BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9636

Length=817
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011083402.1|  PREDICTED: uncharacterized protein LOC105165944  77.8    7e-13   Sesamum indicum [beniseed]
emb|CAN60958.1|  hypothetical protein VITISV_034688                   77.8    8e-13   Vitis vinifera
ref|XP_002275027.1|  PREDICTED: uncharacterized protein LOC100245921  76.3    3e-12   Vitis vinifera
ref|XP_010094831.1|  hypothetical protein L484_016412                 75.9    4e-12   
ref|XP_002534491.1|  protein with unknown function                    75.5    5e-12   Ricinus communis
ref|XP_003548955.1|  PREDICTED: vacuolar protein sorting-associat...  74.7    7e-12   
ref|XP_012089676.1|  PREDICTED: IST1-like protein isoform X1          74.7    8e-12   
ref|XP_012089679.1|  PREDICTED: uncharacterized protein LOC105648...  74.3    9e-12   
ref|XP_006354036.1|  PREDICTED: uncharacterized protein LOC102585287  72.4    5e-11   Solanum tuberosum [potatoes]
gb|KHN32808.1|  IST1-like protein                                     72.0    6e-11   Glycine soja [wild soybean]
ref|NP_001275331.1|  uncharacterized protein LOC102585287             70.9    1e-10   Solanum tuberosum [potatoes]
ref|XP_003518384.1|  PREDICTED: uncharacterized protein DDB_G0271...  69.7    4e-10   Glycine max [soybeans]
ref|XP_004237874.1|  PREDICTED: uncharacterized protein LOC101268389  69.3    5e-10   Solanum lycopersicum
ref|XP_009591345.1|  PREDICTED: uncharacterized protein LOC104088390  69.3    6e-10   Nicotiana tomentosiformis
ref|XP_009773832.1|  PREDICTED: uncharacterized protein LOC104223983  68.6    8e-10   Nicotiana sylvestris
ref|XP_008381028.1|  PREDICTED: IST1-like protein                     68.6    9e-10   
ref|XP_007201705.1|  hypothetical protein PRUPE_ppa004125mg           67.8    2e-09   
gb|KDO83982.1|  hypothetical protein CISIN_1g009857mg                 64.3    1e-08   Citrus sinensis [apfelsine]
ref|XP_006434656.1|  hypothetical protein CICLE_v10000853mg           64.7    1e-08   
ref|XP_006434655.1|  hypothetical protein CICLE_v10000853mg           64.7    2e-08   Citrus clementina [clementine]
gb|KDO83980.1|  hypothetical protein CISIN_1g009857mg                 64.3    2e-08   Citrus sinensis [apfelsine]
gb|KDO83978.1|  hypothetical protein CISIN_1g009857mg                 64.3    2e-08   Citrus sinensis [apfelsine]
gb|KDO83979.1|  hypothetical protein CISIN_1g009857mg                 63.9    3e-08   Citrus sinensis [apfelsine]
ref|XP_009339061.1|  PREDICTED: uncharacterized protein LOC103931...  63.9    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_011038197.1|  PREDICTED: IST1 homolog                          62.8    7e-08   Populus euphratica
ref|XP_006473234.1|  PREDICTED: uncharacterized protein LOC102611062  62.8    8e-08   Citrus sinensis [apfelsine]
gb|KEH25939.1|  regulator of Vps4 activity in the MVB pathway pro...  62.8    9e-08   Medicago truncatula
ref|XP_007151911.1|  hypothetical protein PHAVU_004G086100g           62.8    9e-08   Phaseolus vulgaris [French bean]
ref|XP_006376337.1|  hypothetical protein POPTR_0013s12140g           61.6    2e-07   
ref|XP_009339749.1|  PREDICTED: IST1-like protein                     60.1    7e-07   Pyrus x bretschneideri [bai li]
ref|XP_002325569.2|  hypothetical protein POPTR_0019s11730g           59.3    1e-06   
ref|XP_010245870.1|  PREDICTED: uncharacterized protein LOC104589305  59.3    1e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010543209.1|  PREDICTED: uncharacterized protein LOC104816...  58.9    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_010543191.1|  PREDICTED: uncharacterized protein LOC104816...  58.9    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_008237348.1|  PREDICTED: IST1 homolog                          58.2    3e-06   Prunus mume [ume]
ref|XP_004489726.1|  PREDICTED: dentin sialophosphoprotein-like       57.0    8e-06   Cicer arietinum [garbanzo]
ref|XP_008384411.1|  PREDICTED: uncharacterized protein LOC103447017  56.2    1e-05   
gb|ABS32229.1|  hypothetical protein                                  54.7    5e-05   Carica papaya [mamon]
gb|KHG18028.1|  Uncharacterized protein F383_00577                    53.9    8e-05   Gossypium arboreum [tree cotton]
gb|EYU43558.1|  hypothetical protein MIMGU_mgv1a005603mg              53.5    9e-05   Erythranthe guttata [common monkey flower]
ref|XP_011074152.1|  PREDICTED: vacuolar protein sorting-associat...  50.4    0.001   Sesamum indicum [beniseed]



>ref|XP_011083402.1| PREDICTED: uncharacterized protein LOC105165944 [Sesamum indicum]
Length=522

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 123/206 (60%), Gaps = 40/206 (19%)
 Frame = -3

Query  734  LSPAPNEEKQFLPFMApppkssssvkqsdlpPPLPKAPS--ETNVDLQDVlaaaqaaaes  561
            +S +P  +KQF+PF++PP +S +S    +   P P  P     NVDLQDVLAAAQAAAE+
Sbjct  313  ISASPVGDKQFVPFISPPSQSPASFPAREHSSP-PAVPKTKNVNVDLQDVLAAAQAAAET  371

Query  560  aeraaaaarsaaslaqlRISELTKKKDDAG-----KDPFHVDAQKDDSSEKPHL-EHess  399
            AERAAAAARSAAS+AQLRISEL K K+DA      ++PFH++  K D  EK  L +H+S 
Sbjct  372  AERAAAAARSAASIAQLRISELVKNKNDAVSVPTVENPFHLEKSKSDVVEKTDLLKHKSV  431

Query  398  fss-------------------------------sdaasiseSPKLNDQSRHHQPQRLPS  312
              S                                 A +   S  LN  + HHQPQRLPS
Sbjct  432  GDSDSASTSPSQNESYEQYTTHQPTAHPSHFDPQVAAGTSLGSNVLNQGAGHHQPQRLPS  491

Query  311  IDDETYFSYPNLFTRQGSNLSSNAQS  234
            +DDETYFSYPNLFT QGSN+S +AQS
Sbjct  492  LDDETYFSYPNLFTSQGSNVSPHAQS  517



>emb|CAN60958.1| hypothetical protein VITISV_034688 [Vitis vinifera]
Length=557

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 126/220 (57%), Gaps = 44/220 (20%)
 Frame = -3

Query  737  DLSPAPNEEKQFLPFMA----pppkssssvkqsdlpPPLPKAPSETNVDLQDVlaaaqaa  570
            D+S    E+KQF+PF++         S+       PP L +  +E ++DLQDVLAAAQ A
Sbjct  337  DVSVKAMEDKQFVPFISXPILASASFSARQNNPPPPPSLSRTKTEADIDLQDVLAAAQVA  396

Query  569  aesaeraaaaarsaaslaqlRISELTKKKD----DAGKDPFHVD-AQKDDSSEKPHLEHe  405
            AESAERAAAAARSAASLAQ+RI+E+ KK D     + ++PFH+D + +  ++EKPH++H 
Sbjct  397  AESAERAAAAARSAASLAQVRIAEIMKKNDQVLDSSCENPFHIDTSDQSPTTEKPHVDHH  456

Query  404  ssfsssdaasi-----------seSPKLN----------------------DQSRHHQPQ  324
            +S   SD  S              S  LN                      D+  HHQPQ
Sbjct  457  NSLXDSDGVSNPLDAHQDPENYQASEALNLPSYDRDKVGIDSSPSDDHVIEDKPAHHQPQ  516

Query  323  RLPSIDDETYFSYPNLFTRQGSNLSSNAQSF--NSRPPHE  210
            RLPS+DD++YFSYPNLFT QGSNL S   SF   SR  HE
Sbjct  517  RLPSMDDDSYFSYPNLFTSQGSNLGSGVHSFMDTSRSTHE  556



>ref|XP_002275027.1| PREDICTED: uncharacterized protein LOC100245921 [Vitis vinifera]
Length=539

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 125/220 (57%), Gaps = 44/220 (20%)
 Frame = -3

Query  737  DLSPAPNEEKQFLPFMA----pppkssssvkqsdlpPPLPKAPSETNVDLQDVlaaaqaa  570
            D+S    E+KQF+PF++         S+       PP L +  +E ++DLQDVLAAAQ A
Sbjct  319  DVSVKAMEDKQFVPFISRPILASASFSARQNNPPPPPNLSRTKTEADIDLQDVLAAAQVA  378

Query  569  aesaeraaaaarsaaslaqlRISELTKKKD----DAGKDPFHVD-AQKDDSSEKPHLEHe  405
            AESAERAAAAARSAASLAQ+RI+E+ KK D     + ++PFH D + +  ++EKPH++H 
Sbjct  379  AESAERAAAAARSAASLAQVRIAEIMKKNDQVLDSSCENPFHTDTSDQSPTTEKPHVDHH  438

Query  404  ssfsssdaasi-----------seSPKLN----------------------DQSRHHQPQ  324
            +S   SD  S              S  LN                      D+  HHQPQ
Sbjct  439  NSLGDSDGVSNPLDAHQDPENYQASEALNLPSYDRDKVGIDSSPSDDHVIEDKPAHHQPQ  498

Query  323  RLPSIDDETYFSYPNLFTRQGSNLSSNAQSF--NSRPPHE  210
            RLPS+DD++YFSYPNLFT QGSNL S   SF   SR  HE
Sbjct  499  RLPSMDDDSYFSYPNLFTSQGSNLGSGVHSFTDTSRSTHE  538



>ref|XP_010094831.1| hypothetical protein L484_016412 [Morus notabilis]
 gb|EXB57360.1| hypothetical protein L484_016412 [Morus notabilis]
Length=555

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 123/210 (59%), Gaps = 40/210 (19%)
 Frame = -3

Query  716  EEKQFLPFMApppkssssvkqsdlpP----PLPKAPSETNVDLQDVlaaaqaaaesaera  549
            E+KQF+PF+A P  SSSS            PL +  SE  VDLQDVLAAAQAAA+SAERA
Sbjct  346  EDKQFVPFIAAPSLSSSSFSVRQSSNSPPPPLLRTRSEAKVDLQDVLAAAQAAADSAERA  405

Query  548  aaaarsaaslaqlRISELTKKKDD-----AGKDPFHVDA-QKDDSSEKPHLEHessfsss  387
            AAAARSAASLAQ+RI+EL+KK +D     + ++PFH  +  +  S EKPH +  +S   S
Sbjct  406  AAAARSAASLAQVRINELSKKTNDQVPPNSSENPFHTGSPGRSASLEKPHFDRRNSTGDS  465

Query  386  daasiseSPKLNDQSRH----------------------------HQPQRLPSIDDETYF  291
            D+ S S  P   D+S H                            HQPQRLPS+DDE YF
Sbjct  466  DSVSSSPKPHHIDESVHGLEASNLSSVHSLKADFDAALPESDPARHQPQRLPSMDDEPYF  525

Query  290  SYPNLFTRQGSNLSSNAQSF--NSRPPHEQ  207
            SYPNLF  Q SNL S AQSF  NS  P E+
Sbjct  526  SYPNLFRSQSSNLRSGAQSFKDNSHSPDER  555



>ref|XP_002534491.1| protein with unknown function [Ricinus communis]
 gb|EEF27891.1| protein with unknown function [Ricinus communis]
Length=531

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 117/199 (59%), Gaps = 38/199 (19%)
 Frame = -3

Query  716  EEKQFLPFMApppkssssvkqsdlpPPLPKAPSETNVDLQDVlaaaqaaaesaeraaaaa  537
            EEKQFLPF++PP  S+S   +    PP+ +  SE NVDLQDV+AAAQAAAE+AERAAAAA
Sbjct  322  EEKQFLPFISPPVSSTSFSTRPSTSPPISRTKSEFNVDLQDVIAAAQAAAETAERAAAAA  381

Query  536  rsaaslaqlRISELTKKKDD-----AGKDPFHVDA-QKDDSSEKPHLEHessfsssdaas  375
            R AA+LAQ RIS LTKK  +     + ++PFHVD   +  ++EKPH  H+ SF      S
Sbjct  382  RLAATLAQARISVLTKKNSEKFPECSDENPFHVDTPDQSPTTEKPHFGHQHSFDGPSGVS  441

Query  374  iseS----------PKLND----------------------QSRHHQPQRLPSIDDETYF  291
                           +L+D                      QS  HQPQRLPS+DD+ YF
Sbjct  442  SYLHLHQQHEDHQPSELHDLPSFEKLKMEYDSPPSDLVHEQQSVRHQPQRLPSMDDDAYF  501

Query  290  SYPNLFTRQGSNLSSNAQS  234
            SYPNLFT Q  NL S+AQS
Sbjct  502  SYPNLFTSQNPNLGSSAQS  520



>ref|XP_003548955.1| PREDICTED: vacuolar protein sorting-associated protein IST1-like 
isoform X1 [Glycine max]
 ref|XP_006599451.1| PREDICTED: vacuolar protein sorting-associated protein IST1-like 
isoform X2 [Glycine max]
Length=528

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 118/213 (55%), Gaps = 44/213 (21%)
 Frame = -3

Query  716  EEKQFLPFMApppkssssvkqsdlpPP--LPKAPSETNVDLQDVlaaaqaaaesaeraaa  543
            E KQ+LPF++PP  SS S        P       SE NVDLQDVLAAA AAAE+AERAAA
Sbjct  315  ENKQYLPFISPPSVSSGSFFARHSDSPPSFSSTKSEGNVDLQDVLAAAHAAAETAERAAA  374

Query  542  aarsaaslaqlRISELTKKKD-------DAGKDPFH-----------------VDAQKDD  435
            AAR+ ASLAQ+RI+ELTKKK         + ++PF+                 + A   D
Sbjct  375  AARNMASLAQVRINELTKKKSTEHVPDSSSSENPFYAGGGNESPTIEKHFTDQIPAGNSD  434

Query  434  SSEKPHLEHessfsssdaasiseSPK------------------LNDQSRHHQPQRLPSI  309
            +  + ++EH     +S  +  S  P                   LND+S  HQP+RLPS+
Sbjct  435  ALNRNNVEHHLDHHASPGSHSSSFPSFDTLKEDFASSLPNDHHVLNDKSSSHQPKRLPSM  494

Query  308  DDETYFSYPNLFTRQGSNLSSNAQSFNSRPPHE  210
            DD+TYFSYPNLFT Q SN+ S A S NSR PH+
Sbjct  495  DDDTYFSYPNLFTSQNSNVGSQAHSDNSRSPHD  527



>ref|XP_012089676.1| PREDICTED: IST1-like protein isoform X1 [Jatropha curcas]
 ref|XP_012089677.1| PREDICTED: IST1-like protein isoform X1 [Jatropha curcas]
 ref|XP_012089678.1| PREDICTED: IST1-like protein isoform X1 [Jatropha curcas]
 gb|KDP22885.1| hypothetical protein JCGZ_01959 [Jatropha curcas]
Length=520

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 118/203 (58%), Gaps = 37/203 (18%)
 Frame = -3

Query  725  APNEEKQFLPFMApppks-sssvkqsdlpPPLPKAPSETNVDLQDVlaaaqaaaesaera  549
            A  EEKQFLPFM+PP  S +S   + +    + +  SE NVDL DV+AAAQAAAE+AERA
Sbjct  309  AAKEEKQFLPFMSPPSASPASISTRLNNLSHVSRTKSEANVDLLDVVAAAQAAAETAERA  368

Query  548  aaaarsaaslaqlRISELTKKKD----DAGKDPFHVDA-QKDDSSEKPHLEHessfsssd  384
            AAAARSAA+LAQ +ISELTKK      D  ++PFH D   +  + EKPH +H+ SF   +
Sbjct  369  AAAARSAATLAQAKISELTKKNSEKFPDDDENPFHTDIPAQSATKEKPHFDHQPSFGDRN  428

Query  383  aasiseS----------PKLND---------------------QSRHHQPQRLPSIDDET  297
              S              P+L++                      S HHQPQRLPS+DDE+
Sbjct  429  GVSSYLGSHQLFEGHQPPELHELPSFEKLKVDYDSASVQGPGQGSVHHQPQRLPSMDDES  488

Query  296  YFSYPNLFTRQGSNLSSNAQSFN  228
            YFSYPNLFT Q  N+  NAQS  
Sbjct  489  YFSYPNLFTTQNPNVGLNAQSVT  511



>ref|XP_012089679.1| PREDICTED: uncharacterized protein LOC105648034 isoform X2 [Jatropha 
curcas]
Length=460

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 117/203 (58%), Gaps = 37/203 (18%)
 Frame = -3

Query  725  APNEEKQFLPFMApppkssssvkqsdlpPP-LPKAPSETNVDLQDVlaaaqaaaesaera  549
            A  EEKQFLPFM+PP  S +S+         + +  SE NVDL DV+AAAQAAAE+AERA
Sbjct  249  AAKEEKQFLPFMSPPSASPASISTRLNNLSHVSRTKSEANVDLLDVVAAAQAAAETAERA  308

Query  548  aaaarsaaslaqlRISELTKKKD----DAGKDPFHVDA-QKDDSSEKPHLEHessfsssd  384
            AAAARSAA+LAQ +ISELTKK      D  ++PFH D   +  + EKPH +H+ SF   +
Sbjct  309  AAAARSAATLAQAKISELTKKNSEKFPDDDENPFHTDIPAQSATKEKPHFDHQPSFGDRN  368

Query  383  aasiseS----------PKLND---------------------QSRHHQPQRLPSIDDET  297
              S              P+L++                      S HHQPQRLPS+DDE+
Sbjct  369  GVSSYLGSHQLFEGHQPPELHELPSFEKLKVDYDSASVQGPGQGSVHHQPQRLPSMDDES  428

Query  296  YFSYPNLFTRQGSNLSSNAQSFN  228
            YFSYPNLFT Q  N+  NAQS  
Sbjct  429  YFSYPNLFTTQNPNVGLNAQSVT  451



>ref|XP_006354036.1| PREDICTED: uncharacterized protein LOC102585287 [Solanum tuberosum]
Length=528

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 124/213 (58%), Gaps = 40/213 (19%)
 Frame = -3

Query  725  APNEEKQFLPFMApppkssssvkqsdlpPPLPKAPS------ETNVDLQDVlaaaqaaae  564
            AP EEKQFLPFM PPPKS              + PS      ET+VDLQDVLAAAQAAA+
Sbjct  316  APEEEKQFLPFMVPPPKSPPFSSTERTTTQSTQPPSTTKTKVETDVDLQDVLAAAQAAAD  375

Query  563  saeraaaaarsaaslaqlRISELTKKKDDA-----GKDPFHVDAQKDDSSEKPHLEHess  399
            SAERAAAAARSAASLAQ+RISELT+K+ +       ++PF+ + Q+    EKPHL+ +  
Sbjct  376  SAERAAAAARSAASLAQVRISELTRKRSEEVPVSPSENPFYAEKQESHILEKPHLDLQRQ  435

Query  398  fsssdaa-----------siseSPKLNDQSRH---------------HQPQRLPSIDDET  297
             S+SD              +S  P  +D +                 HQPQRLPS+DDET
Sbjct  436  SSNSDGIPSPLHGSPLEHQVSNIPSYDDSTVGVESPISHIHHPGQGLHQPQRLPSMDDET  495

Query  296  YFSYPNLF-TRQGSNLSSNAQSF--NSRPPHEQ  207
            Y+SYPNLF    GSN  S +QSF  N R  H++
Sbjct  496  YYSYPNLFNATNGSNPGSRSQSFKDNIRSSHDK  528



>gb|KHN32808.1| IST1-like protein [Glycine soja]
Length=528

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 117/213 (55%), Gaps = 44/213 (21%)
 Frame = -3

Query  716  EEKQFLPFMApppkssssvkqsdlpPP--LPKAPSETNVDLQDVlaaaqaaaesaeraaa  543
            E KQ+LPF++PP  SS S        P       SE NVDLQDVLAAA AAAE+AERAAA
Sbjct  315  ENKQYLPFISPPSVSSGSFFARHSDSPPSFSSTKSEGNVDLQDVLAAAHAAAETAERAAA  374

Query  542  aarsaaslaqlRISELTKKKD-------DAGKDPFH-----------------VDAQKDD  435
            AAR+ ASLAQ+RI+ELTKKK         + ++PF+                 + A   D
Sbjct  375  AARNMASLAQVRINELTKKKSTEHVPDSSSSENPFYAGGGNESPTIEKHFTDQIPAGNSD  434

Query  434  SSEKPHLEHessfsssdaasiseSPK------------------LNDQSRHHQPQRLPSI  309
            +  + ++EH     +S  +  S  P                   LND+S  HQP+RLPS+
Sbjct  435  ALNRNNVEHHLDHHASPGSHSSSFPSFDTLKEDFASSLPNDHHVLNDKSSSHQPKRLPSM  494

Query  308  DDETYFSYPNLFTRQGSNLSSNAQSFNSRPPHE  210
            DD+TYFSYPNLFT Q SN+ S A S NSR  H+
Sbjct  495  DDDTYFSYPNLFTSQNSNVGSQAHSDNSRSSHD  527



>ref|NP_001275331.1| uncharacterized protein LOC102585287 [Solanum tuberosum]
 dbj|BAE46414.1| hypothetical protein [Solanum tuberosum]
Length=528

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 124/213 (58%), Gaps = 40/213 (19%)
 Frame = -3

Query  725  APNEEKQFLPFMApppkssssvkqsdlpPPLPKAPS------ETNVDLQDVlaaaqaaae  564
            +P EEKQFLPFM PPPKS              + PS      ET+VDLQDVLAAAQAAA+
Sbjct  316  SPEEEKQFLPFMVPPPKSPPFSSTERTTTQSTQPPSTTKTKVETDVDLQDVLAAAQAAAD  375

Query  563  saeraaaaarsaaslaqlRISELTKKKDDA-----GKDPFHVDAQKDDSSEKPHLEHess  399
            SAERAAAAARSAASLAQ+RISELT+K+ +       ++PF+ + Q+    EKPHL+ +  
Sbjct  376  SAERAAAAARSAASLAQVRISELTRKRSEEVPVSPSENPFYAEKQESHILEKPHLDLQRQ  435

Query  398  fsssdaa-----------siseSPKLNDQSRH---------------HQPQRLPSIDDET  297
             S+SD              +S  P  +D +                 HQPQRLPS+DDET
Sbjct  436  SSNSDGIPSPLHGSPLEHQVSNIPSYDDSTVGVESPISHIHHPGQGLHQPQRLPSMDDET  495

Query  296  YFSYPNLF-TRQGSNLSSNAQSF--NSRPPHEQ  207
            Y+SYPNLF    GSN  S +QSF  N R  H++
Sbjct  496  YYSYPNLFNATNGSNPGSRSQSFKDNIRSSHDK  528



>ref|XP_003518384.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Glycine 
max]
 gb|KHN00708.1| IST1 like [Glycine soja]
Length=537

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  356  LNDQSRHHQPQRLPSIDDETYFSYPNLFTRQGSNLSSNAQSFNSRPPH  213
            L+D+S  HQP+RLPS+DD++YFSYPNLFT Q SN+ S A S NSR PH
Sbjct  480  LDDKSSSHQPKRLPSMDDDSYFSYPNLFTSQNSNVGSQAHSDNSRSPH  527



>ref|XP_004237874.1| PREDICTED: uncharacterized protein LOC101268389 [Solanum lycopersicum]
Length=528

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 126/213 (59%), Gaps = 40/213 (19%)
 Frame = -3

Query  725  APNEEKQFLPFMApppkssssvkqsdlpPPLPKAPS------ETNVDLQDVlaaaqaaae  564
            AP EEKQFLPFM PPPKSS             + PS      ET+VDLQDVLAAAQAAA+
Sbjct  316  APEEEKQFLPFMVPPPKSSPLPSTESTTIQSTQPPSATKTKVETDVDLQDVLAAAQAAAD  375

Query  563  saeraaaaarsaaslaqlRISELTKKKDDA-----GKDPFHVDAQKDDSSEKPHLEHess  399
            SAERAAAAARSAASLAQ+RISELT+K+ +       ++PF+ + Q+    EKP+L+ +  
Sbjct  376  SAERAAAAARSAASLAQVRISELTRKRSEEVPVSPSENPFYSEKQESHILEKPNLDLQHQ  435

Query  398  fsssdaa-----------siseSPKLNDQSRH---------------HQPQRLPSIDDET  297
             S+SD              +S  P  +D +                 HQPQRLPS+DDET
Sbjct  436  SSNSDGIPSPLHGSPLEHQVSNIPSYDDSTVGVESPISHIHHPGQGLHQPQRLPSMDDET  495

Query  296  YFSYPNLF-TRQGSNLSSNAQSF--NSRPPHEQ  207
            Y+SYPNLF    GSN SS +QSF  N R  H++
Sbjct  496  YYSYPNLFNATNGSNPSSRSQSFKDNIRSSHDK  528



>ref|XP_009591345.1| PREDICTED: uncharacterized protein LOC104088390 [Nicotiana tomentosiformis]
Length=530

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 124/214 (58%), Gaps = 41/214 (19%)
 Frame = -3

Query  725  APNEEKQFLPFMApppkssssvkqsdlpPPLPKAPS------ETNVDLQDVlaaaqaaae  564
            AP EEKQFLPFM PPPKSS             + PS      ET++DLQDVLAAAQAAAE
Sbjct  317  APEEEKQFLPFMVPPPKSSPFSSTQSTTTKSTQPPSTTKTKVETDIDLQDVLAAAQAAAE  376

Query  563  saeraaaaarsaaslaqlRISELTKKKDDA-----GKDPFHVDAQKDDS--SEKPHL---  414
            SAERAAAAARSAASLAQ RISELT+K+ +       ++PF+ + Q+ +S   EK      
Sbjct  377  SAERAAAAARSAASLAQFRISELTRKRSEEVPGSPSENPFYAEKQEQESHILEKAPFDLQ  436

Query  413  ------------------EHessfsssdaasiseSPKLNDQ-----SRHHQPQRLPSIDD  303
                              EH+ S   S  A++     + +      +  HQPQRLPS+DD
Sbjct  437  HQLSNSDGIPSPLHGSPSEHQVSNIPSYNATVGFESSMTNHHPAQGTALHQPQRLPSLDD  496

Query  302  ETYFSYPNLFTRQGSNLSSNAQSF--NSRPPHEQ  207
            ETY+SY NLFT  GSN SS +QSF  N RP H++
Sbjct  497  ETYYSYLNLFTANGSNPSSRSQSFKDNIRPSHDK  530



>ref|XP_009773832.1| PREDICTED: uncharacterized protein LOC104223983 [Nicotiana sylvestris]
 ref|XP_009773840.1| PREDICTED: uncharacterized protein LOC104223983 [Nicotiana sylvestris]
Length=532

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 127/216 (59%), Gaps = 43/216 (20%)
 Frame = -3

Query  725  APNEEKQFLPFMApppkssssvkqsdlpPPLPKAPS------ETNVDLQDVlaaaqaaae  564
            AP EEKQFLPFM PPPKSS             + PS      ET++DLQDVLAAAQAAAE
Sbjct  317  APEEEKQFLPFMVPPPKSSPFSSTKSTTTQSTQPPSTTKTKVETDIDLQDVLAAAQAAAE  376

Query  563  saeraaaaarsaaslaqlRISELTKKKDDA-----GKDPFHVDAQKDDS--SEKP--HLE  411
            SAERAAAAARSAASLAQ RISELT+K+ +       ++PF+ + ++ +S   EK    L+
Sbjct  377  SAERAAAAARSAASLAQFRISELTRKRSEEVPGSPSENPFYAEKKEQESHILEKAPFDLQ  436

Query  410  Hessfs---------ssdaasiseSPKLNDQS-----------------RHHQPQRLPSI  309
            H+ S S         S+    +S  P  +D +                   HQPQRLPS+
Sbjct  437  HQLSNSDGIPSPLHGSASEHQVSNIPSYDDATVGFESSMSTNNHPAQGTARHQPQRLPSL  496

Query  308  DDETYFSYPNLFTRQGSNLSSNAQSF--NSRPPHEQ  207
            DDETY+SYPNLFT  GSN SS +QSF  N R  H++
Sbjct  497  DDETYYSYPNLFTANGSNPSSRSQSFKDNIRSRHDK  532



>ref|XP_008381028.1| PREDICTED: IST1-like protein [Malus domestica]
 ref|XP_008381029.1| PREDICTED: IST1-like protein [Malus domestica]
 ref|XP_008381030.1| PREDICTED: IST1-like protein [Malus domestica]
 ref|XP_008381031.1| PREDICTED: IST1-like protein [Malus domestica]
Length=538

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 121/209 (58%), Gaps = 43/209 (21%)
 Frame = -3

Query  716  EEKQFLPFMApppkssssvkqsdlpPP--LPKAPSETNVDLQDVlaaaqaaaesaeraaa  543
            E+KQFLPF++ P  SS+S       PP  L +  SE NVDLQDVLAAAQAAA+SAERAA 
Sbjct  324  EDKQFLPFISYPSLSSASFSTRQSNPPPNLSRTRSEVNVDLQDVLAAAQAAADSAERAAT  383

Query  542  aarsaaslaqlRISELTKKKDD-----AGKDPFHVDA-QKDDSSEKP-------------  420
            AARSAASLAQ+RI+E+TKKK +     + ++PFHVD   + D+ EKP             
Sbjct  384  AARSAASLAQVRINEITKKKSEVVPETSCENPFHVDVPNQSDTREKPDSNHLIPDGGSDG  443

Query  419  ----------HLEHessfsssdaasiseSPKLNDQSRH------------HQPQRLPSID  306
                      HL  + S  S+ ++   E   ++  S H            HQPQRL S+ 
Sbjct  444  VIDSPVPHPIHLYGQGSEISNASSITMEPLNVDFDSAHSNDHASEHEPVRHQPQRLASMG  503

Query  305  DETYFSYPNLFTRQGSNLSSNAQSFNSRP  219
            D++YFSYPNLFT Q SN+ S+AQS    P
Sbjct  504  DDSYFSYPNLFTSQNSNVGSDAQSSTDNP  532



>ref|XP_007201705.1| hypothetical protein PRUPE_ppa004125mg [Prunus persica]
 gb|EMJ02904.1| hypothetical protein PRUPE_ppa004125mg [Prunus persica]
Length=528

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 117/194 (60%), Gaps = 33/194 (17%)
 Frame = -3

Query  716  EEKQFLPFMApppkssssvkqsdlpPP--LPKAPSETNVDLQDVlaaaqaaaesaeraaa  543
            E+KQFLPF++PP  SS+S       PP  L +  S+ NVD QDVLAAAQAAA+SAERAAA
Sbjct  324  EDKQFLPFISPPSLSSASFSTRRSNPPPSLSRTRSDANVDFQDVLAAAQAAADSAERAAA  383

Query  542  aarsaaslaqlRISELTKKK-----DDAGKDPFHVDA-QKDDSSEKPHLEHessfsssda  381
            AARSAASLAQ+RI+ELTKK      +++ ++PFHVD   + D+ EKP  +H      SD 
Sbjct  384  AARSAASLAQVRINELTKKNTEEVPENSCENPFHVDIPSESDTREKPDFDHPIRNGDSDG  443

Query  380  asiseSPKLNDQSRH-------------------------HQPQRLPSIDDETYFSYPNL  276
            A  S  P   ++  H                         HQPQRL S++D+ YFSYPNL
Sbjct  444  AIHSPGPHQVNEYGHGAKPLNADLDSSLPNDHAFEHEPLRHQPQRLSSMEDDPYFSYPNL  503

Query  275  FTRQGSNLSSNAQS  234
            FT Q SN+ S AQS
Sbjct  504  FTSQNSNVGSGAQS  517



>gb|KDO83982.1| hypothetical protein CISIN_1g009857mg [Citrus sinensis]
 gb|KDO83983.1| hypothetical protein CISIN_1g009857mg [Citrus sinensis]
Length=281

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 128/214 (60%), Gaps = 36/214 (17%)
 Frame = -3

Query  746  KLTDLSPAPNEEKQFLPFMApppkssssvkqsdlpPP-LPKAPSETNVDLQDVlaaaqaa  570
            ++ D S    E++QF+PF++PP  ++S   +    PP + K  SETNVDLQDVLAAAQAA
Sbjct  68   EIPDESVGDEEDRQFVPFISPPSLTASFSGRQSSLPPTISKTQSETNVDLQDVLAAAQAA  127

Query  569  aesaeraaaaarsaaslaqlRISELTKKKDDA-GKDPFHVDAQ-KDDSSEKPHLEHessf  396
            AE+AERAAAAARSAASLAQ+RIS LT+KK+DA  ++PF+ D   +  +SE  H +H++S 
Sbjct  128  AETAERAAAAARSAASLAQMRISGLTQKKNDAVSENPFYTDGSDQSCTSENQHFDHKTSL  187

Query  395  ss-sdaasiseSPKLNDQSR------------------------------HHQPQRLPSI  309
            +     ++     ++++Q R                               HQPQRL S+
Sbjct  188  NDPGTISNSLAFHQVHEQQRASELPDLPSFDHKVVFDSSPNDRVSDQEPVRHQPQRLTSM  247

Query  308  DDETYFSYPNLFTRQGSNLSSNAQSF--NSRPPH  213
            DD+++FSYPNLF+ Q  NL S +  F  NSR  H
Sbjct  248  DDDSHFSYPNLFSSQNPNLGSGSDLFTDNSRANH  281



>ref|XP_006434656.1| hypothetical protein CICLE_v10000853mg [Citrus clementina]
 gb|ESR47896.1| hypothetical protein CICLE_v10000853mg [Citrus clementina]
Length=397

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 128/214 (60%), Gaps = 36/214 (17%)
 Frame = -3

Query  746  KLTDLSPAPNEEKQFLPFMApppkssssvkqsdlpPP-LPKAPSETNVDLQDVlaaaqaa  570
            ++ D S    E++QF+PF++PP  ++S   +    PP + K  SETNVDLQDVLAAAQAA
Sbjct  184  EIPDESVGGEEDRQFVPFISPPSLTASFSGRQSSLPPTISKTQSETNVDLQDVLAAAQAA  243

Query  569  aesaeraaaaarsaaslaqlRISELTKKKDDA-GKDPFHVDAQ-KDDSSEKPHLEHessf  396
            AE+AERAAAAARSAASLAQ+RIS LT+KK+DA  ++PF+ D   +  +SE  H +H++S 
Sbjct  244  AETAERAAAAARSAASLAQMRISGLTQKKNDAVSENPFYTDGSDQSCTSENQHFDHKTSL  303

Query  395  ss-sdaasiseSPKLNDQSR------------------------------HHQPQRLPSI  309
            +     ++     ++++Q R                               HQPQRL S+
Sbjct  304  NDPGTISNSLAFHQVHEQQRASELPDLPSFDHKVVFDSSPNDRVSDQEPVRHQPQRLTSM  363

Query  308  DDETYFSYPNLFTRQGSNLSSNAQSF--NSRPPH  213
            DD+++FSYPNLF+ Q  NL S +  F  NSR  H
Sbjct  364  DDDSHFSYPNLFSSQNPNLGSGSDLFTDNSRANH  397



>ref|XP_006434655.1| hypothetical protein CICLE_v10000853mg [Citrus clementina]
 gb|ESR47895.1| hypothetical protein CICLE_v10000853mg [Citrus clementina]
Length=523

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 126/211 (60%), Gaps = 36/211 (17%)
 Frame = -3

Query  737  DLSPAPNEEKQFLPFMApppkssssvkqsdlpPP-LPKAPSETNVDLQDVlaaaqaaaes  561
            D S    E++QF+PF++PP  ++S   +    PP + K  SETNVDLQDVLAAAQAAAE+
Sbjct  313  DESVGGEEDRQFVPFISPPSLTASFSGRQSSLPPTISKTQSETNVDLQDVLAAAQAAAET  372

Query  560  aeraaaaarsaaslaqlRISELTKKKDDA-GKDPFHVDAQ-KDDSSEKPHLEHessfss-  390
            AERAAAAARSAASLAQ+RIS LT+KK+DA  ++PF+ D   +  +SE  H +H++S +  
Sbjct  373  AERAAAAARSAASLAQMRISGLTQKKNDAVSENPFYTDGSDQSCTSENQHFDHKTSLNDP  432

Query  389  sdaasiseSPKLNDQSR------------------------------HHQPQRLPSIDDE  300
               ++     ++++Q R                               HQPQRL S+DD+
Sbjct  433  GTISNSLAFHQVHEQQRASELPDLPSFDHKVVFDSSPNDRVSDQEPVRHQPQRLTSMDDD  492

Query  299  TYFSYPNLFTRQGSNLSSNAQSF--NSRPPH  213
            ++FSYPNLF+ Q  NL S +  F  NSR  H
Sbjct  493  SHFSYPNLFSSQNPNLGSGSDLFTDNSRANH  523



>gb|KDO83980.1| hypothetical protein CISIN_1g009857mg [Citrus sinensis]
 gb|KDO83981.1| hypothetical protein CISIN_1g009857mg [Citrus sinensis]
Length=397

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 128/214 (60%), Gaps = 36/214 (17%)
 Frame = -3

Query  746  KLTDLSPAPNEEKQFLPFMApppkssssvkqsdlpPP-LPKAPSETNVDLQDVlaaaqaa  570
            ++ D S    E++QF+PF++PP  ++S   +    PP + K  SETNVDLQDVLAAAQAA
Sbjct  184  EIPDESVGDEEDRQFVPFISPPSLTASFSGRQSSLPPTISKTQSETNVDLQDVLAAAQAA  243

Query  569  aesaeraaaaarsaaslaqlRISELTKKKDDA-GKDPFHVDAQ-KDDSSEKPHLEHessf  396
            AE+AERAAAAARSAASLAQ+RIS LT+KK+DA  ++PF+ D   +  +SE  H +H++S 
Sbjct  244  AETAERAAAAARSAASLAQMRISGLTQKKNDAVSENPFYTDGSDQSCTSENQHFDHKTSL  303

Query  395  ss-sdaasiseSPKLNDQSR------------------------------HHQPQRLPSI  309
            +     ++     ++++Q R                               HQPQRL S+
Sbjct  304  NDPGTISNSLAFHQVHEQQRASELPDLPSFDHKVVFDSSPNDRVSDQEPVRHQPQRLTSM  363

Query  308  DDETYFSYPNLFTRQGSNLSSNAQSF--NSRPPH  213
            DD+++FSYPNLF+ Q  NL S +  F  NSR  H
Sbjct  364  DDDSHFSYPNLFSSQNPNLGSGSDLFTDNSRANH  397



>gb|KDO83978.1| hypothetical protein CISIN_1g009857mg [Citrus sinensis]
Length=523

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 126/211 (60%), Gaps = 36/211 (17%)
 Frame = -3

Query  737  DLSPAPNEEKQFLPFMApppkssssvkqsdlpPP-LPKAPSETNVDLQDVlaaaqaaaes  561
            D S    E++QF+PF++PP  ++S   +    PP + K  SETNVDLQDVLAAAQAAAE+
Sbjct  313  DESVGDEEDRQFVPFISPPSLTASFSGRQSSLPPTISKTQSETNVDLQDVLAAAQAAAET  372

Query  560  aeraaaaarsaaslaqlRISELTKKKDDA-GKDPFHVDAQ-KDDSSEKPHLEHessfss-  390
            AERAAAAARSAASLAQ+RIS LT+KK+DA  ++PF+ D   +  +SE  H +H++S +  
Sbjct  373  AERAAAAARSAASLAQMRISGLTQKKNDAVSENPFYTDGSDQSCTSENQHFDHKTSLNDP  432

Query  389  sdaasiseSPKLNDQSR------------------------------HHQPQRLPSIDDE  300
               ++     ++++Q R                               HQPQRL S+DD+
Sbjct  433  GTISNSLAFHQVHEQQRASELPDLPSFDHKVVFDSSPNDRVSDQEPVRHQPQRLTSMDDD  492

Query  299  TYFSYPNLFTRQGSNLSSNAQSF--NSRPPH  213
            ++FSYPNLF+ Q  NL S +  F  NSR  H
Sbjct  493  SHFSYPNLFSSQNPNLGSGSDLFTDNSRANH  523



>gb|KDO83979.1| hypothetical protein CISIN_1g009857mg [Citrus sinensis]
Length=453

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 128/214 (60%), Gaps = 36/214 (17%)
 Frame = -3

Query  746  KLTDLSPAPNEEKQFLPFMApppkssssvkqsdlpPP-LPKAPSETNVDLQDVlaaaqaa  570
            ++ D S    E++QF+PF++PP  ++S   +    PP + K  SETNVDLQDVLAAAQAA
Sbjct  240  EIPDESVGDEEDRQFVPFISPPSLTASFSGRQSSLPPTISKTQSETNVDLQDVLAAAQAA  299

Query  569  aesaeraaaaarsaaslaqlRISELTKKKDDA-GKDPFHVDAQ-KDDSSEKPHLEHessf  396
            AE+AERAAAAARSAASLAQ+RIS LT+KK+DA  ++PF+ D   +  +SE  H +H++S 
Sbjct  300  AETAERAAAAARSAASLAQMRISGLTQKKNDAVSENPFYTDGSDQSCTSENQHFDHKTSL  359

Query  395  ss-sdaasiseSPKLNDQSR------------------------------HHQPQRLPSI  309
            +     ++     ++++Q R                               HQPQRL S+
Sbjct  360  NDPGTISNSLAFHQVHEQQRASELPDLPSFDHKVVFDSSPNDRVSDQEPVRHQPQRLTSM  419

Query  308  DDETYFSYPNLFTRQGSNLSSNAQSF--NSRPPH  213
            DD+++FSYPNLF+ Q  NL S +  F  NSR  H
Sbjct  420  DDDSHFSYPNLFSSQNPNLGSGSDLFTDNSRANH  453



>ref|XP_009339061.1| PREDICTED: uncharacterized protein LOC103931336 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009339062.1| PREDICTED: uncharacterized protein LOC103931336 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009339063.1| PREDICTED: uncharacterized protein LOC103931336 isoform X2 [Pyrus 
x bretschneideri]
Length=538

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 122/215 (57%), Gaps = 43/215 (20%)
 Frame = -3

Query  734  LSPAPNEEKQFLPFMApppkssssvkqsdlpPP--LPKAPSETNVDLQDVlaaaqaaaes  561
            +S    E+KQFLPF++ P  SS+S       PP  L +  SE NVDLQDVLAAAQAAA+S
Sbjct  318  VSVGAVEDKQFLPFISSPSLSSASFSTRQSNPPPNLSRTRSEVNVDLQDVLAAAQAAADS  377

Query  560  aeraaaaarsaaslaqlRISELTKKKDD-----AGKDPFHVD-AQKDDSSEKP-------  420
            AERAA AARSAASLAQ+RI+E+T K  +     + ++PFHVD + + D+ EKP       
Sbjct  378  AERAATAARSAASLAQVRINEITTKNSEEVPETSCENPFHVDVSNQSDTREKPNSNHLIP  437

Query  419  ----------------HLEHessfsssdaasiseSPKLNDQSRH------------HQPQ  324
                            HL  + S  S+ ++   E   ++  S H            HQPQ
Sbjct  438  DGGSDGVIDSPVPHQIHLYGQGSEISNASSITMEPLNVDFGSAHSNDHASEHEPVRHQPQ  497

Query  323  RLPSIDDETYFSYPNLFTRQGSNLSSNAQSFNSRP  219
            RL S++D+ YFSYPNLFT Q SN+ S+AQS    P
Sbjct  498  RLASMEDDPYFSYPNLFTSQNSNVGSDAQSSTDNP  532



>ref|XP_011038197.1| PREDICTED: IST1 homolog [Populus euphratica]
 ref|XP_011038198.1| PREDICTED: IST1 homolog [Populus euphratica]
Length=579

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 94/165 (57%), Gaps = 36/165 (22%)
 Frame = -3

Query  620  SETNVDLQDVlaaaqaaaesaeraaaaarsaaslaqlRISELTKKKDDA---GKDPFHVD  450
            +E NVDLQDVLAAA AAAESAERAAAAARSAA+LAQ RISELTKK  +      +PF VD
Sbjct  404  TEANVDLQDVLAAAHAAAESAERAAAAARSAATLAQARISELTKKNSEKFPEDDNPFFVD  463

Query  449  AQ-KDDSSEKPHLEHessf----------------------------sssdaasiseSPK  357
                  S+E+PH  H+ SF                            S        +SP+
Sbjct  464  TSDHSASTERPHFVHQQSFGDPGSVPNNVDSHRPHKDHQASELLDIPSFEKLEVYYDSPR  523

Query  356  ----LNDQSRHHQPQRLPSIDDETYFSYPNLFTRQGSNLSSNAQS  234
                +   S  HQPQRLPS+DDE YFSYPNLFT Q SNL S AQS
Sbjct  524  SDHVVEQGSVSHQPQRLPSMDDEPYFSYPNLFTSQNSNLGSGAQS  568



>ref|XP_006473234.1| PREDICTED: uncharacterized protein LOC102611062 [Citrus sinensis]
Length=523

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 122/204 (60%), Gaps = 34/204 (17%)
 Frame = -3

Query  737  DLSPAPNEEKQFLPFMApppkssssvkqsdlpPP-LPKAPSETNVDLQDVlaaaqaaaes  561
            D S    E++QF+PF++PP  ++S   +    PP + K  SETNVDLQDVLAAAQAAAE+
Sbjct  313  DESVGGEEDRQFVPFISPPSLTASFSGRQSSLPPTISKTQSETNVDLQDVLAAAQAAAET  372

Query  560  aeraaaaarsaaslaqlRISELTKKKDDA-GKDPFHVDAQ-KDDSSEKPHLEHessfss-  390
            AERAAAAARSAASLAQ+RIS LT+KK+DA  ++PF+ D   +  +SE  H +H++S +  
Sbjct  373  AERAAAAARSAASLAQMRISGLTQKKNDAVSENPFYTDGSDQSCTSENQHFDHKTSLNDP  432

Query  389  sdaasiseSPKLNDQSR------------------------------HHQPQRLPSIDDE  300
               ++     ++++Q R                               HQPQRL S+DD+
Sbjct  433  GTISNSLAFHQVHEQQRASELPDLPSFDHKVVFDSSPNDRVSDQEPVRHQPQRLTSMDDD  492

Query  299  TYFSYPNLFTRQGSNLSSNAQSFN  228
            ++FSYPNLF+ Q  NL S +  F 
Sbjct  493  SHFSYPNLFSSQNPNLGSGSDLFT  516



>gb|KEH25939.1| regulator of Vps4 activity in the MVB pathway protein [Medicago 
truncatula]
Length=585

 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  356  LNDQSRHHQPQRLPSIDDETYFSYPNLFTRQGSNLSSNAQSFNSR  222
            L+D+S  HQP+RLPS+DD+TYFSYPNLF  Q SN+ S+  S NSR
Sbjct  536  LDDKSNSHQPKRLPSMDDDTYFSYPNLFNSQNSNVGSHTHSDNSR  580



>ref|XP_007151911.1| hypothetical protein PHAVU_004G086100g [Phaseolus vulgaris]
 gb|ESW23905.1| hypothetical protein PHAVU_004G086100g [Phaseolus vulgaris]
Length=525

 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  356  LNDQSRHHQPQRLPSIDDETYFSYPNLFTRQGSNLSSNAQSFNSRPPHE  210
            LND    HQP+RLPS+DD++YFSYPNLFT Q S++ S   S +SR PH+
Sbjct  476  LNDNFSSHQPKRLPSMDDDSYFSYPNLFTSQNSSVGSQTHSDHSRSPHD  524



>ref|XP_006376337.1| hypothetical protein POPTR_0013s12140g [Populus trichocarpa]
 gb|ERP54134.1| hypothetical protein POPTR_0013s12140g [Populus trichocarpa]
Length=547

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  335  HQPQRLPSIDDETYFSYPNLFTRQGSNLSSNAQS  234
            HQPQRLPS+DDE YFSYPNLFT Q SNL S AQS
Sbjct  503  HQPQRLPSMDDEPYFSYPNLFTSQNSNLGSGAQS  536



>ref|XP_009339749.1| PREDICTED: IST1-like protein [Pyrus x bretschneideri]
 ref|XP_009339750.1| PREDICTED: IST1-like protein [Pyrus x bretschneideri]
Length=538

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 118/215 (55%), Gaps = 43/215 (20%)
 Frame = -3

Query  734  LSPAPNEEKQFLPFMApppkssssvkqsdlpPP--LPKAPSETNVDLQDVlaaaqaaaes  561
            +S    E+KQF+PF++ P   S+S       PP  L +  SE NVDLQDVLAAAQAAA+S
Sbjct  318  VSVGAVEDKQFVPFISSPSLPSASFSTRQSNPPPNLSRTRSEVNVDLQDVLAAAQAAADS  377

Query  560  aeraaaaarsaaslaqlRISELTKKKDD-----AGKDPFHVDA-QKDDSSEKP-------  420
            AERAA AARSAASLAQ+RI+E+TKK  +     + ++PFHVD   + D+ EKP       
Sbjct  378  AERAATAARSAASLAQVRINEITKKNSEEVPETSCENPFHVDVPNQSDTREKPNSNHLIP  437

Query  419  ----------------HLEHessfsssdaasiseSPKLNDQSRH------------HQPQ  324
                            HL  + S  S+ ++   E   ++  S H            HQPQ
Sbjct  438  DGGSDGVIDSPVPHQIHLYGQGSEISNTSSITMEPLNVDFDSAHSNDHASEHEPVRHQPQ  497

Query  323  RLPSIDDETYFSYPNLFTRQGSNLSSNAQSFNSRP  219
            RL S++   YF YPNLFT Q SN+ S+AQS    P
Sbjct  498  RLASMEGVPYFWYPNLFTSQNSNVGSDAQSSTDNP  532



>ref|XP_002325569.2| hypothetical protein POPTR_0019s11730g [Populus trichocarpa]
 gb|EEE99950.2| hypothetical protein POPTR_0019s11730g [Populus trichocarpa]
Length=533

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  344  SRHHQPQRLPSIDDETYFSYPNLFTRQGSNLSSNAQS  234
            S  HQPQRLPS+DDE YFSYPNLFT Q SNL S+A S
Sbjct  486  SVSHQPQRLPSMDDEPYFSYPNLFTSQNSNLGSSALS  522



>ref|XP_010245870.1| PREDICTED: uncharacterized protein LOC104589305 [Nelumbo nucifera]
Length=546

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 119/214 (56%), Gaps = 38/214 (18%)
 Frame = -3

Query  740  TDLSPAPNEEKQFLPFMA--pppkssssvkqsdlpPPLPKAPSETNVDLQDVlaaaqaaa  567
             ++S    EEKQFLPF+       +S S +Q +  P L K  SE + DL+DVLAAAQAAA
Sbjct  333  ANISTGTGEEKQFLPFITPPSLSSASFSSRQCNPAPSLSKTKSEASFDLEDVLAAAQAAA  392

Query  566  esaeraaaaarsaaslaqlRISELTKKKDDAG--KDPFHVDAQKDDSS-EKPHLEHessf  396
            E+AERAAAAARSAASLAQ+RI+EL KK++D    KD   +D Q   +    P  +H  SF
Sbjct  393  ETAERAAAAARSAASLAQVRITELIKKRNDQASEKDELEIDNQNQSAGVGMPQFDHRQSF  452

Query  395  sssdaasise---------------------------SPKLNDQ-----SRHHQPQRLPS  312
              +D AS S                             P  +DQ     S  HQPQRLPS
Sbjct  453  GDTDGASYSLDSHPENGSNERSDSPNFSLYDTPQVGFEPPSSDQINEHESTRHQPQRLPS  512

Query  311  IDDETYFSYPNLFTRQGSNLSSNAQSF-NSRPPH  213
            ++D+ YFSYPNLFT Q SNL S+  +  NSR  H
Sbjct  513  MEDDPYFSYPNLFTSQESNLGSSIYTIGNSRTTH  546



>ref|XP_010543209.1| PREDICTED: uncharacterized protein LOC104816186 isoform X2 [Tarenaya 
hassleriana]
Length=490

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 63/106 (59%), Gaps = 8/106 (8%)
 Frame = -3

Query  506  ISELTKKKDDA-----GKDPFHVDAQKDDSSEKPHLEHessfsssdaasiseSPKLNDQS  342
            I+ELTKK  D       ++PFH   +   S + P  +H++S +SS     S      +Q+
Sbjct  385  ITELTKKNTDQPPEIPSENPFH-GKESPTSVKNPCFDHQNSSNSSFGDLPSLERFSLEQN  443

Query  341  RHHQPQRLPSIDDETYFSYPNLFTRQGSNLSSNAQSF--NSRPPHE  210
              HQPQRLPS+DD+ YFSYPNLF  Q  + S  +++F  NSRPPH+
Sbjct  444  HDHQPQRLPSMDDDPYFSYPNLFPSQNPDSSHGSRTFPENSRPPHD  489



>ref|XP_010543191.1| PREDICTED: uncharacterized protein LOC104816186 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010543201.1| PREDICTED: uncharacterized protein LOC104816186 isoform X1 [Tarenaya 
hassleriana]
Length=494

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 63/106 (59%), Gaps = 8/106 (8%)
 Frame = -3

Query  506  ISELTKKKDDA-----GKDPFHVDAQKDDSSEKPHLEHessfsssdaasiseSPKLNDQS  342
            I+ELTKK  D       ++PFH   +   S + P  +H++S +SS     S      +Q+
Sbjct  389  ITELTKKNTDQPPEIPSENPFH-GKESPTSVKNPCFDHQNSSNSSFGDLPSLERFSLEQN  447

Query  341  RHHQPQRLPSIDDETYFSYPNLFTRQGSNLSSNAQSF--NSRPPHE  210
              HQPQRLPS+DD+ YFSYPNLF  Q  + S  +++F  NSRPPH+
Sbjct  448  HDHQPQRLPSMDDDPYFSYPNLFPSQNPDSSHGSRTFPENSRPPHD  493



>ref|XP_008237348.1| PREDICTED: IST1 homolog [Prunus mume]
Length=538

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 117/210 (56%), Gaps = 43/210 (20%)
 Frame = -3

Query  734  LSPAPNEEKQFLPFMApppkssssvkqsdlpPP--LPKAPSETNVDLQDVlaaaqaaaes  561
            +S    E+KQFLPF++PP  SS+S       PP  L +  S+ NVD QDVLAAAQAAA+S
Sbjct  318  VSVGGVEDKQFLPFISPPSLSSASFSTRRSNPPPSLSRTRSDANVDFQDVLAAAQAAADS  377

Query  560  aeraaaaarsaaslaqlRISELTKKK-----DDAGKDPFHVDA-QKDDSSEKPHLEHess  399
            AERAAAAARSAASLAQ+RI+ELTKK      +++ ++PFH D   + D+ EKP  +H   
Sbjct  378  AERAAAAARSAASLAQVRINELTKKNSEEVPENSCENPFHEDIPSESDTREKPDFDHAIR  437

Query  398  fsssdaasiseS----------PKLNDQSR-------------------------HHQPQ  324
               SD    S             K++D +                           HQPQ
Sbjct  438  NGDSDGVIHSLGLHQVHEYGHGAKVSDLNSVTMEPLNADLDSSLPNDHAFEHEPVRHQPQ  497

Query  323  RLPSIDDETYFSYPNLFTRQGSNLSSNAQS  234
            RL S++D+ YFSYPNLFT Q SN  S AQS
Sbjct  498  RLSSMEDDPYFSYPNLFTSQNSNAGSGAQS  527



>ref|XP_004489726.1| PREDICTED: dentin sialophosphoprotein-like [Cicer arietinum]
Length=523

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  338  HHQPQRLPSIDDETYFSYPNLFTRQGSNLSSNAQSFNSRPPHEQ  207
            H+QP+RLPS+DD+ YFSYPNLFT Q SN+ S+  S NSR  ++ 
Sbjct  480  HNQPKRLPSMDDDPYFSYPNLFTSQNSNVGSHTHSDNSRSTYDM  523



>ref|XP_008384411.1| PREDICTED: uncharacterized protein LOC103447017 [Malus domestica]
Length=597

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  335  HQPQRLPSIDDETYFSYPNLFTRQGSNLSSNAQSFNSRP  219
            HQPQRL S+DD+ YFSYPNLFT Q SN+ S+AQS    P
Sbjct  553  HQPQRLSSMDDDPYFSYPNLFTSQNSNVGSHAQSATDNP  591



>gb|ABS32229.1| hypothetical protein [Carica papaya]
 gb|ABY60780.1| hypothetical protein [Carica papaya]
Length=533

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 111/206 (54%), Gaps = 43/206 (21%)
 Frame = -3

Query  719  NEEKQFLPFM---ApppkssssvkqsdlpPPLPKAPSETNVDLQDVlaaaqaaaesaera  549
            +++KQF+PF    A      S+   S    PL +  S+ NVDLQDV+AAA+AAAE+AERA
Sbjct  321  DKDKQFVPFTSPPAVASALFSARHGSSSLAPL-RTTSDANVDLQDVIAAAEAAAETAERA  379

Query  548  aaaarsaaslaqlRISELTKKKDDAGKD-----PFHVDA-QKDDSSEKPH----------  417
            AAAARSAASLAQ+RI+ELTKK++D   D     PF+  + ++    EKP           
Sbjct  380  AAAARSAASLAQVRIAELTKKRNDKVSDSTCENPFYTGSPEQSPIREKPQFGQQNCLGDT  439

Query  416  ---LEHessfsssdaasiseSPKLNDQSRH--------------------HQPQRLPSID  306
               LE  S     +    SESP ++   +H                     QPQR  S+D
Sbjct  440  NNVLESLSCSEIHEGRQESESPNIHSIEKHKMRFDSPTLDEHFHDHDSADRQPQRSTSMD  499

Query  305  DETYFSYPNLFTRQGSNLSSNAQSFN  228
            D++YFSYPNLFT Q SNL S +  F 
Sbjct  500  DDSYFSYPNLFTSQNSNLGSGSHHFT  525



>gb|KHG18028.1| Uncharacterized protein F383_00577 [Gossypium arboreum]
Length=529

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = -3

Query  362  PKLNDQSRHHQPQRLPSIDDETYFSYPNLFTRQGSNLSSNA  240
            P  +D + HHQP RLPS+DDE +FSYPNLF RQ  +L SN 
Sbjct  479  PVSSDHAVHHQPHRLPSMDDE-FFSYPNLFARQNRDLGSNG  518



>gb|EYU43558.1| hypothetical protein MIMGU_mgv1a005603mg [Erythranthe guttata]
Length=477

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 98/163 (60%), Gaps = 5/163 (3%)
 Frame = -3

Query  716  EEKQFLPFMApppkssssvkqsdlpPPLPKAPSETNVDLQDVlaaaqaaaesaeraaaaa  537
            EEKQF+PF++ P       +      P        ++DLQDVLAAAQAAA+SAERAAA+A
Sbjct  313  EEKQFVPFISSPSLHPVKEQNRH---PAVLKTRNEDMDLQDVLAAAQAAADSAERAAASA  369

Query  536  rsaaslaqlRISELTKKK-DDAGKDPFHVDAQKDDSSEKPHLEHessfsssdaasiseSP  360
            R+AASL QLRISEL KK+ DD  K     D     +S K +  H     + + +    + 
Sbjct  370  RAAASLTQLRISELVKKRNDDFDKQNSVSDCDGASTSPKHNGTHYDPPLAVEPSCPGNNN  429

Query  359  KLNDQSRHHQPQRLPSIDDETYFSYPNLFT-RQGSNLSSNAQS  234
             L     +HQP R P IDDE+YFSYPNLFT  QGSNL ++AQS
Sbjct  430  LLGQGVDNHQPPRSPPIDDESYFSYPNLFTSSQGSNLDNHAQS  472



>ref|XP_011074152.1| PREDICTED: vacuolar protein sorting-associated protein IST1-like 
isoform X2 [Sesamum indicum]
Length=489

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -3

Query  335  HQPQRLPSIDDETYFSYPNLFTRQGSNLSS  246
             +PQ  PS+DD+TYFSYPNLFT QGSN+SS
Sbjct  450  QKPQISPSLDDDTYFSYPNLFTSQGSNVSS  479



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1724604950500