPDGQSLITVFLDKEIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  +
Sbjct  379  VLNLATNAERVIWEEHPITSISV  401



>ref|XP_010264795.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Nelumbo 
nucifera]
Length=527

 Score =   130 bits (327),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R     +V+L +QEIHLW +        K+ GH++ ++V+RSCFGGL+  FIASGSEDSQ
Sbjct  412  RDGRFLIVNLNSQEIHLWGVAEKWDKPLKYVGHRQGKYVIRSCFGGLNCMFIASGSEDSQ  471

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            VYIW+R S + +  L GH  TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  472  VYIWNRKSCKPIEVLPGHRMTVNCVSWNPRRPQMLASASDDQTIRIWG  519


 Score = 77.4 bits (189),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+ +G +D    I  WDL+GNELE WKG R  + SD+ +T DG  ++SV  EK I 
Sbjct  328  PDSKRLVSGSSDPKNCIYTWDLNGNELEAWKGGRLPKVSDLAVTPDGDHLISVFHEKEIR  387

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            ++   +K+E+ I E+  ITS  +
Sbjct  388  IYNXRTKSEQXISEENAITSLSV  410



>ref|XP_011651627.1| PREDICTED: WD repeat-containing protein 26 [Cucumis sativus]
Length=522

 Score =   139 bits (351),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L NQEIH+W++ G      K+ GH++N++V+RSCFGG++ AFIASGSE+S+VYIW 
Sbjct  408  FIVNLNNQEIHMWDVAGEWQQPLKYTGHQQNKYVIRSCFGGVNSAFIASGSENSEVYIWS  467

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R S + +  L GHS TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  468  RHSSKPIEVLSGHSTTVNCVSWNPKRPKMLASASDDQTIRIWG  510


 Score = 67.0 bits (162),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (57%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKS--ISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  R+  G  D    I +WD +GNE++ W+G R  +  D+ +T DGK ++S+  +K I 
Sbjct  319  PDSMRLVCGSADPEMGIHLWDCEGNEIKAWRGSRMPKILDLAVTPDGKNLISIFLDKEIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +   ES AE+ I E   I+S  I
Sbjct  379  ILNLESNAERIISEGHTISSLSI  401



>ref|XP_006355901.1| PREDICTED: WD repeat-containing protein 26-like [Solanum tuberosum]
Length=516

 Score =   142 bits (358),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W+I G      KF+GHK++++V+RSCFGGLD  FIASGSEDS+VYIW+
Sbjct  408  FIVNLNSQEIHMWDIAGEWLSPMKFEGHKQHKYVIRSCFGGLDSTFIASGSEDSKVYIWN  467

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R   + +  L GHS TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  468  RRGSKPIKILCGHSMTVNCVSWNPKRPQMLASASDDQTIRIWG  510


 Score = 63.9 bits (154),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR   G ++  K I MWD +GNE++ WKG R  +  D+ IT DG+++VS+  +K I 
Sbjct  319  PDSKRFVCGSSEPEKGIYMWDSEGNEIKSWKGTRMPKVLDLAITPDGEKLVSIFSDKDIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    +  E+ I E+  ITS  +
Sbjct  379  ILNVGTGGERVISEEHPITSLSL  401



>ref|XP_006281895.1| hypothetical protein CARUB_v10028093mg, partial [Capsella rubella]
 gb|EOA14793.1| hypothetical protein CARUB_v10028093mg, partial [Capsella rubella]
Length=531

 Score =   139 bits (351),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 79/105 (75%), Gaps = 2/105 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             L++L+ Q+IH+WNI+G     +++ GHKR+RF++RSCFGG  ++FIASGSEDSQVYIW 
Sbjct  389  LLINLITQKIHMWNIEGEPYLCSEYTGHKRSRFIIRSCFGGYKDSFIASGSEDSQVYIWK  448

Query  492  --RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
              R   E    L GHSG VNCVSWN  + HMLASASDD TIRIWG
Sbjct  449  ILRPQKEPCSVLRGHSGAVNCVSWNPTDLHMLASASDDGTIRIWG  493


 Score = 65.5 bits (158),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFG  753
            DG  I  G+ D+ I +W+LDG E+E  + QR  + SD+ +T DGK +VSV +   I LF 
Sbjct  303  DGSGIIGGMADRRICLWNLDGTEIEHEQVQREQKLSDVAMTADGKWLVSVGRVCEISLFN  362

Query  752  WESKAEKSIKEDQVITSFCI  693
             E++A + I E+ +ITSF +
Sbjct  363  RETRAVRLIPEEDMITSFSL  382



>gb|KJB26051.1| hypothetical protein B456_004G222700 [Gossypium raimondii]
Length=524

 Score =   132 bits (331),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHL ++ G      K+ GHK+N++V+RSCFGG++  FIASGSE++QVYIW+
Sbjct  408  FIVNLNSQEIHLRDVAGKWAKPLKYTGHKQNKYVIRSCFGGINSMFIASGSENTQVYIWN  467

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ  340
            R S   +  L GHS TVN VSWN   P MLASASDD TIRIWG  Q N  Q
Sbjct  468  RQSSTPIEVLSGHSMTVNSVSWNPKRPLMLASASDDHTIRIWGPSQSNKIQ  518


 Score = 72.8 bits (177),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KRI  G +D  K I MWD DGNE++ W+G R  +  D+ +T+DG+ ++S+  +K I 
Sbjct  319  PDSKRIVCGSSDPEKGICMWDCDGNEMKAWRGMRMPKVLDLAVTSDGENLISIFSDKEIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  +
Sbjct  379  ILNLRTNAEQVIFEEHSITSLSV  401



>ref|XP_007201159.1| hypothetical protein PRUPE_ppa004283mg [Prunus persica]
 gb|EMJ02358.1| hypothetical protein PRUPE_ppa004283mg [Prunus persica]
Length=518

 Score =   131 bits (329),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G      K+ GHK++++V+RSCFGGL+  FIASGSE++QVYIW+
Sbjct  407  FIVNLNSQEIHMWDVAGEWVRPQKYMGHKQSKYVIRSCFGGLNSTFIASGSENAQVYIWN  466

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R +   +  L GHS TVNCVSWN   P +LASASDD +IRIWG
Sbjct  467  RRNHRPIEVLRGHSMTVNCVSWNHRRPQLLASASDDHSIRIWG  509


 Score = 73.6 bits (179),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G +D  K I MWD DGNEL+ W+G R  +  D+ +T DG+ ++S+  +K I 
Sbjct  318  PDSKRLVCGSSDPEKGIYMWDCDGNELKAWRGMRMPKILDLAVTPDGQNLISIFSDKEIR  377

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I ED  ITS  I
Sbjct  378  ILNVGTNAERVISEDHSITSLSI  400



>emb|CDP03813.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   132 bits (333),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G      K++GH + ++V+RSCFGGLD  FIASGSEDSQVY+W+
Sbjct  405  FIVNLNSQEIHMWDVAGKWVKPWKYEGHMQQKYVIRSCFGGLDSRFIASGSEDSQVYVWN  464

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            + S   +  L GH  TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  465  QLSSYPIEILSGHLMTVNCVSWNPRRPQMLASASDDQTIRIWG  507


 Score = 71.6 bits (174),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G +D  K I MWD +GN+++ WKG R  + SDI +T DG+ ++S+  +K I 
Sbjct  316  PDSKRLVCGSSDPEKGIYMWDSEGNDIKAWKGVRMPKVSDIAVTPDGQHLISIFSDKEIH  375

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +   ++ AE+ I E   ITS  +
Sbjct  376  ILNLQTNAERVISEQHSITSLSV  398



>ref|XP_002873372.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49631.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=587

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 6/130 (5%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L NQEI LWNI+G    ++++KGHKR+RF++RSCFGG  +AF+ASGSEDSQVYIWH
Sbjct  457  ILVNLHNQEIRLWNIEGDPKIVSRYKGHKRSRFIIRSCFGGYKQAFVASGSEDSQVYIWH  516

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLK------QNST  331
            RS+G+L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++N +      Q S+
Sbjct  517  RSTGKLIVELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDRINQQNQKKHVQGSS  576

Query  330  VCNGVHHCNG  301
                +H CNG
Sbjct  577  SNGVIHRCNG  586


 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 65/100 (65%), Gaps = 10/100 (10%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+ I  G+TD+SI MWDLDG ELECWKGQRT + SDI +T DGK +VSV K+  I LF
Sbjct  370  PDGQGIIAGMTDRSICMWDLDGRELECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLF  429

Query  755  GWESKAEKSIKEDQVITSFCI----------IQGQQVPFW  666
              E+  E+ I+E+ +ITSF +          +  Q++  W
Sbjct  430  DREATVERLIEEEDMITSFSLSNDNKYILVNLHNQEIRLW  469



>ref|XP_011083080.1| PREDICTED: WD repeat-containing protein 26 [Sesamum indicum]
Length=515

 Score =   133 bits (334),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = -1

Query  678  STFLVSLLN-QEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVY  502
            S FL+  LN QEIH+W+I G      K+ GH++ ++V+RSCFGGL+  FIASGSEDS+VY
Sbjct  405  SNFLIVNLNSQEIHMWDIAGKWLKPLKYNGHRQQKYVIRSCFGGLNSMFIASGSEDSKVY  464

Query  501  IWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            IW+R S   +  L GH  TVNCVSWN   P MLASASDD TIRIWG
Sbjct  465  IWNRRSSNPIEILSGHLMTVNCVSWNPRRPEMLASASDDNTIRIWG  510


 Score = 70.1 bits (170),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G +D  K I MWD +GNE++ WKG R  +  D+ +T DG+ ++S+  +K I 
Sbjct  319  PDSKRLVCGSSDPKKGIYMWDCEGNEIKAWKGMRMPKVLDLAVTPDGENLISIFSDKEIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  +
Sbjct  379  ILNVTTSAERVISEEHSITSLSV  401



>gb|KHF98324.1| WD repeat-containing 26 [Gossypium arboreum]
Length=524

 Score =   132 bits (332),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHL ++ G      K+ GHK+N++V+RSCFGG++  FIASGSE++QVYIW+
Sbjct  408  FIVNLNSQEIHLRDVAGKWAKPLKYTGHKQNKYVIRSCFGGINSMFIASGSENTQVYIWN  467

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ  340
            R S   +  L GHS TVN VSWN   P MLASASDD TIRIWG  Q N  Q
Sbjct  468  RQSSTPIEVLSGHSMTVNSVSWNPKRPLMLASASDDHTIRIWGPSQSNKIQ  518


 Score = 70.9 bits (172),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KRI  G +D  K I MWD DGNE++ W+G R  +  D+ +T+DG+ ++S+  +K   
Sbjct  319  PDSKRIVCGSSDPEKGICMWDCDGNEMKAWRGMRMPKVLDLAVTSDGENLISIFSDKETR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  +
Sbjct  379  ILNLRTNAEQVIFEEHSITSLSV  401



>ref|XP_008235562.1| PREDICTED: WD repeat-containing protein 26 [Prunus mume]
Length=522

 Score =   131 bits (329),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G      K+ GHK++++V+RSCFG L+  FIASGSE++QVYIW+
Sbjct  407  FIVNLNSQEIHMWDVAGEWVKPLKYMGHKQSKYVIRSCFGPLNSTFIASGSENAQVYIWN  466

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R +   +  L GHS TVNCVSWN   P MLASASDD +IRIWG
Sbjct  467  RRNSRPIEVLRGHSMTVNCVSWNHRRPQMLASASDDHSIRIWG  509


 Score = 71.6 bits (174),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD K++  G +D  K I MWD DGNEL+ W+G R  +  D+ +T DG+ ++S+  +K I 
Sbjct  318  PDSKQLVCGSSDPEKGIYMWDCDGNELKAWRGMRMPKILDLAVTPDGQNLISIFSDKEIR  377

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I ED  ITS  I
Sbjct  378  ILNVGTNAERVISEDHSITSLSI  400



>gb|EYU42820.1| hypothetical protein MIMGU_mgv1a018113mg [Erythranthe guttata]
Length=472

 Score =   118 bits (296),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 3/105 (3%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNI--DGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYI  499
             LVS+ N+E+H+W+I  DG V  +  + G  R RFVVRSCF G+D+  IASGSEDS+VYI
Sbjct  369  LLVSMSNRELHVWDIGLDGPVMLLT-YDGITRQRFVVRSCFCGIDQTLIASGSEDSKVYI  427

Query  498  WHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            W+R +G L+ TL GHS  VNCV+ N    +MLAS SDD TI IWG
Sbjct  428  WNRETGVLMCTLEGHSDVVNCVASNPVRTNMLASGSDDCTIAIWG  472


 Score = 84.3 bits (207),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDG  IFTG+ D SISMW+L G E+  W+  +T R +D+ +T +G +++S+ +  TILL
Sbjct  281  APDGVSIFTGLNDGSISMWNLQGEEVRFWQDSKTTRIADLAVTREGTELISISEYDTILL  340

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKK  645
            F WE+  E  I ED+ I SF   + +   F LV ++ +
Sbjct  341  FDWETGNESFIHEDENIVSFS--RSEDGDFLLVSMSNR  376



>ref|XP_009629554.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Nicotiana 
tomentosiformis]
Length=517

 Score =   139 bits (349),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G      K+K H+++++V+RSCFGGLD  FIASGSEDS+VYIW+
Sbjct  408  FIVNLNSQEIHMWDVAGEWFSPMKYKSHRQHKYVIRSCFGGLDSTFIASGSEDSKVYIWN  467

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R   + +  L GH+ TVNCVSWN   PHMLASASDD+TIRIWG
Sbjct  468  RRGSKPIEILCGHTMTVNCVSWNPKRPHMLASASDDQTIRIWG  510


 Score = 63.5 bits (153),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR   G +D  K I MWD +G E++ W+G R  +  D+ +T DG++++S+  +K I 
Sbjct  319  PDSKRFVCGSSDPEKGIYMWDCEGKEIKSWRGLRMPKVLDLAVTPDGEKLISIFSDKDIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  +
Sbjct  379  ILNVGTGAERVIPEEHPITSLSL  401



>ref|XP_010245142.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c-like 
[Nelumbo nucifera]
Length=260

 Score =   111 bits (277),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            SPDGK +F+GV+DKSI MWDLDG ELECWKGQRT++ SD+ IT DGK+I++V +E  +LL
Sbjct  104  SPDGKHVFSGVSDKSICMWDLDGKELECWKGQRTLKISDLAITNDGKEIITVCQETAVLL  163

Query  758  FGWESKAEKSIKEDQVITSF  699
               E+K EK IKE Q ITSF
Sbjct  164  LDREAKVEKLIKEVQPITSF  183


 Score = 91.3 bits (225),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R ++  L++LLNQEIHLW+I+G    IAK+KGHKR R V+RSCFGG ++AFIASGSEDSQ
Sbjct  187  RDSNFVLINLLNQEIHLWSIEGDPKLIAKYKGHKRTRLVIRSCFGGFNQAFIASGSEDSQ  246

Query  507  VYI  499
            V +
Sbjct  247  VCV  249



>ref|XP_006443707.1| hypothetical protein CICLE_v10019514mg [Citrus clementina]
 ref|XP_006479415.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Citrus 
sinensis]
 gb|ESR56947.1| hypothetical protein CICLE_v10019514mg [Citrus clementina]
Length=565

 Score =   137 bits (345),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G      K+ GH +N++V+RSCFGGLD  FIASGSE+SQ+YIW+
Sbjct  456  FIVNLNSQEIHMWDVAGKWEKPFKYTGHSQNKYVIRSCFGGLDSTFIASGSENSQIYIWN  515

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQ  355
            R + + +  L GHS TVNCVSWN   P MLASASDD TIRIWG  Q
Sbjct  516  RRNSKPIEILSGHSMTVNCVSWNPKRPKMLASASDDHTIRIWGPCQ  561


 Score = 65.1 bits (157),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G +D  K I M D DGNE++ W+G R  +  D+ +T DG+ ++SV  +K I 
Sbjct  367  PDSKRLVCGSSDTEKGIFMCDCDGNEIKAWRGTRIPKVLDLAVTPDGENLISVLSDKDIR  426

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  +
Sbjct  427  ILNLGTYAERVISEEHPITSLSV  449



>gb|EYU17955.1| hypothetical protein MIMGU_mgv1a004677mg [Erythranthe guttata]
Length=515

 Score =   130 bits (328),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = -1

Query  678  STFLVSLLN-QEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVY  502
            S FL+  LN QEIH+W+I         +KGH + ++V+RSCFGGL+  FIASGSEDS+VY
Sbjct  405  SKFLIVNLNSQEIHMWDITREGVKSQTYKGHVQQKYVIRSCFGGLNSMFIASGSEDSKVY  464

Query  501  IWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            IW+R S   +  L GHS TVNCVSWN   P MLASASDD TIRIWG
Sbjct  465  IWNRRSPVPIEILSGHSMTVNCVSWNPRRPQMLASASDDNTIRIWG  510


 Score = 71.2 bits (173),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G +D  K I MWD DGNE++ WKG R  +  D+ +T DG+ ++S+  +K I 
Sbjct  319  PDSKRLVCGSSDPKKGIYMWDCDGNEIKAWKGMRMPKILDLAVTPDGENLISIFSDKEIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  +
Sbjct  379  ILNVTTNAERVITEEHSITSLSV  401



>gb|KDO60331.1| hypothetical protein CISIN_1g042434mg [Citrus sinensis]
Length=517

 Score =   136 bits (343),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G      K+ GH +N++V+RSCFGGLD  FIASGSE+SQ+YIW+
Sbjct  408  FIVNLNSQEIHMWDVAGKWEKPFKYTGHSQNKYVIRSCFGGLDGTFIASGSENSQIYIWN  467

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQ  355
            R + + +  L GHS TVNCVSWN   P MLASASDD TIRIWG  Q
Sbjct  468  RRNSKPIEILSGHSMTVNCVSWNPKRPKMLASASDDHTIRIWGPCQ  513


 Score = 65.1 bits (157),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G +D  K I M D DGNE++ W+G R  +  D+ +T DG+ ++SV  +K I 
Sbjct  319  PDSKRLVCGSSDTEKGIFMCDCDGNEIKAWRGTRIPKVLDLAVTPDGENLISVLSDKDIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  +
Sbjct  379  ILNLGTYAERVISEEHPITSLSV  401



>emb|CDX84431.1| BnaC03g50690D [Brassica napus]
Length=504

 Score =   140 bits (354),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 79/112 (71%), Gaps = 3/112 (3%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTC--IAKFKGHKRNRFVVRSCFGGLDEAFIASGSED  514
            R     LV+L+ QEIH+W IDG      + KF GHKR+RFV+RSCFGG DE FIASGSED
Sbjct  390  RDDKYLLVNLITQEIHVWMIDGRREPRRVYKFSGHKRSRFVIRSCFGGYDENFIASGSED  449

Query  513  SQVYIWHRSSGE-LVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL  361
            SQVYIWH          L GH G VNCVSWN  + HMLASASDDRTIRIWGL
Sbjct  450  SQVYIWHTDFERGPCCVLPGHGGAVNCVSWNPTDIHMLASASDDRTIRIWGL  501


 Score = 60.5 bits (145),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKT-ILLF  756
            DG  I   + D+ I +W+LDG E+E  +GQR  + SD+ +T+DGK IVSV +E+  I LF
Sbjct  308  DGSGIIGAMADRRIYLWNLDGTEIEHEQGQRGQKISDVAMTSDGKWIVSVGREQNEISLF  367

Query  755  GWESKAEKSIKEDQVITSFCI  693
               ++ E  I+ + ++TSF +
Sbjct  368  DRVTRGETVIQVEGMVTSFSL  388



>ref|XP_009792757.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Nicotiana 
sylvestris]
Length=485

 Score =   142 bits (358),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G      K+KGH+++++V+RSCFGGLD  FIASGSEDS+VYIW+
Sbjct  377  FIVNLNSQEIHMWDVAGEWLSPMKYKGHRQHKYVIRSCFGGLDSTFIASGSEDSKVYIWN  436

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R   + +  L GH+ TVNCVSWN   PHMLASASDD+TIRIWG
Sbjct  437  RRGSKPIEILCGHTMTVNCVSWNPKRPHMLASASDDQTIRIWG  479


 Score = 58.9 bits (141),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -2

Query  902  DKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFGWESKAEKSIK  723
            +K I MWD +G E++ W+GQR  +  D+ +T DG++++S+  +K I +    + AE+ I 
Sbjct  301  EKGIYMWDCEGKEIKSWRGQRMPKVLDLAVTPDGEKLISIFSDKDIRILNVGTGAERVIP  360

Query  722  EDQVITSFCI  693
            E+  ITS  +
Sbjct  361  EEHPITSLSL  370



>ref|XP_007162638.1| hypothetical protein PHAVU_001G167600g [Phaseolus vulgaris]
 gb|ESW34632.1| hypothetical protein PHAVU_001G167600g [Phaseolus vulgaris]
Length=528

 Score =   140 bits (353),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++DG     ++FKGHK++++V+RSCFGGL+  FIASGSE+SQVYIW+
Sbjct  415  FIVNLNSQEIHMWDVDGKWDMPSRFKGHKQHKYVIRSCFGGLNNTFIASGSENSQVYIWN  474

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R +   +  L GHS TVNCVSWN   P MLASASDD TIRIWG
Sbjct  475  RRNPTPIEVLSGHSMTVNCVSWNPKIPQMLASASDDYTIRIWG  517


 Score = 60.5 bits (145),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 48/83 (58%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            P+ K+   G +D  K + MWD DGN ++ W+G R  +  D+ +T DG+ ++S+  +K I 
Sbjct  326  PNSKQFACGSSDPEKGVCMWDCDGNVIKSWRGMRMPKVVDLAVTPDGEYLISIFLDKEIR  385

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + +E+ I E+  ITS  +
Sbjct  386  ILHMGTNSERVISEEHPITSLSV  408



>gb|KGN58314.1| hypothetical protein Csa_3G611390 [Cucumis sativus]
Length=190

 Score =   140 bits (352),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L NQEIH+W++ G      K+ GH++N++V+RSCFGG++ AFIASGSE+S+VYIW 
Sbjct  76   FIVNLNNQEIHMWDVAGEWQQPLKYTGHQQNKYVIRSCFGGVNSAFIASGSENSEVYIWS  135

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R S + +  L GHS TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  136  RHSSKPIEVLSGHSTTVNCVSWNPKRPKMLASASDDQTIRIWG  178


 Score = 60.8 bits (146),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -2

Query  893  ISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFGWESKAEKSIKEDQ  714
            I +WD +GNE++ W+G R  +  D+ +T DGK ++S+  +K I +   ES AE+ I E  
Sbjct  3    IHLWDCEGNEIKAWRGSRMPKILDLAVTPDGKNLISIFLDKEIRILNLESNAERIISEGH  62

Query  713  VITSFCI  693
             I+S  I
Sbjct  63   TISSLSI  69



>ref|XP_004247123.1| PREDICTED: WD repeat-containing protein 26 [Solanum lycopersicum]
Length=516

 Score =   137 bits (344),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W+I G      KF+GH+++++V+RSCFGGLD  FIASGSEDS+VYIW+
Sbjct  408  FIVNLNSQEIHMWDIAGEWLSPMKFEGHRQHKYVIRSCFGGLDSTFIASGSEDSKVYIWN  467

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R   + +  L GHS TVN VSWN   P MLASASDD+TIRIWG
Sbjct  468  RRGSKPIEILCGHSMTVNSVSWNPKRPQMLASASDDQTIRIWG  510


 Score = 63.5 bits (153),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 48/83 (58%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR   G +D  K I MWD +GNE++ WKG R  +  D+ IT DG++++S+  +K I 
Sbjct  319  PDSKRFVCGSSDAEKGIYMWDSEGNEIKSWKGTRMPKVLDLAITPDGEKLISIFSDKDIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    +  E  I E+  ITS  +
Sbjct  379  ILNVGTGGEHVISEEYPITSLSL  401



>emb|CDY41528.1| BnaA06g22810D [Brassica napus]
Length=479

 Score =   141 bits (356),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 82/113 (73%), Gaps = 5/113 (4%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTC--IAKFKGHKRNRFVVRSCFGGLDEAFIASGSED  514
            R     LV+L+ QEIH+W IDG      + KF GHKRNRFV+RSCFGG D+ FIASGSED
Sbjct  365  RDDKYLLVNLITQEIHVWMIDGRREPRRVYKFSGHKRNRFVIRSCFGGYDDNFIASGSED  424

Query  513  SQVYIWHR--SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL  361
            +QVYIWH    +G     L GH G VNCVSWN A+ HMLASASDD+TIRIWGL
Sbjct  425  TQVYIWHTDFETGPCC-VLPGHGGAVNCVSWNPADLHMLASASDDKTIRIWGL  476


 Score = 58.2 bits (139),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKT-ILLF  756
            DG  I   + D+ I +W+LDG E+E  +GQR  +  D+ +T+DGK +VSV +E+  I LF
Sbjct  283  DGSGIIGAMADRRIYLWNLDGTEIEHEQGQRGQKIYDVAMTSDGKWLVSVGREQNEISLF  342

Query  755  GWESKAEKSIKEDQVITSFCI  693
               ++ E  I+ + ++TSF +
Sbjct  343  DRVTRGETVIQVEGMVTSFSL  363



>ref|XP_009150419.1| PREDICTED: WD repeat-containing protein 26-like [Brassica rapa]
Length=477

 Score =   141 bits (355),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 82/113 (73%), Gaps = 5/113 (4%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTC--IAKFKGHKRNRFVVRSCFGGLDEAFIASGSED  514
            R     LV+L+ QEIH+W IDG      + KF GHKRNRFV+RSCFGG D+ FIASGSED
Sbjct  363  RDDKYLLVNLITQEIHVWMIDGRREPRRVYKFSGHKRNRFVIRSCFGGYDDNFIASGSED  422

Query  513  SQVYIWHR--SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL  361
            +QVYIWH    +G     L GH G VNCVSWN A+ HMLASASDD+TIRIWGL
Sbjct  423  TQVYIWHTDFETGPCC-VLPGHGGAVNCVSWNPADLHMLASASDDKTIRIWGL  474


 Score = 58.2 bits (139),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKT-ILLF  756
            DG  I   + D+ I +W+LDG E+E  +GQR  +  D+ +T+DGK +VSV +E+  I LF
Sbjct  281  DGSGIIGAMADRRIYLWNLDGTEIEHEQGQRGQKIYDVAMTSDGKWLVSVGREQNEISLF  340

Query  755  GWESKAEKSIKEDQVITSFCI  693
               ++ E  I+ + ++TSF +
Sbjct  341  DRVTRGETVIQVEGMVTSFSL  361



>gb|EYU42862.1| hypothetical protein MIMGU_mgv1a021742mg [Erythranthe guttata]
Length=494

 Score =   118 bits (296),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAK-FKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIW  496
             LVSL N+ I LW+I      + K F+GHKR R+VVR+CF GL   FIASGSEDS+VY+W
Sbjct  377  LLVSLANETIDLWDIRPENPGLLKTFEGHKRKRYVVRACFCGL---FIASGSEDSKVYVW  433

Query  495  HRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
            HR +G LVG   GHS TVNCVSWN A   ML S SDDR ++ W
Sbjct  434  HRGTGRLVGVFVGHSDTVNCVSWNRARHLMLVSGSDDRIVKGW  476


 Score = 80.1 bits (196),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDG+ IF G+ + SI MW+L G EL  W+G RT R +D+ I     ++++    +TI  
Sbjct  289  APDGESIFAGLNNGSIVMWNLQGEELRIWEGSRTTRIADLAIARGSGELITTCNYRTIRF  348

Query  758  FGWESKAEKSIKEDQVITSFCI  693
            FGWE+ AE+ I ED  I SF +
Sbjct  349  FGWETGAERFINEDADIVSFSV  370



>ref|XP_004495043.1| PREDICTED: WD repeat-containing protein 26-like [Cicer arietinum]
Length=513

 Score =   137 bits (344),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G+     K+ GHK+ ++V+RSCFGGLD  FIASGSE+S+VYIW+
Sbjct  408  FIVNLNSQEIHMWDVAGTWKKPLKYMGHKQCKYVIRSCFGGLDSTFIASGSENSEVYIWN  467

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
              S + +  L GHS TVNCVSWN   PHMLASASDD TIRIWG
Sbjct  468  SRSSKPIEVLSGHSLTVNCVSWNPKRPHMLASASDDHTIRIWG  510


 Score = 60.1 bits (144),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 46/83 (55%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            P+  +   G  D  K I MWD DGNE+  W+G R  +  D+ +T +G+ ++S+  +K I 
Sbjct  319  PNSTQFVCGSFDPEKGICMWDCDGNEIRAWRGMRMPKVVDLAVTPNGEYLISIFLDKEIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  +
Sbjct  379  ILHLGTNAERVISEEHPITSISV  401



>ref|XP_002268789.2| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
Length=551

 Score =   123 bits (308),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = -1

Query  699  LYYPRTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGS  520
            L   R +   +V+L ++EIH+W++ G      K+ GHK+N++V+RSCFGG    FIASGS
Sbjct  430  LSVSRDSKFLIVNLNSEEIHMWDVAGKWEKPLKYTGHKQNKYVIRSCFGGFHCTFIASGS  489

Query  519  EDSQVYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQ  355
            E+S VYIW+R +   +  L GH  TVNCVSWN     MLASASDD TIRIWG  Q
Sbjct  490  ENSLVYIWNRGNSTPLEVLSGHLMTVNCVSWNPRRHQMLASASDDHTIRIWGPSQ  544


 Score = 73.9 bits (180),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KRI  G +D  K I MWD DGNE++ WKG R  +  D+ +T DG+ ++S+  EK I 
Sbjct  350  PDSKRIVCGSSDPEKGIYMWDCDGNEIKAWKGMRMPKVLDLAVTPDGENLISIFSEKEIR  409

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE  I ED  ITS  +
Sbjct  410  ILNVGTNAEHVISEDYSITSLSV  432



>ref|XP_011035629.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Populus 
euphratica]
Length=519

 Score =   127 bits (318),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G      K+ GH+++++V+RSCFGGLD +FIASGSE+S+VYIW+
Sbjct  408  FIVNLNSQEIHLWDVAGKWKKPLKYIGHQQHKYVIRSCFGGLDSSFIASGSENSKVYIWN  467

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R +   +  L GH  TVNCV WN     MLASASDD TIRIWG
Sbjct  468  RRNSRPIEVLSGHLMTVNCVCWNPKRHQMLASASDDHTIRIWG  510


 Score = 69.7 bits (169),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR   G +D  K I MWD DGNE++ W+G R  +  D+ +T DG+ ++SV  +  I 
Sbjct  319  PDSKRFVCGSSDPEKGICMWDCDGNEIKAWRGTRMPKVLDLAVTPDGENLISVMSDLEIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+Q ITS  +
Sbjct  379  ILNVRTNAEQVIPEEQPITSLSV  401



>emb|CBI37215.3| unnamed protein product [Vitis vinifera]
Length=460

 Score =   122 bits (307),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R +   +V+L ++EIH+W++ G      K+ GHK+N++V+RSCFGG    FIASGSE+S 
Sbjct  343  RDSKFLIVNLNSEEIHMWDVAGKWEKPLKYTGHKQNKYVIRSCFGGFHCTFIASGSENSL  402

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQ  355
            VYIW+R +   +  L GH  TVNCVSWN     MLASASDD TIRIWG  Q
Sbjct  403  VYIWNRGNSTPLEVLSGHLMTVNCVSWNPRRHQMLASASDDHTIRIWGPSQ  453


 Score = 73.6 bits (179),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KRI  G +D  K I MWD DGNE++ WKG R  +  D+ +T DG+ ++S+  EK I 
Sbjct  259  PDSKRIVCGSSDPEKGIYMWDCDGNEIKAWKGMRMPKVLDLAVTPDGENLISIFSEKEIR  318

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE  I ED  ITS  +
Sbjct  319  ILNVGTNAEHVISEDYSITSLSV  341



>ref|XP_010069704.1| PREDICTED: WD repeat-containing protein 26-like [Eucalyptus grandis]
 gb|KCW58124.1| hypothetical protein EUGRSUZ_H00847 [Eucalyptus grandis]
Length=524

 Score =   131 bits (329),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G     +++ GHK++++V+RSCFGGL+  FIASGSED+QVY+W+
Sbjct  407  FIVNLNSQEIHMWDVAGKFVKPSRYIGHKQHKYVIRSCFGGLNSRFIASGSEDAQVYLWN  466

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R S + +  L GH  TVN VSWN   P MLASASDD+TIR+W 
Sbjct  467  RRSPQPIEILSGHKTTVNSVSWNPRRPQMLASASDDQTIRVWA  509


 Score = 65.1 bits (157),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 48/83 (58%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVT--DKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G +  +K I +WD DG E++ W+G R  +  D+ +T DG  ++SV  ++ I 
Sbjct  318  PDSKRLVCGSSHSEKGICLWDCDGTEMKAWRGTRMPKILDLAVTPDGVNLISVFSDRDIR  377

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  I
Sbjct  378  ILNLVTNAERVISEEHPITSLSI  400



>ref|XP_009629555.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Nicotiana 
tomentosiformis]
Length=486

 Score =   139 bits (351),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G      K+K H+++++V+RSCFGGLD  FIASGSEDS+VYIW+
Sbjct  377  FIVNLNSQEIHMWDVAGEWFSPMKYKSHRQHKYVIRSCFGGLDSTFIASGSEDSKVYIWN  436

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R   + +  L GH+ TVNCVSWN   PHMLASASDD+TIRIWG
Sbjct  437  RRGSKPIEILCGHTMTVNCVSWNPKRPHMLASASDDQTIRIWG  479


 Score = 55.8 bits (133),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  902  DKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFGWESKAEKSIK  723
            +K I MWD +G E++ W+G R  +  D+ +T DG++++S+  +K I +    + AE+ I 
Sbjct  301  EKGIYMWDCEGKEIKSWRGLRMPKVLDLAVTPDGEKLISIFSDKDIRILNVGTGAERVIP  360

Query  722  EDQVITSFCI  693
            E+  ITS  +
Sbjct  361  EEHPITSLSL  370



>ref|XP_010481800.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Camelina 
sativa]
Length=511

 Score =   124 bits (312),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G      KF GH+++++V+RSCFGGL+ +FIASGSEDSQVY+W+
Sbjct  412  FIVNLSSQEIHLWDLAGDWKQPLKFSGHRQSKYVIRSCFGGLNSSFIASGSEDSQVYLWN  471

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIR  373
              + + +  L GHS TVNCVSWN  NP MLASASD++ ++
Sbjct  472  LKNAKPLEVLSGHSMTVNCVSWNPRNPRMLASASDNQKMQ  511


 Score = 70.5 bits (171),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  R+  G +D  + I MWD DGNE++ W+G R  +  D+ +T DG+ +++V  +K I 
Sbjct  323  PDSARLVCGSSDPERGIVMWDTDGNEIKAWRGTRIPKVVDLAVTPDGESMITVFSDKEIR  382

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +   E+K E+ I E+Q ITS  +
Sbjct  383  ILHLETKVERVISEEQPITSLSV  405



>ref|XP_010040357.1| PREDICTED: WD repeat-containing protein 26-like [Eucalyptus grandis]
 ref|XP_010040358.1| PREDICTED: WD repeat-containing protein 26-like [Eucalyptus grandis]
 ref|XP_010040359.1| PREDICTED: WD repeat-containing protein 26-like [Eucalyptus grandis]
 gb|KCW45283.1| hypothetical protein EUGRSUZ_L01054 [Eucalyptus grandis]
Length=524

 Score =   131 bits (330),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G     +++ GHK++++V+RSCFGGL+  FIASGSED+QVY+W+
Sbjct  407  FIVNLNSQEIHMWDVAGKFVKPSRYIGHKQHKYVIRSCFGGLNSRFIASGSEDAQVYLWN  466

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R S + +  L GH  TVN VSWN   P MLASASDD+TIR+W 
Sbjct  467  RRSPQPIEILSGHKTTVNSVSWNPRRPQMLASASDDQTIRVWA  509


 Score = 63.5 bits (153),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 48/83 (58%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVT--DKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G +  +K I +WD DG E++ W+G R  +  D+ +T DG  ++SV  ++ I 
Sbjct  318  PDSKRLVCGSSHSEKGICLWDCDGTEMKAWRGTRMPKILDLVVTPDGVNLISVFSDRDIR  377

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  I
Sbjct  378  ILNLVTNAERVISEEHPITSLSI  400



>gb|ABR16581.1| unknown [Picea sitchensis]
Length=584

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 95/128 (74%), Gaps = 2/128 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             L++L NQEIHLW+I      + ++ GH++ R+V+RSCFGG D AF+ SGSEDSQV+IWH
Sbjct  457  LLLNLANQEIHLWDIGAPSKLLLRYTGHRQGRYVIRSCFGGSDLAFVVSGSEDSQVHIWH  516

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLK-QNSTVCNG-  319
            R +GEL+  L GHSGTVNCVSWN  NPH+ ASASDD TIRIWG+ +   K +N++  NG 
Sbjct  517  RGNGELLAVLPGHSGTVNCVSWNPVNPHLFASASDDYTIRIWGVNRNTFKSKNASSSNGV  576

Query  318  VHHCNGGS  295
            VH  NGG 
Sbjct  577  VHLANGGP  584


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 65/110 (59%), Gaps = 10/110 (9%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGKR  +G  DK I +WDL+G EL+ WKGQ   + SD+ +T+DGK+I+S+  E  I+++
Sbjct  370  PDGKRFISGGVDKCIYIWDLEGKELDSWKGQGMPKISDLAVTSDGKEIISICGETAIVMY  429

Query  755  GWESKAEKSIKEDQVITSFCI----------IQGQQVPFWLVCLTKKFIF  636
              E+K E+ I+E+  ITS C+          +  Q++  W +    K + 
Sbjct  430  NLETKTERLIEEESGITSLCVSKDSRFLLLNLANQEIHLWDIGAPSKLLL  479



>ref|XP_010091833.1| WD repeat-containing protein 26 [Morus notabilis]
 gb|EXB46041.1| WD repeat-containing protein 26 [Morus notabilis]
Length=533

 Score =   130 bits (326),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G      K+ GHK++++V+RSCFGGL   FIASGSE++QVYIW+
Sbjct  430  FIVNLNSQEIHMWDVAGKWEKPMKYTGHKQSKYVIRSCFGGLTSKFIASGSENTQVYIWN  489

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R +   +  L GHS TVNCVSWN     MLASASDD+TIRIWG
Sbjct  490  RRNSRPIEVLSGHSMTVNCVSWNPRRHRMLASASDDQTIRIWG  532


 Score = 63.9 bits (154),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G ++  K I +WD DGNE++ W+G R  +  D+ +T DG+ ++ +  +K I 
Sbjct  341  PDSKRLVCGSSEPEKGICLWDCDGNEIKAWRGMRMPKVLDLAVTPDGENLICIFCDKEIR  400

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  +
Sbjct  401  ILNVGTNAERVILEEHSITSLSL  423



>ref|XP_011035628.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Populus 
euphratica]
Length=520

 Score =   124 bits (310),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDS-QVYIW  496
            F+V+L +QEIHLW++ G      K+ GH+++++V+RSCFGGLD +FIASGSE+S QVYIW
Sbjct  408  FIVNLNSQEIHLWDVAGKWKKPLKYIGHQQHKYVIRSCFGGLDSSFIASGSENSKQVYIW  467

Query  495  HRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            +R +   +  L GH  TVNCV WN     MLASASDD TIRIWG
Sbjct  468  NRRNSRPIEVLSGHLMTVNCVCWNPKRHQMLASASDDHTIRIWG  511


 Score = 69.7 bits (169),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR   G +D  K I MWD DGNE++ W+G R  +  D+ +T DG+ ++SV  +  I 
Sbjct  319  PDSKRFVCGSSDPEKGICMWDCDGNEIKAWRGTRMPKVLDLAVTPDGENLISVMSDLEIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+Q ITS  +
Sbjct  379  ILNVRTNAEQVIPEEQPITSLSV  401



>gb|KHN02443.1| WD repeat-containing protein 26 [Glycine soja]
Length=523

 Score =   131 bits (329),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G      +F GHK++++V+RSCFGGL+  FIASGSE+SQVYIW+
Sbjct  410  FIVNLNSQEIHMWDVAGKWDKPLRFMGHKQHKYVIRSCFGGLNNTFIASGSENSQVYIWN  469

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
              +   V  L GHS TVNCVSWN   P MLASASDD TIRIWG
Sbjct  470  CRNSRPVEVLSGHSMTVNCVSWNPKIPQMLASASDDYTIRIWG  512


 Score = 62.0 bits (149),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 48/83 (58%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            P+ K+   G +D  K + MWD DGN ++ W+G R  +  D+ +T DG+ ++S+  +K I 
Sbjct  321  PNSKQFVCGSSDPEKGVCMWDCDGNVIKSWRGMRMPKVVDLAVTPDGEYLISIFMDKEIR  380

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  +
Sbjct  381  ILHMGTYAERVISEEHPITSLSV  403



>ref|XP_003554312.1| PREDICTED: WD repeat-containing protein 26-like [Glycine max]
Length=523

 Score =   131 bits (329),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G      +F GHK++++V+RSCFGGL+  FIASGSE+SQVYIW+
Sbjct  410  FIVNLNSQEIHMWDVAGKWDKPLRFMGHKQHKYVIRSCFGGLNNTFIASGSENSQVYIWN  469

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
              +   V  L GHS TVNCVSWN   P MLASASDD TIRIWG
Sbjct  470  CRNSRPVEVLSGHSMTVNCVSWNPKIPQMLASASDDYTIRIWG  512


 Score = 62.0 bits (149),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 48/83 (58%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            P+ K+   G +D  K + MWD DGN ++ W+G R  +  D+ +T DG+ ++S+  +K I 
Sbjct  321  PNSKQFVCGSSDPEKGVCMWDCDGNVIKSWRGMRMPKVVDLAVTPDGEYLISIFMDKEIR  380

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  +
Sbjct  381  ILHMGTYAERVISEEHPITSLSV  403



>ref|XP_009386572.1| PREDICTED: WD repeat-containing protein 26 [Musa acuminata subsp. 
malaccensis]
Length=532

 Score =   136 bits (343),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             +V+L ++EIHLWNI+ S +   KF+GHK+ ++V+RSCFGG +  FIASGSEDSQ+YIW 
Sbjct  419  LIVNLNSEEIHLWNINVSSSLPDKFRGHKQGKYVIRSCFGGSNSLFIASGSEDSQIYIWQ  478

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
            R     +  L GHS TVNCVSWN A P MLASASDDRT+RIW
Sbjct  479  RHRETPIKILTGHSMTVNCVSWNPAKPRMLASASDDRTVRIW  520


 Score = 56.6 bits (135),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 47/83 (57%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGV--TDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            P+ ++I  G    D  I   DL+GNELE W+G+R  + +D+ +T DG+ ++S+   K IL
Sbjct  330  PESEKIVCGSWEPDNRIFTCDLEGNELEVWEGERMPKVTDLAVTPDGRCLISICSNKEIL  389

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +  +    E  I E+  ITS  +
Sbjct  390  IRDFHRGNEWKIHEEHSITSLSL  412



>ref|XP_010546278.1| PREDICTED: WD repeat-containing protein 26-like [Tarenaya hassleriana]
 ref|XP_010546280.1| PREDICTED: WD repeat-containing protein 26-like [Tarenaya hassleriana]
Length=578

 Score =   157 bits (397),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 97/131 (74%), Gaps = 7/131 (5%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L+NQEI LW+I+G  + +++++GHKR RF++RSCFGG  + FIASGSEDSQVYIWH
Sbjct  447  LLVNLINQEIRLWDIEGEPSLVSRYRGHKRARFIIRSCFGGYKQGFIASGSEDSQVYIWH  506

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL---KQVNLKQN--STV  328
            R+SGE +  L GHSG VNCVSWN  +  MLAS SDD TIRIWGL   +++N ++      
Sbjct  507  RASGEQLQVLPGHSGAVNCVSWNPTDLQMLASGSDDGTIRIWGLLDHRRINPEEKVGPHS  566

Query  327  CNG--VHHCNG  301
             NG  +H CNG
Sbjct  567  SNGLVIHQCNG  577


 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK +F G+TD+SI MWDLDG E ECWKGQRT + SDI +T DGK +VSV K+ TI LF
Sbjct  360  PDGKGVFAGMTDRSICMWDLDGREQECWKGQRTQKISDIAMTNDGKWLVSVCKDTTISLF  419

Query  755  GWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
              E K EK I+E+  ITSF + +  +  + LV L  + I
Sbjct  420  DREGKFEKLIEEEDTITSFSLSEDNK--YLLVNLINQEI  456



>ref|XP_002982745.1| hypothetical protein SELMODRAFT_268628 [Selaginella moellendorffii]
 gb|EFJ15990.1| hypothetical protein SELMODRAFT_268628 [Selaginella moellendorffii]
Length=588

 Score =   157 bits (397),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 94/127 (74%), Gaps = 2/127 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L++QEIHLW++  +     K+KGH++ R+V+RSCFGG D AFI SGSEDSQVYIWH
Sbjct  443  LLVNLVSQEIHLWDMALNSRSPCKYKGHRQGRYVIRSCFGGSDHAFIVSGSEDSQVYIWH  502

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK--QVNLKQNSTVCNG  319
            R +GEL+  L GHSGTVNCVSWN +NPHM ASASDD TIRIWGL   + +  + S+  + 
Sbjct  503  RGNGELLEVLPGHSGTVNCVSWNPSNPHMFASASDDHTIRIWGLSATKRDRHRRSSAASP  562

Query  318  VHHCNGG  298
                NGG
Sbjct  563  TPKSNGG  569


 Score = 72.4 bits (176),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 54/107 (50%), Gaps = 11/107 (10%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK   TG  DK +  WDL G ELE WK  R  R  D+ +T DG  +V +  +K I +F
Sbjct  357  PDGKTFVTGAADKCMYRWDLSGAELEVWK-PRMPRIIDLAVTPDGSNVVCICHDKDIRVF  415

Query  755  GWESKAEKSIKEDQVITSFCI----------IQGQQVPFWLVCLTKK  645
              E K E+ I+ED  ITS  +          +  Q++  W + L  +
Sbjct  416  NLEDKTERVIEEDHSITSLSVSLDGRYLLVNLVSQEIHLWDMALNSR  462



>ref|XP_011033097.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011033098.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011033099.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
Length=529

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L NQEIHLW+++G    +A++KGH R+RF++RSCFGG +EAFIASGSED+QVY+WH
Sbjct  411  LLVNLTNQEIHLWSLEGYPQVVARYKGHTRSRFIIRSCFGGCEEAFIASGSEDTQVYVWH  470

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R SG+L+  L GHSG VNCVSWN  N +MLASASDD  IRIWG
Sbjct  471  RRSGKLIQALDGHSGAVNCVSWNPVNIYMLASASDDGAIRIWG  513


 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 4/107 (4%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            SPDG+ I  G+T+KS S+WD++G EL+ W+ + T+R S++ IT     IVS+ +  TI+ 
Sbjct  323  SPDGRVILAGMTNKSFSLWDVNGAELDFWE-ENTLRISEMAITDARDMIVSICRGDTIVF  381

Query  758  FGWESK-AEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
              WE K   K I+E++VITSF + +  +  F LV LT + I   S+E
Sbjct  382  LDWEEKRCRKLIQEEEVITSFSLSKDNK--FLLVNLTNQEIHLWSLE  426



>ref|XP_002311889.2| hypothetical protein POPTR_0008s00330g [Populus trichocarpa]
 gb|EEE89256.2| hypothetical protein POPTR_0008s00330g [Populus trichocarpa]
Length=529

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L NQEIHLW+++G    +A++KGH R+RF++RSCFGG +EAFIASGSED+QVY+WH
Sbjct  411  LLVNLTNQEIHLWSLEGYPQVVARYKGHTRSRFIIRSCFGGCEEAFIASGSEDAQVYVWH  470

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R SG+L+  L GHSG VNCVSWN  N +MLASASDD  IRIWG
Sbjct  471  RGSGKLIQALDGHSGAVNCVSWNPVNIYMLASASDDGAIRIWG  513


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            SPDG+ I  G+T+KS S+WD++G EL+CW+ + T+R S++ IT     IVS+ +  TI+ 
Sbjct  323  SPDGRVILAGMTNKSFSLWDVNGAELDCWE-ENTLRISEMAITDARDMIVSICRGDTIVF  381

Query  758  FGWESK-AEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGISME  621
              WE K   K I+E++VITSF + +  +  F LV LT + I   S+E
Sbjct  382  LDWEEKRCRKLIQEEEVITSFSLSKDNK--FLLVNLTNQEIHLWSLE  426



>ref|XP_002990891.1| hypothetical protein SELMODRAFT_161256 [Selaginella moellendorffii]
 gb|EFJ07935.1| hypothetical protein SELMODRAFT_161256 [Selaginella moellendorffii]
Length=548

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 92/127 (72%), Gaps = 2/127 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV+L++QEIHLW++  +     K+KGH++ R+V+RSCFGG D AFI SGSEDSQVYIWH
Sbjct  403  LLVNLVSQEIHLWDMALNSRSPCKYKGHRQGRYVIRSCFGGSDHAFIVSGSEDSQVYIWH  462

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQV--NLKQNSTVCNG  319
            R +GEL+  L GHSGTVNCVSWN +NPHM ASASDD TIRIWGL     +  + S+    
Sbjct  463  RGNGELLEVLPGHSGTVNCVSWNPSNPHMFASASDDHTIRIWGLSSTKRDRHRRSSAAAP  522

Query  318  VHHCNGG  298
                NGG
Sbjct  523  TPKSNGG  529


 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 54/107 (50%), Gaps = 11/107 (10%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK   TG  DK +  WDL G ELE WK  R  R  D+ +T DG  +V +  +K I +F
Sbjct  317  PDGKTFVTGAVDKCMYRWDLSGAELEVWK-PRMPRIIDLAVTPDGNNVVCICHDKDIRVF  375

Query  755  GWESKAEKSIKEDQVITSFCI----------IQGQQVPFWLVCLTKK  645
              E K E+ I+ED  ITS  +          +  Q++  W + L  +
Sbjct  376  NLEDKTERLIEEDHSITSLSVSLDGRYLLVNLVSQEIHLWDMALNSR  422



>gb|KJE91550.1| hypothetical protein CAOG_009572 [Capsaspora owczarzaki ATCC 
30864]
Length=1043

 Score =   133 bits (335),  Expect(2) = 7e-39, Method: Composition-based stats.
 Identities = 56/93 (60%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = -1

Query  645  IHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELVGT  466
            IHLW+I+  V  + K+ GH+++ +V+RSCFGGL+E+FIASGSEDS +YIWHR  G+L+  
Sbjct  467  IHLWDIEKRVL-VNKYYGHRQSSYVIRSCFGGLNESFIASGSEDSLIYIWHRHHGQLLER  525

Query  465  LHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
            L GHS T+NCV+WN  NP M ASASDD T+R+W
Sbjct  526  LAGHSNTINCVTWNSQNPFMFASASDDFTVRVW  558


 Score = 55.5 bits (132),  Expect(2) = 7e-39, Method: Composition-based stats.
 Identities = 27/83 (33%), Positives = 49/83 (59%), Gaps = 5/83 (6%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDG +  TG  D +  +WD++GN+L+ +      R +D+   +DGK+++ VH   T+++
Sbjct  359  APDGSKFVTGSLDTTAIVWDVEGNQLDKFDA----RFTDMAFLSDGKRLLGVHCHGTVVM  414

Query  758  FG-WESKAEKSIKEDQVITSFCI  693
            +   E + E+ I E   ITS C+
Sbjct  415  YHIGEQRREEVIHETGAITSICL  437



>ref|XP_002464509.1| hypothetical protein SORBIDRAFT_01g019860 [Sorghum bicolor]
 gb|EER91507.1| hypothetical protein SORBIDRAFT_01g019860 [Sorghum bicolor]
Length=530

 Score =   147 bits (370),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = -1

Query  675  TFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIW  496
            + +V+L +QEIHLW I+ S T   KFKGHK+++FV+RSCFGG +  FIASGSEDSQVYIW
Sbjct  418  SLVVNLTSQEIHLWKINESCTVPEKFKGHKQDKFVIRSCFGGSNSLFIASGSEDSQVYIW  477

Query  495  HRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLK  343
             R     +  LHGH+  VNCVSWN A PHMLASASDDRT+RIW  ++++ K
Sbjct  478  KRHVEMPIKVLHGHTMIVNCVSWNPARPHMLASASDDRTVRIWVARKMHSK  528


 Score = 40.0 bits (92),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 5/56 (9%)
 Frame = -2

Query  935  PDGKRIFTGVTDKS-----ISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSV  783
            P+ ++I    ++ +     I   DL+G ELE W G R  + SD+ +T DG+ ++ V
Sbjct  328  PNSEKIVCASSEPASSPNRIFTCDLEGQELEVWAGDRIPKVSDLAVTPDGRHLIFV  383



>gb|KHN09401.1| WD repeat-containing protein 26 [Glycine soja]
Length=402

 Score =   127 bits (319),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G      +F GHK++++V+RSCFGGL+  FIASG E+SQVYIW+
Sbjct  292  FIVNLNSQEIHMWDVAGKWDKPLRFMGHKQHKYVIRSCFGGLNNTFIASGCENSQVYIWN  351

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
              +   +  L GHS TVNCVSWN   P MLASASDD TIR+WG
Sbjct  352  CRNSRPIEVLSGHSITVNCVSWNPKIPQMLASASDDYTIRVWG  394


 Score = 58.5 bits (140),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 47/83 (57%), Gaps = 2/83 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            P+ K+   G +D  K + MWD DGN ++ W G R  +  D+ +T DG+ ++S+  +K I 
Sbjct  203  PNSKQFGCGSSDPEKGVCMWDCDGNVIKSWIGMRMPKVVDLAVTPDGEYLISIFMDKEIR  262

Query  761  LFGWESKAEKSIKEDQVITSFCI  693
            +    + AE+ I E+  ITS  +
Sbjct  263  ILHMGTSAEQVISEEHPITSLSV  285



>ref|XP_010918959.1| PREDICTED: WD repeat-containing protein 26 [Elaeis guineensis]
Length=542

 Score =   134 bits (338),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            R   + +V+L ++EIHLW ++ +     KF+GHK+ ++V+RSCFGG +  FIASGSEDSQ
Sbjct  425  RDGQSLIVNLNSEEIHLWKVNATSDVPDKFRGHKQGKYVIRSCFGGSNCLFIASGSEDSQ  484

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
            +YIW R     +  L GHS TVNCVSWN   PHMLASASDD T+RIW
Sbjct  485  IYIWQRHHETPIKVLSGHSKTVNCVSWNPTKPHMLASASDDDTVRIW  531


 Score = 50.8 bits (120),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            P+  +I  G ++    I   DL+G ELE W+G+R  + SD+ +T DG  ++S+   + I 
Sbjct  341  PNSDKIVCGSSEPYNCIFTCDLEGKELEVWQGERMPKVSDLAVTPDGCCLISICSSREIW  400

Query  761  LFGWESKAEKSIKEDQVITSFCIIQGQQ  678
            +  +    E+ I+ED  I S  + +  Q
Sbjct  401  IRDFPRGKERFIREDHSIASLSLSRDGQ  428



>ref|XP_008775134.1| PREDICTED: WD repeat-containing protein 26 [Phoenix dactylifera]
Length=542

 Score =   132 bits (332),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = -1

Query  699  LYYPRTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGS  520
            L   R   + +V+L ++EIHLWN++ +     KF+GHK+ ++V+RSCFGG +  FIASGS
Sbjct  421  LSLSRDGQSLIVNLNSEEIHLWNVNATSDVPDKFRGHKQGKYVIRSCFGGSNCLFIASGS  480

Query  519  EDSQVYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
            EDSQ+YIW R     +  L GHS TVN VSWN   PHMLASASDD T+RIW
Sbjct  481  EDSQIYIWQRHHEMPIKVLSGHSKTVNSVSWNPMKPHMLASASDDETVRIW  531


 Score = 52.8 bits (125),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 46/88 (52%), Gaps = 2/88 (2%)
 Frame = -2

Query  935  PDGKRIFTGV--TDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            P+  +I  G    D  I   DL+G ELE W+G+R  + SD+ +T DG  ++S+   + I 
Sbjct  341  PNSDKIVCGSCEPDNCIFTCDLEGKELEVWEGERMPKVSDLAVTPDGCCLISICSSREIW  400

Query  761  LFGWESKAEKSIKEDQVITSFCIIQGQQ  678
            +  +    E+ I ED  ITS  + +  Q
Sbjct  401  IRDFPRGKERFIHEDHSITSLSLSRDGQ  428



>gb|EYU42861.1| hypothetical protein MIMGU_mgv1a020302mg [Erythranthe guttata]
Length=503

 Score =   116 bits (290),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 4/105 (4%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAK-FKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIW  496
             LVSL ++ I+LW+I      + + F+GH R R+VVR+CF GL   FIASGSEDS V++W
Sbjct  380  LLVSLADERINLWDIRPVPPRLVRTFEGHTRKRYVVRACFCGL---FIASGSEDSNVHVW  436

Query  495  HRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL  361
             ++SG LVG   GHS TVNCVSWN A+P MLAS SDDRT+  W +
Sbjct  437  CKASGRLVGVFVGHSDTVNCVSWNRAHPRMLASGSDDRTVIRWAV  481


 Score = 68.6 bits (166),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFG  753
            +GK IF G+ + +I  W+L+G E+  W G+RT   +D+ IT +G+++++     TIL F 
Sbjct  294  NGKSIFAGLNNGNIVRWNLEGEEVGFWDGRRTTMIADLAITRNGRELITTRDYNTILFFR  353

Query  752  WESKAEKSIKEDQVITSFCI  693
            WE+  E+ I ED  I SF +
Sbjct  354  WETGWERFIYEDGDIVSFSM  373



>ref|XP_003574020.1| PREDICTED: WD repeat-containing protein 26 [Brachypodium distachyon]
Length=533

 Score =   140 bits (352),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -1

Query  675  TFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIW  496
            + +V+L +QEIHLW  +GS +   KFKGHK+ +FV+RSCFGG D  FIASGSEDSQVYIW
Sbjct  422  SMIVNLNSQEIHLWKTNGSSSVPDKFKGHKQGKFVIRSCFGGSDSLFIASGSEDSQVYIW  481

Query  495  HRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
             R     +  LHGHS TVNCVSWN   P MLASASDD T+RIW
Sbjct  482  KRCMEMPIKVLHGHSMTVNCVSWNPTRPQMLASASDDCTVRIW  524


 Score = 44.7 bits (104),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 36/63 (57%), Gaps = 1/63 (2%)
 Frame = -2

Query  881  DLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFGWESKAEKSIKEDQVITS  702
            DL+G ELE W G+R  + SD+ +T DG+ ++ V   + I +       E  I E ++I+S
Sbjct  355  DLEGQELEVWAGERIPKVSDLAVTPDGQHLICVCPNE-IWIRELRKGREWKIPEREMISS  413

Query  701  FCI  693
             C+
Sbjct  414  LCV  416



>ref|XP_004982941.1| PREDICTED: WD repeat-containing protein 26-like [Setaria italica]
Length=522

 Score =   143 bits (361),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -1

Query  675  TFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIW  496
            + +V+L +QEIHLW I+ S T   KFKGHK+ +FV+RSCFGG +  FIASGSEDSQVYIW
Sbjct  410  SLIVNLSSQEIHLWKINESSTVPEKFKGHKQEKFVIRSCFGGSNSLFIASGSEDSQVYIW  469

Query  495  HRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
             R     +  LHGH+  VNCVSWN A PHMLASASDDRT+RIW
Sbjct  470  KRHLETPIKVLHGHTMIVNCVSWNPARPHMLASASDDRTVRIW  512


 Score = 40.8 bits (94),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = -2

Query  914  TGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSV  783
             G +   I   DL+G ELE W G R  + SD+ +T DG+ ++ V
Sbjct  332  PGSSPNRIFTCDLEGQELEVWAGDRIPKVSDLAVTPDGRHLIFV  375



>ref|XP_004349429.2| WD repeat-containing protein [Capsaspora owczarzaki ATCC 30864]
 ref|XP_011270165.1| WD repeat-containing protein, variant [Capsaspora owczarzaki 
ATCC 30864]
Length=594

 Score =   128 bits (322),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = -1

Query  645  IHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELVGT  466
            IHLW+I+  V  + K+ GH+++ +V+RSCFGGL+E+FIASGSEDS +YIWHR  G+L+  
Sbjct  467  IHLWDIEKRV-LVNKYYGHRQSSYVIRSCFGGLNESFIASGSEDSLIYIWHRHHGQLLER  525

Query  465  LHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
            L GHS T+NCV+WN  NP M ASASDD T+R+W
Sbjct  526  LAGHSNTINCVTWNSQNPFMFASASDDFTVRVW  558


 Score = 55.5 bits (132),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 49/83 (59%), Gaps = 5/83 (6%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDG +  TG  D +  +WD++GN+L+ +      R +D+   +DGK+++ VH   T+++
Sbjct  359  APDGSKFVTGSLDTTAIVWDVEGNQLDKFDA----RFTDMAFLSDGKRLLGVHCHGTVVM  414

Query  758  FGW-ESKAEKSIKEDQVITSFCI  693
            +   E + E+ I E   ITS C+
Sbjct  415  YHIGEQRREEVIHETGAITSICL  437



>gb|EFA80856.1| hypothetical protein PPL_06445 [Polysphondylium pallidum PN500]
Length=760

 Score =   134 bits (338),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             +V+  NQEIHLW+++  +  + K++G ++ RFV+RSCFGG+DE FI SGSEDS++YIW 
Sbjct  623  IIVNTSNQEIHLWDLEKRII-VQKYRGQRQGRFVIRSCFGGVDEGFILSGSEDSKIYIWR  681

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL  346
            R +G L+  L GH+ TVNCV+W+  +P++  SASDD TIR+W  K++ L
Sbjct  682  RQNGALLECLSGHTKTVNCVAWSPTDPYLFCSASDDETIRVWTRKELEL  730


 Score = 47.8 bits (112),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 48/92 (52%), Gaps = 12/92 (13%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNE--------LECWKGQRTIRTSDIGITTDGKQIVSVH  780
            PDGKR  +G  DK++ +W++   E        +  W      R +D+ I  DGKQ++ + 
Sbjct  530  PDGKRFVSGGNDKNLYLWNIATPETTHQVSVPIRSWA---CARVNDMAIHRDGKQLIVIC  586

Query  779  KEKTILLFGWES-KAEKSIKEDQVITSFCIIQ  687
            +EK I +F  ++ + E SI E + I S  + Q
Sbjct  587  QEKKIRIFDIDAERPEISIAETEAIMSMALSQ  618



>tpg|DAA49690.1| TPA: hypothetical protein ZEAMMB73_458845 [Zea mays]
Length=240

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -1

Query  675  TFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIW  496
            + +V+L +QEIHLW I+ S T   KF GHK+++FV+RSCFGG + +FIASGSEDSQVYIW
Sbjct  130  SLIVNLNSQEIHLWKINESCTVPEKFMGHKQDKFVIRSCFGGSNSSFIASGSEDSQVYIW  189

Query  495  HRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
             R     +  LHGH+  VNCVSWN A PHMLASASDDRT+RIW
Sbjct  190  KRHVEMPIKVLHGHTMIVNCVSWNPARPHMLASASDDRTVRIW  232



>ref|XP_008664896.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Zea 
mays]
 tpg|DAA49691.1| TPA: hypothetical protein ZEAMMB73_458845 [Zea mays]
Length=528

 Score =   143 bits (360),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -1

Query  675  TFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIW  496
            + +V+L +QEIHLW I+ S T   KF GHK+++FV+RSCFGG + +FIASGSEDSQVYIW
Sbjct  418  SLIVNLNSQEIHLWKINESCTVPEKFMGHKQDKFVIRSCFGGSNSSFIASGSEDSQVYIW  477

Query  495  HRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
             R     +  LHGH+  VNCVSWN A PHMLASASDDRT+RIW
Sbjct  478  KRHVEMPIKVLHGHTMIVNCVSWNPARPHMLASASDDRTVRIW  520


 Score = 38.1 bits (87),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (54%), Gaps = 5/56 (9%)
 Frame = -2

Query  935  PDGKRIFTGVTDKS-----ISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSV  783
            P+ ++I    ++ +     I   DL+G  LE W G R  + SD+ +T DG+ ++ V
Sbjct  328  PNSEKIVCASSEPASAPNRIFTCDLEGQNLEVWAGDRIPKVSDLAVTPDGRHLIFV  383



>ref|XP_008664897.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Zea 
mays]
Length=425

 Score =   143 bits (361),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -1

Query  675  TFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIW  496
            + +V+L +QEIHLW I+ S T   KF GHK+++FV+RSCFGG + +FIASGSEDSQVYIW
Sbjct  315  SLIVNLNSQEIHLWKINESCTVPEKFMGHKQDKFVIRSCFGGSNSSFIASGSEDSQVYIW  374

Query  495  HRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
             R     +  LHGH+  VNCVSWN A PHMLASASDDRT+RIW
Sbjct  375  KRHVEMPIKVLHGHTMIVNCVSWNPARPHMLASASDDRTVRIW  417


 Score = 37.7 bits (86),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = -2

Query  881  DLDGNELECWKGQRTIRTSDIGITTDGKQIVSV  783
            DL+G  LE W G R  + SD+ +T DG+ ++ V
Sbjct  248  DLEGQNLEVWAGDRIPKVSDLAVTPDGRHLIFV  280



>gb|EYU42819.1| hypothetical protein MIMGU_mgv1a005559mg [Erythranthe guttata]
Length=479

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAK-FKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIW  496
             LVSLLN+EI LWNI      I K F+GHKR +F+VR+CFGG  + F+ASGSED+QVY+W
Sbjct  376  LLVSLLNEEIQLWNIGLEQPVIVKTFEGHKRQKFIVRTCFGGKGQGFVASGSEDTQVYVW  435

Query  495  HRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
             R+SGE++  L GHS TV CVSWN  NP MLASASDD TIRIWG
Sbjct  436  DRASGEIIRKLEGHSRTVTCVSWNPTNPSMLASASDDGTIRIWG  479



>ref|XP_011046605.1| PREDICTED: WD repeat-containing protein 26 [Populus euphratica]
Length=520

 Score =   120 bits (300),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 75/106 (71%), Gaps = 2/106 (2%)
 Frame = -1

Query  675  TFLVSLLNQEIHLWNI-DGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYI  499
              LV+LLN+ IH W++ +G    I++++G    RF++RSC GGL+E FIASGSEDS+V+I
Sbjct  397  VLLVNLLNRGIHFWSLLEGYEGLISRYEGRISTRFIIRSCLGGLEETFIASGSEDSRVFI  456

Query  498  WHRSSGELVGTLHG-HSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            WHR     +  L   H+GTVNCVSWN  N HMLASASDD  I IWG
Sbjct  457  WHRGQRIPIMQLQSIHTGTVNCVSWNPTNIHMLASASDDHKIVIWG  502


 Score = 58.5 bits (140),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = -2

Query  920  IFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFGWESK  741
            I  G TD+SI + DL+G E++CWK    +R S++ IT DG +I+S++++++I +   E K
Sbjct  316  ILAGTTDQSIILLDLEGAEMDCWKNY-ALRMSEMAITNDGTRILSIYEDRSIAVIDREKK  374

Query  740  A-EKSIKEDQVITSFCIIQGQQV  675
               + + ++ VITSF +    +V
Sbjct  375  KILRLLPQEGVITSFSLSNDNKV  397



>gb|AAP54181.2| WD-repeat protein 26, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG66126.1| WD-repeat protein 26, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG66127.1| WD-repeat protein 26, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG92818.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99292.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99438.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = -1

Query  675  TFLVSLLNQEIHLWNIDGSVTCIA-KFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYI  499
            + +V+L +QEIHLW I  S T    KFKGHK+ +FV+RSCFGG +  FIASGSEDSQVYI
Sbjct  130  SLIVNLNSQEIHLWRISESSTAADNKFKGHKQGKFVIRSCFGGSNSLFIASGSEDSQVYI  189

Query  498  WHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
            W R     +  L+GHS TVNCVSWN A PHMLASASDDRT+RIW
Sbjct  190  WKRHLETPIKVLYGHSLTVNCVSWNPAKPHMLASASDDRTVRIW  233



>dbj|BAD22174.1| putative WD repeat protein [Oryza sativa Japonica Group]
Length=510

 Score = 99.0 bits (245),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK I +G+TD +  +WDLDG E++CWKGQR+ +TSD  ++ DGK I+S+++E TI LF
Sbjct  367  PDGKHILSGLTDHNFCLWDLDGKEVDCWKGQRSSKTSDFAVSNDGKLIISMNRESTIRLF  426

Query  755  GWESKAEKSIKEDQVITSFCI  693
              E+K E+ I+ED  ITSF +
Sbjct  427  DRETKQERLIEEDNTITSFSL  447


 Score = 76.6 bits (187),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVY  502
             LV+L+++ IHLWNI      + ++ GHKR+RFV+RSCFGG ++AFIASGSEDSQV+
Sbjct  454  LLVNLISEAIHLWNIRNCPIRVNRYAGHKRSRFVIRSCFGGSEQAFIASGSEDSQVW  510



>ref|XP_004356287.1| WD repeat protein [Dictyostelium fasciculatum]
 gb|EGG17803.1| WD repeat protein [Dictyostelium fasciculatum]
Length=819

 Score =   126 bits (316),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            LV+  NQEIHLW+++   T I K++G ++ RFV+RSCFGG D+ FI SGSEDS++YIW+R
Sbjct  561  LVNTSNQEIHLWDLEKR-TIIQKYRGMRQGRFVIRSCFGGADQTFIISGSEDSKIYIWNR  619

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
             +G L+ TL GH GTVN V W+  +P++  SASDD++I+IW
Sbjct  620  LNGTLLETLSGHFGTVNSVHWSPTDPYLFCSASDDQSIKIW  660


 Score = 48.9 bits (115),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 44/86 (51%), Gaps = 7/86 (8%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECW-----KGQRTIRTSDIGITTDGKQIVSVHKEK  771
            PDGKR  +G  DK I +W+    E         +  +  R +D+GI  DGKQ+V + +EK
Sbjct  466  PDGKRFVSGGNDKFIYLWNAATVETASMVSTPVRSWQCARVNDLGIHKDGKQLVVICQEK  525

Query  770  TILLFGW--ESKAEKSIKEDQVITSF  699
             I L+    E   E SI E + ITS 
Sbjct  526  KIRLYDIDNEKTPETSIPETEAITSM  551



>ref|XP_002315365.1| hypothetical protein POPTR_0010s26090g [Populus trichocarpa]
 gb|EEF01536.1| hypothetical protein POPTR_0010s26090g [Populus trichocarpa]
Length=505

 Score =   120 bits (300),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 75/106 (71%), Gaps = 2/106 (2%)
 Frame = -1

Query  675  TFLVSLLNQEIHLWNI-DGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYI  499
              LV+LLN+ IH W++ +G    I++++G    RF++RSC GGL+E FIASGSEDS+V+I
Sbjct  397  VLLVNLLNRGIHFWSLLEGYEGLISRYEGRISTRFIIRSCLGGLEETFIASGSEDSRVFI  456

Query  498  WHRSSGELVGTLHG-HSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            WHR     +  L   H+GTVNCVSWN  N HMLASASDD  I IWG
Sbjct  457  WHRGQRIPIMQLQSIHTGTVNCVSWNPTNIHMLASASDDHKIVIWG  502


 Score = 53.9 bits (128),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  920  IFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFGWESK  741
            I  G TD+SI + DL+G EL+ WK    +R S++ IT DG +I+S++++ +I +   E K
Sbjct  316  ILAGTTDQSIILLDLEGAELDSWK-DYALRMSEMAITNDGTRILSIYEDSSIAVIDREKK  374

Query  740  A-EKSIKEDQVITSFCIIQGQQV  675
               + + ++ VITSF +    +V
Sbjct  375  KILRLLPQEGVITSFSLSNDNKV  397



>gb|KFK31679.1| hypothetical protein AALP_AA6G145100 [Arabis alpina]
Length=529

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G      KF GHK++++V+RSCFGGLD +FIASGSE+SQVYIW+
Sbjct  413  FIVNLSSQEIHLWDLAGEWKQPLKFSGHKQSKYVIRSCFGGLDSSFIASGSENSQVYIWN  472

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
                + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG
Sbjct  473  LKKAKPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWG  515


 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD  R+  G +D  + I MWD DGNE++ W+G R  +  D+ +T DG+ +++V  +K I 
Sbjct  324  PDSTRLVCGSSDPERGIVMWDTDGNEIKAWRGTRIPKVVDLAVTPDGESMITVFSDKEIR  383

Query  761  LFGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
            +   E+K E+ I E+Q ITS  I    +  F++V L+ + I
Sbjct  384  ILNLETKVERVIPEEQPITSLSISANGK--FFIVNLSSQEI  422



>ref|XP_011118606.1| hypothetical protein AOL_s00007g403 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX52620.1| hypothetical protein AOL_s00007g403 [Arthrobotrys oligospora 
ATCC 24927]
Length=565

 Score =   122 bits (307),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -1

Query  609  IAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELVGTLHGHSGTVNCVS  430
            +  FKGHK+ +FV++SCFGG DE F+ SGSED  +Y+WH+ +G+L+ +L GH+GTVNCV+
Sbjct  461  VRTFKGHKQGKFVIKSCFGGADENFVVSGSEDCLIYVWHKDNGQLMESLEGHTGTVNCVA  520

Query  429  WNGANPHMLASASDDRTIRIWGLKQVNLK  343
            WN  NP M ASA DD+ +RIW +   +LK
Sbjct  521  WNPTNPQMFASAGDDKVVRIWSVASDSLK  549


 Score = 51.2 bits (121),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 51/103 (50%), Gaps = 13/103 (13%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDG    TG  DKSI +W+L G  L  W+G R     DI IT DG +++++  E  I +
Sbjct  351  APDGTYFATGSVDKSIVLWNLAGEALHTWQGSRIY---DIVITPDGARLIAICTEHKIHI  407

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGI  630
            +   +      K D++    C++   + P   + +TK   F I
Sbjct  408  YDLTTP-----KRDEI----CVLN-MKAPLTSISVTKDSRFAI  440



>ref|XP_011111734.1| hypothetical protein H072_5931 [Dactylellina haptotyla CBS 200.50]
 gb|EPS40252.1| hypothetical protein H072_5931 [Dactylellina haptotyla CBS 200.50]
Length=550

 Score =   120 bits (300),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = -1

Query  609  IAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELVGTLHGHSGTVNCVS  430
            +  FKGHK+ +FV++SCFGG DE F+ SGSED  +Y+WH+ +G L+ +L GH GTVNCV+
Sbjct  448  VRTFKGHKQGKFVIKSCFGGADENFVVSGSEDCMIYVWHKENGLLMESLSGHEGTVNCVA  507

Query  429  WNGANPHMLASASDDRTIRIWGLKQVNLK  343
            WN  NP M ASA DD+ +RIW +    LK
Sbjct  508  WNPTNPQMFASAGDDKVVRIWSVSGDTLK  536


 Score = 53.1 bits (126),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 51/103 (50%), Gaps = 13/103 (13%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGK   TG  DKSI +W+L G +L  W G R     DI IT DG +++++  E+ I +
Sbjct  338  APDGKTFATGSVDKSIVLWNLQGEDLHQWSGSRIY---DIVITPDGTRLIAICTEQKIHI  394

Query  758  FGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIFGI  630
            +   S  ++          FC +   + P   + +TK   + I
Sbjct  395  YDLASPKKE---------EFCTLL-MKAPLTSISVTKDSRYAI  427



>ref|NP_001064796.1| Os10g0465000 [Oryza sativa Japonica Group]
 dbj|BAF26710.1| Os10g0465000, partial [Oryza sativa Japonica Group]
Length=317

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = -1

Query  675  TFLVSLLNQEIHLWNIDGSVTCIA-KFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYI  499
            + +V+L +QEIHLW I  S T    KFKGHK+ +FV+RSCFGG +  FIASGSEDSQVYI
Sbjct  201  SLIVNLNSQEIHLWRISESSTAADNKFKGHKQGKFVIRSCFGGSNSLFIASGSEDSQVYI  260

Query  498  WHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
            W R     +  L+GHS TVNCVSWN A PHMLASASDDRT+RIW
Sbjct  261  WKRHLETPIKVLYGHSLTVNCVSWNPAKPHMLASASDDRTVRIW  304



>ref|XP_003286147.1| hypothetical protein DICPUDRAFT_46602 [Dictyostelium purpureum]
 gb|EGC37333.1| hypothetical protein DICPUDRAFT_46602 [Dictyostelium purpureum]
Length=1022

 Score =   131 bits (329),  Expect(2) = 8e-34, Method: Composition-based stats.
 Identities = 57/101 (56%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = -1

Query  669   LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
             LV+   QEIHLW+++     + K++G K+ RFV+RSCFGG+DEAFI SGSEDS +YIWHR
Sbjct  915   LVNTSCQEIHLWDLEKQ-NIVQKYRGQKQGRFVIRSCFGGVDEAFILSGSEDSTIYIWHR  973

Query  489   SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
              +G L+ TL  HSGTVN V W+  +P++  SASDD+TI++W
Sbjct  974   QTGTLLETLSRHSGTVNTVCWSPCSPNIFCSASDDQTIKVW  1014


 Score = 41.2 bits (95),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 46/111 (41%), Gaps = 32/111 (29%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQ-----------------------------  843
            PD KR  TG  D++I +W ++   L+   G                              
Sbjct  795  PDNKRFVTGGNDRNIYLWSIENLNLDQPNGNSSSSSSNLSNNNYNNHLHIPNQSAQPIKS  854

Query  842  -RTIRTSDIGITTDGKQIVSVHKEKTILLFGWES--KAEKSIKEDQVITSF  699
             +  R +D+ I  DG+Q++ +  EK I ++  E+  KAE S+ E   ITS 
Sbjct  855  WQCARVNDLAIHKDGRQLIVICHEKKIRIYDLENEKKAETSLNEADSITSM  905



>ref|XP_010684801.1| PREDICTED: WD repeat-containing protein 26 [Beta vulgaris subsp. 
vulgaris]
Length=549

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G      K+ GH++N++V+RSCFGG + AFIASGSE+S+VYIW+
Sbjct  433  FIVNLNSQEIHLWDVAGKWKKPLKYTGHRQNKYVIRSCFGGFNSAFIASGSENSEVYIWN  492

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R   E +  L GHS TVN VSWN  NPH+LASASDD+T+RIWG
Sbjct  493  RQKSEPIAILSGHSMTVNSVSWNPRNPHLLASASDDQTVRIWG  535


 Score = 70.1 bits (170),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (52%), Gaps = 12/102 (12%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G  D  K I MWD +GNEL+ W+G R  +  D+ +T+DG  ++SV  EK I 
Sbjct  344  PDSKRLVCGSYDPEKGICMWDCEGNELKVWRGARMPKVLDLAVTSDGDYLISVFSEKDIR  403

Query  761  LFGWESKAEKSIKEDQVITSFCI----------IQGQQVPFW  666
            +    + AE  I E+  ITS  +          +  Q++  W
Sbjct  404  ILNVVTNAEHVISEEHSITSLSVSADGNFFIVNLNSQEIHLW  445



>ref|XP_004345356.1| hypothetical protein ACA1_355860 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR21230.1| hypothetical protein ACA1_355860 [Acanthamoeba castellanii str. 
Neff]
Length=598

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 90/126 (71%), Gaps = 2/126 (2%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
             LV++ +QE+HLW++D S T + K+ GHK++RFV+RSCFGG+D+ F+ SGSED+ VYIW+
Sbjct  410  LLVNVASQEVHLWDLD-SRTLVQKYSGHKQSRFVIRSCFGGVDQGFVVSGSEDNNVYIWN  468

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG-V  316
            R  G L+ +L GH+ TVN V+WN  NPH LA+ASDD TIRIW  +    +++ T      
Sbjct  469  REHGTLLDSLTGHTATVNSVTWNPKNPHQLAAASDDHTIRIWESEHAGAQRHGTKRKTRA  528

Query  315  HHCNGG  298
            H  NGG
Sbjct  529  HEENGG  534


 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 54/100 (54%), Gaps = 11/100 (11%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK   +G  DK I MWDL+G ++  W   R+ + +D+ ++ +G+ ++ + +EK I L+
Sbjct  324  PDGKHFVSGGLDKKIYMWDLEGQDVHMWDFARS-QINDLVVSPNGQWLIVITQEKRIRLY  382

Query  755  GWESKAEKSIKEDQVITSFCI----------IQGQQVPFW  666
              +   ++S++E   ITS  I          +  Q+V  W
Sbjct  383  DIQKGEKESLEEMDAITSLSISDDSRYLLVNVASQEVHLW  422



>dbj|GAM21975.1| hypothetical protein SAMD00019534_051500, partial [Acytostelium 
subglobosum LB1]
Length=702

 Score =   119 bits (299),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            +V+  NQEIHLW+++  +  + K++G K+ RFV+RSCFGG+D+ F+ SGSED++VYIW R
Sbjct  565  IVNTANQEIHLWDLEKRI-IVQKYRGQKQMRFVIRSCFGGVDQGFVLSGSEDAKVYIWRR  623

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK  358
             +  L+  L GH+  VN V W+  +P++  SASDD TI++W  K
Sbjct  624  QNSVLLECLTGHTKMVNSVCWSPTDPYLFCSASDDETIKVWTRK  667


 Score = 50.4 bits (119),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 12/90 (13%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNE--------LECWKGQRTIRTSDIGITTDGKQIVSVH  780
            PDGKR F+G  DK+I MW +   E        +  W      R +D+ I  DG+Q+V + 
Sbjct  471  PDGKRFFSGGNDKNIYMWTMPTPENSQVAAAPVRAWA---CARVNDMAIHRDGRQMVVIC  527

Query  779  KEKTILLFGWES-KAEKSIKEDQVITSFCI  693
            +EK I ++  E+ + E SI E   I S  +
Sbjct  528  QEKKIRIYDIENERPEVSIPETDAIMSMSL  557



>gb|EEC67126.1| hypothetical protein OsI_33942 [Oryza sativa Indica Group]
Length=533

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = -1

Query  675  TFLVSLLNQEIHLWNIDGSVTCIA-KFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYI  499
            + +V+L +QEIHLW I  S T    KFKGHK+ +FV+RSCFGG +  FIASGSEDSQVYI
Sbjct  417  SLIVNLNSQEIHLWRISESSTAPDNKFKGHKQGKFVIRSCFGGSNSLFIASGSEDSQVYI  476

Query  498  WHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
            W R     +  L+GHS TVNCVSWN A PHMLASASDDRT+RIW
Sbjct  477  WKRHLETPIKVLYGHSLTVNCVSWNPAKPHMLASASDDRTVRIW  520



>gb|EEE51100.1| hypothetical protein OsJ_31819 [Oryza sativa Japonica Group]
Length=533

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = -1

Query  675  TFLVSLLNQEIHLWNIDGSVTCIA-KFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYI  499
            + +V+L +QEIHLW I  S T    KFKGHK+ +FV+RSCFGG +  FIASGSEDSQVYI
Sbjct  417  SLIVNLNSQEIHLWRISESSTAADNKFKGHKQGKFVIRSCFGGSNSLFIASGSEDSQVYI  476

Query  498  WHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
            W R     +  L+GHS TVNCVSWN A PHMLASASDDRT+RIW
Sbjct  477  WKRHLETPIKVLYGHSLTVNCVSWNPAKPHMLASASDDRTVRIW  520



>ref|XP_636788.1| hypothetical protein DDB_G0288313 [Dictyostelium discoideum AX4]
 gb|EAL63299.1| hypothetical protein DDB_G0288313 [Dictyostelium discoideum AX4]
Length=1040

 Score =   139 bits (351),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 60/101 (59%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = -1

Query  669   LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
             LV+  NQEIHLW+++  +  + K++GHK+ RFV+RSCFGG+D+AF+ SGSEDS +YIWHR
Sbjct  925   LVNTSNQEIHLWDLEKQII-VQKYRGHKQGRFVIRSCFGGVDQAFVLSGSEDSTIYIWHR  983

Query  489   SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
             SSG L+ TL  HSGTVN V W+  NP +  SASDD+TI++W
Sbjct  984   SSGILLETLSRHSGTVNTVCWSPCNPFIFCSASDDQTIKVW  1024



>ref|XP_006681031.1| hypothetical protein BATDEDRAFT_20488 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF78340.1| hypothetical protein BATDEDRAFT_20488 [Batrachochytrium dendrobatidis 
JAM81]
Length=555

 Score =   127 bits (320),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = -1

Query  699  LYYPRTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGS  520
            +Y        LV+L  QEIHLW+++     + K+ G K+ RFV+RSCFGG+ + FI SGS
Sbjct  437  VYVASDGKHLLVNLAIQEIHLWSLEHK-RLVRKYVGQKQGRFVIRSCFGGIHDNFILSGS  495

Query  519  EDSQVYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
            EDSQVYIWH  SG+L+ TL GH+G VNCVSWN   P   ASASDD TIRIW
Sbjct  496  EDSQVYIWHAESGKLMETLEGHAGCVNCVSWNPTEP-AFASASDDNTIRIW  545


 Score = 40.4 bits (93),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 46/82 (56%), Gaps = 5/82 (6%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            P+G+   +G  DK+I +W+L G+ L  W G   +R  D+ ++ DG  +++   +K I L+
Sbjct  362  PNGECFVSGSLDKNIYLWNLGGDILYKWTG---VRIMDLTVSIDGSTLIAS-SDKKIRLY  417

Query  755  GWESKAE-KSIKEDQVITSFCI  693
                + E  +++E+  ITS  +
Sbjct  418  DLNLRHEIGTLQENDSITSVYV  439



>ref|XP_002835107.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ79228.1| unnamed protein product [Tuber melanosporum]
Length=835

 Score =   120 bits (301),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 70/106 (66%), Gaps = 2/106 (2%)
 Frame = -1

Query  651  QEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELV  472
            QE+ L NI+     +  F G K+  FVVR+CFGG DE F+ SGSEDS VY+W + +G LV
Sbjct  468  QELRLLNIETGAD-VRHFSGTKQEEFVVRNCFGGADENFVVSGSEDSNVYVWRKENGALV  526

Query  471  GTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG-LKQVNLKQN  337
              L GHSG VNCV+WN  NP+M ASA DDR +RIW    Q  LK+ 
Sbjct  527  EVLPGHSGIVNCVAWNPTNPYMFASAGDDRNVRIWSKAPQPQLKEQ  572


 Score = 47.4 bits (111),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 4/82 (5%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDG+   TG  DK + +W+L G  +  W G R     D+ +T DG ++ +V  +  + +
Sbjct  373  APDGQTFVTGSVDKEMILWNLYGESIHTWTGARVY---DLVVTADGARLAAVCTQMKLHV  429

Query  758  FGWESKAEKSIKEDQVITSFCI  693
            F + ++ EK  + D    S CI
Sbjct  430  FNFVTR-EKEYERDLGGVSTCI  450



>ref|XP_008647998.1| PREDICTED: uncharacterized protein LOC100304385 isoform X2 [Zea 
mays]
 gb|AFW74460.1| hypothetical protein ZEAMMB73_133126 [Zea mays]
Length=510

 Score = 87.4 bits (215),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  932  DGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLFG  753
            DGK+I +G+ D++  +WDLDG E++CWKGQR+  TSD  +  DG  I+S+ ++  ILLF 
Sbjct  369  DGKQILSGLADQTFCIWDLDGKEVDCWKGQRSATTSDFAVAKDGNLIISLSRDNAILLFD  428

Query  752  WESKAEKSIKEDQVITSFCI  693
             E+K E+ I+E   ITSF +
Sbjct  429  RETKHERIIEEGSTITSFSL  448


 Score = 76.6 bits (187),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQV  505
             LV+L+++EIHLWNI      + ++ GHK +RFV+RSCFGG ++AFIASGSEDSQV
Sbjct  455  LLVNLVSEEIHLWNIRNDPVRVNRYNGHKHSRFVIRSCFGGSEQAFIASGSEDSQV  510



>emb|CDS03587.1| hypothetical protein LRAMOSA00989 [Absidia idahoensis var. thermophila]
Length=577

 Score =   115 bits (288),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = -1

Query  654  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  475
             QE+HLW+++     I K+ G K+  FV+RS FGG DE+FI SGSED+ VYIW R    L
Sbjct  466  TQELHLWDLEER-QLIRKYTGQKQKSFVIRSTFGGDDESFILSGSEDNCVYIWSRDYQTL  524

Query  474  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL  361
            +  L GH+G VNC SW    P M ASASDD+T+RIWG+
Sbjct  525  LEVLEGHTGIVNCTSWCPVGPPMFASASDDKTVRIWGV  562


 Score = 47.8 bits (112),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 6/86 (7%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+   +   DKSI +W++DG     W+   T RT ++ +T DGK++V++  +K I ++
Sbjct  372  PDGEHFISSACDKSICLWNIDGEIKSRWQ---TPRTLEMKVTKDGKRLVTITYDKFIEIY  428

Query  755  GWESKAEKS---IKEDQVITSFCIIQ  687
              E+        I+E   ITS  I Q
Sbjct  429  NIENFRLNDVGKIEESGAITSLSITQ  454



>ref|XP_002131526.2| PREDICTED: WD repeat-containing protein 26 [Ciona intestinalis]
Length=580

 Score =   112 bits (281),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            L+++  Q +HLW+ID  +  + K++G  +  + + S FGG  + +IASGSED++VYIWHR
Sbjct  460  LLNVATQGVHLWDIDDQIL-VRKYQGVVQGFYTIFSSFGGAADEYIASGSEDNKVYIWHR  518

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQ  355
            S    + TL GHS TVNCVSWN A P MLAS SDD TIRIWG ++
Sbjct  519  SKELPIETLCGHSKTVNCVSWNKAIPSMLASVSDDGTIRIWGPQE  563


 Score = 50.1 bits (118),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGK+  TG T       DLDGN L+ W+G   +R   +    D K ++S   ++ I  
Sbjct  373  TPDGKKYVTGGTKGQFYQCDLDGNILDSWEG---VRVQSLACLPDNKTVLSADTQQRIRA  429

Query  758  FGWESKAEKS-IKEDQVITSFCI  693
            + +E  ++ + IKED  + SF +
Sbjct  430  YNFEDMSDYNVIKEDHPVMSFSL  452



>ref|XP_002533626.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF28755.1| WD-repeat protein, putative [Ricinus communis]
Length=523

 Score =   131 bits (330),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G+     ++ GHK++++V+RSCFGGL+ +FIASGSE+SQVYIW+
Sbjct  408  FIVNLNSQEIHLWDVAGNWEKALRYMGHKQHKYVIRSCFGGLNSSFIASGSENSQVYIWN  467

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQ  355
            R +   +  L GH  TVNCVSWN     MLASASDD+TIRIWG  Q
Sbjct  468  RQNSRPIEVLSGHLMTVNCVSWNPRRHQMLASASDDQTIRIWGPSQ  513


 Score = 69.7 bits (169),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (52%), Gaps = 12/102 (12%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR   G +D  K I MWD  GNE++ W+G R  +  D+ +T DG  ++SV  +K I 
Sbjct  319  PDSKRFVCGSSDPEKGICMWDCHGNEIKAWRGTRMPKVLDLAVTPDGVHLISVFSDKDIR  378

Query  761  LFGWESKAEKSIKEDQVITSFCI----------IQGQQVPFW  666
            +F   + AE+ I E+  ITS  +          +  Q++  W
Sbjct  379  IFNLVTNAEQVISEEHPITSLSVSIDSKFFIVNLNSQEIHLW  420



>gb|KEH42443.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=507

 Score =   131 bits (329),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIH+W++ G+     ++ GHK+ ++V+RSCFGG D  FIASGSE+S+VYIW+
Sbjct  402  FIVNLNSQEIHMWDVAGTWKNPLRYTGHKQCKYVIRSCFGGSDSTFIASGSENSEVYIWN  461

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
              S + +  L GHS TVNCVSWN   P MLASASDD TIRIWG
Sbjct  462  SRSSKPIEVLSGHSLTVNCVSWNPKRPQMLASASDDHTIRIWG  504


 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 54/109 (50%), Gaps = 12/109 (11%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            P+  +   G  D  K I MWD DGNEL  W+G R  +  D+ +T DG+ ++S+  +K I 
Sbjct  313  PNSTQFVCGSFDPEKGICMWDCDGNELRAWRGMRMPKVVDLTVTPDGEYLISIFLDKEIR  372

Query  761  LFGWESKAEKSIKEDQVITSFCI----------IQGQQVPFWLVCLTKK  645
            +    + AE+ I E+  ITS  +          +  Q++  W V  T K
Sbjct  373  ILHLATNAERVISEEHPITSISVSADGKFFIVNLNSQEIHMWDVAGTWK  421



>gb|EXX54855.1| glucose-induced degradation complex subunit GID7 [Rhizophagus 
irregularis DAOM 197198w]
Length=546

 Score =   131 bits (329),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 76/102 (75%), Gaps = 1/102 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            LV+L  +EIHLW+ID     + K+ G K+ +FV+RSCFGG+D+ FI SGSEDS++Y+WHR
Sbjct  432  LVNLSTKEIHLWDIDER-RIVRKYLGQKQGKFVIRSCFGGIDQGFIVSGSEDSKIYVWHR  490

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
               +L+ TL GH G VN V+W+  NP+M ASA DD TIRIWG
Sbjct  491  EHADLIETLSGHKGAVNSVNWSPVNPYMFASAGDDNTIRIWG  532


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 55/100 (55%), Gaps = 6/100 (6%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDGK   +G  DK+  +W+LDG  +  W G    R +D+ I  +G ++V++  +  I ++
Sbjct  346  PDGKWFISGSQDKNTYLWNLDGTTIHKWPGA---RIADLAINKEGTRMVAICHDNKIHIY  402

Query  755  GWESKAEKS-IKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
               +K E++ ++E+  +TS C+       + LV L+ K I
Sbjct  403  DLITKKEEATMEENAKLTSICL--SSDCKYALVNLSTKEI  440



>ref|XP_005765500.1| hypothetical protein EMIHUDRAFT_452007 [Emiliania huxleyi CCMP1516]
 gb|EOD13071.1| hypothetical protein EMIHUDRAFT_452007 [Emiliania huxleyi CCMP1516]
Length=513

 Score =   124 bits (311),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 1/118 (1%)
 Frame = -1

Query  699  LYYPRTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGS  520
            L   R +   L+++ +QE+H W++DG    +  + GH++ RFV+RS FGG  +  + SGS
Sbjct  396  LAISRDSRAVLLNVGSQEVHAWDVDGRRR-LGSYSGHRQGRFVIRSAFGGKHDGLVLSGS  454

Query  519  EDSQVYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL  346
            ED+QVY+WHR SG L+  L GHS  VN VSW+ A+PH+ ASASDD T+RIWGL   ++
Sbjct  455  EDTQVYVWHRHSGALLRKLPGHSCAVNSVSWSPASPHLFASASDDHTVRIWGLPPPSV  512


 Score = 37.7 bits (86),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 28/52 (54%), Gaps = 4/52 (8%)
 Frame = -2

Query  935  PDGKRIFTGVTD-KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSV  783
            P G    +  +  K + +WDL GN L+ W G    R +D+ +  DG ++++V
Sbjct  311  PSGAHFLSSSSAGKRVILWDLGGNALQSWHGP---RVTDLAVAADGARLLAV  359



>ref|XP_005763815.1| hypothetical protein EMIHUDRAFT_452457 [Emiliania huxleyi CCMP1516]
 gb|EOD11386.1| hypothetical protein EMIHUDRAFT_452457 [Emiliania huxleyi CCMP1516]
Length=513

 Score =   124 bits (311),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 1/118 (1%)
 Frame = -1

Query  699  LYYPRTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGS  520
            L   R +   L+++ +QE+H W++DG    +  + GH++ RFV+RS FGG  +  + SGS
Sbjct  396  LAISRDSRAVLLNVGSQEVHAWDVDGRRR-LGSYSGHRQGRFVIRSAFGGKHDGLVLSGS  454

Query  519  EDSQVYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL  346
            ED+QVY+WHR SG L+  L GHS  VN VSW+ A+PH+ ASASDD T+RIWGL   ++
Sbjct  455  EDTQVYVWHRHSGALLRKLPGHSCAVNSVSWSPASPHLFASASDDHTVRIWGLPPPSV  512


 Score = 37.7 bits (86),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 28/52 (54%), Gaps = 4/52 (8%)
 Frame = -2

Query  935  PDGKRIFTGVTD-KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSV  783
            P G    +  +  K + +WDL GN L+ W G    R +D+ +  DG ++++V
Sbjct  311  PSGAHFLSSSSAGKRVILWDLGGNALQSWHGP---RVTDLAVAADGARLLAV  359



>ref|XP_007873440.1| hypothetical protein PNEG_01500 [Pneumocystis murina B123]
 gb|EMR10228.1| hypothetical protein PNEG_01500 [Pneumocystis murina B123]
Length=552

 Score =   120 bits (300),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            ++++ +QE++LW+++  +  + K+ G  +  +++RSCFGG  E FI SGSEDSQVY+WHR
Sbjct  435  IINVSSQEVYLWDLE-KMQVVKKYAGQHQGNYIIRSCFGGAQENFILSGSEDSQVYVWHR  493

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
             +G L+ TL  H GTVN VSW+  NP M ASA DD T+RIW 
Sbjct  494  ENGSLIETLKSHKGTVNSVSWSPINPVMFASAGDDHTVRIWA  535


 Score = 42.0 bits (97),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 3/61 (5%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG    T   D  + +W++DG  +  WKG R     D+ +T DGK+ ++   EK + ++
Sbjct  349  PDGSGFITASLDMEVILWNIDGIIIHQWKGSRVY---DLAVTPDGKKFIAGGTEKMLHVY  405

Query  755  G  753
             
Sbjct  406  N  406



>ref|XP_008294937.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Stegastes 
partitus]
Length=606

 Score =   114 bits (286),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 78/119 (66%), Gaps = 1/119 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            L+++  Q +HLW++   V  + K++G  +  + + SCFGG +E FIASGSED +VYIWHR
Sbjct  481  LLNVATQGVHLWDLQDRV-LVRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHR  539

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  313
             S   +  L GH+ TVNCVSWN   P +LASASDD T+RIWG       Q++   NG+H
Sbjct  540  RSELPIAELTGHTRTVNCVSWNPVLPGLLASASDDGTVRIWGPAPFLDVQDAEGLNGMH  598


 Score = 47.0 bits (110),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKR  TG         DLDGN L+ W+G   +R   +   TDG+ +++    + I  
Sbjct  394  NPDGKRFVTGGQRGQFYQCDLDGNLLDSWEG---VRVQCLWCLTDGRTVLASDTHQRIRG  450

Query  758  FGWESKAEKSI-KEDQVITSFCI  693
            + +E   +++I +ED  I SF +
Sbjct  451  YNFEDLTDRNIVQEDHPIMSFTV  473



>ref|XP_011483295.1| PREDICTED: WD repeat-containing protein 26-like [Oryzias latipes]
Length=334

 Score =   112 bits (280),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQ  508
            +T S  L+++  Q +HLW++   V  + K++G  +  + + SCFGG +E FIASGSED +
Sbjct  157  KTGSLALLNVATQGVHLWDLQDRVL-VRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHK  215

Query  507  VYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            VYIWHR S   +  L GH+ TVNCVSWN   P +LASASDD T+RIWG
Sbjct  216  VYIWHRRSELPIAELTGHTRTVNCVSWNPILPGLLASASDDGTVRIWG  263


 Score = 49.3 bits (116),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 45/83 (54%), Gaps = 4/83 (5%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKR  TG         DLDGN L+ W+G   +R   +G  +DG+ +++    + I  
Sbjct  76   NPDGKRFVTGGQRGQFYQCDLDGNLLDSWEG---VRVQCLGCLSDGRTVLASDTHQRIRG  132

Query  758  FGWESKAEKSI-KEDQVITSFCI  693
            + +E   +++I +ED  I SF I
Sbjct  133  YNFEDLTDRNIVQEDHPIMSFTI  155



>ref|XP_002321301.2| hypothetical protein POPTR_0014s18590g [Populus trichocarpa]
 gb|EEE99616.2| hypothetical protein POPTR_0014s18590g [Populus trichocarpa]
Length=383

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G      K+ GH+++++V+RSCFGGLD +FIASGSE+SQVYIW+
Sbjct  272  FIVNLNSQEIHLWDVAGKWKKPLKYIGHQQHKYVIRSCFGGLDSSFIASGSENSQVYIWN  331

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            R +   +  L GH  TVNCV WN     MLASASDD TIRIWG
Sbjct  332  RRNSRPIEVLSGHLMTVNCVCWNPKRHQMLASASDDHTIRIWG  374


 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 57/101 (56%), Gaps = 4/101 (4%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR   G +D  K I MWD DGNE++ W+G R  +  D+ +T DG+ ++SV  +  I 
Sbjct  183  PDSKRFVCGSSDPEKGICMWDCDGNEIKAWRGTRMPKVLDLAVTPDGENLISVMSDLEIR  242

Query  761  LFGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
            +    + AE+ I E+Q ITS  +    +  F++V L  + I
Sbjct  243  ILNVRTNAEQVIPEEQPITSLSVSADSK--FFIVNLNSQEI  281



>ref|XP_004904369.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Heterocephalus 
glaber]
Length=557

 Score =   113 bits (282),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 81/129 (63%), Gaps = 5/129 (4%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            L+++  Q +HLW++   V  + K++G  +  + + SCFGG +E FIASGSED +VYIWH+
Sbjct  395  LLNVATQGVHLWDLQDRVL-VRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHK  453

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG----LKQVNLKQNSTVCN  322
             S   +  L GH+ TVNCVSWN   P M+ASASDD T+RIWG    L   N++ N+ V  
Sbjct  454  RSELPIAELTGHTRTVNCVSWNPQIPFMMASASDDGTVRIWGPAPFLDHQNVEGNAPVSQ  513

Query  321  GVHHCNGGS  295
               H + G 
Sbjct  514  CFPHVSHGP  522


 Score = 47.0 bits (110),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKR  TG         DLDGN L+ W+G   +R   +   +DGK +++    + I  
Sbjct  308  NPDGKRFVTGGQRGQFYQCDLDGNLLDSWEG---VRVQCLWCLSDGKTVLASDTHQRIRG  364

Query  758  FGWESKAEKSI-KEDQVITSFCI  693
            + +E   +++I +ED  I SF I
Sbjct  365  YNFEDLTDRNIVQEDHPIMSFTI  387



>gb|KDP26444.1| hypothetical protein JCGZ_17602 [Jatropha curcas]
Length=416

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (72%), Gaps = 1/114 (1%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G    + K+ GHK++++V+RSCFGGL+ +FIASGSE+SQVYIW+
Sbjct  304  FIVNLNSQEIHLWDVAGKQKAL-KYMGHKQHKYVIRSCFGGLNSSFIASGSENSQVYIWN  362

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNST  331
            R     +  L GH  TVNCVSWN     MLASASDD TIRIWG +    K  +T
Sbjct  363  RRIPMPIEVLSGHLMTVNCVSWNPRRHQMLASASDDHTIRIWGPRPSQSKNITT  416


 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 60/111 (54%), Gaps = 12/111 (11%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G +D  K I MWD DGNE++ W+G R  +  D+ +T DG+ ++SV  +K I 
Sbjct  215  PDSKRLVCGSSDPEKGICMWDSDGNEIKAWRGTRMPKVLDLAVTPDGEHLISVFSDKDIR  274

Query  761  LFGWESKAEKSIKEDQVITSFCI----------IQGQQVPFWLVCLTKKFI  639
            +F   + AE+ I E+  ITS  +          +  Q++  W V   +K +
Sbjct  275  IFNLVTNAERVISEEHPITSLSVSIDSKYFIVNLNSQEIHLWDVAGKQKAL  325



>gb|EYU42822.1| hypothetical protein MIMGU_mgv1a024382mg [Erythranthe guttata]
Length=468

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 80/105 (76%), Gaps = 8/105 (8%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNI---DGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVY  502
             LVSL N+EIHLWNI   D  +  +  +KGHK  ++VVR+CF G    FIASGSEDS VY
Sbjct  368  LLVSLSNEEIHLWNIGLEDPEIVMV--YKGHKCKKYVVRACFFG---RFIASGSEDSWVY  422

Query  501  IWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
            +WHR SGEL+GT+HGHS TVN V+WN A+P ++AS SDDRT+RIW
Sbjct  423  VWHRGSGELLGTVHGHSDTVNSVTWNPAHPLLVASGSDDRTVRIW  467


 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 60/104 (58%), Gaps = 7/104 (7%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIR--TSDIGITTD--GKQIVSVHKEK-  771
            P G+ IF G+ D SI +W L G EL  W G   I    +D+ +T D  G+++V    E+ 
Sbjct  276  PHGETIFAGLNDGSIVVWSLQGEELRSWDGILGITRIIADLAVTLDDGGREVVVTACERN  335

Query  770  TILLFGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFI  639
            TILLF WE+++++ I ED  I SF  + G  + F LV L+ + I
Sbjct  336  TILLFEWETESKRFIYEDGDIVSFT-LSGDGI-FLLVSLSNEEI  377



>ref|XP_004292253.1| PREDICTED: WD repeat-containing protein 26 [Fragaria vesca subsp. 
vesca]
Length=524

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -1

Query  699  LYYPRTASTFLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGS  520
            L   R +  F+V+L +QEIH+W++ G +    K+ GH ++++V+RSCFGG +  FIASGS
Sbjct  400  LSISRDSEFFIVNLNSQEIHMWDVAGKMEKPLKYMGHMQSKYVIRSCFGGANSTFIASGS  459

Query  519  EDSQVYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
            E++QVYIW+R +   +  L GH+ TVN VSWN   P MLASASDD+TIRIWG
Sbjct  460  ENTQVYIWNRRNSRPIEVLCGHTMTVNSVSWNLRRPQMLASASDDQTIRIWG  511


 Score = 79.3 bits (194),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 59/102 (58%), Gaps = 4/102 (4%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G  D  K I MWD DGNEL+ W+G R  +  D+ +T DG+ ++S+  EK I 
Sbjct  320  PDSKRLVCGSVDPEKGIYMWDCDGNELKAWRGMRMPKIVDLAVTPDGENLISIFSEKEIR  379

Query  761  LFGWESKAEKSIKEDQVITSFCIIQGQQVPFWLVCLTKKFIF  636
            +F   + AE+ I ED  ITS  I +  +  F++V L  + I 
Sbjct  380  IFNVGTNAERVISEDHAITSLSISRDSE--FFIVNLNSQEIH  419



>ref|XP_012085197.1| PREDICTED: WD repeat-containing protein 26 [Jatropha curcas]
 ref|XP_012085198.1| PREDICTED: WD repeat-containing protein 26 [Jatropha curcas]
Length=517

 Score =   128 bits (322),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (72%), Gaps = 1/114 (1%)
 Frame = -1

Query  672  FLVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH  493
            F+V+L +QEIHLW++ G    + K+ GHK++++V+RSCFGGL+ +FIASGSE+SQVYIW+
Sbjct  405  FIVNLNSQEIHLWDVAGKQKAL-KYMGHKQHKYVIRSCFGGLNSSFIASGSENSQVYIWN  463

Query  492  RSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNST  331
            R     +  L GH  TVNCVSWN     MLASASDD TIRIWG +    K  +T
Sbjct  464  RRIPMPIEVLSGHLMTVNCVSWNPRRHQMLASASDDHTIRIWGPRPSQSKNITT  517


 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 12/102 (12%)
 Frame = -2

Query  935  PDGKRIFTGVTD--KSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTIL  762
            PD KR+  G +D  K I MWD DGNE++ W+G R  +  D+ +T DG+ ++SV  +K I 
Sbjct  316  PDSKRLVCGSSDPEKGICMWDSDGNEIKAWRGTRMPKVLDLAVTPDGEHLISVFSDKDIR  375

Query  761  LFGWESKAEKSIKEDQVITSFCI----------IQGQQVPFW  666
            +F   + AE+ I E+  ITS  +          +  Q++  W
Sbjct  376  IFNLVTNAERVISEEHPITSLSVSIDSKYFIVNLNSQEIHLW  417



>ref|XP_007530227.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Erinaceus 
europaeus]
Length=650

 Score =   112 bits (279),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 1/102 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            L+++  Q +HLW++   V  + K++G  +  + + SCFGG +E FIASGSED +VYIWHR
Sbjct  531  LLNVATQGVHLWDLQDRVL-VRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHR  589

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
             S   +  L GH+ TVNCVSWN   P M+ASASDD T+RIWG
Sbjct  590  RSELPIAELTGHTRTVNCVSWNPQIPSMMASASDDGTVRIWG  631


 Score = 47.0 bits (110),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKR  TG         DLDGN L+ W+G   +R   +   +DGK +++    + I  
Sbjct  444  NPDGKRFVTGGQRGQFYQCDLDGNLLDSWEG---VRVQCLWCLSDGKTVLASDTHQRIRG  500

Query  758  FGWESKAEKSI-KEDQVITSFCI  693
            + +E   +++I +ED  I SF I
Sbjct  501  YNFEDLTDRNIVQEDHPIMSFTI  523



>ref|XP_007530226.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Erinaceus 
europaeus]
Length=634

 Score =   112 bits (279),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 1/102 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            L+++  Q +HLW++   V  + K++G  +  + + SCFGG +E FIASGSED +VYIWHR
Sbjct  515  LLNVATQGVHLWDLQDRVL-VRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHR  573

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
             S   +  L GH+ TVNCVSWN   P M+ASASDD T+RIWG
Sbjct  574  RSELPIAELTGHTRTVNCVSWNPQIPSMMASASDDGTVRIWG  615


 Score = 47.0 bits (110),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKR  TG         DLDGN L+ W+G   +R   +   +DGK +++    + I  
Sbjct  428  NPDGKRFVTGGQRGQFYQCDLDGNLLDSWEG---VRVQCLWCLSDGKTVLASDTHQRIRG  484

Query  758  FGWESKAEKSI-KEDQVITSFCI  693
            + +E   +++I +ED  I SF I
Sbjct  485  YNFEDLTDRNIVQEDHPIMSFTI  507



>emb|CDH48456.1| wd repeat protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=587

 Score =   114 bits (286),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = -1

Query  654  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  475
             QE+HLW+++     I K+ G K+  FV+RS FGG DE+FI SGSED+ VYIW R    L
Sbjct  479  TQELHLWDLEER-QLIRKYIGQKQKSFVIRSTFGGDDESFIISGSEDNCVYIWSRDYQTL  537

Query  474  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL  361
            +  L GH+G VNC SW    P M ASASDD+TIRIWG+
Sbjct  538  LEVLEGHTGIVNCTSWCPVGPPMFASASDDKTIRIWGV  575


 Score = 44.3 bits (103),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 46/86 (53%), Gaps = 6/86 (7%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+   +   DK I +W++DG     W+   T RT ++ IT DGK++V++  ++ I ++
Sbjct  385  PDGEHFISSGCDKCICLWNIDGEIKSRWQ---TPRTMEMKITKDGKRLVTMTYDRAIEIY  441

Query  755  GWES---KAEKSIKEDQVITSFCIIQ  687
              E+        I+E   ITS  I Q
Sbjct  442  NIENFRLNDVGKIEESGTITSLSITQ  467



>ref|XP_003410986.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
26 [Loxodonta africana]
Length=644

 Score =   111 bits (277),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 71/102 (70%), Gaps = 1/102 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            L+++  Q +HLW++   V  + K++G  +  + + SCFGG +E FIASGSED +VY+WH+
Sbjct  525  LLNVATQGVHLWDLQDRVL-VRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYVWHK  583

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
             S   +  L GH+ TVNCVSWN   P M+ASASDD T+RIWG
Sbjct  584  RSELPIAELTGHTRTVNCVSWNPQTPSMMASASDDGTVRIWG  625


 Score = 47.0 bits (110),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKR  TG         DLDGN L+ W+G   +R   +   +DGK +++    + I  
Sbjct  438  NPDGKRFVTGGQRGQFYQCDLDGNLLDSWEG---VRVQCLWCLSDGKTVLASDTHQRIRG  494

Query  758  FGWESKAEKSI-KEDQVITSFCI  693
            + +E   +++I +ED  I SF I
Sbjct  495  YNFEDLTDRNIVQEDHPIMSFTI  517



>ref|XP_004805459.1| PREDICTED: WD repeat-containing protein 26 isoform X3 [Mustela 
putorius furo]
Length=659

 Score =   111 bits (277),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            L+++  Q +HLW++   V  + K++G  +  + + SCFGG +E FIASGSED +VYIWH+
Sbjct  535  LLNVATQGVHLWDLQDRV-LVRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHK  593

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHH  310
             S   +  L GH+ TVNCVSWN   P M+ASASDD T+RIWG       QN       HH
Sbjct  594  RSELPIAELTGHTRTVNCVSWNPQIPSMMASASDDGTVRIWGPAPFIDHQNIEGNTTAHH  653


 Score = 47.0 bits (110),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKR  TG         DLDGN L+ W+G   +R   +   +DGK +++    + I  
Sbjct  448  NPDGKRFVTGGQRGQFYQCDLDGNLLDSWEG---VRVQCLWCLSDGKTVLASDTHQRIRG  504

Query  758  FGWESKAEKSI-KEDQVITSFCI  693
            + +E   +++I +ED  I SF I
Sbjct  505  YNFEDLTDRNIVQEDHPIMSFTI  527



>ref|XP_006157333.1| PREDICTED: WD repeat-containing protein 26 [Tupaia chinensis]
Length=498

 Score =   111 bits (277),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 74/111 (67%), Gaps = 1/111 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            L+++  Q +HLW++   V  + K++G  +  + + SCFGG +E FIASGSED +VYIWH+
Sbjct  379  LLNVATQGVHLWDLQDRVL-VRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHK  437

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN  337
             S   +  L GH+ TVNCVSWN   P M+ASASDD T+RIWG      +QN
Sbjct  438  RSELPIAELTGHTRTVNCVSWNPQIPSMMASASDDGTVRIWGPAPFIDQQN  488


 Score = 47.0 bits (110),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKR  TG         DLDGN L+ W+G   +R   +   +DGK +++    + I  
Sbjct  292  NPDGKRFVTGGQRGQFYQCDLDGNLLDSWEG---VRVQCLWCLSDGKTVLASDTHQRIRG  348

Query  758  FGWESKAEKSI-KEDQVITSFCI  693
            + +E   +++I +ED  I SF I
Sbjct  349  YNFEDLTDRNIVQEDHPIMSFTI  371



>ref|XP_004805457.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Mustela 
putorius furo]
Length=643

 Score =   111 bits (277),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            L+++  Q +HLW++   V  + K++G  +  + + SCFGG +E FIASGSED +VYIWH+
Sbjct  519  LLNVATQGVHLWDLQDRV-LVRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHK  577

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHH  310
             S   +  L GH+ TVNCVSWN   P M+ASASDD T+RIWG       QN       HH
Sbjct  578  RSELPIAELTGHTRTVNCVSWNPQIPSMMASASDDGTVRIWGPAPFIDHQNIEGNTTAHH  637


 Score = 47.0 bits (110),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKR  TG         DLDGN L+ W+G   +R   +   +DGK +++    + I  
Sbjct  432  NPDGKRFVTGGQRGQFYQCDLDGNLLDSWEG---VRVQCLWCLSDGKTVLASDTHQRIRG  488

Query  758  FGWESKAEKSI-KEDQVITSFCI  693
            + +E   +++I +ED  I SF I
Sbjct  489  YNFEDLTDRNIVQEDHPIMSFTI  511



>ref|XP_007670666.1| PREDICTED: WD repeat-containing protein 26 [Ornithorhynchus anatinus]
Length=649

 Score =   111 bits (277),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 71/102 (70%), Gaps = 1/102 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            L+++  Q +HLW++   V  + K++G  +  + + SCFGG +E FIASGSED +VYIWH+
Sbjct  530  LLNVATQGVHLWDLQDRV-LVRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHK  588

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
             S   +  L GH+ TVNCVSWN   P M+ASASDD T+RIWG
Sbjct  589  RSELPIAELTGHTRTVNCVSWNPQIPSMMASASDDGTVRIWG  630


 Score = 47.0 bits (110),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKR  TG         DLDGN L+ W+G   +R   +   +DGK +++    + I  
Sbjct  443  NPDGKRFVTGGQRGQFYQCDLDGNLLDSWEG---VRVQCLWCLSDGKTVLASDTHQRIRG  499

Query  758  FGWESKAEKSI-KEDQVITSFCI  693
            + +E   +++I +ED  I SF I
Sbjct  500  YNFEDLTDRNIVQEDHPIMSFTI  522



>ref|XP_006806085.1| PREDICTED: WD repeat-containing protein 26-like [Neolamprologus 
brichardi]
Length=565

 Score =   112 bits (280),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 77/118 (65%), Gaps = 1/118 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            L+++  Q +HLW++   V  + K++G  +  + + SCFGG +E FIASGSED +VYIWHR
Sbjct  444  LLNVATQGVHLWDLQDRV-LVRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHR  502

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGV  316
             S   +  L GH+ TVNCVSWN   P +LASASDD TIRIWG       Q++   NG+
Sbjct  503  RSELPIAELTGHTRTVNCVSWNPVVPGLLASASDDGTIRIWGPAPFLDVQDAEGLNGM  560


 Score = 45.8 bits (107),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKR  TG         DLDGN L+ W+G   +R   +   +DG+ +++    + I  
Sbjct  357  NPDGKRFVTGGQRGQFYQCDLDGNLLDSWEG---VRVQCLWCLSDGRTVLASDTHQRIRG  413

Query  758  FGWESKAEKSI-KEDQVITSFCI  693
            + +E   +++I +ED  I SF +
Sbjct  414  YNFEDLTDRNIVQEDHPIMSFTV  436



>ref|XP_008294938.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Stegastes 
partitus]
Length=602

 Score =   110 bits (276),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 1/102 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            L+++  Q +HLW++   V  + K++G  +  + + SCFGG +E FIASGSED +VYIWHR
Sbjct  481  LLNVATQGVHLWDLQDRV-LVRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHR  539

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
             S   +  L GH+ TVNCVSWN   P +LASASDD T+RIWG
Sbjct  540  RSELPIAELTGHTRTVNCVSWNPVLPGLLASASDDGTVRIWG  581


 Score = 47.0 bits (110),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKR  TG         DLDGN L+ W+G   +R   +   TDG+ +++    + I  
Sbjct  394  NPDGKRFVTGGQRGQFYQCDLDGNLLDSWEG---VRVQCLWCLTDGRTVLASDTHQRIRG  450

Query  758  FGWESKAEKSI-KEDQVITSFCI  693
            + +E   +++I +ED  I SF +
Sbjct  451  YNFEDLTDRNIVQEDHPIMSFTV  473



>ref|XP_005078282.1| PREDICTED: WD repeat-containing protein 26 [Mesocricetus auratus]
Length=621

 Score =   110 bits (276),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 71/102 (70%), Gaps = 1/102 (1%)
 Frame = -1

Query  669  LVSLLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  490
            L+++  Q +HLW++   V  + K++G  +  + + SCFGG +E FIASGSED +VYIWH+
Sbjct  502  LLNVATQGVHLWDLQDRV-LVRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHK  560

Query  489  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  364
             S   +  L GH+ TVNCVSWN   P M+ASASDD T+RIWG
Sbjct  561  RSELPIAELTGHTRTVNCVSWNPQIPSMMASASDDGTVRIWG  602


 Score = 47.0 bits (110),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -2

Query  938  SPDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILL  759
            +PDGKR  TG         DLDGN L+ W+G   +R   +   +DGK +++    + I  
Sbjct  415  NPDGKRFVTGGQRGQFYQCDLDGNLLDSWEG---VRVQCLWCLSDGKTVLASDTHQRIRG  471

Query  758  FGWESKAEKSI-KEDQVITSFCI  693
            + +E   +++I +ED  I SF I
Sbjct  472  YNFEDLTDRNIVQEDHPIMSFTI  494



>ref|XP_005851148.1| hypothetical protein CHLNCDRAFT_7805, partial [Chlorella variabilis]
 gb|EFN59046.1| hypothetical protein CHLNCDRAFT_7805, partial [Chlorella variabilis]
Length=439

 Score =   116 bits (290),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 80/115 (70%), Gaps = 9/115 (8%)
 Frame = -1

Query  687  RTASTFLVSLLNQEIHLWNID--------GSVTCIAKFKGHKRNRFVVRSCFGGLDEAFI  532
            R     LV+L +  +HLW++          ++ C A ++G  ++RFVVRSC GGLD+ F+
Sbjct  326  RDGRYLLVNLTSNSMHLWDLGDAPREMHLPAMPC-ASYQGANQSRFVVRSCLGGLDDRFV  384

Query  531  ASGSEDSQVYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  367
             +GSE+ +VY++HR++GE + +L GHSGTVN V+WN  +PHM ASASDD++I +W
Sbjct  385  LTGSEECRVYVYHRATGERLLSLEGHSGTVNSVAWNPTDPHMFASASDDKSIHVW  439


 Score = 42.0 bits (97),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 22/79 (28%), Positives = 41/79 (52%), Gaps = 3/79 (4%)
 Frame = -2

Query  935  PDGKRIFTGVTDKSISMWDLDGNELECWKGQRTIRTSDIGITTDGKQIVSVHKEKTILLF  756
            PDG+R+ TG  DK + +  LDG+    W+ Q   R  ++ +   G+ I++   E+ + ++
Sbjct  247  PDGRRLVTGSHDKQLCVVGLDGSVERQWRIQ---RIQEVVVAKGGRYILATTCERKVRVY  303

Query  755  GWESKAEKSIKEDQVITSF  699
              E  +E  I E + + S 
Sbjct  304  DLEGDSESYIPEAETLISM  322



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2241263107768