BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig953

Length=796
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011081031.1|  PREDICTED: lysophospholipid acyltransferase ...    416   8e-141   Sesamum indicum [beniseed]
ref|XP_006358391.1|  PREDICTED: lysophospholipid acyltransferase ...    411   6e-139   Solanum tuberosum [potatoes]
ref|XP_009609255.1|  PREDICTED: lysophospholipid acyltransferase ...    410   3e-138   Nicotiana tomentosiformis
ref|XP_004244602.1|  PREDICTED: lysophospholipid acyltransferase ...    408   1e-137   Solanum lycopersicum
gb|EYU38990.1|  hypothetical protein MIMGU_mgv1a005877mg                407   4e-137   Erythranthe guttata [common monkey flower]
gb|EYU29840.1|  hypothetical protein MIMGU_mgv1a0059782mg               402   5e-137   Erythranthe guttata [common monkey flower]
ref|XP_009764156.1|  PREDICTED: lysophospholipid acyltransferase ...    405   1e-136   Nicotiana sylvestris
ref|XP_009759896.1|  PREDICTED: lysophospholipid acyltransferase ...    405   2e-136   Nicotiana sylvestris
ref|XP_009628905.1|  PREDICTED: lysophospholipid acyltransferase ...    404   8e-136   Nicotiana tomentosiformis
ref|XP_004245650.1|  PREDICTED: lysophospholipid acyltransferase ...    403   1e-135   Solanum lycopersicum
emb|CDP09808.1|  unnamed protein product                                403   1e-135   Coffea canephora [robusta coffee]
ref|XP_006358867.1|  PREDICTED: lysophospholipid acyltransferase ...    399   6e-134   Solanum tuberosum [potatoes]
gb|AER57988.1|  putative lysophosphatidylcholine acyltransferase 1      395   2e-132   Helianthus annuus
ref|XP_006364125.1|  PREDICTED: lysophospholipid acyltransferase ...    395   2e-132   Solanum tuberosum [potatoes]
gb|AHE80989.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        393   9e-132   Carthamus tinctorius
ref|XP_002509709.1|  o-acyltransferase (membrane bound) domain co...    387   3e-131   
gb|AHE80985.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        391   6e-131   Bernardia pulchella
ref|XP_011072149.1|  PREDICTED: lysophospholipid acyltransferase ...    390   1e-130   Sesamum indicum [beniseed]
gb|AGO14581.1|  lysophosphatidylcholine acyltransferase                 390   1e-130   Ricinus communis
ref|XP_012087002.1|  PREDICTED: lysophospholipid acyltransferase ...    389   4e-130   Jatropha curcas
ref|XP_002282807.1|  PREDICTED: lysophospholipid acyltransferase 1      389   5e-130   Vitis vinifera
gb|AER57989.2|  putative lysophosphatidylcholine acyltransferase 2      388   6e-130   
gb|AGL74879.1|  1-acylglycerophosphocholine O-acyltransferase           387   2e-129   Vernicia fordii [tung oil tree]
ref|XP_004252578.1|  PREDICTED: lysophospholipid acyltransferase ...    387   2e-129   Solanum lycopersicum
gb|AHE80988.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        387   2e-129   Hiptage benghalensis
gb|AHE80986.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        386   4e-129   Hiptage benghalensis
ref|XP_002304469.2|  membrane bound O-acyl transferase family pro...    384   3e-128   Populus trichocarpa [western balsam poplar]
gb|AHE80984.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        384   3e-128   Bernardia pulchella
ref|XP_010112575.1|  hypothetical protein L484_010580                   384   4e-128   Morus notabilis
gb|KDP25507.1|  hypothetical protein JCGZ_20663                         383   6e-128   Jatropha curcas
emb|CBI34747.3|  unnamed protein product                                382   1e-127   Vitis vinifera
ref|XP_008448977.1|  PREDICTED: lysophospholipid acyltransferase 1      381   4e-127   Cucumis melo [Oriental melon]
ref|XP_010933881.1|  PREDICTED: lysophospholipid acyltransferase ...    381   4e-127   Elaeis guineensis
ref|XP_004148282.1|  PREDICTED: lysophospholipid acyltransferase 1      381   6e-127   Cucumis sativus [cucumbers]
ref|XP_010278548.1|  PREDICTED: lysophospholipid acyltransferase 1      380   8e-127   Nelumbo nucifera [Indian lotus]
ref|XP_011033798.1|  PREDICTED: lysophospholipid acyltransferase ...    380   1e-126   Populus euphratica
gb|KJB68443.1|  hypothetical protein B456_010G246400                    375   2e-126   Gossypium raimondii
gb|AGL81301.1|  lysophosphatidylcholine acyltransferase                 379   3e-126   Momordica charantia [balsam pear]
gb|KJB68445.1|  hypothetical protein B456_010G246400                    377   5e-126   Gossypium raimondii
ref|XP_006440537.1|  hypothetical protein CICLE_v10020062mg             374   7e-126   
gb|KJB68442.1|  hypothetical protein B456_010G246400                    378   9e-126   Gossypium raimondii
gb|KDO63566.1|  hypothetical protein CISIN_1g012501mg                   374   1e-125   Citrus sinensis [apfelsine]
gb|KHG22777.1|  Lysophospholipid acyltransferase 2                      370   1e-125   Gossypium arboreum [tree cotton]
gb|KDO63565.1|  hypothetical protein CISIN_1g012501mg                   375   2e-125   Citrus sinensis [apfelsine]
ref|XP_008803275.1|  PREDICTED: lysophospholipid acyltransferase ...    377   2e-125   Phoenix dactylifera
gb|KCW72088.1|  hypothetical protein EUGRSUZ_E00532                     374   2e-125   Eucalyptus grandis [rose gum]
ref|XP_011029182.1|  PREDICTED: lysophospholipid acyltransferase ...    377   2e-125   Populus euphratica
ref|XP_002298063.2|  membrane bound O-acyl transferase family pro...    377   2e-125   
gb|EPS74023.1|  hypothetical protein M569_00723                         377   2e-125   Genlisea aurea
gb|KCW72087.1|  hypothetical protein EUGRSUZ_E00532                     374   2e-125   Eucalyptus grandis [rose gum]
ref|XP_004515799.1|  PREDICTED: lysophospholipid acyltransferase ...    376   3e-125   Cicer arietinum [garbanzo]
gb|KJB68447.1|  hypothetical protein B456_010G246400                    374   7e-125   Gossypium raimondii
gb|KDO63564.1|  hypothetical protein CISIN_1g012501mg                   375   1e-124   Citrus sinensis [apfelsine]
ref|XP_006440536.1|  hypothetical protein CICLE_v10020062mg             375   1e-124   Citrus clementina [clementine]
ref|XP_010055596.1|  PREDICTED: lysophospholipid acyltransferase ...    375   2e-124   Eucalyptus grandis [rose gum]
ref|XP_004515798.1|  PREDICTED: lysophospholipid acyltransferase ...    375   2e-124   
ref|XP_008795385.1|  PREDICTED: lysophospholipid acyltransferase ...    374   3e-124   Phoenix dactylifera
ref|XP_007023110.1|  MBOAT (membrane bound O-acyl transferase) fa...    370   5e-124   
ref|XP_007023106.1|  MBOAT (membrane bound O-acyl transferase) fa...    372   1e-123   Theobroma cacao [chocolate]
ref|XP_006307436.1|  hypothetical protein CARUB_v10009061mg             372   2e-123   Capsella rubella
ref|XP_010546005.1|  PREDICTED: lysophospholipid acyltransferase 1      371   3e-123   Tarenaya hassleriana [spider flower]
ref|XP_002892700.1|  membrane bound O-acyl transferase family pro...    371   4e-123   Arabidopsis lyrata subsp. lyrata
gb|ERN19360.1|  hypothetical protein AMTR_s00069p00124460               371   5e-123   Amborella trichopoda
ref|XP_006477394.1|  PREDICTED: membrane-bound O-acyltransferase ...    370   8e-123   Citrus sinensis [apfelsine]
gb|AGM15931.1|  lysophosphatidylcholine acyltransferase 1               370   9e-123   Physaria fendleri
ref|XP_008238778.1|  PREDICTED: lysophospholipid acyltransferase 1      370   1e-122   Prunus mume [ume]
gb|AGM15932.1|  lysophosphatidylcholine acyltransferase 2               370   1e-122   Physaria fendleri
ref|XP_004298745.1|  PREDICTED: lysophospholipid acyltransferase 1      369   2e-122   Fragaria vesca subsp. vesca
ref|XP_010494443.1|  PREDICTED: lysophospholipid acyltransferase ...    369   2e-122   Camelina sativa [gold-of-pleasure]
ref|XP_007209112.1|  hypothetical protein PRUPE_ppa005358mg             369   2e-122   
ref|XP_003549863.1|  PREDICTED: lysophospholipid acyltransferase 2      369   2e-122   Glycine max [soybeans]
ref|XP_009377923.1|  PREDICTED: lysophospholipid acyltransferase ...    369   3e-122   Pyrus x bretschneideri [bai li]
ref|XP_008364537.1|  PREDICTED: lysophospholipid acyltransferase ...    367   8e-122   
ref|NP_172724.2|  lysophosphatidylcholine acyltransferase 1             367   9e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010919229.1|  PREDICTED: lysophospholipid acyltransferase ...    367   2e-121   Elaeis guineensis
ref|XP_010476235.1|  PREDICTED: lysophospholipid acyltransferase 1      367   2e-121   Camelina sativa [gold-of-pleasure]
ref|XP_008369472.1|  PREDICTED: lysophospholipid acyltransferase ...    366   3e-121   
gb|AAM13086.1|  unknown protein                                         366   3e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458693.1|  PREDICTED: lysophospholipid acyltransferase ...    366   4e-121   Camelina sativa [gold-of-pleasure]
ref|XP_007155562.1|  hypothetical protein PHAVU_003G212400g             366   4e-121   Phaseolus vulgaris [French bean]
emb|CDY63224.1|  BnaCnng41640D                                          365   6e-121   Brassica napus [oilseed rape]
ref|XP_010553491.1|  PREDICTED: lysophospholipid acyltransferase ...    365   6e-121   Tarenaya hassleriana [spider flower]
ref|XP_009148576.1|  PREDICTED: lysophospholipid acyltransferase 1      365   8e-121   Brassica rapa
gb|KJB29823.1|  hypothetical protein B456_005G120200                    365   9e-121   Gossypium raimondii
gb|KJB29824.1|  hypothetical protein B456_005G120200                    365   1e-120   Gossypium raimondii
emb|CDX98051.1|  BnaA06g08020D                                          365   1e-120   
dbj|BAJ34298.1|  unnamed protein product                                360   1e-120   Eutrema halophilum
gb|AAF88094.1|AC025417_22  T12C24.17                                    363   2e-120   Arabidopsis thaliana [mouse-ear cress]
gb|KHN14121.1|  Membrane-bound O-acyltransferase domain-containin...    363   3e-120   Glycine soja [wild soybean]
ref|XP_010934443.1|  PREDICTED: lysophospholipid acyltransferase ...    363   3e-120   Elaeis guineensis
ref|XP_010934444.1|  PREDICTED: lysophospholipid acyltransferase ...    362   3e-120   Elaeis guineensis
gb|KEH31706.1|  membrane-bound O-acyltransferase family MBOAT pro...    362   8e-120   Medicago truncatula
gb|KHN34432.1|  Lysophospholipid acyltransferase 2                      362   1e-119   Glycine soja [wild soybean]
ref|XP_006417213.1|  hypothetical protein EUTSA_v10007564mg             362   1e-119   Eutrema salsugineum [saltwater cress]
ref|XP_006857893.2|  PREDICTED: lysophospholipid acyltransferase 1      362   1e-119   Amborella trichopoda
ref|XP_009364173.1|  PREDICTED: lysophospholipid acyltransferase ...    362   2e-119   Pyrus x bretschneideri [bai li]
emb|CDY45972.1|  BnaA09g12940D                                          361   3e-119   Brassica napus [oilseed rape]
ref|XP_009113025.1|  PREDICTED: lysophospholipid acyltransferase 2      361   3e-119   Brassica rapa
ref|XP_003525728.1|  PREDICTED: lysophospholipid acyltransferase ...    361   4e-119   Glycine max [soybeans]
emb|CDY57076.1|  BnaCnng31560D                                          361   4e-119   Brassica napus [oilseed rape]
ref|XP_002886438.1|  membrane bound O-acyl transferase family pro...    361   4e-119   Arabidopsis lyrata subsp. lyrata
gb|KFK43529.1|  hypothetical protein AALP_AA1G138000                    360   6e-119   Arabis alpina [alpine rockcress]
ref|XP_010255524.1|  PREDICTED: lysophospholipid acyltransferase ...    360   6e-119   Nelumbo nucifera [Indian lotus]
gb|KHG06049.1|  Lysophospholipid acyltransferase 2                      360   6e-119   Gossypium arboreum [tree cotton]
ref|XP_009339650.1|  PREDICTED: lysophospholipid acyltransferase ...    360   1e-118   Pyrus x bretschneideri [bai li]
ref|XP_010430382.1|  PREDICTED: lysophospholipid acyltransferase ...    359   2e-118   Camelina sativa [gold-of-pleasure]
ref|XP_006391786.1|  hypothetical protein EUTSA_v10023446mg             358   4e-118   Eutrema salsugineum [saltwater cress]
ref|XP_008646049.1|  PREDICTED: lysophospholipid acyltransferase 1      358   5e-118   
ref|NP_176493.1|  lysophosphatidylcholine acyltransferase               358   6e-118   Arabidopsis thaliana [mouse-ear cress]
gb|KFK40546.1|  hypothetical protein AALP_AA2G010000                    357   1e-117   Arabis alpina [alpine rockcress]
ref|XP_010473534.1|  PREDICTED: lysophospholipid acyltransferase 2      356   2e-117   Camelina sativa [gold-of-pleasure]
ref|XP_010693498.1|  PREDICTED: lysophospholipid acyltransferase ...    356   2e-117   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004953433.1|  PREDICTED: lysophospholipid acyltransferase-...    356   3e-117   
ref|XP_010418312.1|  PREDICTED: lysophospholipid acyltransferase ...    355   6e-117   Camelina sativa [gold-of-pleasure]
ref|XP_002454488.1|  hypothetical protein SORBIDRAFT_04g031990          354   2e-116   Sorghum bicolor [broomcorn]
ref|XP_009391951.1|  PREDICTED: lysophospholipid acyltransferase ...    354   2e-116   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006300445.1|  hypothetical protein CARUB_v10020125mg             356   2e-116   
ref|XP_003570095.1|  PREDICTED: lysophospholipid acyltransferase 2      348   3e-114   Brachypodium distachyon [annual false brome]
ref|NP_001047723.1|  Os02g0676000                                       344   1e-112   
gb|AFW72781.1|  hypothetical protein ZEAMMB73_982934                    343   5e-112   
dbj|BAJ87726.1|  predicted protein                                      342   8e-112   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002892698.1|  predicted protein                                  340   3e-111   
ref|XP_010494450.1|  PREDICTED: lysophospholipid acyltransferase ...    330   2e-107   Camelina sativa [gold-of-pleasure]
gb|ABK24304.1|  unknown                                                 330   3e-107   Picea sitchensis
ref|XP_007023107.1|  MBOAT (membrane bound O-acyl transferase) fa...    317   2e-102   
ref|XP_001780460.1|  predicted protein                                  268   5e-83    
ref|XP_001763507.1|  predicted protein                                  258   5e-79    
ref|XP_006665020.1|  PREDICTED: lysophospholipid acyltransferase-...    253   3e-78    
ref|XP_001751825.1|  predicted protein                                  254   2e-77    
gb|KJB68448.1|  hypothetical protein B456_010G246400                    219   2e-65    Gossypium raimondii
gb|EMT11337.1|  hypothetical protein F775_10016                         186   2e-52    
gb|EMS54344.1|  hypothetical protein TRIUR3_33673                       184   2e-51    Triticum urartu
ref|XP_007023108.1|  MBOAT (membrane bound O-acyl transferase) fa...    182   3e-51    
ref|XP_005649636.1|  membrane bound O-acyl transferase family pro...    179   7e-49    Coccomyxa subellipsoidea C-169
gb|KFK23829.1|  hypothetical protein AALP_AAs39384U000100               157   3e-44    Arabis alpina [alpine rockcress]
ref|XP_005850438.1|  hypothetical protein CHLNCDRAFT_20761              135   4e-33    Chlorella variabilis
gb|AFW72780.1|  hypothetical protein ZEAMMB73_982934                    126   1e-32    
ref|XP_011398849.1|  Membrane-bound O-acyltransferase domain-cont...    131   2e-31    Auxenochlorella protothecoides
gb|KDD76279.1|  membrane-bound O-acyltransferase                        130   6e-31    Helicosporidium sp. ATCC 50920
ref|XP_002500677.1|  predicted protein                                  127   3e-30    Micromonas commoda
ref|XP_006386564.1|  hypothetical protein POPTR_0002s14510g             115   8e-29    
ref|XP_003064354.1|  predicted protein                                  123   1e-28    Micromonas pusilla CCMP1545
gb|EMT11338.1|  hypothetical protein F775_10017                         112   1e-27    
gb|KIY98914.1|  hypothetical protein MNEG_9048                          118   1e-26    Monoraphidium neglectum
ref|XP_003084126.1|  Predicted membrane protein (ISS)                   117   2e-26    Ostreococcus tauri
ref|XP_001422221.1|  predicted protein                                  103   8e-22    Ostreococcus lucimarinus CCE9901
ref|XP_002950776.1|  hypothetical protein VOLCADRAFT_120919             103   3e-21    Volvox carteri f. nagariensis
ref|XP_007511041.1|  predicted protein                                  103   3e-21    Bathycoccus prasinos
ref|XP_003283301.1|  hypothetical protein DICPUDRAFT_52171            96.3    4e-19    Dictyostelium purpureum
ref|XP_002180603.1|  predicted protein                                94.0    2e-18    Phaeodactylum tricornutum CCAP 1055/1
emb|CDW83355.1|  UNKNOWN                                              90.1    4e-17    Stylonychia lemnae
ref|XP_002670587.1|  predicted protein                                89.4    1e-16    Naegleria gruberi strain NEG-M
ref|XP_004356029.1|  membrane bound O-acyl transferase family pro...  88.2    3e-16    Cavenderia fasciculata
ref|XP_699295.3|  PREDICTED: lysophospholipid acyltransferase 2 i...  87.8    4e-16    Danio rerio [leopard danio]
ref|XP_642430.1|  membrane bound O-acyl transferase family protein    87.0    5e-16    Dictyostelium discoideum AX4
ref|XP_004353223.1|  hypothetical protein ACA1_073390                 86.7    8e-16    Acanthamoeba castellanii str. Neff
emb|CCI43023.1|  unnamed protein product                              85.5    1e-15    Albugo candida
ref|XP_002287025.1|  predicted protein                                84.7    2e-15    Thalassiosira pseudonana CCMP1335
gb|EJY79920.1|  Membrane bound O-acyl transferase family protein      85.5    2e-15    Oxytricha trifallax
emb|CCA18672.1|  lysophospholipid acyltransferase putative            85.1    3e-15    Albugo laibachii Nc14
gb|EJY80788.1|  Membrane bound O-acyl transferase family protein      84.7    4e-15    Oxytricha trifallax
gb|ENN75377.1|  hypothetical protein YQE_08152                        84.3    5e-15    Dendroctonus ponderosae
ref|XP_008992148.1|  PREDICTED: LOW QUALITY PROTEIN: lysophosphol...  84.0    7e-15    
ref|XP_005723976.1|  PREDICTED: membrane-bound O-acyltransferase ...  84.0    8e-15    Pundamilia nyererei
ref|XP_004540559.1|  PREDICTED: membrane-bound O-acyltransferase ...  83.6    8e-15    Maylandia zebra
ref|XP_005942406.1|  PREDICTED: membrane-bound O-acyltransferase ...  83.6    8e-15    Haplochromis burtoni
gb|KKA64414.1|  hypothetical protein PRIPAC_13276                     83.6    9e-15    
ref|XP_005477146.1|  PREDICTED: membrane-bound O-acyltransferase ...  83.6    9e-15    Oreochromis niloticus
ref|XP_005101404.1|  PREDICTED: membrane-bound O-acyltransferase ...  83.2    1e-14    Aplysia californica
ref|XP_003962745.1|  PREDICTED: lysophospholipid acyltransferase 2    82.8    1e-14    
ref|XP_005177952.1|  PREDICTED: lysophospholipid acyltransferase 1    83.2    2e-14    Musca domestica
gb|EFQ28671.1|  MBOAT family protein                                  82.4    2e-14    Colletotrichum graminicola M1.001
gb|EJY76231.1|  Membrane bound O-acyl transferase family protein      82.0    2e-14    Oxytricha trifallax
ref|XP_001381215.1|  PREDICTED: lysophospholipid acyltransferase ...  82.0    3e-14    Monodelphis domestica
emb|CDJ83922.1|  Membrane bound O-acyl transferase domain contain...  80.5    3e-14    Haemonchus contortus [red stomach worm]
ref|XP_009526166.1|  hypothetical protein PHYSODRAFT_314590           81.6    4e-14    Phytophthora sojae
ref|XP_007252280.1|  PREDICTED: membrane-bound O-acyltransferase ...  81.6    4e-14    
gb|EEZ99452.1|  hypothetical protein TcasGA2_TC030770                 81.3    4e-14    
ref|XP_003757931.1|  PREDICTED: membrane-bound O-acyltransferase ...  81.3    5e-14    Sarcophilus harrisii
ref|XP_002059375.1|  GJ17620                                          81.6    6e-14    Drosophila virilis
ref|XP_011498420.1|  PREDICTED: lysophospholipid acyltransferase ...  80.9    7e-14    Ceratosolen solmsi marchali
ref|XP_005801344.1|  PREDICTED: membrane-bound O-acyltransferase ...  80.9    8e-14    
ref|XP_011228196.1|  PREDICTED: lysophospholipid acyltransferase 2    80.5    1e-13    
ref|XP_007893047.1|  PREDICTED: lysophospholipid acyltransferase ...  80.5    1e-13    Callorhinchus milii [Australian ghost shark]
ref|XP_007565592.1|  PREDICTED: lysophospholipid acyltransferase 2    80.5    1e-13    Poecilia formosa
ref|XP_006715063.1|  PREDICTED: lysophospholipid acyltransferase ...  77.8    1e-13    Homo sapiens [man]
ref|XP_008299182.1|  PREDICTED: membrane-bound O-acyltransferase ...  80.1    1e-13    Stegastes partitus
ref|XP_004401863.1|  PREDICTED: lysophospholipid acyltransferase 2    80.1    1e-13    Odobenus rosmarus divergens
gb|EFA78146.1|  membrane bound O-acyl transferase family protein      79.7    1e-13    Heterostelium album PN500
ref|XP_007457003.1|  PREDICTED: lysophospholipid acyltransferase ...  79.3    1e-13    Lipotes vexillifer [baiji]
ref|XP_011512615.1|  PREDICTED: lysophospholipid acyltransferase ...  77.4    1e-13    Homo sapiens [man]
gb|EAR97515.2|  membrane-bound O-acyltransferase family MBOAT pro...  78.2    1e-13    Tetrahymena thermophila SB210
ref|XP_004082306.1|  PREDICTED: lysophospholipid acyltransferase 2    79.7    2e-13    Oryzias latipes [Japanese rice fish]
ref|XP_007433489.1|  PREDICTED: lysophospholipid acyltransferase 1    79.7    2e-13    Python bivittatus
ref|XP_003701761.1|  PREDICTED: lysophospholipid acyltransferase ...  79.7    2e-13    Megachile rotundata
ref|XP_003927360.1|  PREDICTED: lysophospholipid acyltransferase ...  79.3    2e-13    Saimiri boliviensis boliviensis
ref|XP_010336319.1|  PREDICTED: lysophospholipid acyltransferase ...  79.0    2e-13    Saimiri boliviensis boliviensis
gb|ETE68526.1|  Lysophospholipid acyltransferase 1                    79.0    2e-13    Ophiophagus hannah
ref|XP_001083917.2|  PREDICTED: lysophospholipid acyltransferase ...  79.0    2e-13    
gb|KDN66214.1|  putative MBOAT family protein                         79.3    2e-13    Colletotrichum sublineola
emb|CCF46357.1|  MBOAT family protein                                 79.0    3e-13    Colletotrichum higginsianum
ref|XP_009967143.1|  PREDICTED: membrane-bound O-acyltransferase ...  76.6    3e-13    Tyto alba [Schleiereule]
ref|XP_007457002.1|  PREDICTED: lysophospholipid acyltransferase ...  79.0    3e-13    Lipotes vexillifer [baiji]
ref|XP_008400149.1|  PREDICTED: lysophospholipid acyltransferase 2    79.0    3e-13    
ref|XP_004363935.1|  hypothetical protein CAOG_03096                  79.0    3e-13    Capsaspora owczarzaki ATCC 30864
ref|XP_008306774.1|  PREDICTED: lysophospholipid acyltransferase 2    79.0    3e-13    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_011747724.1|  PREDICTED: lysophospholipid acyltransferase ...  79.0    4e-13    Macaca nemestrina [pigtail macaque]
ref|XP_005576658.1|  PREDICTED: lysophospholipid acyltransferase ...  78.6    4e-13    Macaca fascicularis [crab eating macaque]
ref|XP_004868363.1|  PREDICTED: lysophospholipid acyltransferase ...  78.6    4e-13    Heterocephalus glaber [naked mole rat]
gb|AAI28938.1|  LOC100037100 protein                                  78.6    4e-13    Xenopus laevis [clawed frog]
ref|XP_008201126.1|  PREDICTED: lysophospholipid acyltransferase 1    78.6    4e-13    Tribolium castaneum [rust-red flour beetle]
ref|XP_011508614.1|  PREDICTED: lysophospholipid acyltransferase ...  77.4    4e-13    
ref|XP_007296108.1|  MBOAT family protein                             78.6    4e-13    Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_011508613.1|  PREDICTED: lysophospholipid acyltransferase ...  77.4    4e-13    
ref|XP_011975217.1|  PREDICTED: lysophospholipid acyltransferase ...  78.6    4e-13    Ovis aries musimon
ref|XP_006898258.1|  PREDICTED: lysophospholipid acyltransferase 2    78.6    5e-13    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_001253491.3|  PREDICTED: lysophospholipid acyltransferase ...  78.6    5e-13    
ref|XP_007969738.1|  PREDICTED: lysophospholipid acyltransferase ...  77.8    5e-13    Chlorocebus sabaeus
ref|XP_010590200.1|  PREDICTED: LOW QUALITY PROTEIN: lysophosphol...  78.2    5e-13    Loxodonta africana [African bush elephant]
ref|XP_002816515.1|  PREDICTED: lysophospholipid acyltransferase 1    78.2    5e-13    Pongo abelii [orang utan]
ref|XP_004274952.1|  PREDICTED: lysophospholipid acyltransferase 2    78.2    5e-13    Orcinus orca [Orca]
ref|XP_006073877.1|  PREDICTED: lysophospholipid acyltransferase 2    78.2    5e-13    
ref|XP_007287206.1|  mboat family protein                             78.2    5e-13    
ref|XP_003219829.1|  PREDICTED: lysophospholipid acyltransferase 1    78.2    6e-13    Anolis carolinensis [Carolina anole]
ref|XP_011508611.1|  PREDICTED: lysophospholipid acyltransferase ...  77.4    6e-13    
ref|XP_011406119.1|  PREDICTED: lysophospholipid acyltransferase ...  75.5    6e-13    
ref|XP_002016308.1|  GL10561                                          78.2    7e-13    Drosophila persimilis
ref|XP_008560197.1|  PREDICTED: lysophospholipid acyltransferase ...  77.8    7e-13    Microplitis demolitor
ref|XP_003908301.1|  PREDICTED: lysophospholipid acyltransferase ...  77.8    7e-13    Papio anubis [baboon]
ref|XP_004609428.1|  PREDICTED: lysophospholipid acyltransferase 2    77.8    7e-13    Sorex araneus [Eurasian shrew]
ref|XP_006864041.1|  PREDICTED: lysophospholipid acyltransferase 2    77.8    8e-13    Chrysochloris asiatica
ref|XP_001360700.2|  GA14938                                          78.2    8e-13    Drosophila pseudoobscura pseudoobscura
ref|XP_011919313.1|  PREDICTED: lysophospholipid acyltransferase ...  77.8    8e-13    Cercocebus atys
ref|XP_004025015.1|  mboat family protein, putative                   77.4    8e-13    Ichthyophthirius multifiliis
ref|XP_010377990.1|  PREDICTED: lysophospholipid acyltransferase 2    77.8    8e-13    Rhinopithecus roxellana
ref|XP_007969727.1|  PREDICTED: lysophospholipid acyltransferase ...  77.8    8e-13    Chlorocebus sabaeus
ref|XP_001032451.1|  MBOAT family protein                             77.4    9e-13    Tetrahymena thermophila SB210
gb|EAW55418.1|  hCG37003, isoform CRA_a                               77.0    9e-13    Homo sapiens [man]
ref|XP_003071140.1|  MBOAT family protein                             77.8    9e-13    Coccidioides posadasii C735 delta SOWgp
gb|EAS37304.3|  MBOAT family protein                                  77.8    9e-13    Coccidioides immitis RS
ref|XP_002197683.1|  PREDICTED: membrane-bound O-acyltransferase ...  77.4    9e-13    Taeniopygia guttata
ref|XP_008848363.1|  PREDICTED: lysophospholipid acyltransferase 2    77.4    1e-12    Nannospalax galili
dbj|BAC85105.1|  unnamed protein product                              77.4    1e-12    Homo sapiens [man]
ref|XP_004644660.1|  PREDICTED: lysophospholipid acyltransferase 2    77.4    1e-12    Octodon degus
ref|NP_620154.2|  lysophospholipid acyltransferase 2                  77.4    1e-12    Homo sapiens [man]
ref|XP_003263601.1|  PREDICTED: lysophospholipid acyltransferase 1    77.0    1e-12    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_007197214.1|  PREDICTED: lysophospholipid acyltransferase ...  77.0    1e-12    Balaenoptera acutorostrata scammoni
ref|NP_001073949.1|  lysophospholipid acyltransferase 1               77.0    1e-12    Homo sapiens [man]
ref|XP_008178122.1|  PREDICTED: lysophospholipid acyltransferase ...  77.0    1e-12    Chrysemys picta bellii
ref|XP_005521935.1|  PREDICTED: membrane-bound O-acyltransferase ...  77.0    1e-12    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_007197213.1|  PREDICTED: lysophospholipid acyltransferase ...  77.0    1e-12    Balaenoptera acutorostrata scammoni
ref|XP_009235832.1|  PREDICTED: lysophospholipid acyltransferase ...  77.0    1e-12    
ref|XP_002908001.1|  lysophospholipid acyltransferase, putative       76.6    1e-12    Phytophthora infestans T30-4
ref|XP_010564996.1|  PREDICTED: lysophospholipid acyltransferase 2    77.0    1e-12    Haliaeetus leucocephalus
ref|XP_009010990.1|  hypothetical protein HELRODRAFT_167215           77.0    1e-12    Helobdella robusta
ref|XP_007235305.1|  PREDICTED: membrane-bound O-acyltransferase ...  76.6    2e-12    Astyanax mexicanus [blind cave fish]
ref|XP_004613994.1|  PREDICTED: lysophospholipid acyltransferase 1    76.6    2e-12    Sorex araneus [Eurasian shrew]
ref|NP_001026261.1|  membrane-bound O-acyltransferase domain-cont...  76.6    2e-12    Gallus gallus [bantam]
ref|XP_001945360.2|  PREDICTED: lysophospholipid acyltransferase ...  76.6    2e-12    
ref|XP_001959520.1|  GF12916                                          77.0    2e-12    Drosophila ananassae
ref|NP_001088865.1|  lysophosphatidylcholine acyltransferase 3        76.6    2e-12    Xenopus laevis [clawed frog]
gb|EYB99497.1|  hypothetical protein Y032_0122g1082                   75.9    2e-12    Ancylostoma ceylanicum
ref|XP_004043374.1|  PREDICTED: lysophospholipid acyltransferase 1    76.6    2e-12    Gorilla gorilla gorilla [lowland gorilla]
ref|XP_002812355.3|  PREDICTED: lysophospholipid acyltransferase ...  76.6    2e-12    
ref|XP_002941254.1|  PREDICTED: lysophospholipid acyltransferase 5    76.3    2e-12    Xenopus tropicalis [western clawed frog]
gb|KKA70051.1|  hypothetical protein PRIPAC_11524                     76.6    2e-12    
ref|XP_004384055.1|  PREDICTED: lysophospholipid acyltransferase 1    76.6    2e-12    Trichechus manatus latirostris
ref|XP_009440252.1|  PREDICTED: lysophospholipid acyltransferase 2    76.6    2e-12    
ref|XP_003787425.1|  PREDICTED: lysophospholipid acyltransferase 2    76.6    2e-12    Otolemur garnettii
ref|XP_003136165.1|  hypothetical protein LOAG_00577                  75.5    2e-12    
ref|XP_005867334.1|  PREDICTED: lysophospholipid acyltransferase 2    76.3    2e-12    Myotis brandtii
gb|EYB99499.1|  hypothetical protein Y032_0122g1082                   76.3    2e-12    Ancylostoma ceylanicum
gb|EPQ08440.1|  Lysophospholipid acyltransferase 2                    76.6    2e-12    Myotis brandtii
gb|ETP43022.1|  hypothetical protein F442_10106                       76.3    2e-12    Phytophthora parasitica P10297
ref|XP_002063522.1|  GK21363                                          76.6    2e-12    Drosophila willistoni
gb|KEQ75562.1|  MBOAT-domain-containing protein                       76.3    3e-12    Aureobasidium namibiae CBS 147.97
ref|XP_004745813.1|  PREDICTED: lysophospholipid acyltransferase ...  76.3    3e-12    Mustela putorius furo [black ferret]
ref|XP_003788378.1|  PREDICTED: lysophospholipid acyltransferase 1    75.9    3e-12    Otolemur garnettii
ref|XP_007053245.1|  PREDICTED: membrane-bound O-acyltransferase ...  75.9    3e-12    Chelonia mydas [green seaturtle]
ref|XP_003823234.1|  PREDICTED: lysophospholipid acyltransferase 1    75.9    3e-12    
ref|XP_004660118.1|  PREDICTED: LOW QUALITY PROTEIN: lysophosphol...  75.9    3e-12    
ref|XP_011300527.1|  PREDICTED: lysophospholipid acyltransferase 1    75.9    3e-12    
ref|XP_008893287.1|  hypothetical protein PPTG_01659                  75.9    3e-12    
emb|CCD51731.1|  similar to MBOAT family protein                      75.9    3e-12    
ref|XP_007784935.1|  hypothetical protein W97_08878                   75.9    4e-12    
ref|XP_001560657.1|  hypothetical protein BC1G_00685                  75.9    4e-12    
gb|KKA67416.1|  mboa-3                                                75.5    4e-12    
ref|XP_001604606.2|  PREDICTED: lysophospholipid acyltransferase 5    75.5    4e-12    
ref|XP_011332944.1|  PREDICTED: membrane-bound O-acyltransferase ...  75.5    4e-12    
ref|XP_010746884.1|  PREDICTED: membrane-bound O-acyltransferase ...  75.5    4e-12    
ref|XP_004436507.1|  PREDICTED: lysophospholipid acyltransferase ...  75.1    4e-12    
ref|XP_006093811.1|  PREDICTED: lysophospholipid acyltransferase 1    75.5    5e-12    
ref|XP_007476227.1|  PREDICTED: lysophospholipid acyltransferase ...  75.5    5e-12    
ref|XP_005366549.1|  PREDICTED: lysophospholipid acyltransferase ...  75.5    5e-12    
ref|XP_001496894.1|  PREDICTED: lysophospholipid acyltransferase 1    75.1    5e-12    
ref|XP_007430948.1|  PREDICTED: membrane-bound O-acyltransferase ...  75.1    5e-12    
ref|XP_008620340.1|  hypothetical protein SDRG_15932                  75.1    6e-12    
ref|XP_005950509.1|  PREDICTED: lysophospholipid acyltransferase ...  75.1    6e-12    
ref|XP_003117707.1|  hypothetical protein CRE_00233                   75.1    6e-12    
ref|XP_006972346.1|  PREDICTED: lysophospholipid acyltransferase 1    75.1    6e-12    
ref|XP_008300105.1|  PREDICTED: membrane-bound O-acyltransferase ...  75.1    6e-12    
ref|XP_005732861.1|  PREDICTED: lysophospholipid acyltransferase ...  75.1    6e-12    
ref|NP_001096155.1|  membrane bound O-acyltransferase domain cont...  75.1    6e-12    
ref|NP_001087473.1|  lysophosphatidylcholine acyltransferase 3        75.1    6e-12    
ref|XP_005873716.1|  PREDICTED: lysophospholipid acyltransferase 5    75.1    6e-12    
ref|XP_006793511.1|  PREDICTED: lysophospholipid acyltransferase ...  75.1    6e-12    
ref|XP_001907785.1|  hypothetical protein                             75.1    6e-12    
ref|XP_003388610.1|  PREDICTED: membrane-bound O-acyltransferase ...  72.4    6e-12    
gb|KEQ96118.1|  hypothetical protein AUEXF2481DRAFT_107545            75.1    7e-12    
ref|XP_011196586.1|  PREDICTED: lysophospholipid acyltransferase 1    75.1    7e-12    
ref|XP_007446010.1|  PREDICTED: lysophospholipid acyltransferase 1    74.7    7e-12    
ref|XP_004436506.1|  PREDICTED: lysophospholipid acyltransferase ...  74.7    7e-12    
ref|XP_004373135.1|  PREDICTED: lysophospholipid acyltransferase 2    74.7    7e-12    
ref|XP_006123680.1|  PREDICTED: membrane-bound O-acyltransferase ...  74.7    7e-12    
ref|XP_006626243.1|  PREDICTED: lysophospholipid acyltransferase ...  74.7    7e-12    
dbj|GAM40820.1|  membrane bound O-acyltransferase                     74.7    7e-12    
ref|XP_005905579.1|  PREDICTED: lysophospholipid acyltransferase 2    74.7    7e-12    
ref|XP_003424410.1|  PREDICTED: lysophospholipid acyltransferase ...  74.7    7e-12    
ref|XP_006123679.1|  PREDICTED: membrane-bound O-acyltransferase ...  74.7    8e-12    
gb|EJD76171.1|  porcupine                                             74.3    8e-12    
ref|XP_008216640.1|  PREDICTED: lysophospholipid acyltransferase ...  74.7    8e-12    
ref|XP_006271644.1|  PREDICTED: membrane-bound O-acyltransferase ...  74.7    8e-12    
ref|XP_008115909.1|  PREDICTED: lysophospholipid acyltransferase ...  74.7    8e-12    
ref|XP_011863530.1|  PREDICTED: membrane-bound O-acyltransferase ...  74.7    8e-12    
ref|XP_008115914.1|  PREDICTED: lysophospholipid acyltransferase ...  74.7    9e-12    
ref|NP_001101486.2|  membrane-bound O-acyltransferase domain-cont...  74.7    9e-12    
ref|XP_012008298.1|  PREDICTED: lysophospholipid acyltransferase ...  74.3    9e-12    
ref|XP_007901355.1|  PREDICTED: lysophospholipid acyltransferase ...  74.3    9e-12    
ref|XP_004610692.1|  PREDICTED: lysophospholipid acyltransferase 5    74.3    9e-12    
gb|EQB57300.1|  MBOAT family protein                                  74.3    1e-11    
ref|XP_011242607.1|  PREDICTED: lysophospholipid acyltransferase ...  73.2    1e-11    
ref|NP_001265531.1|  membrane bound O-acyltransferase domain cont...  74.3    1e-11    
ref|XP_009448856.1|  PREDICTED: lysophospholipid acyltransferase 1    74.3    1e-11    
gb|AHE80987.1|  acyl-CoA:lysophosphatidylcholine acyltransferase      72.4    1e-11    
ref|XP_008143101.1|  PREDICTED: lysophospholipid acyltransferase 5    74.3    1e-11    
ref|XP_001986306.1|  GH21285                                          74.7    1e-11    
gb|KDO21008.1|  hypothetical protein SPRG_13936                       74.3    1e-11    
ref|XP_005355055.1|  PREDICTED: lysophospholipid acyltransferase 1    73.9    1e-11    
ref|NP_001102590.1|  lysophospholipid acyltransferase 1               73.9    1e-11    
gb|ESA24244.1|  hypothetical protein GLOINDRAFT_100689                74.3    1e-11    
ref|XP_005404403.1|  PREDICTED: lysophospholipid acyltransferase 2    73.9    1e-11    
ref|XP_003304329.1|  hypothetical protein PTT_16886                   74.3    1e-11    
gb|EXX59759.1|  Ale1p                                                 73.9    1e-11    
gb|KDR07796.1|  Lysophospholipid acyltransferase 5                    73.9    1e-11    
ref|XP_002399954.1|  complement c3f, putative                         73.9    1e-11    
ref|XP_010896429.1|  PREDICTED: lysophospholipid acyltransferase 2    73.9    1e-11    
ref|XP_001375972.1|  PREDICTED: lysophospholipid acyltransferase 1    73.9    1e-11    
ref|NP_001026168.1|  membrane bound O-acyltransferase domain cont...  73.2    1e-11    
ref|XP_002758028.3|  PREDICTED: lysophospholipid acyltransferase 2    73.9    1e-11    
emb|CEJ81320.1|  Putative MBOAT family protein                        73.9    1e-11    
ref|XP_007933308.1|  PREDICTED: LOW QUALITY PROTEIN: lysophosphol...  73.9    1e-11    
ref|XP_005082068.1|  PREDICTED: membrane-bound O-acyltransferase ...  73.9    1e-11    
ref|XP_006757611.1|  PREDICTED: lysophospholipid acyltransferase 5    73.6    2e-11    
gb|EEH03012.1|  MBOAT family protein                                  73.9    2e-11    
ref|NP_080313.2|  lysophospholipid acyltransferase 2 isoform a        73.9    2e-11    
ref|XP_006793510.1|  PREDICTED: lysophospholipid acyltransferase ...  73.6    2e-11    
ref|XP_005732862.1|  PREDICTED: lysophospholipid acyltransferase ...  73.6    2e-11    
ref|XP_004521129.1|  PREDICTED: membrane-bound O-acyltransferase ...  73.9    2e-11    
gb|EHH21875.1|  hypothetical protein EGK_05035                        73.6    2e-11    
ref|XP_009842324.1|  hypothetical protein, variant 11                 72.8    2e-11    
ref|XP_009842322.1|  hypothetical protein, variant 9                  73.2    2e-11    
ref|XP_006888722.1|  PREDICTED: lysophospholipid acyltransferase ...  73.6    2e-11    
ref|XP_005950510.1|  PREDICTED: lysophospholipid acyltransferase ...  73.6    2e-11    
ref|XP_003760187.1|  PREDICTED: lysophospholipid acyltransferase 1    73.6    2e-11    
ref|XP_003747942.1|  PREDICTED: membrane-bound O-acyltransferase ...  73.6    2e-11    
ref|XP_010847121.1|  PREDICTED: lysophospholipid acyltransferase ...  73.6    2e-11    
ref|XP_011630272.1|  PREDICTED: membrane-bound O-acyltransferase ...  73.6    2e-11    
ref|XP_010864712.1|  PREDICTED: lysophospholipid acyltransferase 1    73.6    2e-11    
ref|XP_005365245.1|  PREDICTED: lysophospholipid acyltransferase 5    73.6    2e-11    
ref|XP_009842333.1|  hypothetical protein, variant 1                  73.2    2e-11    
ref|XP_011209779.1|  PREDICTED: lysophospholipid acyltransferase 1    73.9    2e-11    
ref|XP_010978414.1|  PREDICTED: lysophospholipid acyltransferase 1    73.6    2e-11    
ref|XP_011747723.1|  PREDICTED: lysophospholipid acyltransferase ...  73.6    2e-11    
gb|EFB27452.1|  hypothetical protein PANDA_012394                     73.6    2e-11    
gb|EDL36985.1|  membrane bound O-acyltransferase domain containin...  73.6    2e-11    
emb|CDQ80448.1|  unnamed protein product                              73.2    2e-11    
dbj|GAM22032.1|  hypothetical protein SAMD00019534_052070             73.2    2e-11    
ref|XP_010620974.1|  PREDICTED: lysophospholipid acyltransferase 2    73.6    2e-11    
ref|XP_005898295.1|  PREDICTED: lysophospholipid acyltransferase 1    73.2    2e-11    
ref|XP_008587713.1|  PREDICTED: lysophospholipid acyltransferase 1    73.2    2e-11    
ref|XP_003045299.1|  hypothetical protein NECHADRAFT_70470            73.6    2e-11    
ref|XP_005452546.1|  PREDICTED: lysophospholipid acyltransferase ...  73.2    2e-11    
ref|XP_008069756.1|  PREDICTED: lysophospholipid acyltransferase ...  73.2    2e-11    
ref|XP_004273580.1|  PREDICTED: lysophospholipid acyltransferase 1    73.2    2e-11    
ref|XP_009842325.1|  hypothetical protein H257_15806                  73.2    2e-11    
ref|XP_003388609.1|  PREDICTED: membrane-bound O-acyltransferase ...  73.2    2e-11    
ref|NP_001179786.1|  lysophospholipid acyltransferase 1               73.2    2e-11    
gb|KGL99857.1|  Membrane-bound O-acyltransferase domain-containin...  73.2    3e-11    
ref|XP_009891566.1|  PREDICTED: lysophospholipid acyltransferase 2    73.2    3e-11    
gb|ELK29149.1|  Lysophospholipid acyltransferase 2                    73.2    3e-11    
gb|ETI45133.1|  hypothetical protein F443_10202                       72.8    3e-11    
ref|XP_006692858.1|  hypothetical protein CTHT_0023960                73.2    3e-11    
ref|XP_004457275.1|  PREDICTED: lysophospholipid acyltransferase 2    73.2    3e-11    
ref|XP_004572906.1|  PREDICTED: lysophospholipid acyltransferase ...  73.2    3e-11    
ref|XP_002621865.1|  MBOAT family protein                             73.2    3e-11    
ref|XP_004745812.1|  PREDICTED: lysophospholipid acyltransferase ...  73.2    3e-11    
ref|XP_006140916.1|  PREDICTED: lysophospholipid acyltransferase 2    73.2    3e-11    
gb|EAX01013.1|  O-acyltransferase (membrane bound) domain contain...  72.8    3e-11    
gb|KEQ63877.1|  MBOAT family protein-like protein                     72.8    3e-11    
ref|XP_006182285.1|  PREDICTED: lysophospholipid acyltransferase 1    72.8    3e-11    
ref|XP_007671493.1|  PREDICTED: LOW QUALITY PROTEIN: lysophosphol...  72.8    3e-11    
ref|XP_006046595.1|  PREDICTED: lysophospholipid acyltransferase 1    72.8    3e-11    
ref|XP_006198743.1|  PREDICTED: lysophospholipid acyltransferase 1    72.8    3e-11    
ref|NP_705774.1|  lysophospholipid acyltransferase 1                  72.8    3e-11    
ref|XP_005630649.1|  PREDICTED: lysophospholipid acyltransferase 2    72.8    3e-11    
ref|XP_011499110.1|  PREDICTED: lysophospholipid acyltransferase 5    72.8    3e-11    
ref|XP_007098291.1|  PREDICTED: lysophospholipid acyltransferase 2    72.4    4e-11    
ref|XP_010352404.1|  PREDICTED: lysophospholipid acyltransferase 1    72.4    4e-11    
ref|XP_002488149.1|  MBOAT family protein, putative                   72.8    4e-11    
ref|XP_006909296.1|  PREDICTED: lysophospholipid acyltransferase 1    72.4    4e-11    
ref|XP_010761659.1|  hypothetical protein PADG_06237                  72.8    4e-11    
ref|XP_007542063.1|  PREDICTED: lysophospholipid acyltransferase ...  72.4    4e-11    
ref|XP_003984562.2|  PREDICTED: lysophospholipid acyltransferase 2    72.4    4e-11    
emb|CDQ79223.1|  unnamed protein product                              72.4    4e-11    
ref|XP_001928378.1|  PREDICTED: lysophospholipid acyltransferase ...  72.4    4e-11    
ref|XP_005808738.1|  PREDICTED: lysophospholipid acyltransferase ...  72.4    4e-11    
ref|XP_006084245.1|  PREDICTED: lysophospholipid acyltransferase 5    72.4    4e-11    
ref|XP_004640210.1|  PREDICTED: lysophospholipid acyltransferase 1    72.4    4e-11    
gb|KJA21611.1|  hypothetical protein HYPSUDRAFT_140361                72.4    4e-11    
gb|EPY83145.1|  lysophospholipid acyltransferase 1                    72.4    4e-11    
ref|XP_008893288.1|  hypothetical protein PPTG_01660                  72.4    5e-11    
gb|EHB15193.1|  Lysophospholipid acyltransferase 2                    72.4    5e-11    
ref|XP_005665670.1|  PREDICTED: lysophospholipid acyltransferase ...  72.4    5e-11    
ref|XP_008601653.1|  MBOAT family protein                             72.4    5e-11    
ref|XP_005963265.1|  PREDICTED: lysophospholipid acyltransferase 2    72.4    5e-11    
ref|XP_009202758.1|  PREDICTED: lysophospholipid acyltransferase ...  72.0    5e-11    
ref|XP_004186086.1|  membrane-bound O-acyltransferase mboat famil...  69.7    5e-11    
ref|XP_011818154.1|  PREDICTED: lysophospholipid acyltransferase 1    72.0    5e-11    
gb|AAH24653.1|  Mboat1 protein                                        72.0    5e-11    
dbj|GAM86818.1|  hypothetical protein ANO11243_048380                 72.4    5e-11    
ref|XP_011427949.1|  PREDICTED: lysophospholipid acyltransferase ...  72.0    5e-11    
ref|XP_011886805.1|  PREDICTED: lysophospholipid acyltransferase ...  72.0    5e-11    
ref|XP_011853552.1|  PREDICTED: lysophospholipid acyltransferase 1    72.0    6e-11    
ref|XP_003036952.1|  hypothetical protein SCHCODRAFT_63856            72.0    6e-11    
ref|XP_005964475.1|  PREDICTED: lysophospholipid acyltransferase 1    72.0    6e-11    
gb|KGQ08072.1|  Lysophospholipid acyltransferase                      72.0    6e-11    
ref|NP_001090470.1|  membrane bound O-acyltransferase domain cont...  72.0    6e-11    
ref|XP_011364104.1|  PREDICTED: lysophospholipid acyltransferase 5    72.0    6e-11    
gb|EHH17983.1|  Lysophospholipid acyltransferase 1                    72.0    6e-11    
ref|XP_005553995.1|  PREDICTED: lysophospholipid acyltransferase 1    72.0    6e-11    
ref|XP_001098322.1|  PREDICTED: lysophospholipid acyltransferase ...  72.0    6e-11    
gb|ELR49221.1|  Lysophospholipid acyltransferase 2                    72.0    6e-11    
gb|EHH52747.1|  Lysophospholipid acyltransferase 1                    72.0    6e-11    
ref|XP_003897158.1|  PREDICTED: lysophospholipid acyltransferase ...  72.0    6e-11    
ref|XP_007971772.1|  PREDICTED: lysophospholipid acyltransferase 1    72.0    6e-11    
emb|CCA18673.1|  lysophospholipid acyltransferase putative            72.0    6e-11    
gb|EER40416.1|  MBOAT family protein                                  72.0    6e-11    
gb|KJJ12453.1|  hypothetical protein U727_00434080251                 72.0    6e-11    
ref|XP_007664636.1|  PREDICTED: lysophospholipid acyltransferase 1    71.6    7e-11    
gb|KDQ14382.1|  hypothetical protein BOTBODRAFT_159594                71.6    7e-11    
ref|XP_003395903.1|  PREDICTED: membrane-bound O-acyltransferase ...  71.6    7e-11    
ref|XP_007912419.1|  putative mboat family protein                    71.6    7e-11    
ref|XP_011698497.1|  PREDICTED: lysophospholipid acyltransferase ...  71.6    7e-11    
ref|XP_007792823.1|  putative mboat family protein                    71.6    8e-11    
ref|XP_002543581.1|  conserved hypothetical protein                   71.6    8e-11    
gb|KEQ80500.1|  MBOAT family protein-like protein                     71.6    8e-11    
emb|CDQ58417.1|  unnamed protein product                              71.6    8e-11    
ref|XP_007100631.1|  PREDICTED: lysophospholipid acyltransferase ...  71.6    8e-11    
ref|XP_004448540.1|  PREDICTED: lysophospholipid acyltransferase ...  71.6    8e-11    
ref|XP_003464977.1|  PREDICTED: membrane-bound O-acyltransferase ...  71.6    8e-11    
ref|XP_007592829.1|  MBOAT family protein                             71.6    8e-11    
gb|EFW22616.1|  MBOAT family protein                                  71.6    8e-11    
ref|XP_001248887.1|  hypothetical protein CIMG_02658                  71.6    9e-11    
ref|XP_008687022.1|  PREDICTED: lysophospholipid acyltransferase 2    71.6    9e-11    
ref|NP_610546.1|  oysgedart, isoform A                                71.6    9e-11    
ref|XP_008845806.1|  PREDICTED: lysophospholipid acyltransferase 1    71.6    9e-11    
ref|XP_001839338.1|  endoplasmic reticulum protein                    71.6    9e-11    
gb|EJK56616.1|  hypothetical protein THAOC_23460                      71.2    9e-11    
ref|XP_008430409.1|  PREDICTED: lysophospholipid acyltransferase 1    71.6    9e-11    
ref|XP_010706777.1|  PREDICTED: lysophospholipid acyltransferase 1    71.2    9e-11    
gb|KIW78152.1|  hypothetical protein Z517_07985                       71.6    9e-11    
ref|XP_008144294.1|  PREDICTED: lysophospholipid acyltransferase 1    71.2    9e-11    
ref|XP_002908002.1|  lysophospholipid acyltransferase, putative       71.2    9e-11    
ref|XP_011332945.1|  PREDICTED: membrane-bound O-acyltransferase ...  71.2    1e-10    
gb|EKC41409.1|  Lysophospholipid acyltransferase 5                    71.2    1e-10    
ref|XP_003094304.1|  hypothetical protein CRE_12270                   71.2    1e-10    
gb|KKA19937.1|  Uncharacterized protein T310_6051                     71.2    1e-10    
gb|KIK42844.1|  hypothetical protein CY34DRAFT_751446                 71.2    1e-10    
ref|XP_005066484.1|  PREDICTED: lysophospholipid acyltransferase 1    71.2    1e-10    
gb|KKA29495.1|  hypothetical protein TD95_001594                      71.2    1e-10    
ref|XP_003146964.1|  hypothetical protein LOAG_11396                  70.1    1e-10    
ref|XP_006914721.1|  PREDICTED: lysophospholipid acyltransferase 5    71.2    1e-10    
gb|EPS26117.1|  hypothetical protein PDE_01053                        71.2    1e-10    
gb|ELK10414.1|  Lysophospholipid acyltransferase 5                    71.2    1e-10    
ref|XP_005687152.1|  PREDICTED: lysophospholipid acyltransferase 2    71.2    1e-10    
ref|XP_001848902.1|  porcupine                                        71.2    1e-10    
ref|XP_007724974.1|  hypothetical protein A1O1_05900                  71.2    1e-10    
ref|XP_011579503.1|  PREDICTED: lysophospholipid acyltransferase 1    70.9    1e-10    
ref|XP_002153291.1|  MBOAT family protein, putative                   71.2    1e-10    
ref|XP_004448542.1|  PREDICTED: lysophospholipid acyltransferase ...  70.9    1e-10    
ref|XP_010621390.1|  PREDICTED: lysophospholipid acyltransferase 1    70.9    1e-10    
ref|XP_008248220.1|  PREDICTED: lysophospholipid acyltransferase 2    70.9    1e-10    
ref|XP_006715062.1|  PREDICTED: lysophospholipid acyltransferase ...  70.9    1e-10    
ref|XP_004582886.1|  PREDICTED: lysophospholipid acyltransferase 2    70.9    1e-10    
ref|XP_006765254.1|  PREDICTED: lysophospholipid acyltransferase 2    71.2    1e-10    
ref|XP_009473773.1|  PREDICTED: lysophospholipid acyltransferase 1    70.9    1e-10    
gb|EGE83597.1|  MBOAT family protein                                  70.9    1e-10    
ref|XP_011280404.1|  PREDICTED: lysophospholipid acyltransferase 1    70.9    1e-10    
ref|XP_004692974.1|  PREDICTED: lysophospholipid acyltransferase 5    70.9    1e-10    
ref|XP_006980998.1|  PREDICTED: lysophospholipid acyltransferase 2    70.9    1e-10    



>ref|XP_011081031.1| PREDICTED: lysophospholipid acyltransferase 1-like [Sesamum indicum]
 ref|XP_011081032.1| PREDICTED: lysophospholipid acyltransferase 1-like [Sesamum indicum]
Length=465

 Score =   416 bits (1070),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 217/240 (90%), Gaps = 1/240 (0%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            E+E MASAIGVSV VLRFLLCF+ATIPVS  HRFVPGG++ RHLYAA TGA+LSYLSFGF
Sbjct  5    EMESMASAIGVSVSVLRFLLCFIATIPVSFFHRFVPGGATARHLYAAATGAILSYLSFGF  64

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHFLVPMLLGYASMLLYR YCGIITFFLAFGYLIGCHVYYMSGDAWKEGGID+TGAL
Sbjct  65   SSNLHFLVPMLLGYASMLLYRKYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  124

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MVITLKIISC +NY DGLLKE DLREAQK+NRLLKLPS+ EY GYCLCCGSHFAGPVYEM
Sbjct  125  MVITLKIISCAINYNDGLLKEEDLREAQKKNRLLKLPSILEYFGYCLCCGSHFAGPVYEM  184

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K YLEWTERKGIW+P  K   +PSP+  T RAL+QAAFCMGLYLYLVP+FPL+RF + +Y
Sbjct  185  KDYLEWTERKGIWQPTEKGL-TPSPYWATFRALVQAAFCMGLYLYLVPHFPLSRFTEPVY  243



>ref|XP_006358391.1| PREDICTED: lysophospholipid acyltransferase 1-like [Solanum tuberosum]
Length=463

 Score =   411 bits (1057),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 217/240 (90%), Gaps = 3/240 (1%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            E+E MA+AIGVSVPVLRFLLCFVATIPVS  HRFVP  S+GRHLYAA+ G +LSYLSFGF
Sbjct  5    EMESMATAIGVSVPVLRFLLCFVATIPVSFFHRFVPT-STGRHLYAAVMGGVLSYLSFGF  63

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHF VPMLLGYASM++YRPYCGIITFF+AFGYLIGCHVYYMSGDAWKEGGID+TGAL
Sbjct  64   SSNLHFFVPMLLGYASMVIYRPYCGIITFFIAFGYLIGCHVYYMSGDAWKEGGIDATGAL  123

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MV+TLKIISC +NYQDGLLKE DLREAQK+NRLLKLPSL EY GYCLCCGSHFAGPVYEM
Sbjct  124  MVVTLKIISCAINYQDGLLKEEDLREAQKKNRLLKLPSLLEYFGYCLCCGSHFAGPVYEM  183

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K YL+WTER GIWK +  E+  PSP   TLR+LLQAAFCMGLYLYLVP++PL+RF+D LY
Sbjct  184  KDYLDWTERNGIWKSS--EKGHPSPLGATLRSLLQAAFCMGLYLYLVPFYPLSRFSDPLY  241



>ref|XP_009609255.1| PREDICTED: lysophospholipid acyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=463

 Score =   410 bits (1053),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 217/240 (90%), Gaps = 3/240 (1%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            E+E MASAIGVSVPVLRFLLCFVATIP+S LHRFVP  + GRHLYAA+TGA+LSYLSFGF
Sbjct  5    EMESMASAIGVSVPVLRFLLCFVATIPMSFLHRFVPS-AVGRHLYAAVTGAVLSYLSFGF  63

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHF  PMLLGYASM+L R +CGIITFF AFGYLIGCHVYYMSGDAWKEGGID+TGAL
Sbjct  64   SSNLHFFGPMLLGYASMVLSRRFCGIITFFAAFGYLIGCHVYYMSGDAWKEGGIDATGAL  123

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MVITLKIISCV+NYQDGLLKE DLREAQK+NRLLKLPSL EY+GYCLCCGSHFAGPVYEM
Sbjct  124  MVITLKIISCVINYQDGLLKEEDLREAQKKNRLLKLPSLLEYVGYCLCCGSHFAGPVYEM  183

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K YL+WTERKGIWKP+  E+ +PSP   TLRALLQAA CMGLYLYLVP FPL+RF D LY
Sbjct  184  KDYLDWTERKGIWKPS--EKGNPSPLGSTLRALLQAAICMGLYLYLVPLFPLSRFTDPLY  241



>ref|XP_004244602.1| PREDICTED: lysophospholipid acyltransferase 1-like [Solanum lycopersicum]
Length=463

 Score =   408 bits (1048),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 216/240 (90%), Gaps = 3/240 (1%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            E+E MA+AIGVSVPVLRFLLCFVATIPVS  HRFVP  S+GRHLYAA+ G +LSYLSFGF
Sbjct  5    EMESMATAIGVSVPVLRFLLCFVATIPVSFFHRFVPS-STGRHLYAAVMGGVLSYLSFGF  63

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHFLVPMLLGYASM++YRPYCGIITFF+AFGYLIGCHVYYMSGDAWKEGGID+TGAL
Sbjct  64   SSNLHFLVPMLLGYASMVIYRPYCGIITFFIAFGYLIGCHVYYMSGDAWKEGGIDATGAL  123

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MV+TLKIIS  +NYQDGLLKE DLREAQK+NRLLKLPSL EY GYCLCCGSHFAGPVYEM
Sbjct  124  MVVTLKIISSAINYQDGLLKEEDLREAQKKNRLLKLPSLLEYFGYCLCCGSHFAGPVYEM  183

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K YL+WTER GIWK +  E+  PSP   TLR+LLQAA CMGLYLYLVP++PL+RF+D LY
Sbjct  184  KDYLDWTERNGIWKSS--EKGHPSPLGATLRSLLQAAICMGLYLYLVPFYPLSRFSDPLY  241



>gb|EYU38990.1| hypothetical protein MIMGU_mgv1a005877mg [Erythranthe guttata]
Length=466

 Score =   407 bits (1045),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 199/241 (83%), Positives = 216/241 (90%), Gaps = 2/241 (1%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            E+E MASAIGVSV VLRFLLCFVATIPV  LHRFVPGG + RHLYAA TGA+LSYLSFGF
Sbjct  5    EMESMASAIGVSVAVLRFLLCFVATIPVGFLHRFVPGGPAARHLYAAATGAILSYLSFGF  64

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHFLVPMLLGYASM+L R +CGIITFFLAFGYLIGCHVYYMSGDAWKEGGID+TGAL
Sbjct  65   SSNLHFLVPMLLGYASMVLCRKHCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  124

Query  437  MVITLKIISCVMNYQDGLLKEND-LREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            MVITLKIISCV+NY DGLLKE + LREAQK+NRLL LPSL EY+GYCLCCGSHFAGPVYE
Sbjct  125  MVITLKIISCVINYNDGLLKEEENLREAQKKNRLLNLPSLLEYVGYCLCCGSHFAGPVYE  184

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YL+WTERKGIW+ + K   SPSP+ PT RAL+QA FCMGLYLYLVPYFPL+RF D +
Sbjct  185  MKDYLQWTERKGIWQRSDKGL-SPSPYWPTFRALIQAGFCMGLYLYLVPYFPLSRFTDPV  243

Query  794  Y  796
            Y
Sbjct  244  Y  244



>gb|EYU29840.1| hypothetical protein MIMGU_mgv1a0059782mg, partial [Erythranthe 
guttata]
Length=328

 Score =   402 bits (1032),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 196/241 (81%), Positives = 213/241 (88%), Gaps = 1/241 (0%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            ME++ MASAIGVSV VLRFLLCF ATIPVS LHR VPGG + RHLYAA TGA LSYLSFG
Sbjct  1    MEMDSMASAIGVSVAVLRFLLCFAATIPVSFLHRLVPGGPAARHLYAAATGAYLSYLSFG  60

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHF+VPMLLGYASM+L R YCGI+TFFL FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  61   FSSNLHFVVPMLLGYASMVLCRKYCGIVTFFLGFGYLIGCHVYYMSGDAWKEGGIDATGA  120

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMVITLKIISCV+NY DGLLKE  LREAQK+NRLLKLPSL EY GY LCCGSHFAGPVYE
Sbjct  121  LMVITLKIISCVINYNDGLLKEEGLREAQKKNRLLKLPSLLEYFGYGLCCGSHFAGPVYE  180

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTERKGIW+P  + R SPSP+  TLRAL+QAA CMGLYLYLVP+FPL+RF + +
Sbjct  181  MKDYLEWTERKGIWQPTKQGR-SPSPYFATLRALIQAAICMGLYLYLVPHFPLSRFTEPV  239

Query  794  Y  796
            Y
Sbjct  240  Y  240



>ref|XP_009764156.1| PREDICTED: lysophospholipid acyltransferase 1-like [Nicotiana 
sylvestris]
Length=463

 Score =   405 bits (1041),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 216/240 (90%), Gaps = 3/240 (1%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            E+E MA+AIGVSVPVLRFLLCF+ATIPVS LHRFVP  ++G+HLYAA+ G +LSYLSFGF
Sbjct  5    EMESMATAIGVSVPVLRFLLCFIATIPVSFLHRFVPS-ATGKHLYAAVMGGVLSYLSFGF  63

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHFLVPM+LGY SM++ R YCGIITFF+AFGYLIGCHVYYMSGDAWKEGGID+TGAL
Sbjct  64   SSNLHFLVPMVLGYGSMVVSRSYCGIITFFIAFGYLIGCHVYYMSGDAWKEGGIDATGAL  123

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MV+TLKIISCV+NYQDGLLKE DLREAQK+NRLLKLPS+ EY GYCLCCGSHFAGPVYEM
Sbjct  124  MVVTLKIISCVINYQDGLLKEEDLREAQKKNRLLKLPSVLEYFGYCLCCGSHFAGPVYEM  183

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K YL+WTERKGIWK    E+  PSPF  TLRALLQAAFCMGLYLYLVP +PL RF+D LY
Sbjct  184  KDYLDWTERKGIWKST--EKGHPSPFGATLRALLQAAFCMGLYLYLVPLYPLTRFSDPLY  241



>ref|XP_009759896.1| PREDICTED: lysophospholipid acyltransferase 1-like [Nicotiana 
sylvestris]
Length=463

 Score =   405 bits (1040),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 214/240 (89%), Gaps = 3/240 (1%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            E+E MASAIGVSVPVLRFLLCFVATIPVS LHRFVP     RHLYAA+TGA+LSYLSFGF
Sbjct  5    EMESMASAIGVSVPVLRFLLCFVATIPVSFLHRFVPSAVC-RHLYAAVTGAVLSYLSFGF  63

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHF  PMLLGY SM++ R YCGIITFF AFGYLIGCHVYYMSGDAWKEGGID+TGAL
Sbjct  64   SSNLHFFGPMLLGYVSMVVSRRYCGIITFFAAFGYLIGCHVYYMSGDAWKEGGIDATGAL  123

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MVITLKIISCV+NYQDGLLKE DLREAQK+N LLKLPSLFEYIGYCLCCGSHFAGPVYEM
Sbjct  124  MVITLKIISCVINYQDGLLKEEDLREAQKKNCLLKLPSLFEYIGYCLCCGSHFAGPVYEM  183

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K YL+WTERKGIWKP+  E+ +PSP   TLRALLQAA CMGLYLYLVP FPL+RF D LY
Sbjct  184  KDYLDWTERKGIWKPS--EKGNPSPLGSTLRALLQAAICMGLYLYLVPLFPLSRFTDPLY  241



>ref|XP_009628905.1| PREDICTED: lysophospholipid acyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=463

 Score =   404 bits (1037),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 215/240 (90%), Gaps = 3/240 (1%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            E+E MA+AIGVSVPVLRFLLCF+ATIPVS LHRFVP  ++G+HLYAA+ G +LSYLSFGF
Sbjct  5    EMESMATAIGVSVPVLRFLLCFIATIPVSFLHRFVPS-ATGKHLYAAVMGGVLSYLSFGF  63

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHF+VPM+LGY SM++ R YCGIITFF+ FGYLIGCHVYYMSGDAWKEGGID+TGAL
Sbjct  64   SSNLHFMVPMVLGYVSMVVSRSYCGIITFFIVFGYLIGCHVYYMSGDAWKEGGIDATGAL  123

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MV+TLKIISCV+NYQDGLLKE DLREAQK+NRLLKLPS+ EY GYCLCCGSHFAGPVYEM
Sbjct  124  MVVTLKIISCVINYQDGLLKEEDLREAQKKNRLLKLPSVLEYFGYCLCCGSHFAGPVYEM  183

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K YL+WTERKGIWK    E+  PSPF  TLRALLQAAFCMGLYLYLVP +PL RF+D LY
Sbjct  184  KDYLDWTERKGIWKST--EKGHPSPFGATLRALLQAAFCMGLYLYLVPLYPLTRFSDPLY  241



>ref|XP_004245650.1| PREDICTED: lysophospholipid acyltransferase 1-like [Solanum lycopersicum]
Length=463

 Score =   403 bits (1036),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 216/240 (90%), Gaps = 3/240 (1%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            ELE MA AIGVSVPVLRFLLCF+ATIPVS LHRFVP  ++GRHLYAA+TGA+LSYLSFGF
Sbjct  5    ELESMAPAIGVSVPVLRFLLCFIATIPVSFLHRFVPS-ATGRHLYAAVTGAVLSYLSFGF  63

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHF  PMLLGYASM+L R YCGIIT+  AFGYLIGCHVYYMSGDAWKEGGID+TGAL
Sbjct  64   SSNLHFFGPMLLGYASMVLCRRYCGIITYVAAFGYLIGCHVYYMSGDAWKEGGIDATGAL  123

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MVITLKIIS V+NYQDGLLKE DLREAQK+NRLL+LPSL EYIG+CLCCGSHFAGPVYEM
Sbjct  124  MVITLKIISSVINYQDGLLKEEDLREAQKKNRLLELPSLLEYIGFCLCCGSHFAGPVYEM  183

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K YLEWTERKGIWKP+  E+  PSPF  TLRALLQAA CMGLYLYLVP FPL+RF +S+Y
Sbjct  184  KDYLEWTERKGIWKPS--EKGKPSPFGSTLRALLQAAICMGLYLYLVPQFPLSRFTESVY  241



>emb|CDP09808.1| unnamed protein product [Coffea canephora]
Length=463

 Score =   403 bits (1035),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 218/240 (91%), Gaps = 3/240 (1%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            E+E MASAIGVSVPVLRFLLCFVATIPVS LHRFVPG  +GRHLYAA+TGA+LSYLSFGF
Sbjct  5    EMESMASAIGVSVPVLRFLLCFVATIPVSFLHRFVPG-VTGRHLYAAVTGAVLSYLSFGF  63

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHFLVPMLLGYASM++ R +CGIITFF+AFGYLIGCHVYYMSGDAWKEGGID+TGAL
Sbjct  64   SSNLHFLVPMLLGYASMVISRKHCGIITFFVAFGYLIGCHVYYMSGDAWKEGGIDATGAL  123

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MVITLKIISCV+NY DG LKE +LREAQK+NRL KLPS  EY GYCLCCGSHFAGPVYEM
Sbjct  124  MVITLKIISCVINYGDGSLKEENLREAQKKNRLEKLPSFLEYFGYCLCCGSHFAGPVYEM  183

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K YLEWTERKGIWK +  E+ SPSP+  T+RA++QAA CMGLYLYLVP++PLARF++ +Y
Sbjct  184  KDYLEWTERKGIWKAS--EKGSPSPYGATIRAIVQAAICMGLYLYLVPHYPLARFSEPIY  241



>ref|XP_006358867.1| PREDICTED: lysophospholipid acyltransferase 1-like [Solanum tuberosum]
Length=463

 Score =   399 bits (1024),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 195/240 (81%), Positives = 214/240 (89%), Gaps = 3/240 (1%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            ELE MA AIGVSVPVLRFLLCF+ATIPVS LHRFVP  ++GRHLYAA+TGA+LSYLSFGF
Sbjct  5    ELESMAPAIGVSVPVLRFLLCFIATIPVSFLHRFVPS-ATGRHLYAAVTGAVLSYLSFGF  63

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHF  PMLLGYASM+L R YCGIIT+  AFGYLIGCHVYYMSGDAWKEGGID+TGAL
Sbjct  64   SSNLHFFGPMLLGYASMVLCRRYCGIITYIAAFGYLIGCHVYYMSGDAWKEGGIDATGAL  123

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MVITLKIIS V+NYQDGLLKE DLRE+QK+NRLL+LPSL EY+G+CLCCGSHFAGPVYEM
Sbjct  124  MVITLKIISSVINYQDGLLKEEDLRESQKKNRLLELPSLLEYVGFCLCCGSHFAGPVYEM  183

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K YLEWTERKGIWKP+  E+  PSPF  TLRAL QAA CMGLYLYLVP+FPL+ F D +Y
Sbjct  184  KDYLEWTERKGIWKPS--EKGKPSPFGSTLRALFQAAICMGLYLYLVPHFPLSWFTDPVY  241



>gb|AER57988.1| putative lysophosphatidylcholine acyltransferase 1 [Helianthus 
annuus]
Length=462

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/241 (76%), Positives = 213/241 (88%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            M++E  A+AIGVSVPVLRFLLCF+ATIP    HRFVPGG++G+HLYAA+TG +LSYLSFG
Sbjct  1    MDMESTAAAIGVSVPVLRFLLCFIATIPTGFFHRFVPGGATGKHLYAAVTGVVLSYLSFG  60

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPML+GY SM++YR  CG+ITF LAFGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  61   FSSNLHFLVPMLVGYVSMVVYRKRCGVITFVLAFGYLIGCHVYYMSGDAWKEGGIDATGA  120

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGLLKE DLR++QK+NRLLKLPSL EY+GYCLCC SHFAGPVYE
Sbjct  121  LMVLTLKVISCAINYNDGLLKEEDLRDSQKKNRLLKLPSLIEYMGYCLCCASHFAGPVYE  180

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YL+WTE KGIW  +  E+ SPSPF  T+RAL+QA FCMGLYLYLVP++PL++F D +
Sbjct  181  MKDYLDWTEGKGIWSKS--EKGSPSPFRATIRALVQAGFCMGLYLYLVPHYPLSKFTDPV  238

Query  794  Y  796
            Y
Sbjct  239  Y  239



>ref|XP_006364125.1| PREDICTED: lysophospholipid acyltransferase 2-like [Solanum tuberosum]
Length=464

 Score =   395 bits (1014),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 194/240 (81%), Positives = 212/240 (88%), Gaps = 3/240 (1%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            E++ MASAIGVS+PV RFLLCFV TIPVS LHRFVP   SGRH YAAL+GA+LSYLSFGF
Sbjct  5    EMDSMASAIGVSIPVFRFLLCFVGTIPVSFLHRFVPC-VSGRHFYAALSGAVLSYLSFGF  63

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHFLVPMLLGYASM+L R YCGIITFFLAFGYLIGCHVYYMSGDAWK+GG+D+TGAL
Sbjct  64   SSNLHFLVPMLLGYASMVLCRHYCGIITFFLAFGYLIGCHVYYMSGDAWKKGGMDATGAL  123

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MVI+LKIIS V+NYQDGLLKE DLREAQK+NRLLKLPSL EY GYCLCCGSHFAGPVYEM
Sbjct  124  MVISLKIISSVINYQDGLLKEEDLREAQKKNRLLKLPSLLEYFGYCLCCGSHFAGPVYEM  183

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K YLEWTER GIWKP+ K +  PSPF  TLRA+LQAA CMGLY+YLVP FP++ F D  Y
Sbjct  184  KDYLEWTERNGIWKPSDKGQ--PSPFGATLRAILQAALCMGLYMYLVPLFPISMFLDPTY  241



>gb|AHE80989.1| acyl-CoA:lysophosphatidylcholine acyltransferase [Carthamus tinctorius]
Length=462

 Score =   393 bits (1010),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 185/241 (77%), Positives = 210/241 (87%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            ME+E MASAIGVSVPVLRFLLCFVATIPVS  HR VPGG + RHLYAA TGALLSY+SFG
Sbjct  1    MEMESMASAIGVSVPVLRFLLCFVATIPVSFFHRLVPGGPAARHLYAAFTGALLSYISFG  60

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHF VPML+ YASM+LYR  CGII+F  A GYLIGCHVYYMSGDAWKEGGID+TG+
Sbjct  61   FSSNLHFFVPMLISYASMVLYRKRCGIISFLSAMGYLIGCHVYYMSGDAWKEGGIDATGS  120

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMVITLK+ISC +NY DGLLKE DLRE+QK+NRL+KLPS  EY+GYC+CCGSHFAGPVYE
Sbjct  121  LMVITLKVISCAINYNDGLLKEEDLRESQKKNRLIKLPSFIEYVGYCMCCGSHFAGPVYE  180

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            +K YL+WTERKGIW  +  E+ SPSP   TL+ALLQA FCMGLYLYLVP+ PL+RF++ +
Sbjct  181  VKDYLDWTERKGIWTKS--EKGSPSPLGATLKALLQAVFCMGLYLYLVPHHPLSRFSEPI  238

Query  794  Y  796
            Y
Sbjct  239  Y  239



>ref|XP_002509709.1| o-acyltransferase (membrane bound) domain containing protein, 
putative [Ricinus communis]
 gb|EEF51096.1| o-acyltransferase (membrane bound) domain containing protein, 
putative [Ricinus communis]
Length=338

 Score =   387 bits (995),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 216/243 (89%), Gaps = 4/243 (2%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            D++LE MASAIGVS+PVLRFLLCFVATIPVS +HR  PG S G+HLYAALTGA LSYLSF
Sbjct  2    DLDLESMASAIGVSIPVLRFLLCFVATIPVSFMHRLAPG-SLGKHLYAALTGAFLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGYASM+L+R +CGI+ F L FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYASMVLFRSHCGILVFLLGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY+DGLLKE +L+ +QK+NRL+KLPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAINYKDGLLKEEELQGSQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKER-PSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFND  787
            EMK YLEWTERKGIW  AG E+ PSPSPF  T+RA+LQAA CM ++LYLVP++PL+RF D
Sbjct  181  EMKDYLEWTERKGIW--AGTEKGPSPSPFGATIRAILQAAICMVIHLYLVPHYPLSRFTD  238

Query  788  SLY  796
             +Y
Sbjct  239  PVY  241



>gb|AHE80985.1| acyl-CoA:lysophosphatidylcholine acyltransferase [Bernardia pulchella]
Length=466

 Score =   391 bits (1005),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 184/242 (76%), Positives = 214/242 (88%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            D+ +E MAS+IGVS+PVLRFLLCFVATIPVS +HR +PG   G+H+YAAL+GA+LSYLSF
Sbjct  2    DLHMESMASSIGVSIPVLRFLLCFVATIPVSFVHRVIPG-RLGKHVYAALSGAVLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGY SM+L+R +CGI+TF L FGYLIGCHV+YMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYGSMVLFRSHCGIMTFALGFGYLIGCHVHYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC MNY DGLLKE DLRE+QK+NRL+KLPSL EY GYCLCC SHFAGPVY
Sbjct  121  ALMVLTLKVISCAMNYNDGLLKEEDLRESQKKNRLIKLPSLIEYFGYCLCCASHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTERKGIW    K  PSPSP+  T+RA++QAA CMG+YLYLVPY+PL+RF DS
Sbjct  181  EMKDYLDWTERKGIWARTEKG-PSPSPYWATVRAVMQAAICMGIYLYLVPYYPLSRFTDS  239

Query  791  LY  796
            +Y
Sbjct  240  VY  241



>ref|XP_011072149.1| PREDICTED: lysophospholipid acyltransferase 1-like [Sesamum indicum]
Length=465

 Score =   390 bits (1002),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/240 (78%), Positives = 208/240 (87%), Gaps = 1/240 (0%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            E+E MAS IGVSVPVLRFL+CF ATIPVS +HRFVPGG++GRHL+AA+TGA LSYLSFGF
Sbjct  5    EMESMASGIGVSVPVLRFLICFAATIPVSFMHRFVPGGTAGRHLFAAVTGAFLSYLSFGF  64

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHF+ PMLLGYASM+  R YCGII F L FGYLIGCHVYYMSGDAWKEGGID+TGAL
Sbjct  65   SSNLHFITPMLLGYASMVFCRKYCGIIAFILGFGYLIGCHVYYMSGDAWKEGGIDATGAL  124

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MVITLKIISCV+NY DGLLKE DL EAQK+ RLLK+PSL EY GYCLCCGSHFAGPVYEM
Sbjct  125  MVITLKIISCVINYNDGLLKEEDLSEAQKKYRLLKIPSLLEYFGYCLCCGSHFAGPVYEM  184

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
              YL WTERKG+W+   K+  SPSP+V TLRALLQAA CMGLYLYL P FPL+RF + +Y
Sbjct  185  NDYLVWTERKGMWQRT-KQGLSPSPYVATLRALLQAAVCMGLYLYLGPRFPLSRFAEPVY  243



>gb|AGO14581.1| lysophosphatidylcholine acyltransferase [Ricinus communis]
 gb|AHF20951.1| lysophosphatidylcholine: acyl-CoA acyltransferase [Ricinus communis]
Length=465

 Score =   390 bits (1002),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 216/243 (89%), Gaps = 4/243 (2%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            D++LE MASAIGVS+PVLRFLLCFVATIPVS +HR  PG S G+HLYAALTGA LSYLSF
Sbjct  2    DLDLESMASAIGVSIPVLRFLLCFVATIPVSFMHRLAPG-SLGKHLYAALTGAFLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGYASM+L+R +CGI+ F L FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYASMVLFRSHCGILVFLLGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY+DGLLKE +L+ +QK+NRL+KLPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAINYKDGLLKEEELQGSQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKER-PSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFND  787
            EMK YLEWTERKGIW  AG E+ PSPSPF  T+RA+LQAA CM ++LYLVP++PL+RF D
Sbjct  181  EMKDYLEWTERKGIW--AGTEKGPSPSPFGATIRAILQAAICMVIHLYLVPHYPLSRFTD  238

Query  788  SLY  796
             +Y
Sbjct  239  PVY  241



>ref|XP_012087002.1| PREDICTED: lysophospholipid acyltransferase 1-like [Jatropha 
curcas]
Length=465

 Score =   389 bits (999),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 186/242 (77%), Positives = 211/242 (87%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            D+  E MA+AIGVS+PVLRFLLCFVATIPVS +HR  PG   G+HLYAA +G +LSYLSF
Sbjct  2    DLNTEAMAAAIGVSIPVLRFLLCFVATIPVSFIHRLAPG-RLGKHLYAAGSGIILSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGYASM+L+R YCGI+TF L FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYASMVLFRAYCGILTFILGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DGLLKE +LREAQK+ RL+KLPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAINYNDGLLKEEELREAQKKYRLIKLPSLIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YLEWTERKGIW  + +  PSPSP+VPT+RALLQAA CM +YLYL P+FPL+RF D 
Sbjct  181  EMKDYLEWTERKGIWARS-EGGPSPSPYVPTIRALLQAAICMAIYLYLTPHFPLSRFTDP  239

Query  791  LY  796
            +Y
Sbjct  240  IY  241



>ref|XP_002282807.1| PREDICTED: lysophospholipid acyltransferase 1 [Vitis vinifera]
Length=463

 Score =   389 bits (998),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 190/242 (79%), Positives = 211/242 (87%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            D ++E MASAIGVSVPVLRFLLCFVATIPVS L RF+PG  + RH+Y+A TGA LSYLSF
Sbjct  2    DFDMESMASAIGVSVPVLRFLLCFVATIPVSFLVRFIPGAFT-RHVYSAFTGASLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGYA+MLL R  CG+ITFFL FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYAAMLLCRRRCGVITFFLGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC MNY DGLLKE+ LREAQK+NRLLKLPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAMNYNDGLLKEDGLREAQKKNRLLKLPSLIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            E+K YLEWTERKGIW  + K  P PSP+  T+RAL+QAAFCMGLY+YLVP+FPL  F D 
Sbjct  181  EIKDYLEWTERKGIWAKSEKG-PPPSPYGATIRALIQAAFCMGLYVYLVPHFPLTIFTDP  239

Query  791  LY  796
            +Y
Sbjct  240  VY  241



>gb|AER57989.2| putative lysophosphatidylcholine acyltransferase 2 [Helianthus 
annuus]
Length=454

 Score =   388 bits (997),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 180/236 (76%), Positives = 210/236 (89%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   MASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSSNL  268
            MASAIGVSVPVLRFLLCFVATIPVS  HR VPGG++ RHLYAA+TGALLSY+SFGFSSNL
Sbjct  1    MASAIGVSVPVLRFLLCFVATIPVSFFHRLVPGGATARHLYAAVTGALLSYISFGFSSNL  60

Query  269  HFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALMVIT  448
            HF VPML+ Y SM++ R +CG+I+F  A GYLIGCHVYYMSGDAWKEGGID+TG+LMVIT
Sbjct  61   HFFVPMLISYGSMVVARKWCGVISFLSAMGYLIGCHVYYMSGDAWKEGGIDATGSLMVIT  120

Query  449  LKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYL  628
            LK+ISC +NY DGLLKE DLRE+QK+NR+LKLPSL EY+GYCLCCGSHFAGPVYE+K YL
Sbjct  121  LKVISCAINYNDGLLKEADLRESQKKNRILKLPSLIEYVGYCLCCGSHFAGPVYEIKDYL  180

Query  629  EWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            +WTERKGIW  +  E+ +PSPF+PTLRA+LQA FCMGLYLYL P +PL+RF++ +Y
Sbjct  181  DWTERKGIWTKS--EKGTPSPFLPTLRAILQAGFCMGLYLYLSPSYPLSRFSEPIY  234



>gb|AGL74879.1| 1-acylglycerophosphocholine O-acyltransferase [Vernicia fordii]
Length=465

 Score =   387 bits (994),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 212/242 (88%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            D+++E MASAIGVS+PVLRFLLCFVATIPVS +HR  PG   G+HLYAA +G +LSYLSF
Sbjct  2    DLDMEAMASAIGVSIPVLRFLLCFVATIPVSFMHRLTPG-RLGKHLYAAGSGVILSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGYASM+L+R YCG +TF L FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYASMVLFRAYCGTLTFVLGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DGLLKE +LREAQK+N+L+KLPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAINYNDGLLKEEELREAQKRNQLIKLPSLLEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YLEWTERKGIW  + +  PSPSP+   +RA+LQAAFCM +Y+YLVP+FPL+RF D 
Sbjct  181  EMKDYLEWTERKGIWARS-EGGPSPSPYGAAIRAILQAAFCMAMYVYLVPHFPLSRFTDP  239

Query  791  LY  796
            +Y
Sbjct  240  VY  241



>ref|XP_004252578.1| PREDICTED: lysophospholipid acyltransferase 1-like [Solanum lycopersicum]
Length=459

 Score =   387 bits (993),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/239 (80%), Positives = 208/239 (87%), Gaps = 3/239 (1%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFS  259
            +E MASAIGVS+PV RFLLCFV TIPVS LHRFVP   SGRH YAAL+GA+LSYLSFGFS
Sbjct  1    MESMASAIGVSIPVFRFLLCFVGTIPVSFLHRFVPC-VSGRHFYAALSGAVLSYLSFGFS  59

Query  260  SNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALM  439
            SNLHFLVPMLLGYASM+L R YCGIITFFLAFGYLIGCHVYYMSGDAWK+GG+D+TGALM
Sbjct  60   SNLHFLVPMLLGYASMVLCRHYCGIITFFLAFGYLIGCHVYYMSGDAWKKGGMDATGALM  119

Query  440  VITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMK  619
            VI+LKIIS V+NYQDGLLK  DL EAQK+NRLLKLPSL EY GYCLCCGSHFAGPVYEMK
Sbjct  120  VISLKIISSVINYQDGLLKVEDLSEAQKKNRLLKLPSLLEYFGYCLCCGSHFAGPVYEMK  179

Query  620  AYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
             YLEWTER GIWKP+ K +  PSPF   LRA LQAA CMGLY+YLVP FP++ F D +Y
Sbjct  180  DYLEWTERNGIWKPSDKGQ--PSPFGAALRAFLQAALCMGLYMYLVPLFPISMFLDPMY  236



>gb|AHE80988.1| acyl-CoA:lysophosphatidylcholine acyltransferase [Hiptage benghalensis]
Length=462

 Score =   387 bits (994),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/242 (77%), Positives = 209/242 (86%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            +++++ MAS+IGVSVPVLRFLLCFVATIPVS LHRFVP  S G+H YA   GA LSYLSF
Sbjct  2    ELDMDAMASSIGVSVPVLRFLLCFVATIPVSYLHRFVPS-SLGKHAYAFGVGAYLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            G SSN HFLVPML GYASMLL+R +CGIITF L FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GMSSNAHFLVPMLSGYASMLLFRRHCGIITFLLGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DGLLKE DLRE QK+NRL+K+PSL EY GYCLCCGSHFAGPV+
Sbjct  121  ALMVLTLKVISCAINYNDGLLKEEDLRETQKKNRLIKMPSLLEYFGYCLCCGSHFAGPVF  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YLEWTERKGIW P  K  PSPSP+  T RA+LQAA CMG+YLYLVP+FPL+RFND 
Sbjct  181  EMKDYLEWTERKGIWAPTEKG-PSPSPYGATARAILQAAICMGIYLYLVPHFPLSRFNDP  239

Query  791  LY  796
            +Y
Sbjct  240  IY  241



>gb|AHE80986.1| acyl-CoA:lysophosphatidylcholine acyltransferase [Hiptage benghalensis]
Length=462

 Score =   386 bits (992),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 186/242 (77%), Positives = 208/242 (86%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            +++L+ MAS+IGVSVPVLRFLLCFVATIPV   HRFVP  S G+H+YA   GA LSYLSF
Sbjct  2    ELDLDAMASSIGVSVPVLRFLLCFVATIPVGYFHRFVPS-SFGKHVYAFGAGAYLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            G SSN HFLVPMLLGYASMLL+R +CGIITFFL FGYLIGCHVYYMSGDAWKEGGIDSTG
Sbjct  61   GMSSNAHFLVPMLLGYASMLLFRRHCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDSTG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DGLLKE DLRE QK+NRL+K+PSL EY GYCLCCG HFAGPV+
Sbjct  121  ALMVLTLKVISCAINYNDGLLKEEDLRETQKKNRLIKMPSLIEYFGYCLCCGCHFAGPVF  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YLEWTERKGIW P  K  PSPSP+  T RA+LQAA CM +YLYLVPY+PL+RFND 
Sbjct  181  EMKDYLEWTERKGIWAPTNKG-PSPSPYGATARAILQAAVCMAIYLYLVPYYPLSRFNDP  239

Query  791  LY  796
            +Y
Sbjct  240  IY  241



>ref|XP_002304469.2| membrane bound O-acyl transferase family protein [Populus trichocarpa]
 gb|EEE79448.2| membrane bound O-acyl transferase family protein [Populus trichocarpa]
Length=465

 Score =   384 bits (987),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 184/240 (77%), Positives = 205/240 (85%), Gaps = 2/240 (1%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            E+E MA+AIGVSVPVLRFLLCFV TIPVS +HRFVP  S G+HLYAA++GA LSYLSFGF
Sbjct  4    EMESMAAAIGVSVPVLRFLLCFVVTIPVSFIHRFVPS-SFGKHLYAAISGAFLSYLSFGF  62

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHFLVPMLLGY SM+L+RPYCGI+TF   FGYLIGCHVYYMSGDAWKEGGID+TGAL
Sbjct  63   SSNLHFLVPMLLGYLSMVLFRPYCGILTFLFGFGYLIGCHVYYMSGDAWKEGGIDATGAL  122

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MV+TLK+ISC MNY DGLLKE +LRE QK+NRL+KLPS  EY+GYCLCCGSHFAGPVYEM
Sbjct  123  MVLTLKVISCAMNYNDGLLKEEELREVQKKNRLIKLPSFIEYVGYCLCCGSHFAGPVYEM  182

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K YLEWTERKGIW P+ K  PSPSPF  T+RAL QAA CM LYLYL+P + +   N   Y
Sbjct  183  KDYLEWTERKGIWAPSEKA-PSPSPFGATIRALFQAAVCMALYLYLIPQYNIPGLNGPAY  241



>gb|AHE80984.1| acyl-CoA:lysophosphatidylcholine acyltransferase [Bernardia pulchella]
Length=459

 Score =   384 bits (986),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 182/241 (76%), Positives = 210/241 (87%), Gaps = 7/241 (3%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E++ MASAIGVSVPVLRFLLCFVATIPVSC+HR VPG   G+H YAAL+G LLSYLSFG
Sbjct  3    LEMDSMASAIGVSVPVLRFLLCFVATIPVSCMHRVVPG-RLGKHAYAALSGVLLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPMLLGYASM+L+R +CGI+ F L FGYLIGCH YYMSGDAWKEGGID+TGA
Sbjct  62   FSSNLHFLVPMLLGYASMVLFRSHCGILAFILGFGYLIGCHAYYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGLLKE +LRE+QK+NRL+KLPSL EYIGYCLCCGSHFAGPVYE
Sbjct  122  LMVLTLKVISCAINYNDGLLKEEELRESQKKNRLIKLPSLIEYIGYCLCCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            +K YLEWTE+KGIW        +PSP+  T+RA+LQA  CM +YLYLVP++PL+RFND L
Sbjct  182  VKDYLEWTEKKGIWT------HTPSPYGATVRAILQAGICMAIYLYLVPHYPLSRFNDPL  235

Query  794  Y  796
            Y
Sbjct  236  Y  236



>ref|XP_010112575.1| hypothetical protein L484_010580 [Morus notabilis]
 gb|EXC34122.1| hypothetical protein L484_010580 [Morus notabilis]
Length=464

 Score =   384 bits (986),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 186/242 (77%), Positives = 210/242 (87%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++++E MAS+IG+SV V RFLLCFVATIPVS L RF+PG    +HLYAAL+GA+LSYLSF
Sbjct  2    ELDMESMASSIGLSVAVFRFLLCFVATIPVSFLWRFIPG-QHAKHLYAALSGAILSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGYASM+LYR  CGIITFFL FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYASMVLYRRRCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DGLLKE DLREAQK+NRL+KLPSL EY GYCLC GSHFAGPVY
Sbjct  121  ALMVLTLKVISCAINYNDGLLKEEDLREAQKKNRLVKLPSLIEYFGYCLCSGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            E K YL+WTE KGIW  + K   SPSP+  T+RALLQAA CMGLYLYLVP+FPL+RF D 
Sbjct  181  ETKDYLDWTEGKGIWNKSEKGL-SPSPYGATIRALLQAAVCMGLYLYLVPHFPLSRFTDE  239

Query  791  LY  796
            +Y
Sbjct  240  IY  241



>gb|KDP25507.1| hypothetical protein JCGZ_20663 [Jatropha curcas]
Length=458

 Score =   383 bits (984),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 184/236 (78%), Positives = 208/236 (88%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   MASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSSNL  268
            MA+AIGVS+PVLRFLLCFVATIPVS +HR  PG   G+HLYAA +G +LSYLSFGFSSNL
Sbjct  1    MAAAIGVSIPVLRFLLCFVATIPVSFIHRLAPG-RLGKHLYAAGSGIILSYLSFGFSSNL  59

Query  269  HFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALMVIT  448
            HFLVPMLLGYASM+L+R YCGI+TF L FGYLIGCHVYYMSGDAWKEGGID+TGALMV+T
Sbjct  60   HFLVPMLLGYASMVLFRAYCGILTFILGFGYLIGCHVYYMSGDAWKEGGIDATGALMVLT  119

Query  449  LKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYL  628
            LK+ISC +NY DGLLKE +LREAQK+ RL+KLPSL EY GYCLCCGSHFAGPVYEMK YL
Sbjct  120  LKVISCAINYNDGLLKEEELREAQKKYRLIKLPSLIEYFGYCLCCGSHFAGPVYEMKDYL  179

Query  629  EWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            EWTERKGIW  + +  PSPSP+VPT+RALLQAA CM +YLYL P+FPL+RF D +Y
Sbjct  180  EWTERKGIWARS-EGGPSPSPYVPTIRALLQAAICMAIYLYLTPHFPLSRFTDPIY  234



>emb|CBI34747.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   382 bits (982),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 207/236 (88%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   MASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSSNL  268
            MASAIGVSVPVLRFLLCFVATIPVS L RF+PG  + RH+Y+A TGA LSYLSFGFSSNL
Sbjct  1    MASAIGVSVPVLRFLLCFVATIPVSFLVRFIPGAFT-RHVYSAFTGASLSYLSFGFSSNL  59

Query  269  HFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALMVIT  448
            HFLVPMLLGYA+MLL R  CG+ITFFL FGYLIGCHVYYMSGDAWKEGGID+TGALMV+T
Sbjct  60   HFLVPMLLGYAAMLLCRRRCGVITFFLGFGYLIGCHVYYMSGDAWKEGGIDATGALMVLT  119

Query  449  LKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYL  628
            LK+ISC MNY DGLLKE+ LREAQK+NRLLKLPSL EY GYCLCCGSHFAGPVYE+K YL
Sbjct  120  LKVISCAMNYNDGLLKEDGLREAQKKNRLLKLPSLIEYFGYCLCCGSHFAGPVYEIKDYL  179

Query  629  EWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            EWTERKGIW  + K  P PSP+  T+RAL+QAAFCMGLY+YLVP+FPL  F D +Y
Sbjct  180  EWTERKGIWAKSEKG-PPPSPYGATIRALIQAAFCMGLYVYLVPHFPLTIFTDPVY  234



>ref|XP_008448977.1| PREDICTED: lysophospholipid acyltransferase 1 [Cucumis melo]
Length=464

 Score =   381 bits (979),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 186/241 (77%), Positives = 211/241 (88%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E +A++IGVSVPVLRFLLCFVATIPVS L R VPG    +HLY+AL+G LLSYLSFG
Sbjct  3    LEMESLAASIGVSVPVLRFLLCFVATIPVSFLWRIVPG-RLPKHLYSALSGVLLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM LGYASM+L+R +CG+ITFFL FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  62   FSSNLHFLVPMFLGYASMVLFRRHCGLITFFLGFGYLIGCHVYYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGLLKE  L EAQK+NRL+KLPSL EYIGYCLCCGSHFAGPVYE
Sbjct  122  LMVLTLKVISCAINYNDGLLKEEGLTEAQKKNRLIKLPSLIEYIGYCLCCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWT+ KGIWK   ++ P PSP+  T+RALLQAAFCMGLYLYLVP FPL+RF D +
Sbjct  182  MKDYLEWTDGKGIWK-HDEQNPPPSPYWATIRALLQAAFCMGLYLYLVPQFPLSRFIDPV  240

Query  794  Y  796
            Y
Sbjct  241  Y  241



>ref|XP_010933881.1| PREDICTED: lysophospholipid acyltransferase 1-like [Elaeis guineensis]
Length=465

 Score =   381 bits (979),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 212/242 (88%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++E+  MASAIGVS+PVLRFLLCFVATIPVS L RFVPG +  +HLYA L+GA LSYLSF
Sbjct  2    ELEMASMASAIGVSIPVLRFLLCFVATIPVSFLWRFVPG-TLAKHLYAGLSGAALSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFL+PM  GYASMLL R YCGI+TFF+ FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLIPMAAGYASMLLCRRYCGILTFFVGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DGLL+E  LREAQK+NRL+  PS+ EY GYCLCCGSHFAGP+Y
Sbjct  121  ALMVLTLKVISCAINYNDGLLREEGLREAQKKNRLIHCPSVIEYFGYCLCCGSHFAGPIY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WT +KGIW  + ++RPSPSP+V TLRAL+QAA CMG+YLYLVP++PL+RFN+ 
Sbjct  181  EMKDYLDWTAKKGIWARS-EDRPSPSPYVATLRALIQAAICMGIYLYLVPHYPLSRFNEP  239

Query  791  LY  796
            +Y
Sbjct  240  IY  241



>ref|XP_004148282.1| PREDICTED: lysophospholipid acyltransferase 1 [Cucumis sativus]
 gb|KGN55973.1| hypothetical protein Csa_3G043890 [Cucumis sativus]
Length=464

 Score =   381 bits (978),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 186/241 (77%), Positives = 211/241 (88%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E +A++IGVSVPVLRFLLCFVATIPVS L R VPG    +HLY+AL+G LLSYLSFG
Sbjct  3    LEMESLAASIGVSVPVLRFLLCFVATIPVSFLWRIVPG-RLPKHLYSALSGVLLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM LGYASM+L+R +CG+ITFFL FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  62   FSSNLHFLVPMFLGYASMVLFRRHCGLITFFLGFGYLIGCHVYYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGLLKE  L EAQK+NRL+KLPSL EYIGYCLCCGSHFAGPVYE
Sbjct  122  LMVLTLKVISCAINYNDGLLKEEGLTEAQKKNRLIKLPSLIEYIGYCLCCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWT+ KGIWK   ++ P PSP+  T+RALLQAAFCMGLYLYLVP FPL+RF D +
Sbjct  182  MKDYLEWTDGKGIWK-HDEQNPPPSPYWATIRALLQAAFCMGLYLYLVPQFPLSRFIDPV  240

Query  794  Y  796
            Y
Sbjct  241  Y  241



>ref|XP_010278548.1| PREDICTED: lysophospholipid acyltransferase 1 [Nelumbo nucifera]
Length=464

 Score =   380 bits (977),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 184/242 (76%), Positives = 209/242 (86%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++E+E MAS+IGVSVPVLRFLLCF ATIPVS + R VPG +  +H+Y+A +GALLSYLSF
Sbjct  2    EIEMESMASSIGVSVPVLRFLLCFAATIPVSFIWRLVPG-TLLKHIYSAASGALLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPML+GY SML+YR  CGIITFF  FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMLMGYISMLVYRRRCGIITFFTGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DGLLKE  LREAQK+NRLL+LPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAINYNDGLLKEEGLREAQKKNRLLRLPSLIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YLEWTE KGIW  + K  PSPSP+  T++ALLQAA CM LYLYLVP+FPL+RF D 
Sbjct  181  EMKDYLEWTENKGIWSQSAKG-PSPSPYGATIKALLQAAICMALYLYLVPHFPLSRFTDP  239

Query  791  LY  796
            +Y
Sbjct  240  IY  241



>ref|XP_011033798.1| PREDICTED: lysophospholipid acyltransferase 1-like [Populus euphratica]
Length=465

 Score =   380 bits (975),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/240 (76%), Positives = 204/240 (85%), Gaps = 2/240 (1%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            E+E MA+AIGVSVPVLRFLLCFV TIPVS +HRFVP  S G+HLYAA++GA LSYLSFGF
Sbjct  4    EMESMAAAIGVSVPVLRFLLCFVVTIPVSFIHRFVPS-SFGKHLYAAISGAFLSYLSFGF  62

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHFLVPMLLGY SM+L+RPYCGI+TF   FGYLIGCHVYYMSGDAWKEGGID+TGAL
Sbjct  63   SSNLHFLVPMLLGYLSMVLFRPYCGILTFLFGFGYLIGCHVYYMSGDAWKEGGIDATGAL  122

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MV+TLK+ISC MNY DGLLKE +LRE QK+NRL++LPS  EY+GYCLCCGSHFAGPVYEM
Sbjct  123  MVLTLKVISCAMNYNDGLLKEEELREVQKKNRLIQLPSFIEYVGYCLCCGSHFAGPVYEM  182

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K YLEWTERK IW P+ K  PSPSPF  T+RAL QAA CM LYLYL+P + +   N   Y
Sbjct  183  KDYLEWTERKEIWAPSEKG-PSPSPFGATIRALFQAAVCMALYLYLIPQYNIPGLNGPAY  241



>gb|KJB68443.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=333

 Score =   375 bits (962),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 208/242 (86%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++++  MA++IGVSVPV+RFLLCFV TIPVS L R VPG    +HLY+A TGALLSYLSF
Sbjct  2    ELDMVTMAASIGVSVPVIRFLLCFVTTIPVSFLWRLVPG-PLAKHLYSAFTGALLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGYA+M+LYRP CGIITFFL FG+LIGCHVYYMSGDAWK+GGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYAAMVLYRPKCGIITFFLGFGFLIGCHVYYMSGDAWKQGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC MNY DGLLKE DLREAQK+NRL+KLPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAMNYNDGLLKEEDLREAQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE KGIW  + K  PSPSP+V TLRAL+QAAFCM ++LYL P  PL+ F D 
Sbjct  181  EMKDYLDWTEGKGIWAHSDKG-PSPSPYVATLRALVQAAFCMAMFLYLSPSHPLSWFIDP  239

Query  791  LY  796
             Y
Sbjct  240  AY  241



>gb|AGL81301.1| lysophosphatidylcholine acyltransferase [Momordica charantia]
Length=465

 Score =   379 bits (973),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 185/241 (77%), Positives = 208/241 (86%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+EP+A++IG+SVPVLRFLLCFVATIPVS L R VPG    +HLY+AL+G LLSYLSFG
Sbjct  3    LEMEPLAASIGISVPVLRFLLCFVATIPVSFLWRLVPG-RLPKHLYSALSGVLLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM LGYASMLL+  +CG ITFFL FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  62   FSSNLHFLVPMSLGYASMLLFHRHCGFITFFLGFGYLIGCHVYYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGLLKE  L EAQK+NRL+KLPS  EYIGYCLCCGSHFAGPVYE
Sbjct  122  LMVLTLKVISCAINYNDGLLKEEGLSEAQKKNRLIKLPSSIEYIGYCLCCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTE  GIWK   ++ PSPSP+  T+RAL QAAFCMGLYLYLVP FPL+RF D +
Sbjct  182  MKDYLEWTEGNGIWK-HDEQNPSPSPYFATIRALFQAAFCMGLYLYLVPQFPLSRFIDPV  240

Query  794  Y  796
            Y
Sbjct  241  Y  241



>gb|KJB68445.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=433

 Score =   377 bits (969),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 208/242 (86%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++++  MA++IGVSVPV+RFLLCFV TIPVS L R VPG    +HLY+A TGALLSYLSF
Sbjct  2    ELDMVTMAASIGVSVPVIRFLLCFVTTIPVSFLWRLVPG-PLAKHLYSAFTGALLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGYA+M+LYRP CGIITFFL FG+LIGCHVYYMSGDAWK+GGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYAAMVLYRPKCGIITFFLGFGFLIGCHVYYMSGDAWKQGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC MNY DGLLKE DLREAQK+NRL+KLPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAMNYNDGLLKEEDLREAQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE KGIW  + K  PSPSP+V TLRAL+QAAFCM ++LYL P  PL+ F D 
Sbjct  181  EMKDYLDWTEGKGIWAHSDKG-PSPSPYVATLRALVQAAFCMAMFLYLSPSHPLSWFIDP  239

Query  791  LY  796
             Y
Sbjct  240  AY  241



>ref|XP_006440537.1| hypothetical protein CICLE_v10020062mg [Citrus clementina]
 gb|ESR53777.1| hypothetical protein CICLE_v10020062mg [Citrus clementina]
Length=359

 Score =   374 bits (961),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 181/241 (75%), Positives = 203/241 (84%), Gaps = 6/241 (2%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA +IGVSV VLRFLLC+VATIPVS L RFVP   +G+H+YAA +GALLSYLSFG
Sbjct  4    LEMESMAGSIGVSVAVLRFLLCYVATIPVSFLWRFVPS-RTGKHVYAAASGALLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPMLLGY SM +YR  CGIITFFL FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  63   FSSNLHFLVPMLLGYLSMAIYRAKCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDATGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGL+ E +LREAQK+NRL +LPSL EYIGYCLCCGSHFAGPVYE
Sbjct  123  LMVLTLKVISCAINYNDGLVTEENLREAQKKNRLTRLPSLIEYIGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTERKGIW       P PSP+  TLRA+LQA  CM LYLYLVP +PL RF + +
Sbjct  183  MKDYLEWTERKGIW-----SEPWPSPYAATLRAILQAGVCMALYLYLVPQYPLTRFTEPI  237

Query  794  Y  796
            Y
Sbjct  238  Y  238



>gb|KJB68442.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
 gb|KJB68446.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=464

 Score =   378 bits (970),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 208/242 (86%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++++  MA++IGVSVPV+RFLLCFV TIPVS L R VPG    +HLY+A TGALLSYLSF
Sbjct  2    ELDMVTMAASIGVSVPVIRFLLCFVTTIPVSFLWRLVPG-PLAKHLYSAFTGALLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGYA+M+LYRP CGIITFFL FG+LIGCHVYYMSGDAWK+GGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYAAMVLYRPKCGIITFFLGFGFLIGCHVYYMSGDAWKQGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC MNY DGLLKE DLREAQK+NRL+KLPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAMNYNDGLLKEEDLREAQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE KGIW  + K  PSPSP+V TLRAL+QAAFCM ++LYL P  PL+ F D 
Sbjct  181  EMKDYLDWTEGKGIWAHSDKG-PSPSPYVATLRALVQAAFCMAMFLYLSPSHPLSWFIDP  239

Query  791  LY  796
             Y
Sbjct  240  AY  241



>gb|KDO63566.1| hypothetical protein CISIN_1g012501mg [Citrus sinensis]
Length=387

 Score =   374 bits (961),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/241 (75%), Positives = 203/241 (84%), Gaps = 6/241 (2%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA +IGVSV VLRFLLC+VATIPVS L RFVP   +G+H+YAA +GALLSYLSFG
Sbjct  4    LEMESMAGSIGVSVAVLRFLLCYVATIPVSFLWRFVPS-RTGKHVYAAASGALLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPMLLGY SM +YR  CGIITFFL FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  63   FSSNLHFLVPMLLGYLSMAIYRAKCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDATGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGL+ E +LREAQK+NRL +LPSL EYIGYCLCCGSHFAGPVYE
Sbjct  123  LMVLTLKVISCAINYNDGLVTEENLREAQKKNRLTRLPSLIEYIGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTERKGIW       P PSP+  TLRA+LQA  CM LYLYLVP +PL RF + +
Sbjct  183  MKDYLEWTERKGIW-----SEPWPSPYAATLRAILQAGVCMALYLYLVPQYPLTRFTEPI  237

Query  794  Y  796
            Y
Sbjct  238  Y  238



>gb|KHG22777.1| Lysophospholipid acyltransferase 2 [Gossypium arboreum]
Length=276

 Score =   370 bits (951),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 206/242 (85%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++++  MA++IGVSVPV+RFLLCFV TIPVS L R VPG    +HLY+A TGALLSYLSF
Sbjct  2    ELDMVTMAASIGVSVPVIRFLLCFVTTIPVSFLWRLVPG-PLAKHLYSAFTGALLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGYA+M+LYRP CG+ITFFL FG+LIGCHVYYMSGDAWK+GGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYAAMVLYRPKCGVITFFLGFGFLIGCHVYYMSGDAWKQGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC MNY DGLLKE DLREAQK+NRL+KLPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAMNYNDGLLKEEDLREAQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE  GIW  + K  PSPSP+V TLRAL+QAA CM ++LYL P  PL+ F D 
Sbjct  181  EMKDYLDWTEGNGIWAHSDKG-PSPSPYVATLRALVQAAICMAMFLYLSPSHPLSWFTDP  239

Query  791  LY  796
             Y
Sbjct  240  AY  241



>gb|KDO63565.1| hypothetical protein CISIN_1g012501mg [Citrus sinensis]
Length=420

 Score =   375 bits (964),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/241 (75%), Positives = 203/241 (84%), Gaps = 6/241 (2%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA +IGVSV VLRFLLC+VATIPVS L RFVP   +G+H+YAA +GALLSYLSFG
Sbjct  4    LEMESMAGSIGVSVAVLRFLLCYVATIPVSFLWRFVPS-RTGKHVYAAASGALLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPMLLGY SM +YR  CGIITFFL FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  63   FSSNLHFLVPMLLGYLSMAIYRAKCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDATGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGL+ E +LREAQK+NRL +LPSL EYIGYCLCCGSHFAGPVYE
Sbjct  123  LMVLTLKVISCAINYNDGLVTEENLREAQKKNRLTRLPSLIEYIGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTERKGIW       P PSP+  TLRA+LQA  CM LYLYLVP +PL RF + +
Sbjct  183  MKDYLEWTERKGIW-----SEPWPSPYAATLRAILQAGVCMALYLYLVPQYPLTRFTEPI  237

Query  794  Y  796
            Y
Sbjct  238  Y  238



>ref|XP_008803275.1| PREDICTED: lysophospholipid acyltransferase 1-like [Phoenix dactylifera]
Length=466

 Score =   377 bits (968),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/242 (74%), Positives = 207/242 (86%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++E+  MA+AIGVS+PVLRFLLCFVATIP S L R VPG +  +HLYA L+GA LSYLSF
Sbjct  2    ELEMASMAAAIGVSIPVLRFLLCFVATIPASFLWRLVPG-TLAKHLYAGLSGAALSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFL+PM  GYASMLL R YCGI TFF  FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLIPMAAGYASMLLCRRYCGIFTFFAGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DGLL+E  LREAQK+NR+L  PS+ EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAINYSDGLLREEGLREAQKKNRILHCPSIIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTERKG+W  + K+RPSPSP+V TLRAL+QAA CM +YLYLVP +PL+RFN+ 
Sbjct  181  EMKDYLDWTERKGMWARS-KDRPSPSPYVATLRALIQAAICMAIYLYLVPQYPLSRFNEP  239

Query  791  LY  796
            +Y
Sbjct  240  IY  241



>gb|KCW72088.1| hypothetical protein EUGRSUZ_E00532 [Eucalyptus grandis]
Length=388

 Score =   374 bits (961),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 207/242 (86%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++E+E MASAIGVSV V RFLLC++ATIPVS L RFVPG    +H YAA +GALLSYLSF
Sbjct  2    ELEMESMASAIGVSVAVFRFLLCYLATIPVSFLWRFVPG-RLAKHAYAAGSGALLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGY SM+  R  CGI+TFFL FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYLSMVACRSKCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DGLLKE DLR++QK+NRL+KLPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAINYNDGLLKEEDLRDSQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YLEWTE KGIW  + K  P PSPF  T+RA+LQAAFCMGLYLYLVP +PL++F D 
Sbjct  181  EMKDYLEWTEGKGIWSRSDKG-PKPSPFGATVRAILQAAFCMGLYLYLVPQYPLSQFTDP  239

Query  791  LY  796
            +Y
Sbjct  240  VY  241



>ref|XP_011029182.1| PREDICTED: lysophospholipid acyltransferase 1-like [Populus euphratica]
Length=465

 Score =   377 bits (968),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/241 (75%), Positives = 205/241 (85%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MASAIGVSVPVLRFLLCFVATIPVS  HRFVP    G+HLYAAL+GA LSYLSFG
Sbjct  3    LEMESMASAIGVSVPVLRFLLCFVATIPVSFTHRFVPS-PFGKHLYAALSGAFLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM+LGY SM+L+RPYCGI+TF L FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  62   FSSNLHFLVPMVLGYLSMVLFRPYCGILTFLLGFGYLIGCHVYYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC M+Y DGLLKE +LREAQK+NRL++LPS  EY+GYCLCCGSHFAGPV+E
Sbjct  122  LMVLTLKVISCAMSYNDGLLKEEELREAQKKNRLIELPSFTEYVGYCLCCGSHFAGPVFE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK Y EWTERKGIW P  K  P+PSPF  T++ALLQA  CM LYLYL+P + +   N   
Sbjct  182  MKDYFEWTERKGIWAPTEKG-PAPSPFGATIQALLQATVCMALYLYLIPQYNIPGLNGPA  240

Query  794  Y  796
            Y
Sbjct  241  Y  241



>ref|XP_002298063.2| membrane bound O-acyl transferase family protein [Populus trichocarpa]
 gb|EEE82868.2| membrane bound O-acyl transferase family protein [Populus trichocarpa]
Length=465

 Score =   377 bits (968),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/241 (75%), Positives = 206/241 (85%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA AIGVSVPVLRFLLCFVATIPVS  HRFVP    G+HLYAAL+GA LSYLSFG
Sbjct  3    LEMESMALAIGVSVPVLRFLLCFVATIPVSFTHRFVPS-LFGKHLYAALSGAFLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPMLLGY SM+L+RPYCGI+TF   FGYLIGCH+YYMSGDAWKEGGID+TGA
Sbjct  62   FSSNLHFLVPMLLGYLSMVLFRPYCGILTFLSGFGYLIGCHMYYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC M+Y DGLLKE +LREAQK+NRL++LPS  EY+GYCLCCGSHFAGPV+E
Sbjct  122  LMVLTLKVISCAMSYNDGLLKEEELREAQKKNRLIELPSFIEYVGYCLCCGSHFAGPVFE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTERKGIW P  K  P+PSPF  T++ALLQA  CM LYLYL+P+F ++  N   
Sbjct  182  MKDYLEWTERKGIWAPTEKG-PAPSPFGATIQALLQATVCMALYLYLIPHFNISGLNGPA  240

Query  794  Y  796
            Y
Sbjct  241  Y  241



>gb|EPS74023.1| hypothetical protein M569_00723, partial [Genlisea aurea]
Length=461

 Score =   377 bits (967),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/240 (75%), Positives = 204/240 (85%), Gaps = 1/240 (0%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            E+  MASAIGVSVPVLRFLLCFVATIP+S LHRFVPGG + RH YA   GA+LSYLSFG 
Sbjct  1    EISTMASAIGVSVPVLRFLLCFVATIPLSFLHRFVPGGPNTRHFYAVAIGAVLSYLSFGL  60

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSN HF+VP+LLGYA+ML YR +CGIITFFLAFGYLIGCHVYYMSGDAWKEGGID+TGAL
Sbjct  61   SSNFHFIVPILLGYAAMLFYRKHCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  120

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MV+TLKIISC +NY DGLLKE DL  AQK+ RL+KLPSL EY GYCLCCG+H AGPVYE+
Sbjct  121  MVVTLKIISCAINYNDGLLKEEDLSSAQKKYRLIKLPSLLEYFGYCLCCGTHLAGPVYEI  180

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K YL+WT+RKGIW+  GK    PSP+  TLRALLQAA  MGLYLYL P++PL+RF + +Y
Sbjct  181  KDYLDWTDRKGIWQTKGKGL-LPSPYGATLRALLQAAISMGLYLYLSPHYPLSRFTEPVY  239



>gb|KCW72087.1| hypothetical protein EUGRSUZ_E00532 [Eucalyptus grandis]
Length=391

 Score =   374 bits (960),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 207/242 (86%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++E+E MASAIGVSV V RFLLC++ATIPVS L RFVPG    +H YAA +GALLSYLSF
Sbjct  2    ELEMESMASAIGVSVAVFRFLLCYLATIPVSFLWRFVPG-RLAKHAYAAGSGALLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGY SM+  R  CGI+TFFL FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYLSMVACRSKCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DGLLKE DLR++QK+NRL+KLPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAINYNDGLLKEEDLRDSQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YLEWTE KGIW  + K  P PSPF  T+RA+LQAAFCMGLYLYLVP +PL++F D 
Sbjct  181  EMKDYLEWTEGKGIWSRSDKG-PKPSPFGATVRAILQAAFCMGLYLYLVPQYPLSQFTDP  239

Query  791  LY  796
            +Y
Sbjct  240  VY  241



>ref|XP_004515799.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X2 
[Cicer arietinum]
Length=465

 Score =   376 bits (966),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 178/242 (74%), Positives = 210/242 (87%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            +++L+ MA++IGVS+PVLRFL+CFVATIP+S L RFVPG    +H Y+A  G +LSYLSF
Sbjct  2    ELQLDSMAASIGVSIPVLRFLICFVATIPLSFLCRFVPG-RLPKHFYSAAVGVVLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGYASMLLYRP CGI+TFFL FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYASMLLYRPRCGIVTFFLGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DG+LKE+ LREAQK+NRL++LP+L EY+GYCLCCGSHFAGPV+
Sbjct  121  ALMVLTLKVISCAINYNDGMLKEDGLREAQKKNRLIQLPTLIEYVGYCLCCGSHFAGPVF  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE KGIW  +G + P PSP+  T+RALLQA  CMGLYL LVPYFPL++F D 
Sbjct  181  EMKDYLDWTEEKGIWS-SGAKGPKPSPYGATIRALLQAGVCMGLYLKLVPYFPLSKFTDP  239

Query  791  LY  796
             Y
Sbjct  240  SY  241



>gb|KJB68447.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=429

 Score =   374 bits (961),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 208/242 (86%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++++  MA++IGVSVPV+RFLLCFV TIPVS L R VPG    +HLY+A TGALLSYLSF
Sbjct  2    ELDMVTMAASIGVSVPVIRFLLCFVTTIPVSFLWRLVPG-PLAKHLYSAFTGALLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGYA+M+LYRP CGIITFFL FG+LIGCHVYYMSGDAWK+GGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYAAMVLYRPKCGIITFFLGFGFLIGCHVYYMSGDAWKQGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC MNY DGLLKE DLREAQK+NRL+KLPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAMNYNDGLLKEEDLREAQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE KGIW  + K  PSPSP+V TLRAL+QAAFCM ++LYL P  PL+ F D 
Sbjct  181  EMKDYLDWTEGKGIWAHSDKG-PSPSPYVATLRALVQAAFCMAMFLYLSPSHPLSWFIDP  239

Query  791  LY  796
             Y
Sbjct  240  AY  241



>gb|KDO63564.1| hypothetical protein CISIN_1g012501mg [Citrus sinensis]
Length=462

 Score =   375 bits (962),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/241 (75%), Positives = 203/241 (84%), Gaps = 6/241 (2%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA +IGVSV VLRFLLC+VATIPVS L RFVP   +G+H+YAA +GALLSYLSFG
Sbjct  4    LEMESMAGSIGVSVAVLRFLLCYVATIPVSFLWRFVPS-RTGKHVYAAASGALLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPMLLGY SM +YR  CGIITFFL FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  63   FSSNLHFLVPMLLGYLSMAIYRAKCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDATGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGL+ E +LREAQK+NRL +LPSL EYIGYCLCCGSHFAGPVYE
Sbjct  123  LMVLTLKVISCAINYNDGLVTEENLREAQKKNRLTRLPSLIEYIGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTERKGIW       P PSP+  TLRA+LQA  CM LYLYLVP +PL RF + +
Sbjct  183  MKDYLEWTERKGIW-----SEPWPSPYAATLRAILQAGVCMALYLYLVPQYPLTRFTEPI  237

Query  794  Y  796
            Y
Sbjct  238  Y  238



>ref|XP_006440536.1| hypothetical protein CICLE_v10020062mg [Citrus clementina]
 gb|ESR53776.1| hypothetical protein CICLE_v10020062mg [Citrus clementina]
Length=462

 Score =   375 bits (962),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/241 (75%), Positives = 203/241 (84%), Gaps = 6/241 (2%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA +IGVSV VLRFLLC+VATIPVS L RFVP   +G+H+YAA +GALLSYLSFG
Sbjct  4    LEMESMAGSIGVSVAVLRFLLCYVATIPVSFLWRFVPS-RTGKHVYAAASGALLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPMLLGY SM +YR  CGIITFFL FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  63   FSSNLHFLVPMLLGYLSMAIYRAKCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDATGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGL+ E +LREAQK+NRL +LPSL EYIGYCLCCGSHFAGPVYE
Sbjct  123  LMVLTLKVISCAINYNDGLVTEENLREAQKKNRLTRLPSLIEYIGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTERKGIW       P PSP+  TLRA+LQA  CM LYLYLVP +PL RF + +
Sbjct  183  MKDYLEWTERKGIW-----SEPWPSPYAATLRAILQAGVCMALYLYLVPQYPLTRFTEPI  237

Query  794  Y  796
            Y
Sbjct  238  Y  238



>ref|XP_010055596.1| PREDICTED: lysophospholipid acyltransferase 1-like [Eucalyptus 
grandis]
 gb|KCW72086.1| hypothetical protein EUGRSUZ_E00532 [Eucalyptus grandis]
Length=465

 Score =   375 bits (962),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 207/242 (86%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++E+E MASAIGVSV V RFLLC++ATIPVS L RFVPG    +H YAA +GALLSYLSF
Sbjct  2    ELEMESMASAIGVSVAVFRFLLCYLATIPVSFLWRFVPG-RLAKHAYAAGSGALLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGY SM+  R  CGI+TFFL FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYLSMVACRSKCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DGLLKE DLR++QK+NRL+KLPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAINYNDGLLKEEDLRDSQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YLEWTE KGIW  + K  P PSPF  T+RA+LQAAFCMGLYLYLVP +PL++F D 
Sbjct  181  EMKDYLEWTEGKGIWSRSDKG-PKPSPFGATVRAILQAAFCMGLYLYLVPQYPLSQFTDP  239

Query  791  LY  796
            +Y
Sbjct  240  VY  241



>ref|XP_004515798.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X1 
[Cicer arietinum]
Length=484

 Score =   375 bits (962),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/242 (74%), Positives = 210/242 (87%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            +++L+ MA++IGVS+PVLRFL+CFVATIP+S L RFVPG    +H Y+A  G +LSYLSF
Sbjct  2    ELQLDSMAASIGVSIPVLRFLICFVATIPLSFLCRFVPG-RLPKHFYSAAVGVVLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPMLLGYASMLLYRP CGI+TFFL FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMLLGYASMLLYRPRCGIVTFFLGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DG+LKE+ LREAQK+NRL++LP+L EY+GYCLCCGSHFAGPV+
Sbjct  121  ALMVLTLKVISCAINYNDGMLKEDGLREAQKKNRLIQLPTLIEYVGYCLCCGSHFAGPVF  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE KGIW  +G + P PSP+  T+RALLQA  CMGLYL LVPYFPL++F D 
Sbjct  181  EMKDYLDWTEEKGIWS-SGAKGPKPSPYGATIRALLQAGVCMGLYLKLVPYFPLSKFTDP  239

Query  791  LY  796
             Y
Sbjct  240  SY  241



>ref|XP_008795385.1| PREDICTED: lysophospholipid acyltransferase 1-like [Phoenix dactylifera]
Length=465

 Score =   374 bits (960),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 210/242 (87%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++E+  MASAIGVS+PVLRFLLCFVATIPVS L R VPG +  +H+YA L+GA LS LSF
Sbjct  2    ELEMASMASAIGVSIPVLRFLLCFVATIPVSFLWRLVPG-TLAKHIYAGLSGAALSCLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFL+PM  GY SMLL R YCGI+TFF+ FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLIPMSAGYGSMLLCRRYCGILTFFVGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DGLL+E  LREAQK+NRL+  PS+ EY GYC+CCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAINYNDGLLREEGLREAQKKNRLIHCPSIIEYFGYCVCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE+KGIW  + ++RPSPSP+V TLRAL+QAA CMG+YLYLVP++PL+RFN+ 
Sbjct  181  EMKDYLDWTEKKGIWAHS-EDRPSPSPYVATLRALIQAATCMGIYLYLVPHYPLSRFNEP  239

Query  791  LY  796
            +Y
Sbjct  240  IY  241



>ref|XP_007023110.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
5 [Theobroma cacao]
 gb|EOY25732.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
5 [Theobroma cacao]
Length=385

 Score =   370 bits (951),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 178/242 (74%), Positives = 206/242 (85%), Gaps = 3/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++++  MA++IGVSVPVLRFLLCFVATIPVS   R VPG    +H+Y+A +GALLSYLSF
Sbjct  2    ELDMGTMAASIGVSVPVLRFLLCFVATIPVSFSWRLVPG-RLAKHVYSAFSGALLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPM+LGYA+M+LYRP CG+ITFFL FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMVLGYAAMVLYRPKCGVITFFLGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DGLLKE  LREAQK+NRL+KLPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAINYNDGLLKEEGLREAQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE KGIW  A  ++ SPSP+  T RAL+QA+ CM  YLYLVPY PL RF + 
Sbjct  181  EMKDYLDWTEGKGIW--AHSDKRSPSPYGATFRALVQASICMAFYLYLVPYHPLTRFTEP  238

Query  791  LY  796
            +Y
Sbjct  239  IY  240



>ref|XP_007023106.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
1 [Theobroma cacao]
 ref|XP_007023109.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
1 [Theobroma cacao]
 gb|EOY25728.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
1 [Theobroma cacao]
 gb|EOY25731.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
1 [Theobroma cacao]
Length=461

 Score =   372 bits (956),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/242 (74%), Positives = 206/242 (85%), Gaps = 3/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++++  MA++IGVSVPVLRFLLCFVATIPVS   R VPG    +H+Y+A +GALLSYLSF
Sbjct  2    ELDMGTMAASIGVSVPVLRFLLCFVATIPVSFSWRLVPG-RLAKHVYSAFSGALLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPM+LGYA+M+LYRP CG+ITFFL FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMVLGYAAMVLYRPKCGVITFFLGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DGLLKE  LREAQK+NRL+KLPSL EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCAINYNDGLLKEEGLREAQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE KGIW  A  ++ SPSP+  T RAL+QA+ CM  YLYLVPY PL RF + 
Sbjct  181  EMKDYLDWTEGKGIW--AHSDKRSPSPYGATFRALVQASICMAFYLYLVPYHPLTRFTEP  238

Query  791  LY  796
            +Y
Sbjct  239  IY  240



>ref|XP_006307436.1| hypothetical protein CARUB_v10009061mg [Capsella rubella]
 gb|EOA40334.1| hypothetical protein CARUB_v10009061mg [Capsella rubella]
Length=465

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/241 (74%), Positives = 201/241 (83%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            M++  MA++IGVSV VLRFLLCFVATIPVS   R VP    G+HLYAA +GALLSYLSFG
Sbjct  4    MDMSSMAASIGVSVAVLRFLLCFVATIPVSFAWRIVPS-RLGKHLYAAASGALLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM +GYASM +YRP CGIITFFL F YLIGCHV+YMSGDAWKEGGIDSTGA
Sbjct  63   FSSNLHFLVPMTIGYASMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC MNY DG+LKE  L EAQK+NRL+++PSL EY GYCLCCGSHFAGPVYE
Sbjct  123  LMVLTLKVISCAMNYNDGMLKEEGLSEAQKKNRLIQMPSLIEYFGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTE KGIW  + K R  PSPF  T+RA+LQAA CM LYLYLVP +PL RF + +
Sbjct  183  MKDYLEWTEGKGIWDTSDK-RKQPSPFGATIRAILQAAICMALYLYLVPQYPLTRFTEPV  241

Query  794  Y  796
            Y
Sbjct  242  Y  242



>ref|XP_010546005.1| PREDICTED: lysophospholipid acyltransferase 1 [Tarenaya hassleriana]
Length=463

 Score =   371 bits (953),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 206/241 (85%), Gaps = 3/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            ++++ MA++IGVSVPVLRFLLCFVATIPVS + R VP    G+H+Y+A +GA LSYLSFG
Sbjct  4    VDMDSMAASIGVSVPVLRFLLCFVATIPVSFMWRLVPS-RLGKHIYSAASGAFLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM+LGYASM +YRP CGIITFFL FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  63   FSSNLHFLVPMMLGYASMAIYRPRCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDATGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+ LK+ISC +NY DG+L+E  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPVYE
Sbjct  123  LMVLVLKVISCAINYNDGMLEEEGLREAQKKNRLIQMPSLIEYFGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTE KGIW  A ++  +PSP+  TLRALLQA  CM LYLYLVPYFPL RF + +
Sbjct  183  MKDYLEWTEGKGIW--ATEKGNAPSPYGATLRALLQAGICMALYLYLVPYFPLTRFTEPI  240

Query  794  Y  796
            Y
Sbjct  241  Y  241



>ref|XP_002892700.1| membrane bound O-acyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH68959.1| membrane bound O-acyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=462

 Score =   371 bits (952),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 179/241 (74%), Positives = 202/241 (84%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            M++  MA++IGVSV VLRFLLCFVATIPVS   R VP    G+HLYAA +GA LSYLSFG
Sbjct  1    MDMSSMAASIGVSVAVLRFLLCFVATIPVSFACRIVPS-RLGKHLYAAASGAFLSYLSFG  59

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM +GYASM +YRP CGIITFFL FGYLIGCHV+YMSGDAWKEGGIDSTGA
Sbjct  60   FSSNLHFLVPMTIGYASMAIYRPKCGIITFFLGFGYLIGCHVFYMSGDAWKEGGIDSTGA  119

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC MNY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPVYE
Sbjct  120  LMVLTLKVISCAMNYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCLCCGSHFAGPVYE  179

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTE KGIW  + K R  PSP+  T+RA+LQAA CM LYLYLVP +PL RF + +
Sbjct  180  MKDYLEWTEGKGIWDTSEK-RKRPSPYGATIRAILQAAICMALYLYLVPQYPLTRFTEPV  238

Query  794  Y  796
            Y
Sbjct  239  Y  239



>gb|ERN19360.1| hypothetical protein AMTR_s00069p00124460 [Amborella trichopoda]
Length=463

 Score =   371 bits (952),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 180/241 (75%), Positives = 207/241 (86%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            M+++ MA++IGVSVPVLRFLLCFVATIPVS L RFVPG    +HLY+ALTGALLSYLSFG
Sbjct  1    MDMQAMAASIGVSVPVLRFLLCFVATIPVSWLWRFVPG-RLPKHLYSALTGALLSYLSFG  59

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFL+PM LGY SML+YRP CG  TF   FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  60   FSSNLHFLIPMSLGYLSMLVYRPLCGPFTFIAGFGYLIGCHVYYMSGDAWKEGGIDATGA  119

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGLLKE  LREAQK+ RL++ PSL EYIGYCLCCGSHFAGPVYE
Sbjct  120  LMVLTLKVISCSINYNDGLLKEEGLREAQKKYRLIQCPSLIEYIGYCLCCGSHFAGPVYE  179

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTE  GIW P+ K RP PSP+   L+A+LQ+A CMG+YLYLVP+FPL+RF++ +
Sbjct  180  MKEYLEWTENTGIWSPSDK-RPPPSPYGAALQAVLQSAVCMGIYLYLVPHFPLSRFSEPI  238

Query  794  Y  796
            Y
Sbjct  239  Y  239



>ref|XP_006477394.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Citrus sinensis]
Length=462

 Score =   370 bits (950),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 178/241 (74%), Positives = 203/241 (84%), Gaps = 6/241 (2%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +++E MA +IGVSV VLRFLLC+VATIPVS L RFVP   +G+H+YAA +GALLSYLSFG
Sbjct  4    LDMESMAGSIGVSVAVLRFLLCYVATIPVSFLWRFVPS-RTGKHVYAAASGALLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPMLLGY SM +YR  CGIITFF+ FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  63   FSSNLHFLVPMLLGYLSMAIYRAKCGIITFFIGFGYLIGCHVYYMSGDAWKEGGIDATGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGL+ E +LREAQK+NRL +LPSL EYIGYCLCCGSHFAGPVYE
Sbjct  123  LMVLTLKVISCAINYNDGLVTEENLREAQKKNRLTRLPSLIEYIGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            +K YLEWTERKGIW       P PSP+  TLRA+LQA  CM LYLYLVP +PL RF + +
Sbjct  183  IKDYLEWTERKGIW-----SGPWPSPYAATLRAILQAGVCMALYLYLVPQYPLTRFTEPI  237

Query  794  Y  796
            Y
Sbjct  238  Y  238



>gb|AGM15931.1| lysophosphatidylcholine acyltransferase 1 [Physaria fendleri]
Length=465

 Score =   370 bits (950),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 199/241 (83%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            M +  MA +IGVSV VLRFLLCFVATIPVS + R VP    G+HLYAA++G LLSYLSFG
Sbjct  4    MNMSSMAGSIGVSVAVLRFLLCFVATIPVSFVWRIVPS-KLGKHLYAAVSGVLLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM +GY SM +YRP CGIITFFL F YLIGCHV+YMSGDAWKEGGIDSTGA
Sbjct  63   FSSNLHFLVPMTIGYGSMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC MNY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPVYE
Sbjct  123  LMVLTLKVISCAMNYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTE KGIW  + K R  PSPF  T+RA+ QAA CM LYLYLVP +PL RF + +
Sbjct  183  MKDYLEWTEGKGIWDTSDK-RKQPSPFGATIRAIFQAAICMALYLYLVPRYPLTRFTEPV  241

Query  794  Y  796
            Y
Sbjct  242  Y  242



>ref|XP_008238778.1| PREDICTED: lysophospholipid acyltransferase 1 [Prunus mume]
Length=465

 Score =   370 bits (950),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 181/241 (75%), Positives = 206/241 (85%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA+ IGVSV VLRFLLCFVATIPVS L R VP     +HLYAA++GALLSYLSFG
Sbjct  3    LEMESMAATIGVSVAVLRFLLCFVATIPVSFLWRLVPS-PPAKHLYAAVSGALLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPMLLGYASM+  R +CGIITF L FGYLIGCHV+YMSGDAWKEGGID+TGA
Sbjct  62   FSSNLHFLVPMLLGYASMVFARSHCGIITFILGFGYLIGCHVFYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGLLKE  L E+QK+NRL+KLPSL EY+GYCLCCGSHFAGPVYE
Sbjct  122  LMVLTLKVISCAINYNDGLLKEEGLLESQKKNRLIKLPSLIEYVGYCLCCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            +K YL+WTE KGIW  + +E  SPSP+  T+RALLQAAFCM LYLYLVP FPL+RF D +
Sbjct  182  IKDYLDWTEGKGIWSHS-EEGLSPSPYGATIRALLQAAFCMALYLYLVPQFPLSRFTDPI  240

Query  794  Y  796
            Y
Sbjct  241  Y  241



>gb|AGM15932.1| lysophosphatidylcholine acyltransferase 2 [Physaria fendleri]
Length=465

 Score =   370 bits (949),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/241 (72%), Positives = 204/241 (85%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            ++++ MAS+IGVSV VLRFLLCFVATIPVS L RFVP    G+H+Y+A +GA LSYLSFG
Sbjct  4    LDMDSMASSIGVSVAVLRFLLCFVATIPVSFLWRFVPS-RLGKHIYSAASGAFLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM +GYASM +YRP+ G ITFFL F YLIGCHV+YMSGDAWKEGGID+TGA
Sbjct  63   FSSNLHFLVPMTIGYASMAIYRPFSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDATGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPV+E
Sbjct  123  LMVLTLKVISCSINYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCLCCGSHFAGPVFE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTE KGIW  +GK++  PSPF   +RA+ QAA CMGLYLYLVP FPL RF + +
Sbjct  183  MKDYLEWTEEKGIWAVSGKQK-RPSPFGAMIRAIFQAAICMGLYLYLVPKFPLTRFTEPV  241

Query  794  Y  796
            Y
Sbjct  242  Y  242



>ref|XP_004298745.1| PREDICTED: lysophospholipid acyltransferase 1 [Fragaria vesca 
subsp. vesca]
Length=464

 Score =   369 bits (948),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/241 (74%), Positives = 204/241 (85%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA++IGVSVPVLRFLLC+VATIPVS L R VPG    +H YAA +GA+LSYLSFG
Sbjct  3    LEMESMAASIGVSVPVLRFLLCYVATIPVSFLWRVVPG-PLAKHFYAAASGAILSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM LGYASM+ +R +CGIITF L FGYLIGCH+YYMSGDAWKEGGID+TGA
Sbjct  62   FSSNLHFLVPMSLGYASMMFFRKHCGIITFVLGFGYLIGCHMYYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DG+LKE  LRE+QK++RL KLPSL EY GYCL CGSHFAGPVYE
Sbjct  122  LMVLTLKVISCAINYNDGILKEEGLRESQKKHRLTKLPSLIEYFGYCLSCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YL+WTE KGIW P+ K +P PSPF   +RALLQAAFCMGLYLYLVP FP  RF + +
Sbjct  182  MKDYLDWTESKGIWSPSEKGQP-PSPFGAAMRALLQAAFCMGLYLYLVPQFPWTRFTEPI  240

Query  794  Y  796
            Y
Sbjct  241  Y  241



>ref|XP_010494443.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X1 
[Camelina sativa]
Length=465

 Score =   369 bits (948),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 200/241 (83%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +++  MA++IGVSV VLRFLLCFVA IPVS   R VP G  G+HLYAA +GALLSYLSFG
Sbjct  4    VDMSSMAASIGVSVAVLRFLLCFVAMIPVSFAWRIVPSGI-GKHLYAAASGALLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM +GYASM +YRP CGIITFFL F YLIGCHV+YMSGDAWKEGGIDSTGA
Sbjct  63   FSSNLHFLVPMTIGYASMAVYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC MNY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPVYE
Sbjct  123  LMVLTLKVISCAMNYNDGMLKEEGLREAQKKNRLVQMPSLIEYFGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
             K YLEWTE KGIW  + K R  PSPF  T+RA+ QAA CM LYLYLVP +PL RF + +
Sbjct  183  TKDYLEWTEGKGIWDTSNK-RKQPSPFEATVRAIFQAAICMALYLYLVPQYPLTRFTEPV  241

Query  794  Y  796
            Y
Sbjct  242  Y  242



>ref|XP_007209112.1| hypothetical protein PRUPE_ppa005358mg [Prunus persica]
 gb|EMJ10311.1| hypothetical protein PRUPE_ppa005358mg [Prunus persica]
Length=465

 Score =   369 bits (948),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/241 (76%), Positives = 205/241 (85%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA+AIGVSV VLRFLLCFV TIPVS L R VP     +HLYAA++GALLSYLSFG
Sbjct  3    LEMESMAAAIGVSVAVLRFLLCFVFTIPVSFLWRLVPS-PPAKHLYAAVSGALLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPMLLGYASM+  R +CGIITF L+FGYLIGCHV YMSGDAWKEGGID+TGA
Sbjct  62   FSSNLHFLVPMLLGYASMVFARSHCGIITFILSFGYLIGCHVVYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGLLKE  LRE+QK+NRL+KLPSL EY GYCLCCGSHFAGPVYE
Sbjct  122  LMVLTLKVISCAINYNDGLLKEEGLRESQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            +K YL+WTE KGIW    +E  SPSP+  T+RALLQAAFCM LYLYLVP FPL+RF D +
Sbjct  182  IKDYLDWTEGKGIWSHT-EEGLSPSPYGATIRALLQAAFCMALYLYLVPQFPLSRFTDPI  240

Query  794  Y  796
            Y
Sbjct  241  Y  241



>ref|XP_003549863.1| PREDICTED: lysophospholipid acyltransferase 2 [Glycine max]
Length=463

 Score =   369 bits (947),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/241 (75%), Positives = 204/241 (85%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            M ++ MA++IGVSVPVLRFLLCF AT+P+S L RF+P G   +HLY+++ G  LSYLSFG
Sbjct  1    MSMDSMATSIGVSVPVLRFLLCFAATVPLSFLCRFLPRGLP-KHLYSSVVGVALSYLSFG  59

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM LGYASMLLYRP CGI+TFFL FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  60   FSSNLHFLVPMFLGYASMLLYRPRCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDATGA  119

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGLLKE  LREAQK+ RL+KLPSL EYIGYCLCCGSHFAGPVYE
Sbjct  120  LMVLTLKVISCAVNYNDGLLKEEGLREAQKKYRLIKLPSLIEYIGYCLCCGSHFAGPVYE  179

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YL+WTE KGIW    K  PSPSP+  TLRALLQA FCM +YL LVP+FPL++F D  
Sbjct  180  MKDYLDWTEGKGIWGTEAKG-PSPSPYGATLRALLQAGFCMAMYLNLVPHFPLSKFTDPT  238

Query  794  Y  796
            Y
Sbjct  239  Y  239



>ref|XP_009377923.1| PREDICTED: lysophospholipid acyltransferase 1-like [Pyrus x bretschneideri]
 ref|XP_009344265.1| PREDICTED: lysophospholipid acyltransferase 1-like [Pyrus x bretschneideri]
Length=465

 Score =   369 bits (947),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/241 (75%), Positives = 205/241 (85%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA+ IGVSV VLRFLLCFVATIPVS + R VP   + +HLYAA +GALLSYLSFG
Sbjct  3    LEMESMAAGIGVSVSVLRFLLCFVATIPVSFIWRLVPSAPA-KHLYAAASGALLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPMLLGYASM   R +CGIITF L FGYLIGCHV+YMSGDAWKEGGID+TGA
Sbjct  62   FSSNLHFLVPMLLGYASMAFARNHCGIITFVLGFGYLIGCHVFYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DG+LKE  LRE+QK+NRL+KLPSL EY GYCLCCGSHFAGPVYE
Sbjct  122  LMVLTLKVISCAINYNDGVLKEEGLRESQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            +K YL+WTE KGIW  + K  PSPSP+  T+RALLQAAFCM LYLYLVP FPL+RF + +
Sbjct  182  IKDYLDWTEGKGIWSHSEKG-PSPSPYGATIRALLQAAFCMALYLYLVPKFPLSRFTEPI  240

Query  794  Y  796
            Y
Sbjct  241  Y  241



>ref|XP_008364537.1| PREDICTED: lysophospholipid acyltransferase 1-like [Malus domestica]
Length=460

 Score =   367 bits (943),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 180/241 (75%), Positives = 205/241 (85%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA+AIGVSVPVLRFLLCFVATIPVS + R VP     +HLYA  +GALLSYLSFG
Sbjct  3    LEMESMAAAIGVSVPVLRFLLCFVATIPVSFIWRLVPS-PPAKHLYAFASGALLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPMLLGYASM+  R +CGIITF L FGYLIGCHV+YMSGDAWKEGGID+TGA
Sbjct  62   FSSNLHFLVPMLLGYASMVFARNHCGIITFILGFGYLIGCHVFYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DG+LKE  LRE+QK+NRL+KLPSL EY GYCL CGSHFAGPVYE
Sbjct  122  LMVLTLKVISCAINYNDGVLKEEGLRESQKKNRLIKLPSLIEYFGYCLGCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YL+WTE KGIW  + K  PSPSP+  T+RALLQAAFCM LY+YLVP FPL+RF + +
Sbjct  182  MKDYLDWTEGKGIWSRSEKG-PSPSPYGATIRALLQAAFCMALYVYLVPQFPLSRFTEPI  240

Query  794  Y  796
            Y
Sbjct  241  Y  241



>ref|NP_172724.2| lysophosphatidylcholine acyltransferase 1 [Arabidopsis thaliana]
 sp|F4IDU4.1|MBOA1_ARATH RecName: Full=Lysophospholipid acyltransferase 1; Short=AtLPLAT1; 
AltName: Full=1-acylglycerophosphocholine O-acyltransferase 
1; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; 
AltName: Full=1-acylglycerophosphoserine O-acyltransferase; 
AltName: Full=Lysophosphatidylcholine acyltransferase 
1; Short=LPCAT1; AltName: Full=Lysophosphatidylethanolamine 
acyltransferase; Short=LPEAT; AltName: Full=Lysophosphatidylglycerol 
acyltransferase; Short=LPGAT; AltName: Full=Lysophosphatidylserine 
acyltransferase; Short=LPSAT [Arabidopsis 
thaliana]
 gb|AEE28904.1| MBOAT (membrane bound O-acyl transferase)-like protein [Arabidopsis 
thaliana]
Length=462

 Score =   367 bits (943),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 178/241 (74%), Positives = 199/241 (83%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            M++  MA +IGVSV VLRFLLCFVATIPVS   R VP    G+HLYAA +GA LSYLSFG
Sbjct  1    MDMSSMAGSIGVSVAVLRFLLCFVATIPVSFACRIVPS-RLGKHLYAAASGAFLSYLSFG  59

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM +GYASM +YRP CGIITFFL F YLIGCHV+YMSGDAWKEGGIDSTGA
Sbjct  60   FSSNLHFLVPMTIGYASMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGA  119

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC MNY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPVYE
Sbjct  120  LMVLTLKVISCSMNYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCLCCGSHFAGPVYE  179

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTE KGIW    K R  PSP+  T+RA+LQAA CM LYLYLVP +PL RF + +
Sbjct  180  MKDYLEWTEGKGIWDTTEK-RKKPSPYGATIRAILQAAICMALYLYLVPQYPLTRFTEPV  238

Query  794  Y  796
            Y
Sbjct  239  Y  239



>ref|XP_010919229.1| PREDICTED: lysophospholipid acyltransferase 1-like [Elaeis guineensis]
Length=465

 Score =   367 bits (941),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 204/242 (84%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++E+  MA+AIGVS+PVLRFLLCFVATIP S   R VPG +  +HLYA L+GA LSYLSF
Sbjct  2    ELEMASMAAAIGVSIPVLRFLLCFVATIPASFFWRLVPG-TLAKHLYAGLSGAALSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            G SSNLHFL+PM +GYASMLL R YCG +TFF  FGYLIGCHVYYMSG+AWKEGGID+TG
Sbjct  61   GLSSNLHFLIPMAVGYASMLLCRRYCGTLTFFAGFGYLIGCHVYYMSGNAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DGLL+E  LREAQ +NRLL  PS+ EY GYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVISCTINYSDGLLREEGLREAQTKNRLLHCPSIIEYFGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE+KGIW  + K+RPSPSP++ TLRAL+QAA CM +YLY VP +PL+RFN+ 
Sbjct  181  EMKDYLDWTEKKGIWARS-KDRPSPSPYLATLRALIQAAICMAIYLYFVPQYPLSRFNEP  239

Query  791  LY  796
            +Y
Sbjct  240  IY  241



>ref|XP_010476235.1| PREDICTED: lysophospholipid acyltransferase 1 [Camelina sativa]
Length=465

 Score =   367 bits (941),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/241 (73%), Positives = 200/241 (83%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +++  MA++IGVSV VLRFLLCFVATIPVS   R VP G  G+HLYAA +GALLSYLSFG
Sbjct  4    VDMSSMAASIGVSVAVLRFLLCFVATIPVSFAWRIVPSGI-GKHLYAAASGALLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM +GYASM +YRP CGIITFFL F YLIGCHV+YMSGDAWKEGGIDSTGA
Sbjct  63   FSSNLHFLVPMTIGYASMAVYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC MNY DG+LKE  LREAQK++RL+++PSL EY GYCLCCGSHFAGPVYE
Sbjct  123  LMVLTLKVISCAMNYNDGMLKEEGLREAQKKHRLIQMPSLIEYFGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
             K YLEWTE KGIW  + K R  PSPF  T+RA+ QA  CM LYLYLVP +PL RF + +
Sbjct  183  TKDYLEWTEGKGIWDTSDK-RKQPSPFGATVRAIFQAGICMALYLYLVPQYPLTRFTEPV  241

Query  794  Y  796
            Y
Sbjct  242  Y  242



>ref|XP_008369472.1| PREDICTED: lysophospholipid acyltransferase 1-like [Malus domestica]
Length=465

 Score =   366 bits (940),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/241 (74%), Positives = 204/241 (85%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA+ IGVSV VLRFLLCFVATIPVS + R VP     +HLYAA +GALLSYLSFG
Sbjct  3    LEMESMAAGIGVSVSVLRFLLCFVATIPVSFIWRLVPS-PPAKHLYAAASGALLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPMLLGYASM+  R +CGIITF L FGYLIGCHV+YMSGDAWKEGGID+TGA
Sbjct  62   FSSNLHFLVPMLLGYASMVFARNHCGIITFVLGFGYLIGCHVFYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DG+LKE  LRE+QK+NRL+KLPSL EY GYCLCCGSHFAGPVYE
Sbjct  122  LMVLTLKVISCAINYNDGVLKEEGLRESQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            +K YL+WTE KGIW  + K  PSPSP+  T+RALLQAA CM LYLYLVP FPL+RF + +
Sbjct  182  IKDYLDWTEGKGIWSHSEKG-PSPSPYGATIRALLQAAXCMALYLYLVPKFPLSRFTEPI  240

Query  794  Y  796
            Y
Sbjct  241  Y  241



>gb|AAM13086.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91162.1| unknown protein [Arabidopsis thaliana]
Length=462

 Score =   366 bits (939),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 199/241 (83%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            M++  MA +IGVSV VLRFLLCFVATIPVS   R VP    G+HLYAA +GA LSYLSFG
Sbjct  1    MDMSSMAGSIGVSVAVLRFLLCFVATIPVSFACRIVPS-RLGKHLYAAASGAFLSYLSFG  59

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM +GYASM +YRP CGIITFFL F YLIGCHV+YMSGDAWKEGGIDSTGA
Sbjct  60   FSSNLHFLVPMTIGYASMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGA  119

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC MNY DG+LKE  LREAQK+NRL+++PSL +Y GYCLCCGSHFAGPVYE
Sbjct  120  LMVLTLKVISCSMNYNDGMLKEEGLREAQKKNRLIQMPSLIKYFGYCLCCGSHFAGPVYE  179

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTE KGIW    K R  PSP+  T+RA+LQAA CM LYLYLVP +PL RF + +
Sbjct  180  MKDYLEWTEGKGIWDTTEK-RKKPSPYGATIRAILQAAICMALYLYLVPQYPLTRFTEPV  238

Query  794  Y  796
            Y
Sbjct  239  Y  239



>ref|XP_010458693.1| PREDICTED: lysophospholipid acyltransferase 1-like [Camelina 
sativa]
Length=465

 Score =   366 bits (939),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 199/241 (83%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +++  MA++IGVSV VLRFLLCFVATIPVS   R VP G  G+HLYAA +GALLSYLSFG
Sbjct  4    VDMSSMAASIGVSVAVLRFLLCFVATIPVSFAWRIVPSGI-GKHLYAAASGALLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLV M +GYASM +YRP CGIITFFL F YLIGCHV+YMSGDAWKEGGIDSTGA
Sbjct  63   FSSNLHFLVLMTIGYASMAVYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC MNY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPVYE
Sbjct  123  LMVLTLKVISCAMNYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
             K YLEWTE KGIW  + K R  PSPF  T+RA+ QAA CM LYLYLVP +PL RF +  
Sbjct  183  TKDYLEWTEGKGIWDTSDK-RKQPSPFGATVRAIFQAAICMALYLYLVPQYPLTRFTEPA  241

Query  794  Y  796
            Y
Sbjct  242  Y  242



>ref|XP_007155562.1| hypothetical protein PHAVU_003G212400g [Phaseolus vulgaris]
 gb|ESW27556.1| hypothetical protein PHAVU_003G212400g [Phaseolus vulgaris]
Length=463

 Score =   366 bits (939),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 204/241 (85%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            M ++ MA++IGVSVPVLRFLLCF AT+P+S L RF+P G   +HLY+A+ G +LSYLSFG
Sbjct  1    MAMDSMAASIGVSVPVLRFLLCFAATVPLSFLCRFLPRGLP-KHLYSAVVGVVLSYLSFG  59

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
             SSNLHFLVPM LGYASMLL+RP CGI+TFFL FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  60   VSSNLHFLVPMFLGYASMLLFRPRCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDATGA  119

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGLLKE  LREAQK+ RL++LPSL EYIGYCLCCGSHFAGPVYE
Sbjct  120  LMVLTLKVISCAVNYNDGLLKEEGLREAQKKYRLVRLPSLLEYIGYCLCCGSHFAGPVYE  179

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YL+WTE KGIW    K  PSPSP+  T+RALLQA FCM +YL LVP+FPL++F D  
Sbjct  180  MKDYLDWTEGKGIWSSEAKG-PSPSPYGATIRALLQAGFCMAMYLNLVPHFPLSKFTDPT  238

Query  794  Y  796
            Y
Sbjct  239  Y  239



>emb|CDY63224.1| BnaCnng41640D [Brassica napus]
Length=467

 Score =   365 bits (938),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 172/243 (71%), Positives = 199/243 (82%), Gaps = 1/243 (0%)
 Frame = +2

Query  68   RDMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLS  247
              +++  MA++IGVSV VLRFLLCFVATIPVS   RFVP    G+H+Y+A +GALLSYLS
Sbjct  2    ESLDMSSMAASIGVSVAVLRFLLCFVATIPVSFAWRFVPS-RLGKHIYSAASGALLSYLS  60

Query  248  FGFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDST  427
            FGFSSNLHFLVPM +GYASM +YRP CG ITFFL F YLIGCHV+YMSGDAWKEGGIDST
Sbjct  61   FGFSSNLHFLVPMTIGYASMAIYRPMCGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDST  120

Query  428  GALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPV  607
            GALMV+TLK+ISC +NY DG+LKE  LREAQ++NRL+++PSL EY GYCLCCGSHFAGPV
Sbjct  121  GALMVLTLKVISCSINYNDGMLKEETLREAQRKNRLVRMPSLIEYFGYCLCCGSHFAGPV  180

Query  608  YEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFND  787
            +EMK YLEWTE KGIW     +   PSP+  TLRA+LQA  CM LYLYLVP FPL RF +
Sbjct  181  FEMKDYLEWTEEKGIWAVTSGKGKRPSPYGATLRAILQAGICMALYLYLVPQFPLTRFTE  240

Query  788  SLY  796
             +Y
Sbjct  241  PVY  243



>ref|XP_010553491.1| PREDICTED: lysophospholipid acyltransferase 1-like [Tarenaya 
hassleriana]
Length=462

 Score =   365 bits (938),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 175/241 (73%), Positives = 204/241 (85%), Gaps = 3/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            ++++ MA+AIGVSVPVLRFL+CFVATIPVS L R VP    G+H+Y+A +GA LSYLSFG
Sbjct  4    VDMDSMAAAIGVSVPVLRFLICFVATIPVSFLWRLVPS-RLGKHIYSAASGAFLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM++GYASM +YRP CGIITF L F YLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  63   FSSNLHFLVPMMIGYASMAIYRPKCGIITFSLGFAYLIGCHVYYMSGDAWKEGGIDATGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+ LK+ISC +NY DG+L+E  LREAQK+NRL+++PS  EY GYCLCCGSHFAGPVYE
Sbjct  123  LMVLVLKVISCAINYNDGMLEEEGLREAQKKNRLIQMPSPIEYFGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTE KGIW  A ++R  PSP+  T+RALLQAA CM LYLYLVP+FPL RF D +
Sbjct  183  MKDYLEWTEGKGIW--AIEKRRWPSPYGATIRALLQAAICMALYLYLVPHFPLTRFTDPV  240

Query  794  Y  796
            Y
Sbjct  241  Y  241



>ref|XP_009148576.1| PREDICTED: lysophospholipid acyltransferase 1 [Brassica rapa]
Length=466

 Score =   365 bits (937),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 199/242 (82%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
             M+++ MA++IGVSV VLRFLLCFVATIPVS   R VP    G+H+YAA +G  LSYLSF
Sbjct  3    SMDMDSMAASIGVSVAVLRFLLCFVATIPVSFFWRIVPS-RLGKHIYAAASGVFLSYLSF  61

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPM +GYASM +YRP CGIITFFL F YLIGCHV+YMSGDAWKEGGIDSTG
Sbjct  62   GFSSNLHFLVPMTIGYASMAMYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTG  121

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPVY
Sbjct  122  ALMVLTLKVISCAVNYNDGMLKEEGLREAQKKNRLIEMPSLIEYFGYCLCCGSHFAGPVY  181

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE  GIW  + K R  PSP++ TLRA+ QA  CM LYLYLVP FPL RF + 
Sbjct  182  EMKDYLQWTEGTGIWDSSEK-RKQPSPYLATLRAIFQAGICMALYLYLVPQFPLTRFTEP  240

Query  791  LY  796
            +Y
Sbjct  241  VY  242



>gb|KJB29823.1| hypothetical protein B456_005G120200 [Gossypium raimondii]
Length=462

 Score =   365 bits (936),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 206/242 (85%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++ LE MA+AIGVSVPVLRFLLCFVATIPVS L RFVP  +  +H+Y+A +G +LSYLSF
Sbjct  2    ELGLETMAAAIGVSVPVLRFLLCFVATIPVSFLWRFVPR-TLPKHVYSAFSGVVLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            G SSNL FLVPMLLGYA+MLLYRP CGIITFFL+FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GISSNLLFLVPMLLGYAAMLLYRPKCGIITFFLSFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+IS  +NY DGLLKE DLREAQK+ RL+KLPSL EY GYCLCCGSHFAGPV+
Sbjct  121  ALMVLTLKVISSAINYNDGLLKEEDLREAQKKYRLVKLPSLIEYFGYCLCCGSHFAGPVF  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YLEWTE KGIW P+ K   SPSP+  T RAL+QA   M +YLYLVPY PL+RF++ 
Sbjct  181  EMKDYLEWTEGKGIWAPSDKGL-SPSPYGATFRALVQAGISMAVYLYLVPYHPLSRFSEP  239

Query  791  LY  796
            +Y
Sbjct  240  VY  241



>gb|KJB29824.1| hypothetical protein B456_005G120200 [Gossypium raimondii]
Length=463

 Score =   365 bits (936),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 206/242 (85%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++ LE MA+AIGVSVPVLRFLLCFVATIPVS L RFVP  +  +H+Y+A +G +LSYLSF
Sbjct  2    ELGLETMAAAIGVSVPVLRFLLCFVATIPVSFLWRFVPR-TLPKHVYSAFSGVVLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            G SSNL FLVPMLLGYA+MLLYRP CGIITFFL+FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GISSNLLFLVPMLLGYAAMLLYRPKCGIITFFLSFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+IS  +NY DGLLKE DLREAQK+ RL+KLPSL EY GYCLCCGSHFAGPV+
Sbjct  121  ALMVLTLKVISSAINYNDGLLKEEDLREAQKKYRLVKLPSLIEYFGYCLCCGSHFAGPVF  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YLEWTE KGIW P+ K   SPSP+  T RAL+QA   M +YLYLVPY PL+RF++ 
Sbjct  181  EMKDYLEWTEGKGIWAPSDKGL-SPSPYGATFRALVQAGISMAVYLYLVPYHPLSRFSEP  239

Query  791  LY  796
            +Y
Sbjct  240  VY  241



>emb|CDX98051.1| BnaA06g08020D [Brassica napus]
Length=466

 Score =   365 bits (936),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 199/242 (82%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
             M+++ MA++IGVSV VLRFLLCFVATIPVS   R VP    G+H+YAA +G  LSYLSF
Sbjct  3    SMDMDSMAASIGVSVAVLRFLLCFVATIPVSFFWRIVPS-RLGKHVYAAASGVFLSYLSF  61

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPM +GYASM +YRP CGIITFFL F YLIGCHV+YMSGDAWKEGGIDSTG
Sbjct  62   GFSSNLHFLVPMTIGYASMAMYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTG  121

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPVY
Sbjct  122  ALMVLTLKVISCAVNYNDGMLKEEGLREAQKKNRLIEMPSLIEYFGYCLCCGSHFAGPVY  181

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE  GIW  + K R  PSP++ TLRA+ QA  CM LYLYLVP FPL RF + 
Sbjct  182  EMKDYLQWTEGTGIWDSSEK-RKQPSPYLATLRAIFQAGICMALYLYLVPQFPLTRFTEP  240

Query  791  LY  796
            +Y
Sbjct  241  VY  242



>dbj|BAJ34298.1| unnamed protein product [Thellungiella halophila]
Length=339

 Score =   360 bits (924),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/241 (72%), Positives = 200/241 (83%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            M++  MA++IGVSV VLRFLLCFVATIPVS   R VP    G+H+Y+A +GA LSYLSFG
Sbjct  4    MDMNSMAASIGVSVAVLRFLLCFVATIPVSFAWRIVPS-RLGKHVYSAASGAFLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM +GYASM +YRP CGIITFFL F YLIGCHV+YMSGDAWKEGGIDSTGA
Sbjct  63   FSSNLHFLVPMTIGYASMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DG+LKE  LREAQ +NRL+ +PSL EY GYCLCCGSHFAGPVYE
Sbjct  123  LMVLTLKVISCAINYNDGMLKEEGLREAQMKNRLIGMPSLIEYFGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YL+WTE KGIW+ + K R  PSP+  T+RA+LQAA CM LYLYLVP +PL RF + +
Sbjct  183  MKDYLQWTEGKGIWETSEK-RKRPSPYGATIRAILQAAICMALYLYLVPQYPLTRFTEPV  241

Query  794  Y  796
            Y
Sbjct  242  Y  242



>gb|AAF88094.1|AC025417_22 T12C24.17 [Arabidopsis thaliana]
Length=457

 Score =   363 bits (933),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/236 (75%), Positives = 196/236 (83%), Gaps = 2/236 (1%)
 Frame = +2

Query  89   MASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSSNL  268
            MA +IGVSV VLRFLLCFVATIPVS   R VP    G+HLYAA +GA LSYLSFGFSSNL
Sbjct  1    MAGSIGVSVAVLRFLLCFVATIPVSFACRIVPS-RLGKHLYAAASGAFLSYLSFGFSSNL  59

Query  269  HFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALMVIT  448
            HFLVPM +GYASM +YRP CGIITFFL F YLIGCHV+YMSGDAWKEGGIDSTGALMV+T
Sbjct  60   HFLVPMTIGYASMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGALMVLT  119

Query  449  LKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYL  628
            LK+ISC MNY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPVYEMK YL
Sbjct  120  LKVISCSMNYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCLCCGSHFAGPVYEMKDYL  179

Query  629  EWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            EWTE KGIW    K R  PSP+  T+RA+LQAA CM LYLYLVP +PL RF + +Y
Sbjct  180  EWTEGKGIWDTTEK-RKKPSPYGATIRAILQAAICMALYLYLVPQYPLTRFTEPVY  234



>gb|KHN14121.1| Membrane-bound O-acyltransferase domain-containing protein 2 
[Glycine soja]
Length=463

 Score =   363 bits (933),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 178/241 (74%), Positives = 201/241 (83%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            M ++ MA++IGVSVPVLRFLLCF AT+P+S L R +P G   +HLY+A  G  LSYLSFG
Sbjct  1    MSMDSMATSIGVSVPVLRFLLCFAATVPLSFLCRLLPRGLP-KHLYSAAVGVALSYLSFG  59

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
             SSNLHFLVPM LGYASMLL+RP CGI+TFFL FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  60   VSSNLHFLVPMFLGYASMLLFRPRCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDATGA  119

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGLLKE  LREAQK+ RL+KLPSL EYIGYCLCCGSHFAGPVYE
Sbjct  120  LMVLTLKVISCAVNYNDGLLKEEGLREAQKKYRLIKLPSLIEYIGYCLCCGSHFAGPVYE  179

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YL+WTE KGIW    K  PSPSP+  TLRALLQA FCM +YL LVP+FPL++F D  
Sbjct  180  MKDYLDWTEGKGIWGTEAKG-PSPSPYGATLRALLQAGFCMAMYLNLVPHFPLSKFTDPT  238

Query  794  Y  796
            Y
Sbjct  239  Y  239



>ref|XP_010934443.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X1 
[Elaeis guineensis]
Length=465

 Score =   363 bits (933),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 207/242 (86%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++E+E +A+AIGVSVPVLRFL CFVATIPVS   R VPG +  +HLYAA+TGA+LSYLSF
Sbjct  2    ELEMESIAAAIGVSVPVLRFLHCFVATIPVSLAWRLVPG-TLPKHLYAAVTGAVLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            G SSNLHFL+PM LGYASM L+R +CGIITFF+ FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GLSSNLHFLIPMALGYASMRLFRRHCGIITFFIGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK++SC +NY DGLLKE  LR+AQK+ RL+  PS+ EYIGYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVVSCAINYGDGLLKEEGLRDAQKKYRLIHCPSIIEYIGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            E+K YLEWTE KGIW  +  +R  PSP+  TLRAL+QAA CMGLYLYLVP +PL+RF++ 
Sbjct  181  EIKDYLEWTEAKGIWAHS-NDRSLPSPYGATLRALVQAAVCMGLYLYLVPQYPLSRFSEP  239

Query  791  LY  796
            +Y
Sbjct  240  IY  241



>ref|XP_010934444.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X2 
[Elaeis guineensis]
Length=433

 Score =   362 bits (930),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 207/242 (86%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++E+E +A+AIGVSVPVLRFL CFVATIPVS   R VPG +  +HLYAA+TGA+LSYLSF
Sbjct  2    ELEMESIAAAIGVSVPVLRFLHCFVATIPVSLAWRLVPG-TLPKHLYAAVTGAVLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            G SSNLHFL+PM LGYASM L+R +CGIITFF+ FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GLSSNLHFLIPMALGYASMRLFRRHCGIITFFIGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK++SC +NY DGLLKE  LR+AQK+ RL+  PS+ EYIGYCLCCGSHFAGPVY
Sbjct  121  ALMVLTLKVVSCAINYGDGLLKEEGLRDAQKKYRLIHCPSIIEYIGYCLCCGSHFAGPVY  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            E+K YLEWTE KGIW  +  +R  PSP+  TLRAL+QAA CMGLYLYLVP +PL+RF++ 
Sbjct  181  EIKDYLEWTEAKGIWAHS-NDRSLPSPYGATLRALVQAAVCMGLYLYLVPQYPLSRFSEP  239

Query  791  LY  796
            +Y
Sbjct  240  IY  241



>gb|KEH31706.1| membrane-bound O-acyltransferase family MBOAT protein [Medicago 
truncatula]
Length=462

 Score =   362 bits (930),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 204/242 (84%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            +++L+ MA++IGVSV VLRFLLCFVATIP+S   RFVPG    +H Y+A  G  LSYLSF
Sbjct  2    ELQLDSMAASIGVSVAVLRFLLCFVATIPLSFFWRFVPG-RLPKHFYSAAVGVFLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPM+LGYASM++YR  CGIITFFL FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GFSSNLHFLVPMVLGYASMVIYRQRCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DG+LKE  LR+AQK+NRL+KLPS+ EY+G+CLCCGSHFAGPV+
Sbjct  121  ALMVLTLKVISCAINYNDGILKEEGLRDAQKKNRLVKLPSVIEYVGFCLCCGSHFAGPVF  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE +GIW   G + P PSP+  T+RALLQA FCMGLYL LVPYFPL +F + 
Sbjct  181  EMKDYLDWTEGQGIWS-FGAKGPKPSPYGATIRALLQAGFCMGLYLNLVPYFPLTKFTEP  239

Query  791  LY  796
             Y
Sbjct  240  SY  241



>gb|KHN34432.1| Lysophospholipid acyltransferase 2 [Glycine soja]
Length=463

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/241 (74%), Positives = 200/241 (83%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            M ++ MA++IGVSVPVLRFLLCF AT+P+S L R +P G   +HLY+A  G  LSYLSFG
Sbjct  1    MAMDSMAASIGVSVPVLRFLLCFAATVPLSFLCRLLPRGLP-KHLYSAAVGVALSYLSFG  59

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
             SSNLHFLVPM LGYASMLLYRP CGI+TFFL FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  60   VSSNLHFLVPMFLGYASMLLYRPRCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDATGA  119

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGLLKE  LREAQK+ RL+KLPSL EYIGYCLCCGSHFAGPVYE
Sbjct  120  LMVLTLKVISCAVNYNDGLLKEEGLREAQKKYRLIKLPSLIEYIGYCLCCGSHFAGPVYE  179

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YL+WTE KGIW    K  P PSP+  TLRALLQA FCM +YL LVP+FPL++F D  
Sbjct  180  MKDYLDWTEGKGIWSTEAKG-PLPSPYGATLRALLQAGFCMAMYLNLVPHFPLSKFTDPT  238

Query  794  Y  796
            Y
Sbjct  239  Y  239



>ref|XP_006417213.1| hypothetical protein EUTSA_v10007564mg [Eutrema salsugineum]
 gb|ESQ35566.1| hypothetical protein EUTSA_v10007564mg [Eutrema salsugineum]
Length=465

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/241 (72%), Positives = 200/241 (83%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            M++  MA++IGVSV VLRFLLCFVATIPVS   R VP    G+H+Y+A +GA LSYLSFG
Sbjct  4    MDMNSMAASIGVSVAVLRFLLCFVATIPVSFAWRIVPS-RLGKHVYSAASGAFLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM +GYASM +YRP CGIITFFL F YLIGCHV+YMSGDAWKEGGIDSTGA
Sbjct  63   FSSNLHFLVPMTIGYASMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DG+LKE  LREAQ +NRL+ +PSL EY GYCLCCGSHFAGPVYE
Sbjct  123  LMVLTLKVISCAINYNDGMLKEEGLREAQMKNRLIGMPSLIEYFGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YL+WTE KGIW+ + K R  PSP+  T+RA+LQAA CM LYLYLVP +PL RF + +
Sbjct  183  MKDYLQWTEGKGIWETSEK-RKRPSPYGATIRAILQAAICMALYLYLVPQYPLTRFTEPV  241

Query  794  Y  796
            Y
Sbjct  242  Y  242



>ref|XP_006857893.2| PREDICTED: lysophospholipid acyltransferase 1 [Amborella trichopoda]
Length=465

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/233 (76%), Positives = 200/233 (86%), Gaps = 2/233 (1%)
 Frame = +2

Query  98   AIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSSNLHFL  277
            +IGVSVPVLRFLLCFVATIPVS L RFVPG    +HLY+ALTGALLSYLSFGFSSNLHFL
Sbjct  11   SIGVSVPVLRFLLCFVATIPVSWLWRFVPG-RLPKHLYSALTGALLSYLSFGFSSNLHFL  69

Query  278  VPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALMVITLKI  457
            +PM LGY SML+YRP CG  TF   FGYLIGCHVYYMSGDAWKEGGID+TGALMV+TLK+
Sbjct  70   IPMSLGYLSMLVYRPLCGPFTFIAGFGYLIGCHVYYMSGDAWKEGGIDATGALMVLTLKV  129

Query  458  ISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYLEWT  637
            ISC +NY DGLLKE  LREAQK+ RL++ PSL EYIGYCLCCGSHFAGPVYEMK YLEWT
Sbjct  130  ISCSINYNDGLLKEEGLREAQKKYRLIQCPSLIEYIGYCLCCGSHFAGPVYEMKEYLEWT  189

Query  638  ERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            E  GIW P+ K RP PSP+   L+A+LQ+A CMG+YLYLVP+FPL+RF++ +Y
Sbjct  190  ENTGIWSPSDK-RPPPSPYGAALQAVLQSAVCMGIYLYLVPHFPLSRFSEPIY  241



>ref|XP_009364173.1| PREDICTED: lysophospholipid acyltransferase 1-like [Pyrus x bretschneideri]
 ref|XP_009364174.1| PREDICTED: lysophospholipid acyltransferase 1-like [Pyrus x bretschneideri]
Length=465

 Score =   362 bits (928),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/241 (74%), Positives = 203/241 (84%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA AIGVSVPVLRFLLCFVATIPVS + R VP     +HLYA  +GALLSYLSFG
Sbjct  3    LEMESMAVAIGVSVPVLRFLLCFVATIPVSFIWRLVPS-PPAKHLYAFASGALLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPMLLGYASM+  R +CGIITF L FGYLIGCHV+YMSGDAWKEGGID+TGA
Sbjct  62   FSSNLHFLVPMLLGYASMVFARNHCGIITFILGFGYLIGCHVFYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+IS  +NY DG+LKE  LRE+QK+NRL+KLPSL EY GYCLCCGSHFAGPVYE
Sbjct  122  LMVLTLKVISSAINYNDGVLKEEGLRESQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YL+ TE KGIW  + K  PSPSP+  T+RALLQAAFCM LY+YLVP FPL+RF + +
Sbjct  182  MKDYLDCTEGKGIWSYSEKG-PSPSPYGATIRALLQAAFCMALYVYLVPQFPLSRFTEPI  240

Query  794  Y  796
            Y
Sbjct  241  Y  241



>emb|CDY45972.1| BnaA09g12940D [Brassica napus]
Length=467

 Score =   361 bits (927),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/243 (71%), Positives = 197/243 (81%), Gaps = 1/243 (0%)
 Frame = +2

Query  68   RDMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLS  247
               ++  MA++IGVSV VLRFLLCFVATIPVS   RFVP    G+H+Y+A +GALLSYLS
Sbjct  2    ESFDMSSMAASIGVSVAVLRFLLCFVATIPVSFAWRFVPS-RLGKHIYSAASGALLSYLS  60

Query  248  FGFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDST  427
            FGFSSNLHFLVPM +GYASM +YRP  G ITFFL F YLIGCHV+YMSGDAWKEGGIDST
Sbjct  61   FGFSSNLHFLVPMTIGYASMAIYRPMSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDST  120

Query  428  GALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPV  607
            GALMV+TLK+ISC +NY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPV
Sbjct  121  GALMVLTLKVISCSINYNDGMLKEEGLREAQKKNRLVRMPSLIEYFGYCLCCGSHFAGPV  180

Query  608  YEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFND  787
            +EMK YLEWTE KGIW     +   PSP+  TLRA+LQA  CM LYLYLVP FPL RF +
Sbjct  181  FEMKDYLEWTEGKGIWAVTSGKGKRPSPYGATLRAILQAGICMALYLYLVPQFPLTRFTE  240

Query  788  SLY  796
             +Y
Sbjct  241  PVY  243



>ref|XP_009113025.1| PREDICTED: lysophospholipid acyltransferase 2 [Brassica rapa]
Length=467

 Score =   361 bits (927),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/243 (71%), Positives = 197/243 (81%), Gaps = 1/243 (0%)
 Frame = +2

Query  68   RDMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLS  247
               ++  MA++IGVSV VLRFLLCFVATIPVS   RFVP    G+H+Y+A +GALLSYLS
Sbjct  2    ESFDMSSMAASIGVSVAVLRFLLCFVATIPVSFAWRFVPS-RLGKHIYSAASGALLSYLS  60

Query  248  FGFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDST  427
            FGFSSNLHFLVPM +GYASM +YRP  G ITFFL F YLIGCHV+YMSGDAWKEGGIDST
Sbjct  61   FGFSSNLHFLVPMTIGYASMAIYRPMSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDST  120

Query  428  GALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPV  607
            GALMV+TLK+ISC +NY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPV
Sbjct  121  GALMVLTLKVISCSINYNDGMLKEEGLREAQKKNRLVRMPSLIEYFGYCLCCGSHFAGPV  180

Query  608  YEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFND  787
            +EMK YLEWTE KGIW     +   PSP+  TLRA+LQA  CM LYLYLVP FPL RF +
Sbjct  181  FEMKDYLEWTEGKGIWAVTSGKGKRPSPYGATLRAILQAGICMALYLYLVPQFPLTRFTE  240

Query  788  SLY  796
             +Y
Sbjct  241  PVY  243



>ref|XP_003525728.1| PREDICTED: lysophospholipid acyltransferase 2-like [Glycine max]
Length=463

 Score =   361 bits (926),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 200/241 (83%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            M ++ MA++IGVSVPVLRFLLCF AT+P+S L R +P G   +HLY+A  G  LSYLSFG
Sbjct  1    MAMDSMAASIGVSVPVLRFLLCFAATVPLSFLCRLLPRGLP-KHLYSAAVGVALSYLSFG  59

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
             SSNLHFLVPM LGYASMLL+RP CGI+TFFL FGYLIGCHVYYMSGDAWKEGGID+TGA
Sbjct  60   VSSNLHFLVPMFLGYASMLLFRPRCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDATGA  119

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGLLKE  LREAQK+ RL+KLPSL EYIGYCLCCGSHFAGPVYE
Sbjct  120  LMVLTLKVISCAVNYNDGLLKEEGLREAQKKYRLIKLPSLIEYIGYCLCCGSHFAGPVYE  179

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YL+WTE KGIW    K  P PSP+  TLRALLQA FCM +YL LVP+FPL++F D  
Sbjct  180  MKDYLDWTEGKGIWSTEAKG-PLPSPYGATLRALLQAGFCMAMYLNLVPHFPLSKFTDPT  238

Query  794  Y  796
            Y
Sbjct  239  Y  239



>emb|CDY57076.1| BnaCnng31560D [Brassica napus]
Length=465

 Score =   361 bits (926),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 197/242 (81%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
             M++  MA++IGVSV VLRFL CFVATIPVS   R VP    G+H+YAA +G  LSYLSF
Sbjct  3    SMDMNSMAASIGVSVAVLRFLQCFVATIPVSFFWRIVPS-RLGKHIYAAASGVFLSYLSF  61

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPM +GYASM +YRP CGII+FFL F YLIGCHV+YMSGDAWKEGGIDSTG
Sbjct  62   GFSSNLHFLVPMTIGYASMAMYRPKCGIISFFLGFAYLIGCHVFYMSGDAWKEGGIDSTG  121

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPVY
Sbjct  122  ALMVLTLKVISCAVNYNDGMLKEEGLREAQKKNRLIEMPSLIEYFGYCLCCGSHFAGPVY  181

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE  GIW  + K R  PSP++ TLRA+ QA  CM LYLYLVP FPL RF + 
Sbjct  182  EMKDYLQWTEGTGIWDSSEK-RKQPSPYLATLRAIFQAGICMALYLYLVPQFPLTRFTEP  240

Query  791  LY  796
            +Y
Sbjct  241  VY  242



>ref|XP_002886438.1| membrane bound O-acyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH62697.1| membrane bound O-acyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=465

 Score =   361 bits (926),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 200/241 (83%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +++  MAS+IGVSV VLRFLLCFVATIP+S L RFVP    G+H+Y+A +GA LSYLSFG
Sbjct  4    LDMNSMASSIGVSVAVLRFLLCFVATIPISFLWRFVPS-RLGKHIYSAASGAFLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM +GYASM +YRP  G+ITFFL F YLIGCHV+YMSGDAWKEGGIDSTGA
Sbjct  63   FSSNLHFLVPMTIGYASMAIYRPLSGLITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DG+LKE  LREAQK+NRL++ PSL EY GYCLCCGSHFAGPV+E
Sbjct  123  LMVLTLKVISCSINYNDGMLKEEGLREAQKKNRLIQRPSLIEYFGYCLCCGSHFAGPVFE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTE KGIW  + K +  PSP+  T+RA+ QAA CM LYLYLVP FPL RF + +
Sbjct  183  MKDYLEWTEEKGIWDVSVKGK-RPSPYGATIRAIFQAAICMALYLYLVPQFPLTRFTEPV  241

Query  794  Y  796
            Y
Sbjct  242  Y  242



>gb|KFK43529.1| hypothetical protein AALP_AA1G138000 [Arabis alpina]
Length=465

 Score =   360 bits (925),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 199/241 (83%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            M++  MA++IGVS+ VLRFLLCFVATIPVS   R VP    G+H+Y+  +GA LSYLSFG
Sbjct  4    MDMSSMAASIGVSIAVLRFLLCFVATIPVSFAWRIVPS-QLGKHVYSFASGAFLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM +GYASM +YR  CGIITFFL F YLIGCHV+YMSGDAWKEGGIDSTGA
Sbjct  63   FSSNLHFLVPMTIGYASMAIYRAKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPVYE
Sbjct  123  LMVLTLKVISCSINYNDGILKEEGLREAQKKNRLIRMPSLIEYFGYCLCCGSHFAGPVYE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTE KGIW  + K R  PSP+  T+RA+LQAA CM LYLYLVP +PL RF + +
Sbjct  183  MKDYLEWTEGKGIWDTSEK-RKQPSPYGATIRAILQAALCMALYLYLVPQYPLTRFTEPV  241

Query  794  Y  796
            Y
Sbjct  242  Y  242



>ref|XP_010255524.1| PREDICTED: lysophospholipid acyltransferase 1-like [Nelumbo nucifera]
Length=464

 Score =   360 bits (924),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 173/240 (72%), Positives = 202/240 (84%), Gaps = 2/240 (1%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            ++E MAS+I VSVPVLRFLLCFVATIPVS L R VPG +  +HLY+A +GA+LSYLSFG 
Sbjct  4    DMESMASSISVSVPVLRFLLCFVATIPVSFLWRLVPG-TIPKHLYSAASGAVLSYLSFGL  62

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            SSNLHFLV ML+GY SML+YR  CGII+FF  FGYLIGCH+YYMSGDAWKEGGID+TGAL
Sbjct  63   SSNLHFLVSMLMGYTSMLVYRRRCGIISFFTGFGYLIGCHIYYMSGDAWKEGGIDATGAL  122

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MV++LK+ISC +NY DGLLKE  LR AQK+NRLLKLP+L EY GYCLCCGSHFAGPVYEM
Sbjct  123  MVVSLKVISCAINYNDGLLKEEGLRVAQKKNRLLKLPTLVEYFGYCLCCGSHFAGPVYEM  182

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K Y+EWTERKGIW  +   +P PSP+   ++AL+QAA CM LYLYLVP FP++RF D +Y
Sbjct  183  KDYIEWTERKGIWSQS-MNKPLPSPYGAAIKALVQAAICMVLYLYLVPRFPVSRFTDPIY  241



>gb|KHG06049.1| Lysophospholipid acyltransferase 2 [Gossypium arboreum]
Length=462

 Score =   360 bits (924),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 178/242 (74%), Positives = 205/242 (85%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++ LE MA+AIGVSVPVL FLLCFVATIPVS L RFVPG +  +H+Y+A +G +LSYLSF
Sbjct  2    ELGLETMAAAIGVSVPVLWFLLCFVATIPVSFLWRFVPG-TLPKHVYSAFSGLVLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            G SSNL FLVPMLLGYA+MLLYRP CGIITFFL+FGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GISSNLLFLVPMLLGYAAMLLYRPKCGIITFFLSFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+IS  +NY DGLLKE DLREAQK+ RL+KLPSL EY GYCLCCGSHFAGPV+
Sbjct  121  ALMVLTLKVISSAINYNDGLLKEEDLREAQKKYRLVKLPSLIEYFGYCLCCGSHFAGPVF  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            E+K YLEWTE +GIW P+ K   SPSP+  T RAL+QA   M +YLYLVPY PL+RF + 
Sbjct  181  EIKDYLEWTEGEGIWAPSDKGL-SPSPYGATFRALVQAGISMAVYLYLVPYHPLSRFGEP  239

Query  791  LY  796
            +Y
Sbjct  240  VY  241



>ref|XP_009339650.1| PREDICTED: lysophospholipid acyltransferase 1-like [Pyrus x bretschneideri]
Length=461

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 202/239 (85%), Gaps = 2/239 (1%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFS  259
            +E MA+AIGVSVPVLRFLLCFVATIPVS + R VP     +HLYA  +GALLSYLSFGFS
Sbjct  1    MESMAAAIGVSVPVLRFLLCFVATIPVSFIWRLVPS-PPAKHLYAFASGALLSYLSFGFS  59

Query  260  SNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALM  439
            SNLHFLVPMLLGYASM+  R +CGIITF L FGYLIGCHV+YMSGDAWKEGGID+TGALM
Sbjct  60   SNLHFLVPMLLGYASMVFARNHCGIITFILGFGYLIGCHVFYMSGDAWKEGGIDATGALM  119

Query  440  VITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMK  619
            V+TLK+IS  +NY DG+LKE  LRE+QK+NRL+KLPSL EY GYCLCCGSHFAGPVYEMK
Sbjct  120  VLTLKVISSAINYNDGVLKEEGLRESQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVYEMK  179

Query  620  AYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
             YL+ TE KGIW  + K  PSPSP+  T+RALLQAAFCM LY+YLVP FPL+RF + +Y
Sbjct  180  DYLDCTEGKGIWSYSEKG-PSPSPYGATIRALLQAAFCMALYVYLVPQFPLSRFTEPIY  237



>ref|XP_010430382.1| PREDICTED: lysophospholipid acyltransferase 2-like [Camelina 
sativa]
Length=465

 Score =   359 bits (922),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/242 (71%), Positives = 200/242 (83%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
             ++++ MA++IGVSV VLRFLLCFVATIPVS L RFVP    G+H+YAA +GA LSYLSF
Sbjct  3    SLDMDSMAASIGVSVAVLRFLLCFVATIPVSFLWRFVPS-RLGKHIYAAASGAFLSYLSF  61

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPM +GYASM +YRP  G ITFFL F YLIGCHV+YMSGDAWKEGGIDSTG
Sbjct  62   GFSSNLHFLVPMTIGYASMAIYRPLSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTG  121

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DG+LKE  LREAQK+NRL+ +PSL EY GYCLCCGSHFAGPV+
Sbjct  122  ALMVLTLKVISCSINYNDGVLKEEGLREAQKKNRLIGMPSLIEYFGYCLCCGSHFAGPVF  181

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YLEWTE+KGIW  + K +  PSP+   +RA+ QAA CM LYLYLVP FPL RF + 
Sbjct  182  EMKDYLEWTEQKGIWGVSEKGK-RPSPYGAMIRAIFQAAICMALYLYLVPQFPLTRFTEP  240

Query  791  LY  796
            +Y
Sbjct  241  VY  242



>ref|XP_006391786.1| hypothetical protein EUTSA_v10023446mg [Eutrema salsugineum]
 gb|ESQ29072.1| hypothetical protein EUTSA_v10023446mg [Eutrema salsugineum]
Length=466

 Score =   358 bits (920),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 172/243 (71%), Positives = 198/243 (81%), Gaps = 2/243 (1%)
 Frame = +2

Query  68   RDMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLS  247
               ++  MA++IGVSV VLRFLLCFVATIPVS   R VP    G+H+Y+A +GA LSYLS
Sbjct  2    ESFDMGSMAASIGVSVAVLRFLLCFVATIPVSFAWRLVPS-RLGKHIYSAASGAFLSYLS  60

Query  248  FGFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDST  427
            FGFSSNLHFLVPM +GYASM +YRP  G ITFFL F YLIGCHV+YMSGDAWKEGGIDST
Sbjct  61   FGFSSNLHFLVPMTIGYASMAIYRPMSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDST  120

Query  428  GALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPV  607
            GALMV+TLK+ISC +NY DG+LKE  LREAQK+NRL++LPSL EY GYCLCCGSHFAGPV
Sbjct  121  GALMVLTLKVISCSINYNDGMLKEESLREAQKKNRLIQLPSLIEYCGYCLCCGSHFAGPV  180

Query  608  YEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFND  787
            +EMK YLEWTE KGIW  +GK +  PSP+  T+RA+ QAA CM LYLYLVP FPL RF +
Sbjct  181  FEMKDYLEWTEEKGIWAVSGKGK-RPSPYGATIRAIFQAAICMALYLYLVPQFPLTRFTE  239

Query  788  SLY  796
             +Y
Sbjct  240  PVY  242



>ref|XP_008646049.1| PREDICTED: lysophospholipid acyltransferase 1 [Zea mays]
 gb|AFW72782.1| hypothetical protein ZEAMMB73_982934 [Zea mays]
Length=457

 Score =   358 bits (918),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 175/241 (73%), Positives = 199/241 (83%), Gaps = 6/241 (2%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA +IGVSVPVLRFLLCF ATIP   L R VPG + GRHLYA LTGA LSYLSFG
Sbjct  3    LEMEAMAGSIGVSVPVLRFLLCFAATIPTGLLWRAVPG-AMGRHLYAGLTGATLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
             +SNL F+VPM LGY +MLL+R + G+ITF  AFG+LI CHVYYMSGDAWKEGGID+TGA
Sbjct  62   ATSNLLFVVPMTLGYLAMLLFRRHAGLITFLGAFGFLIACHVYYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DG+LKE  LR+AQK+NRL KLPSL EY GYCLCCGSHFAGPVYE
Sbjct  122  LMVLTLKVISCSINYSDGILKEEGLRDAQKKNRLTKLPSLIEYFGYCLCCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTERKGIW       P+PSP +PTLRAL+QA  CMGLYLYL P FPL+RF++ L
Sbjct  182  MKDYLEWTERKGIW-----ASPTPSPLLPTLRALVQAGICMGLYLYLSPKFPLSRFSEPL  236

Query  794  Y  796
            Y
Sbjct  237  Y  237



>ref|NP_176493.1| lysophosphatidylcholine acyltransferase [Arabidopsis thaliana]
 sp|Q9CAN8.1|MBOA2_ARATH RecName: Full=Lysophospholipid acyltransferase 2; Short=AtLPLAT2; 
AltName: Full=1-acylglycerophosphocholine O-acyltransferase 
2; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; 
AltName: Full=1-acylglycerophosphoserine O-acyltransferase; 
AltName: Full=Lysophosphatidylcholine acyltransferase 
2; Short=LPCAT2; AltName: Full=Lysophosphatidylethanolamine 
acyltransferase; Short=LPEAT; AltName: Full=Lysophosphatidylglycerol 
acyltransferase; Short=LPGAT; AltName: Full=Lysophosphatidylserine 
acyltransferase; Short=LPSAT [Arabidopsis 
thaliana]
 gb|AAG51612.1|AC010795_16 unknown protein; 29405-27288 [Arabidopsis thaliana]
 gb|AAL59903.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67512.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34045.1| lysophosphatidylcholine acyltransferase [Arabidopsis thaliana]
Length=465

 Score =   358 bits (918),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 169/241 (70%), Positives = 199/241 (83%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +++  MA++IGVSV VLRFLLCFVATIP+S L RF+P    G+H+Y+A +GA LSYLSFG
Sbjct  4    LDMNSMAASIGVSVAVLRFLLCFVATIPISFLWRFIPS-RLGKHIYSAASGAFLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM +GYASM +YRP  G ITFFL F YLIGCHV+YMSGDAWKEGGIDSTGA
Sbjct  63   FSSNLHFLVPMTIGYASMAIYRPLSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGA  122

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPV+E
Sbjct  123  LMVLTLKVISCSINYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCLCCGSHFAGPVFE  182

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTE KGIW  + K +  PSP+   +RA+ QAA CM LYLYLVP FPL RF + +
Sbjct  183  MKDYLEWTEEKGIWAVSEKGK-RPSPYGAMIRAVFQAAICMALYLYLVPQFPLTRFTEPV  241

Query  794  Y  796
            Y
Sbjct  242  Y  242



>gb|KFK40546.1| hypothetical protein AALP_AA2G010000 [Arabis alpina]
Length=467

 Score =   357 bits (917),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 199/243 (82%), Gaps = 2/243 (1%)
 Frame = +2

Query  68   RDMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLS  247
              ++L  MA+ IGVSV VLRFLLCFVATIP+S   RFVP    G+H+Y+A +GALLSYLS
Sbjct  2    ESLDLSSMAATIGVSVAVLRFLLCFVATIPISFAWRFVPS-RLGKHIYSAASGALLSYLS  60

Query  248  FGFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDST  427
            FGFSSNLHFLVPM +GYASM +YRP  G ITFFL F YLIGCH +YMSGDAWKEGGIDST
Sbjct  61   FGFSSNLHFLVPMTIGYASMAIYRPLSGFITFFLGFAYLIGCHWFYMSGDAWKEGGIDST  120

Query  428  GALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPV  607
            GALMV+TLK+ISC +NY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPV
Sbjct  121  GALMVLTLKVISCSINYTDGMLKEEGLREAQKKNRLIQMPSLIEYCGYCLCCGSHFAGPV  180

Query  608  YEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFND  787
            +EMK YLEWTE KGIW  + K +  PSP+  T+RA++QA  CMGLYLYLVP FPL RF +
Sbjct  181  FEMKDYLEWTEEKGIWAVSEKGK-RPSPYGATVRAIVQAGICMGLYLYLVPQFPLTRFTE  239

Query  788  SLY  796
             +Y
Sbjct  240  PVY  242



>ref|XP_010473534.1| PREDICTED: lysophospholipid acyltransferase 2 [Camelina sativa]
Length=465

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 198/242 (82%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
             ++++ MA++IGVSV VLRFLLCFVATIPVS L RFVP    G+H+YAA +GA LSYLSF
Sbjct  3    SLDMDSMAASIGVSVAVLRFLLCFVATIPVSFLWRFVPS-RLGKHIYAAASGAFLSYLSF  61

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPM +GYASM +Y P  G ITFFL F YLIGCHV+YMSGDAWKEGGIDSTG
Sbjct  62   GFSSNLHFLVPMTIGYASMAIYPPLSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTG  121

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DG+LKE  LREAQK+NRL+ +PSL EY GYCLCCGSHFAGPV+
Sbjct  122  ALMVLTLKVISCSINYNDGMLKEEGLREAQKKNRLIGMPSLIEYFGYCLCCGSHFAGPVF  181

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YLEWTE KGIW  + K +  PSP+   +RA+ QAA CM LYLYLVP FPL RF + 
Sbjct  182  EMKDYLEWTEEKGIWAVSEKGK-RPSPYGAMIRAIFQAAVCMALYLYLVPQFPLTRFTEP  240

Query  791  LY  796
            +Y
Sbjct  241  VY  242



>ref|XP_010693498.1| PREDICTED: lysophospholipid acyltransferase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=462

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 204/242 (84%), Gaps = 4/242 (2%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            ++++  MA+A+G+SV VLRFLLCFVATIP+S L R VP  +  +H+Y+A TG LL  +SF
Sbjct  2    NLDMSSMAAAMGLSVAVLRFLLCFVATIPISLLWRLVPR-TLPKHIYSAFTGVLLCCISF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            G SSNLHFLV +L+GY+SML+YRP CG+I FF AFGYLIGCHVYYMSGDAWKEGGID+TG
Sbjct  61   GISSNLHFLVSILIGYSSMLVYRPKCGLIAFFAAFGYLIGCHVYYMSGDAWKEGGIDATG  120

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NYQDGLLK+ DLREAQK+NRLLK+PSLFEY+GYCLCCGSHFAGPV+
Sbjct  121  ALMVLTLKVISCAINYQDGLLKDEDLREAQKKNRLLKMPSLFEYVGYCLCCGSHFAGPVF  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YL+WTE KG+W P+ K+   PSP+    RA+LQAA CM LYLYLVP FPL+ F + 
Sbjct  181  EMKDYLDWTEGKGLWSPSEKQ---PSPWGAVARAILQAAICMALYLYLVPLFPLSTFTNH  237

Query  791  LY  796
            LY
Sbjct  238  LY  239



>ref|XP_004953433.1| PREDICTED: lysophospholipid acyltransferase-like [Setaria italica]
Length=457

 Score =   356 bits (913),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 173/241 (72%), Positives = 200/241 (83%), Gaps = 6/241 (2%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA++IGVSVPVLRFLLCF ATIP   L R VPG ++GRHLYA LTGA LSYLSFG
Sbjct  3    LEMEAMAASIGVSVPVLRFLLCFAATIPTGLLWRAVPG-ATGRHLYAGLTGAALSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
             +SNL F+VPM LGY +MLL+R + G+ITF  AFG+LI CHVYYMSGDAWKEGGID+TGA
Sbjct  62   ATSNLLFVVPMALGYLAMLLFRRHAGLITFLGAFGFLIACHVYYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DG+LKE  LR+AQK+ RL KLPSL EY GYCLCCGSHFAGPVYE
Sbjct  122  LMVLTLKVISCAINYSDGILKEEGLRDAQKKYRLTKLPSLIEYFGYCLCCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YL+WTERKGIW       P+PSP +PTLRAL+QA  CMGLYLYL P FPL+RF++ L
Sbjct  182  MKDYLDWTERKGIW-----ASPTPSPLLPTLRALVQAGICMGLYLYLSPKFPLSRFSEPL  236

Query  794  Y  796
            Y
Sbjct  237  Y  237



>ref|XP_010418312.1| PREDICTED: lysophospholipid acyltransferase 2-like [Camelina 
sativa]
Length=465

 Score =   355 bits (911),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 170/242 (70%), Positives = 199/242 (82%), Gaps = 2/242 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
             ++++ MA++IGVSV VLRFLLCFVATIPVS L RFVP    G+H+YAA +GA LSYLSF
Sbjct  3    SLDMDSMAASIGVSVAVLRFLLCFVATIPVSFLWRFVPS-RLGKHIYAAASGAFLSYLSF  61

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            GFSSNLHFLVPM +GYASM ++RP  G ITFFL F YLIGCHV+YMSGDAWKEGGIDSTG
Sbjct  62   GFSSNLHFLVPMTIGYASMAIHRPLSGFITFFLGFTYLIGCHVFYMSGDAWKEGGIDSTG  121

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            ALMV+TLK+ISC +NY DG+LKE  LREAQ++NRL+ +PSL EY GYCLCCGSHFAGPV+
Sbjct  122  ALMVLTLKVISCSINYNDGVLKEEGLREAQRKNRLIGMPSLIEYFGYCLCCGSHFAGPVF  181

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YLEWTE KGIW  + K +  PSP+   +RA+ QAA CM LYLYLVP FPL RF + 
Sbjct  182  EMKDYLEWTEGKGIWAVSEKGK-RPSPYGAMIRAIFQAAICMALYLYLVPQFPLTRFTEP  240

Query  791  LY  796
            +Y
Sbjct  241  VY  242



>ref|XP_002454488.1| hypothetical protein SORBIDRAFT_04g031990 [Sorghum bicolor]
 gb|EES07464.1| hypothetical protein SORBIDRAFT_04g031990 [Sorghum bicolor]
Length=457

 Score =   354 bits (908),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/241 (72%), Positives = 199/241 (83%), Gaps = 6/241 (2%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA++IGVSVPVLRFLLCF ATIP   L R VPG ++GRHLYA LTGA LSYLSFG
Sbjct  3    LEMEAMAASIGVSVPVLRFLLCFAATIPTGLLWRAVPG-ATGRHLYAGLTGATLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
             SSNL F+VPM LGY +MLL R + G+ITF  AFG+LI CHVYYMSGDAWKEGGID+TGA
Sbjct  62   PSSNLLFVVPMTLGYLAMLLSRRHAGLITFLGAFGFLIACHVYYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DG+LKE  LR+AQK+ RL KLPSL EY GYCLCCGSHFAGPVYE
Sbjct  122  LMVLTLKVISCAINYSDGILKEEGLRDAQKKYRLTKLPSLIEYFGYCLCCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YL+WTERKGIW       P+PSP +PTLRAL+QA  CMGLYLYL P FPL+RF++ L
Sbjct  182  MKDYLDWTERKGIW-----ASPTPSPLLPTLRALVQAGVCMGLYLYLSPKFPLSRFSEPL  236

Query  794  Y  796
            Y
Sbjct  237  Y  237



>ref|XP_009391951.1| PREDICTED: lysophospholipid acyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   354 bits (908),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/232 (75%), Positives = 192/232 (83%), Gaps = 2/232 (1%)
 Frame = +2

Query  101  IGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSSNLHFLV  280
            IGVSVPVLRFL CFVATIPVS   R VPG +  RHLYAA++GA+LSYLSFG SSNLHFL+
Sbjct  12   IGVSVPVLRFLFCFVATIPVSLAWRLVPG-TLPRHLYAAVSGAVLSYLSFGASSNLHFLI  70

Query  281  PMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALMVITLKII  460
            PM + YASML  R Y G ITFF  FGYLIGCHVYYMSGDAWKEGGID+TGALMV+TLK+I
Sbjct  71   PMSVSYASMLFIRRYAGAITFFAGFGYLIGCHVYYMSGDAWKEGGIDATGALMVLTLKVI  130

Query  461  SCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYLEWTE  640
            SC +NY DGLLKE  LREAQK+NRL++ PSL EYIGYCLCCGSHFAGPVYEMK YLEWTE
Sbjct  131  SCAINYSDGLLKEESLREAQKKNRLVRCPSLVEYIGYCLCCGSHFAGPVYEMKDYLEWTE  190

Query  641  RKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
             KGIW  +    P PSP   TLRALLQAA CMGLYL LVP+FPL RFN+ +Y
Sbjct  191  HKGIWA-SSTNSPLPSPLGATLRALLQAAICMGLYLQLVPHFPLYRFNEPIY  241



>ref|XP_006300445.1| hypothetical protein CARUB_v10020125mg [Capsella rubella]
 gb|EOA33343.1| hypothetical protein CARUB_v10020125mg [Capsella rubella]
Length=531

 Score =   356 bits (913),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/241 (70%), Positives = 197/241 (82%), Gaps = 2/241 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            ++++  A++IGVSV VLRFLLCFVATIPVS   RFVP    G+H+YAA +G  LSYLSFG
Sbjct  70   LDMDSTAASIGVSVAVLRFLLCFVATIPVSFSWRFVPS-RLGKHIYAAASGVFLSYLSFG  128

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM +GYASM +YRP  G ITFFL F YLIGCHV+YMSGDAWKEGGIDSTGA
Sbjct  129  FSSNLHFLVPMTIGYASMAIYRPLSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGA  188

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPV+E
Sbjct  189  LMVLTLKVISCSINYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCLCCGSHFAGPVFE  248

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLEWTE KGIW  + K +  PSP+   +RA+ QAA CM LYLYLVP FPL RF + +
Sbjct  249  MKDYLEWTEEKGIWAVSEKGK-RPSPYGAMIRAIFQAAICMALYLYLVPQFPLTRFTEPV  307

Query  794  Y  796
            Y
Sbjct  308  Y  308



>ref|XP_003570095.1| PREDICTED: lysophospholipid acyltransferase 2 [Brachypodium distachyon]
Length=459

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 173/241 (72%), Positives = 199/241 (83%), Gaps = 6/241 (2%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+EPMA+AIGVSVPVLRFLLCF ATIP   L R VPG ++GRHLYA L+GA LSYLSFG
Sbjct  3    LEMEPMAAAIGVSVPVLRFLLCFAATIPTGLLWRAVPG-ATGRHLYAGLSGAALSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
             +SNL F+VPM LGY +MLL R + G++TF  A G+LI CHVYYMSGDAWKEGGID+TGA
Sbjct  62   ATSNLLFVVPMALGYLAMLLCRRHAGLVTFLGALGFLIACHVYYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DGLLKE  LR+AQK+ RL KLPSL EY GYCLCCGSHFAGPVYE
Sbjct  122  LMVLTLKVISCAINYSDGLLKEEGLRDAQKKYRLAKLPSLVEYFGYCLCCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YL+WTERKGIW  AG    +PSP +PTLRAL+QA  CM LYLYL P FPL+RF++ L
Sbjct  182  MKDYLDWTERKGIW--AGS---TPSPLLPTLRALVQAGICMSLYLYLSPRFPLSRFSEPL  236

Query  794  Y  796
            Y
Sbjct  237  Y  237



>ref|NP_001047723.1| Os02g0676000 [Oryza sativa Japonica Group]
 dbj|BAD29531.1| membrane bound O-acyl transferase-like [Oryza sativa Japonica 
Group]
 dbj|BAF09637.1| Os02g0676000 [Oryza sativa Japonica Group]
 gb|EEC73776.1| hypothetical protein OsI_08451 [Oryza sativa Indica Group]
 gb|EEE57566.1| hypothetical protein OsJ_07912 [Oryza sativa Japonica Group]
Length=459

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/241 (71%), Positives = 197/241 (82%), Gaps = 6/241 (2%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA+AIGVSVPVLRFLLCF ATIP   + R VPG ++GRHLYA LTGA LSYLSFG
Sbjct  3    LEMEGMAAAIGVSVPVLRFLLCFAATIPTGLMWRAVPG-AAGRHLYAGLTGAALSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
             +SNL F+VPM  GY +MLL R   G++TF  AFG+LI CH+YYMSGDAWKEGGID+TGA
Sbjct  62   ATSNLLFVVPMAFGYLAMLLCRRLAGLVTFLGAFGFLIACHMYYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLKIISC +NY DG+LKE  LR+AQK+ RL KLPSL EY GYCLCCGSHFAGPVYE
Sbjct  122  LMVLTLKIISCAINYSDGMLKEEGLRDAQKKYRLAKLPSLIEYFGYCLCCGSHFAGPVYE  181

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
            MK YLE+TERKG+W       P+PSP +PTLRAL+QA  CMGLYLYL P FPL+RF++ L
Sbjct  182  MKDYLEYTERKGLW-----ASPTPSPLLPTLRALVQAGACMGLYLYLSPQFPLSRFSEPL  236

Query  794  Y  796
            Y
Sbjct  237  Y  237



>gb|AFW72781.1| hypothetical protein ZEAMMB73_982934 [Zea mays]
Length=483

 Score =   343 bits (880),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 175/267 (66%), Positives = 199/267 (75%), Gaps = 32/267 (12%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+E MA +IGVSVPVLRFLLCF ATIP   L R VPG + GRHLYA LTGA LSYLSFG
Sbjct  3    LEMEAMAGSIGVSVPVLRFLLCFAATIPTGLLWRAVPG-AMGRHLYAGLTGATLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
             +SNL F+VPM LGY +MLL+R + G+ITF  AFG+LI CHVYYMSGDAWKEGGID+TGA
Sbjct  62   ATSNLLFVVPMTLGYLAMLLFRRHAGLITFLGAFGFLIACHVYYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC +NY DG+LKE  LR+AQK+NRL KLPSL EY GYCLCCGSHFAGPVYE
Sbjct  122  LMVLTLKVISCSINYSDGILKEEGLRDAQKKNRLTKLPSLIEYFGYCLCCGSHFAGPVYE  181

Query  614  MKAYLEWTERKG--------------------------IWKPAGKERPSPSPFVPTLRAL  715
            MK YLEWTERKG                          IW       P+PSP +PTLRAL
Sbjct  182  MKDYLEWTERKGVSVVQQLPCMGYAVLTLYLIFVNLLQIW-----ASPTPSPLLPTLRAL  236

Query  716  LQAAFCMGLYLYLVPYFPLARFNDSLY  796
            +QA  CMGLYLYL P FPL+RF++ LY
Sbjct  237  VQAGICMGLYLYLSPKFPLSRFSEPLY  263



>dbj|BAJ87726.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   342 bits (877),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 197/242 (81%), Gaps = 7/242 (3%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +E+EPMA+AIGVSVPVLRFLLCF ATIP   L R VP  ++GRHLYA L+GA LSYLSFG
Sbjct  3    LEMEPMAAAIGVSVPVLRFLLCFAATIPTGLLWRAVPS-ATGRHLYAGLSGAGLSYLSFG  61

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
             +SNL F+ PM LGY +MLL R   G++TF  AFG+LI CHVYYMSGDAWKEGGID+TGA
Sbjct  62   ATSNLLFVGPMALGYLAMLLCRRRAGLVTFLGAFGFLIACHVYYMSGDAWKEGGIDATGA  121

Query  434  LMVITLKIISCVMNYQDGLLKEND-LREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            LMV+TLK+ISC MNY DGLLKE + LR+AQK+ RL  +PSL EY GYCLCCGSHFAGPVY
Sbjct  122  LMVLTLKVISCSMNYSDGLLKEEEGLRDAQKKYRLTTMPSLVEYFGYCLCCGSHFAGPVY  181

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            EMK YLEWTERKGIW  +     +PSP +PTLRAL+QA  CMGLYLYL P FPL+RF++ 
Sbjct  182  EMKDYLEWTERKGIWASS-----TPSPLLPTLRALVQAGICMGLYLYLSPMFPLSRFSEP  236

Query  791  LY  796
            LY
Sbjct  237  LY  238



>ref|XP_002892698.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68957.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=447

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/236 (71%), Positives = 190/236 (81%), Gaps = 12/236 (5%)
 Frame = +2

Query  89   MASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSSNL  268
            MA++IGVSV VLRFLLCFVATIPVS   R VP    G+HLYAA +G LLSYLSFGFSSNL
Sbjct  1    MAASIGVSVAVLRFLLCFVATIPVSFAWRIVPS-RLGKHLYAAASGVLLSYLSFGFSSNL  59

Query  269  HFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALMVIT  448
            HFLVPM +GYASM +YRP CGIITFFL F YLIGCHV+YMSGDAWKEGGID+TGALMV+T
Sbjct  60   HFLVPMTIGYASMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDATGALMVLT  119

Query  449  LKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYL  628
            LK+ISC MNY DG+          ++NRL+++PSL EY GYCLCCGSHFAGPVYEMK YL
Sbjct  120  LKVISCAMNYNDGI----------RKNRLVQMPSLIEYFGYCLCCGSHFAGPVYEMKDYL  169

Query  629  EWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            +WTE KGIW  + K R  PSPF  T+RA+LQAA CM LYLYLVP +PL RF + +Y
Sbjct  170  QWTEGKGIWDTSEK-RKQPSPFGATIRAILQAAICMALYLYLVPQYPLTRFTEPVY  224



>ref|XP_010494450.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X2 
[Camelina sativa]
Length=449

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/241 (68%), Positives = 186/241 (77%), Gaps = 18/241 (7%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            +++  MA++IGVSV VLRFLLCFVA IPVS   R VP G  G+HLYAA +GALLSYLSFG
Sbjct  4    VDMSSMAASIGVSVAVLRFLLCFVAMIPVSFAWRIVPSGI-GKHLYAAASGALLSYLSFG  62

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            FSSNLHFLVPM +GYASM +YRP                 HV+YMSGDAWKEGGIDSTGA
Sbjct  63   FSSNLHFLVPMTIGYASMAVYRP----------------NHVFYMSGDAWKEGGIDSTGA  106

Query  434  LMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYE  613
            LMV+TLK+ISC MNY DG+LKE  LREAQK+NRL+++PSL EY GYCLCCGSHFAGPVYE
Sbjct  107  LMVLTLKVISCAMNYNDGMLKEEGLREAQKKNRLVQMPSLIEYFGYCLCCGSHFAGPVYE  166

Query  614  MKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSL  793
             K YLEWTE KGIW  + K R  PSPF  T+RA+ QAA CM LYLYLVP +PL RF + +
Sbjct  167  TKDYLEWTEGKGIWDTSNK-RKQPSPFEATVRAIFQAAICMALYLYLVPQYPLTRFTEPV  225

Query  794  Y  796
            Y
Sbjct  226  Y  226



>gb|ABK24304.1| unknown [Picea sitchensis]
Length=465

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/239 (69%), Positives = 196/239 (82%), Gaps = 4/239 (2%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFS  259
            +E +A+ +G+SVPVLRFL+CFVATIPVS   RF+     GRHLY+A TGA LSYLSFGFS
Sbjct  7    MERVAAIMGLSVPVLRFLMCFVATIPVSWACRFM---GRGRHLYSAFTGAFLSYLSFGFS  63

Query  260  SNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALM  439
            SNLHFLVP+ +GY SML  R + G ITFFLAFGYLIGCHVYYMSGDAWK+GGID+TGALM
Sbjct  64   SNLHFLVPISVGYGSMLFCRRHSGRITFFLAFGYLIGCHVYYMSGDAWKQGGIDATGALM  123

Query  440  VITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMK  619
            V+TLK+IS  +NYQDGLLKE+ LRE+QK+NRLL  PS  EY+GYCLCCGSHFAGPVYEMK
Sbjct  124  VLTLKVISSAVNYQDGLLKEDGLRESQKKNRLLNCPSFIEYLGYCLCCGSHFAGPVYEMK  183

Query  620  AYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
             YL+W E KG+W P+ +  P  + +   LRAL QAAFCMG+YLYL  +FPL+RF++ +Y
Sbjct  184  DYLDWAENKGVWSPSSERSPPSA-YGGMLRALAQAAFCMGMYLYLASHFPLSRFSEPVY  241



>ref|XP_007023107.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
2 [Theobroma cacao]
 gb|EOY25729.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
2 [Theobroma cacao]
Length=417

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 167/192 (87%), Gaps = 2/192 (1%)
 Frame = +2

Query  221  TGALLSYLSFGFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDA  400
            TGALLSYLSFGFSSNLHFLVPM+LGYA+M+LYRP CG+ITFFL FGYLIGCHVYYMSGDA
Sbjct  7    TGALLSYLSFGFSSNLHFLVPMVLGYAAMVLYRPKCGVITFFLGFGYLIGCHVYYMSGDA  66

Query  401  WKEGGIDSTGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLC  580
            WKEGGID+TGALMV+TLK+ISC +NY DGLLKE  LREAQK+NRL+KLPSL EY GYCLC
Sbjct  67   WKEGGIDATGALMVLTLKVISCAINYNDGLLKEEGLREAQKKNRLIKLPSLIEYFGYCLC  126

Query  581  CGSHFAGPVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVP  760
            CGSHFAGPVYEMK YL+WTE KGIW  A  ++ SPSP+  T RAL+QA+ CM  YLYLVP
Sbjct  127  CGSHFAGPVYEMKDYLDWTEGKGIW--AHSDKRSPSPYGATFRALVQASICMAFYLYLVP  184

Query  761  YFPLARFNDSLY  796
            Y PL RF + +Y
Sbjct  185  YHPLTRFTEPIY  196



>ref|XP_001780460.1| predicted protein [Physcomitrella patens]
 gb|EDQ54750.1| predicted protein [Physcomitrella patens]
Length=468

 Score =   268 bits (685),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 165/224 (74%), Gaps = 2/224 (1%)
 Frame = +2

Query  125  RFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSSNLHFLVPMLLGYAS  304
            RFLLCFV +IP S L RF+P G   R +YA  TG LLSY SFG  +NL F+ P+ +GY S
Sbjct  19   RFLLCFVGSIPCSALARFMPSGRV-RSVYAVATGILLSYYSFGPEANLFFIPPIAVGYGS  77

Query  305  MLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALMVITLKIISCVMNYQD  484
            MLL   +CG ITF +AF +L+ CHV  +SGDAWK GGID+TGALMV+TLK+IS  M+YQD
Sbjct  78   MLLAPRHCGAITFVVAFAFLLTCHVMMLSGDAWKNGGIDTTGALMVLTLKVISASMSYQD  137

Query  485  GLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYLEWTERKGIWKPA  664
            GL+K+ DLR +QK+NRL +LPSL +Y+GYCL CG+H AGPVYE++ Y++WTE KG+W   
Sbjct  138  GLVKKEDLRVSQKKNRLKELPSLVQYLGYCLNCGTHLAGPVYEIRDYIDWTEDKGLWS-R  196

Query  665  GKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
               RP PSP+   LRAL QAA CM +Y+ L+P  PL+ F+   Y
Sbjct  197  DSARPLPSPYGAALRALFQAALCMAVYMTLLPRIPLSMFDSPEY  240



>ref|XP_001763507.1| predicted protein [Physcomitrella patens]
 gb|EDQ71696.1| predicted protein [Physcomitrella patens]
Length=466

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 168/233 (72%), Gaps = 3/233 (1%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFS  259
            +E +A  +G+ VPVL FL  FVA+IPVS L RF PG  + RHLYAA +GA L++ +FG+ 
Sbjct  1    MEDVAGTLGIGVPVLWFLASFVASIPVSWLWRFAPG-VAARHLYAAASGAFLAHCAFGYE  59

Query  260  SNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALM  439
            +NL+ ++P+ + Y +M+L R  CG+++   AFG+L+ CHV +MSGDAWK GGID TG++M
Sbjct  60   ANLYMMIPICVSYGAMMLNRRMCGVVSAIFAFGFLVYCHVMFMSGDAWKSGGIDHTGSMM  119

Query  440  VITLKIISCVMNYQDGLLKEND-LREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            V+TLK+ S   NYQDGL+K+ D LREAQK+ RL K PS   Y+GYC  CGS   GPV+E+
Sbjct  120  VLTLKVTSAAFNYQDGLIKDGDSLREAQKKYRLEKPPSFIAYLGYCYNCGSILVGPVFEL  179

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLA  775
            + Y++WTE KG+W P  ++RP P P+  T   +++A  CMG+Y+Y+   FPL+
Sbjct  180  RDYMDWTEDKGLWDPKAEKRP-PQPYGATFLVVVKAFICMGIYMYITGTFPLS  231



>ref|XP_006665020.1| PREDICTED: lysophospholipid acyltransferase-like [Oryza brachyantha]
Length=388

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 139/171 (81%), Gaps = 5/171 (3%)
 Frame = +2

Query  284  MLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALMVITLKIIS  463
            M  GY +MLL R   G+ITF  AFG+LI CHVYYMSGDAWKEGGID+TGALMV+TLKIIS
Sbjct  1    MAFGYLAMLLCRRLAGLITFLGAFGFLIACHVYYMSGDAWKEGGIDATGALMVLTLKIIS  60

Query  464  CVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYLEWTER  643
            C +NY DG+LKE  LR+AQK+ RL KLPSL EY GYCLCCGSHFAGPVYEMK YLE+TER
Sbjct  61   CAINYSDGMLKEEGLRDAQKKYRLTKLPSLIEYFGYCLCCGSHFAGPVYEMKDYLEYTER  120

Query  644  KGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            KGIW       P+PSP +PTLRAL+QA  CMGLYLYL P FPL+RF++ LY
Sbjct  121  KGIW-----ASPTPSPLLPTLRALVQAGACMGLYLYLSPQFPLSRFSEPLY  166



>ref|XP_001751825.1| predicted protein [Physcomitrella patens]
 gb|EDQ83260.1| predicted protein [Physcomitrella patens]
Length=469

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/235 (51%), Positives = 171/235 (73%), Gaps = 3/235 (1%)
 Frame = +2

Query  74   MELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFG  253
            + +  +A A+G+ +PVL FL+ F+A+IPVS L RFV G  + RHLYAA +GALLS+ +FG
Sbjct  2    ITMRDVAGALGIGIPVLWFLMAFMASIPVSWLRRFVRG-VTARHLYAAASGALLSHCAFG  60

Query  254  FSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            + SNL+ +VP+ + Y +M++ R  CG+I+   AFG+LI CHV +MSGDAWK GGID TG+
Sbjct  61   YESNLYLMVPICVSYGAMVVSRRMCGVISAVFAFGFLIYCHVMFMSGDAWKSGGIDHTGS  120

Query  434  LMVITLKIISCVMNYQDGLLK-ENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            +MV+TLK+ S   NYQDGL+K E  LREAQK++RL KLPS   Y+GYC  CG+   GPV+
Sbjct  121  MMVLTLKVTSAAFNYQDGLIKDEESLREAQKKSRLGKLPSFLAYLGYCFNCGTILVGPVF  180

Query  611  EMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLA  775
            E++ Y++WTE KG+W P  + +P PSP+     A ++A  CMG+Y+Y+   +PL+
Sbjct  181  ELRDYMDWTEDKGLWDPQAENQP-PSPYAAAFLAAVKAFVCMGIYMYMTGTYPLS  234



>gb|KJB68448.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=359

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 116/137 (85%), Gaps = 1/137 (1%)
 Frame = +2

Query  386  MSGDAWKEGGIDSTGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYI  565
            MSGDAWK+GGID+TGALMV+TLK+ISC MNY DGLLKE DLREAQK+NRL+KLPSL EY 
Sbjct  1    MSGDAWKQGGIDATGALMVLTLKVISCAMNYNDGLLKEEDLREAQKKNRLIKLPSLIEYF  60

Query  566  GYCLCCGSHFAGPVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLY  745
            GYCLCCGSHFAGPVYEMK YL+WTE KGIW  + K  PSPSP+V TLRAL+QAAFCM ++
Sbjct  61   GYCLCCGSHFAGPVYEMKDYLDWTEGKGIWAHSDKG-PSPSPYVATLRALVQAAFCMAMF  119

Query  746  LYLVPYFPLARFNDSLY  796
            LYL P  PL+ F D  Y
Sbjct  120  LYLSPSHPLSWFIDPAY  136



>gb|EMT11337.1| hypothetical protein F775_10016 [Aegilops tauschii]
Length=374

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 103/126 (82%), Gaps = 6/126 (5%)
 Frame = +2

Query  422  STGALMVITLKIISCVMNYQDGLLKEND-LREAQKQNRLLKLPSLFEYIGYCLCCGSHFA  598
             +GALMV+TLK+ISC MNY DGLLKE + LR+AQK+ RL KLPSL EY GYCLCCGSHFA
Sbjct  2    DSGALMVLTLKVISCSMNYSDGLLKEEEGLRDAQKKYRLAKLPSLVEYFGYCLCCGSHFA  61

Query  599  GPVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLAR  778
            GPVYEMK YLEWTERKGIW  +     +PSP +PTLRAL+QA  CMGLYLYL P FPL+R
Sbjct  62   GPVYEMKDYLEWTERKGIWASS-----TPSPLLPTLRALVQAGICMGLYLYLSPMFPLSR  116

Query  779  FNDSLY  796
            F++ LY
Sbjct  117  FSEPLY  122



>gb|EMS54344.1| hypothetical protein TRIUR3_33673 [Triticum urartu]
Length=386

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 104/126 (83%), Gaps = 6/126 (5%)
 Frame = +2

Query  422  STGALMVITLKIISCVMNYQDGLLKEND-LREAQKQNRLLKLPSLFEYIGYCLCCGSHFA  598
            + GALMV+TLK+ISC MNY DGLLKE + LR+AQK+ RL KLPSL EY GYCLCCGSHFA
Sbjct  14   NAGALMVLTLKVISCSMNYSDGLLKEEEGLRDAQKKYRLAKLPSLVEYFGYCLCCGSHFA  73

Query  599  GPVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLAR  778
            GPVYEMK YLEWTERKGIW  AG    +PSP +PTLRAL+QA  CMGLYLYL P FPL+R
Sbjct  74   GPVYEMKDYLEWTERKGIW--AGS---TPSPLLPTLRALVQAGICMGLYLYLSPMFPLSR  128

Query  779  FNDSLY  796
            F++ LY
Sbjct  129  FSEPLY  134



>ref|XP_007023108.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
3 [Theobroma cacao]
 gb|EOY25730.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
3 [Theobroma cacao]
Length=339

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +2

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MV+TLK+ISC +NY DGLLKE  LREAQK+NRL+KLPSL EY GYCLCCGSHFAGPVYEM
Sbjct  1    MVLTLKVISCAINYNDGLLKEEGLREAQKKNRLIKLPSLIEYFGYCLCCGSHFAGPVYEM  60

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            K YL+WTE KGIW  A  ++ SPSP+  T RAL+QA+ CM  YLYLVPY PL RF + +Y
Sbjct  61   KDYLDWTEGKGIW--AHSDKRSPSPYGATFRALVQASICMAFYLYLVPYHPLTRFTEPIY  118



>ref|XP_005649636.1| membrane bound O-acyl transferase family protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25092.1| membrane bound O-acyl transferase family protein [Coccomyxa subellipsoidea 
C-169]
Length=499

 Score =   179 bits (455),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/234 (38%), Positives = 135/234 (58%), Gaps = 2/234 (1%)
 Frame = +2

Query  95   SAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSSNLHF  274
             A G+ V +LRF + FVA++PV  L +F+P    G+H +A +TG  L Y  FG    LH 
Sbjct  21   EATGIHVSLLRFAISFVASVPVGALFKFIPT-VRGKHTFAIVTGFALLYYPFGIGV-LHL  78

Query  275  LVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALMVITLK  454
            LVP  L Y  ML  R     +++ + F YLI CHV   SG  WKEG +D TGA+MV+ LK
Sbjct  79   LVPTFLTYLVMLQVRENSATLSWVINFAYLIACHVAASSGSKWKEGQVDFTGAMMVLALK  138

Query  455  IISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYLEW  634
            +IS  ++YQDGL K  +L   Q+ ++L ++PS+ E++ +    G+  AGP +E+  YL +
Sbjct  139  LISAGVSYQDGLRKSEELTPYQQAHKLTQMPSVLEWLSFTFASGNLLAGPYFELADYLNF  198

Query  635  TERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
             ++KG W P  K+  + S +       L+A  C+G++ + V Y P+   N   Y
Sbjct  199  IQKKGPWDPRSKQPTAASQYKAGALRFLKALICLGVHFFFVQYLPIDILNSEWY  252



>gb|KFK23829.1| hypothetical protein AALP_AAs39384U000100 [Arabis alpina]
Length=129

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 95/129 (74%), Gaps = 8/129 (6%)
 Frame = +2

Query  68   RDMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLS  247
              ++L  MA++IGVSV VLRF LC VAT  +S   RFVP    G+H+Y+A +GALLSY+S
Sbjct  2    ESLDLSSMAASIGVSVAVLRFFLCLVATNLISFAWRFVPS-RLGKHIYSAASGALLSYVS  60

Query  248  FGFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGC-------HVYYMSGDAWK  406
            FGFSSNLHFLVPM +GYASM +YRP  G ITFFL F YL+GC       H +YMSGDAWK
Sbjct  61   FGFSSNLHFLVPMTIGYASMTIYRPLSGFITFFLGFAYLVGCKVVILCSHWFYMSGDAWK  120

Query  407  EGGIDSTGA  433
             GGIDSTG 
Sbjct  121  GGGIDSTGT  129



>ref|XP_005850438.1| hypothetical protein CHLNCDRAFT_20761 [Chlorella variabilis]
 gb|EFN58336.1| hypothetical protein CHLNCDRAFT_20761 [Chlorella variabilis]
Length=485

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 109/191 (57%), Gaps = 4/191 (2%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            EL   ASA G+++   RF + F+ ++ V    R VP    GRH ++ +TG LL Y  FG 
Sbjct  17   ELNACASA-GLTISQFRFTVAFLLSVLVGAFLRVVP--RRGRHAFSVVTGFLLIYYPFG-  72

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            +  +H  VP  L Y  M  +R +CG + + +AF YLI  HV   SG AWKEG +D TGA 
Sbjct  73   NGCIHAFVPSALVYFCMCRFRTHCGTLAWLIAFPYLILAHVMQASGVAWKEGHLDFTGAQ  132

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MV+TL++I+  ++YQDG      L E   + +L +LPSL EY  Y    G+  AGP +E 
Sbjct  133  MVLTLRLIAVAVSYQDGTKPPERLSEYASKKQLRQLPSLLEYFSYLFAAGNLLAGPFFEA  192

Query  617  KAYLEWTERKG  649
              Y ++ +RK 
Sbjct  193  HDYFDYVDRKA  203



>gb|AFW72780.1| hypothetical protein ZEAMMB73_982934 [Zea mays]
Length=101

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
             +E+E MA +IGVSVPVLRFLLCF ATIP   L R VPG + GRHLYA LTGA LSYLSF
Sbjct  2    GLEMEAMAGSIGVSVPVLRFLLCFAATIPTGLLWRAVPG-AMGRHLYAGLTGATLSYLSF  60

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLI  367
            G +SNL F+VPM LGY +MLL+R + G+ITF  AFG+LI
Sbjct  61   GATSNLLFVVPMTLGYLAMLLFRRHAGLITFLGAFGFLI  99



>ref|XP_011398849.1| Membrane-bound O-acyltransferase domain-containing protein 2 
[Auxenochlorella protothecoides]
 gb|KFM25953.1| Membrane-bound O-acyltransferase domain-containing protein 2 
[Auxenochlorella protothecoides]
Length=456

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 104/185 (56%), Gaps = 3/185 (2%)
 Frame = +2

Query  194  SGRHLYAALTGALLSYLSFGFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGC  373
              RH YA +TG LL Y  FG +  LH LVP  L Y +M  +  +CG + + +AF YLI  
Sbjct  10   QARHWYAVITGFLLIYYPFG-TGVLHALVPSSLIYLAMCAFPTHCGTLAWLIAFPYLIMN  68

Query  374  HVYYMSGDAWKEGGIDSTGALMVITLKIISCVMNYQDGLLK-ENDLREAQKQNRLLKLPS  550
            HV+  SG +WKEG +D TGA MV+TLK+++  + YQDG    +   R  +   RL +LPS
Sbjct  69   HVFQASGLSWKEGQLDFTGAQMVLTLKLVAIGVCYQDGRTHADKHDRPYRAAMRLDRLPS  128

Query  551  LFEYIGYCLCCGSHFAGPVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAF  730
            L EY  YC   G+  AGP +E K Y ++ ER+G W  A   R   S     LR  L+ A 
Sbjct  129  LLEYYSYCFASGNLLAGPFFEAKEYFDFIERRGDWDEAAHGRLQSSLLPGALR-FLRGAA  187

Query  731  CMGLY  745
            C  L+
Sbjct  188  CATLW  192



>gb|KDD76279.1| membrane-bound O-acyltransferase [Helicosporidium sp. ATCC 50920]
Length=522

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 80/231 (35%), Positives = 118/231 (51%), Gaps = 15/231 (6%)
 Frame = +2

Query  92   ASAIGVSVPVLRFLLCFVATIPVSCLHRFVPG----------GSSGRHLYAALTGALLSY  241
            A ++G+S+   RF + F+A++ V    R +            G+   H++  LTG  L Y
Sbjct  19   AESVGLSLSQFRFAISFLASVLVGFGLRHIRSRQGAFALFWKGAVSEHIF--LTGFALIY  76

Query  242  LSFGFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGID  421
              FG +   H +    L YA M  +R +CG +T+   F YLI  HV   SG +W++G +D
Sbjct  77   YPFG-NGVFHAVFTSALTYAIMSRFRTHCGTLTWMTIFPYLIANHVLQASGLSWEKGELD  135

Query  422  STGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAG  601
             TGA MV+TL++I+  + YQDG      LR     NRL +LP   E+  YC   G+  AG
Sbjct  136  FTGAQMVLTLRLIAAAVCYQDGARSIEKLRPYAVGNRLEELPGALEFFAYCFASGNLLAG  195

Query  602  PVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYL  754
            P YE+K +L++   +G W   GK  P PS   P L  L +   C   +L +
Sbjct  196  PFYEIKDFLDYASSRGDWAADGK--PQPSCLRPALLRLAKGLLCAAAWLAM  244



>ref|XP_002500677.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61935.1| predicted protein [Micromonas sp. RCC299]
Length=494

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 115/202 (57%), Gaps = 5/202 (2%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFS  259
            +EP A   G+    + F     A++P+  + + +P   + +++Y+ ++G LLS  +FG S
Sbjct  18   VEPFAQMSGIPPGTVLFTFALWASLPLGAVFQLIPW-PTLKNVYSFVSGVLLSLFAFG-S  75

Query  260  SNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALM  439
            S     V  +  YA+M++ R  CG + F  +F YLI  H +  SG+AWK G ID TG LM
Sbjct  76   STYTCAVLGIFSYAAMVIDRKRCGYVVFAGSFAYLIYFHAFSASGEAWKAGNIDITGLLM  135

Query  440  VITLKIISCVMNYQD-GLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            V+TLK+ +C +NYQD G + E++  + Q++  +  LP + EY G+ +   +   GP  E 
Sbjct  136  VLTLKVTACALNYQDSGTIAESERNDFQRRRAVETLPGVIEYAGWLMFPCTLVVGPAIEF  195

Query  617  KAYLEWTERKGIWKPAGKERPS  682
            + Y +W  +KG+W   GK  PS
Sbjct  196  RDYHDWLHKKGVW--GGKGCPS  215



>ref|XP_006386564.1| hypothetical protein POPTR_0002s14510g [Populus trichocarpa]
 gb|ERP64361.1| hypothetical protein POPTR_0002s14510g [Populus trichocarpa]
Length=88

 Score =   115 bits (289),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFS  259
            +E MA+ IGVSVPVLRFLLCFV  IPVS +HRFV     G+HLYAAL+GA LSYLS GFS
Sbjct  1    MESMAATIGVSVPVLRFLLCFVVMIPVSFIHRFVLS-PFGKHLYAALSGAFLSYLSSGFS  59

Query  260  SNLHFLVPMLLGYASMLLYRPYCGIITF  343
            SNLHFLV MLLGY SM+L+  YC I+ F
Sbjct  60   SNLHFLVSMLLGYLSMVLFWSYCEILEF  87



>ref|XP_003064354.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51259.1| predicted protein [Micromonas pusilla CCMP1545]
Length=497

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 115/230 (50%), Gaps = 2/230 (1%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSS  262
             P++  +GV    + F L   A++P+    RF+      ++LY  L G  LS  +FG S+
Sbjct  11   RPLSGPLGVPPGTVLFTLALFASLPIGAGFRFIES-PVLKNLYGLLAGTFLSVFAFG-SA  68

Query  263  NLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALMV  442
                 V     YA+M  +R  CG I    AF YLI  H    SG+AWK G ID TG LMV
Sbjct  69   TASVFVFGAASYAAMAAHRKRCGAIVGVGAFAYLIYFHATSSSGEAWKAGNIDITGLLMV  128

Query  443  ITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKA  622
            +TLK+ +C +NYQD     + L + QK+  +  LP+  +Y  + +   +   GP  E + 
Sbjct  129  LTLKVTACALNYQDAAAPLDRLSDFQKRRAVTTLPNPLDYAAWLVFPCTLVVGPALEFRD  188

Query  623  YLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPL  772
            Y +W   KG+W    +    PS FV  ++    A F M ++LY+   + +
Sbjct  189  YSDWLRGKGVWDKNHRNGGCPSVFVQAMKTAAYATFFMTIHLYVATIYTI  238



>gb|EMT11338.1| hypothetical protein F775_10017 [Aegilops tauschii]
Length=94

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  89   MASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSSNL  268
            MA+AIGVSVPVLRFLLCF ATIP   L R VP  ++GRHLYA L+GA LSYLSFG +SNL
Sbjct  1    MAAAIGVSVPVLRFLLCFAATIPTGLLWRAVPS-ATGRHLYAGLSGAALSYLSFGATSNL  59

Query  269  HFLVPMLLGYASMLLYRPYCGIITFFLAFGYLI  367
             F+ PM LGY SMLL R   G++TF  AFG+LI
Sbjct  60   LFVGPMALGYLSMLLCRRRAGLVTFLGAFGFLI  92



>gb|KIY98914.1| hypothetical protein MNEG_9048 [Monoraphidium neglectum]
Length=529

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 119/228 (52%), Gaps = 5/228 (2%)
 Frame = +2

Query  74   MELEPMASAI-GVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            M+ E  A  +  +++  +RF + F+A I    L R +    + R+LY+   G LL Y  F
Sbjct  1    MDWEVQAQQVTALTLDQVRFAVSFLACIVAGILIRGLRS-PTARNLYSLAVGLLLLYYPF  59

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            G S  +H ++   + Y  M L    CG   + + F YL+  H    SG +W +G +D TG
Sbjct  60   G-SGIVHVVLTSWVTYIVMWLIPKKCGTWAWLINFPYLLMLHTINASGVSWNKGVLDPTG  118

Query  431  ALMVITLKIISCVMNYQDGLLKE-NDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPV  607
            A MV+TLK+IS  M  QD   K+   + + QK + L KLPSL E+ GY  C G+  AGP+
Sbjct  119  AQMVLTLKLISTAMCLQDSKEKKLEAMSDYQKSHHLKKLPSLLEFFGYVFCFGNLLAGPI  178

Query  608  YEMKAYLEWTERKGIWKP-AGKERPSPSPFVPTLRALLQAAFCMGLYL  748
             E K Y ++    G+W P A K+ P    F+  +RA + A     LY+
Sbjct  179  IEFKDYQDFINHTGLWDPRAPKKVPVSGCFLQGVRATVTALLAAALYI  226



>ref|XP_003084126.1| Predicted membrane protein (ISS) [Ostreococcus tauri]
 emb|CAL58542.1| Membrane bound O-acyl transferase, MBOAT [Ostreococcus tauri]
Length=475

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 102/194 (53%), Gaps = 11/194 (6%)
 Frame = +2

Query  200  RHLYAALTGALLSYLSFGFSSNL--HFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGC  373
            R +YA L G  LS +SFG  + +  HF     + YA M L R  CG++ F  +F YLI  
Sbjct  64   RSVYALLAGVALSLMSFGRQTVVCAHFGA---VAYAVMALARRRCGVVVFLGSFAYLIRF  120

Query  374  HVYYMSGDAWKEGGIDSTGALMVITLKIISCVMNYQDG-LLKENDLREAQKQNRLLKLPS  550
            HV   + + WK G +D +G LMV+TLK+ +C MNYQDG  +  +++ E Q +  L  LP+
Sbjct  121  HVMADTANTWKAGEVDISGLLMVMTLKVTACAMNYQDGATVAASEMTEHQHRRHLKTLPN  180

Query  551  LFEYIGYCLCCGSHFAGPVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAF  730
            + +Y  + +   +  +GP  E + Y +W   +G+W        +PS    T +    AA 
Sbjct  181  VLDYASWLMFPCTLVSGPAVEFRDYSDWLNGRGVWSG-----EAPSRVAATAKKFFGAAT  235

Query  731  CMGLYLYLVPYFPL  772
            C+ L+  L   + L
Sbjct  236  CVALFQVLSVKYTL  249



>ref|XP_001422221.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00538.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=402

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 82/152 (54%), Gaps = 6/152 (4%)
 Frame = +2

Query  293  GYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALMVITLKIISCVM  472
             YA+ML  R  CG + F  +F YL+  H    +  AWK G +D +G LMV+ LK+ +C +
Sbjct  21   AYATMLATRRRCGYVVFAGSFAYLMRYHFVADTATAWKSGEVDISGLLMVLVLKVTACAL  80

Query  473  NYQD-GLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYLEWTERKG  649
            NYQD    K +++ E Q +  L +LPS  +Y  + +   +  +GP  E + Y +W   +G
Sbjct  81   NYQDAATTKASEMSEFQNRRHLKRLPSALDYASWLMFPCTLVSGPAIEFRDYSDWLRDRG  140

Query  650  IWKPAGKERPSPSPFVPTLRALLQAAFCMGLY  745
            ++      R +P+   P  R LL A  C+G+Y
Sbjct  141  VY-----ARGTPNRVAPATRKLLGAIACLGIY  167



>ref|XP_002950776.1| hypothetical protein VOLCADRAFT_120919 [Volvox carteri f. nagariensis]
 gb|EFJ48091.1| hypothetical protein VOLCADRAFT_120919 [Volvox carteri f. nagariensis]
Length=625

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 100/190 (53%), Gaps = 3/190 (2%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSS  262
            E ++SA G+S+   RF L   A++ +    R +   ++ RHLYA +TG  + Y  FG S 
Sbjct  5    EQLSSATGLSLSQFRFTLALFASVLLVAGIRLLRN-TTLRHLYALVTGVAIIYYPFG-SG  62

Query  263  NLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALMV  442
             +H L   +  Y ++ L     G + +   F YLI  HV   SG++WK G +D TG  MV
Sbjct  63   IIHVLPMAVAAYLALHLAPRRAGAVAWCTVFPYLIYLHVVNASGESWKTGNMDFTGGAMV  122

Query  443  ITLKIISCVMNYQDGLLK-ENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMK  619
              LK++S  +  QD   K + DL   Q  ++L+  P+L E++ Y    G+  AGP +E  
Sbjct  123  AVLKLVSICVCRQDSFRKNKEDLSAYQAAHQLVSTPTLLEFLSYLFGLGNLLAGPFFEFS  182

Query  620  AYLEWTERKG  649
             Y E+ E KG
Sbjct  183  EYKEFIELKG  192



>ref|XP_007511041.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66601.1| predicted protein [Bathycoccus prasinos]
Length=556

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/244 (29%), Positives = 113/244 (46%), Gaps = 29/244 (12%)
 Frame = +2

Query  128  FLLCFVATIPVSCLHRFVPGGSSG------RHLYAALTGALLSYLSFGFSSNLHFLVPM-  286
            F +   + +P+  L R + GG         + L + ++G ++S ++FG ++   F + + 
Sbjct  64   FTVALFSGLPLGVLFRTIQGGDRKGSQFQRKALLSLVSGTMISLMTFGKTTVHAFYLSLP  123

Query  287  ---LLGYASML-----------LYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDS  424
               LL   S               R   G +TF  +FGYL+  H    SG  WK G ID 
Sbjct  124  SLCLLKLTSSTKAGDSKTKSERRKRIGVGFVTFLWSFGYLVYIHYSADSGGEWKRGNIDI  183

Query  425  TGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGP  604
            TG LMV+ LK  SC MN++D  +K+ +     K++ L + P   EY+ +C+   +  +GP
Sbjct  184  TGLLMVLCLKTTSCAMNFEDYEIKDEEKSSFMKEHELSEAPKTLEYLAWCMFPCTLVSGP  243

Query  605  VYEMKAYLEWTERKGIWKPAGKE-------RPSPSPF-VPTLRALLQAAFCMGLYLYLVP  760
              E K +  W   +GI+ P           R  P  + V T++  + A  C+GL+LYL  
Sbjct  244  TLEFKTFRMWLREEGIFDPNSPRNKLTHYARGWPRTWMVLTMQRFIGAMICLGLHLYLAN  303

Query  761  YFPL  772
               L
Sbjct  304  IVSL  307



>ref|XP_003283301.1| hypothetical protein DICPUDRAFT_52171 [Dictyostelium purpureum]
 gb|EGC40111.1| hypothetical protein DICPUDRAFT_52171 [Dictyostelium purpureum]
Length=470

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 116/240 (48%), Gaps = 9/240 (4%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            +L+    + G     ++ ++C +A+ P + L R +P  +  +H+     G      S G 
Sbjct  3    DLDAYLGSFGFPADQIKTVICLLASYPFAYLLRKLPNANL-KHMLNIFLGIAYCTWSLGQ  61

Query  257  SSNLHFLVPMLLGYAS-MLLYRPYCGIITFFLAFGYLIGCHVYYMSGD--AWKEGGIDST  427
             S +H  +  L+ Y   M+L R Y  ++ F    GYL   H+Y +  D   W    +D T
Sbjct  62   WSWVHSFISSLISYGLLMVLPRRYSQLVVFAFCLGYLSVSHIYRIWTDYMGWT---LDFT  118

Query  428  GALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPV  607
            G  M++TLK+ S   N  DG   +N+L   QK+  + KLP+L E+ G+     +  AGP 
Sbjct  119  GPQMILTLKLTSFAWNLSDGSKPDNELSSDQKRRSIKKLPNLLEFFGFVYFFPTFLAGPT  178

Query  608  YEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFND  787
             E+  YL++T  K ++K    +   P+ F+P+++ L    F    ++ L  YFP+    D
Sbjct  179  IEITDYLDYTSGK-MFKDEKLKGKIPNSFLPSMKTLGYGLFVFP-FVILSGYFPVLDLAD  236



>ref|XP_002180603.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48011.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=499

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/243 (32%), Positives = 121/243 (50%), Gaps = 19/243 (8%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            +++ ++ AIG  V  L + L      P++ +   +P G   RHL++ L GA L   + G 
Sbjct  39   QVQALSDAIGFDVETLNYCLGLFLCYPLALIMNTIPYGQL-RHLFSFLLGAFLLQFTLGV  97

Query  257  SSNLHFLVPMLLGYASM-LLYRPYCGIITFFLAFGYLIGCHVY-----YMSGDAWKEGGI  418
               +H LV  L+ Y  + +L R     +    A  YL+  H++     Y+  D      +
Sbjct  98   QW-IHQLVTSLIAYGLLAILPRQTTSTLVPLFAMLYLVMGHLHRQYTNYLGYD------L  150

Query  419  DSTGALMVITLKIISCVMNYQDG--LLKENDLREAQK--QNRLLKLPSLFEYIGYCLCCG  586
            D TGA MV+T K+     N  DG  L +  D + A+K  +  L +LP+L E++GY  C  
Sbjct  151  DFTGAQMVLTQKLYMIAYNLYDGEVLSQGKDSKAAKKCSEYALPQLPNLIEFLGYTFCFS  210

Query  587  SHFAGPVYEMKAYLEWTERKGIWKPAGKERPS-PSPFVPTLRALLQAAFCMGLYLYLVPY  763
            +  +GPV+E   Y +    + ++  AGK R   PS   PTLR LL +   MGL+++L   
Sbjct  211  NVLSGPVFEFSVYRDVCSGQILFDDAGKPRGKIPSNVWPTLRPLLTSLINMGLFVFLGGM  270

Query  764  FPL  772
            FPL
Sbjct  271  FPL  273



>emb|CDW83355.1| UNKNOWN [Stylonychia lemnae]
Length=455

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/225 (28%), Positives = 104/225 (46%), Gaps = 13/225 (6%)
 Frame = +2

Query  101  IGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSSNLHFLV  280
            IG     +R +LC +   P+  +      G + RH +A +TG +L    F     LH   
Sbjct  2    IGKPEDQIRLILCLLIAYPLGWIMNLALRGKTARHTFATVTGIILQAYMFR-DEILHTFF  60

Query  281  PMLLGYASMLLY-RPYCGIITFFLAFGYLIGCHVY--YMSGDAWKEGGIDSTGALMVITL  451
              L+ Y  M ++ R     + F     YL   H+Y  Y++   W    +D T   M++T 
Sbjct  61   MSLITYLLMNVFPRQTQHKVVFAFTLAYLSASHIYRMYVNFGGWD---LDITTYTMILTA  117

Query  452  KIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYLE  631
            K+ +    Y+DG LK+ +L   Q + +++ +P+ FEY+ Y   CG    GP +E   Y+ 
Sbjct  118  KLSALSFCYKDGGLKDQELIPDQIERKVISMPTPFEYLSYVFFCGGCIVGPFFEYSDYIN  177

Query  632  WTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYF  766
            + E+KGI++        P+  + +L  L Q   C+   L +  YF
Sbjct  178  FIEQKGIYQKV------PNSILQSLIRLGQGFLCLLFNLIVGQYF  216



>ref|XP_002670587.1| predicted protein [Naegleria gruberi]
 gb|EFC37843.1| predicted protein [Naegleria gruberi]
Length=508

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 125/273 (46%), Gaps = 38/273 (14%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLL-CFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLS  247
            D  +E  AS +G+ V    +++   V  IP++ L R +P G + R L+  + G    + +
Sbjct  9    DQWMEKAASLVGLDVSACTYMMFLIVVNIPMAFLMRSLPFGMA-RILFGLIVGLFYCFYT  67

Query  248  FGFSSNLHFLVPMLLGYASMLL-------YRPYC-----GIIT----FFLAFGYLIGCHV  379
            FG S+ LH +   L+ Y  + L        R Y      G+I     FF +FGYL+ CH 
Sbjct  68   FG-SATLHSVAIPLIVYVWLFLTVGMSSSVREYLKKSRLGLIVPLFAFFFSFGYLLICHY  126

Query  380  YYMSGD--AWKEGGIDSTGALMVITLKIISCVMNYQDGLLKEND--LREAQKQNRLLKLP  547
              M  D   WK   +D TG  M+ TLK IS   N  DG++ ++D  +    K NR+ ++P
Sbjct  127  NRMITDYLGWK---LDFTGLQMLATLKTISVAWNIYDGMIAQSDEKMNYYHKVNRMERMP  183

Query  548  SLFEYIGYCLCCGSHFAGPVYEMKAYL-----EWTE-----RKGIWKPAGKERPSPSPFV  697
             L EY  Y     S   GP+YE+  YL     E+ E      K   KP  ++ P P  + 
Sbjct  184  GLLEYFSYMFFFPSILTGPIYEISDYLRMIYGEFDEDISFLNKMELKP-NRQNP-PIHWK  241

Query  698  PTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
                 LL A   M L L  +P F   +  D +Y
Sbjct  242  KIFTNLLIAMVNMVLTLKALPIFDRPQLEDVIY  274



>ref|XP_004356029.1| membrane bound O-acyl transferase family protein [Dictyostelium 
fasciculatum]
 gb|EGG17545.1| membrane bound O-acyl transferase family protein [Dictyostelium 
fasciculatum]
Length=520

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 95/191 (50%), Gaps = 7/191 (4%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            +++      G  +  ++FL+C VA+ P++ L++ +P  S+ +H+ +   G L  + S G 
Sbjct  48   DIDSYLGGFGFPIDQVKFLICVVASYPLATLYKRLPN-STLKHIMSVFLGILYCHWSLGE  106

Query  257  SSNLHFLVPMLLGYASM-LLYRPYCGIITFFLAFGYLIGCHVYYMSGD--AWKEGGIDST  427
             S +H  +  L+ Y  +  L R    +I F  +  YL   H Y M  D   WK   +D T
Sbjct  107  WSWIHSFISSLVVYLIVSFLPRRNSHLIAFTFSMIYLSVSHWYRMYTDYMGWK---MDYT  163

Query  428  GALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPV  607
               MV+TLK+ S   NY DG    N+L   Q +  +  LPSL E+ G+     +  AGP 
Sbjct  164  SPQMVLTLKLTSFAWNYYDGQRASNELTPDQAKKAIKTLPSLLEFFGFVYFFPTFLAGPT  223

Query  608  YEMKAYLEWTE  640
             E+  YL++T 
Sbjct  224  IEISDYLKFTS  234



>ref|XP_699295.3| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Danio 
rerio]
Length=502

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 116/252 (46%), Gaps = 24/252 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L+P++  I + +  + F++C +  +  +   R    P  +S   RH+ A L G  L+   
Sbjct  13   LQPISKMIDLPLDQVNFVVCQLFALVTAFWFRLYLHPSKTSPFIRHVVATLLGFYLALFC  72

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ + LHFLV   L Y  M+         YC ++T     GYL  CHV  +    +   
Sbjct  73   FGWYA-LHFLVQSGLAYGVMIFTSVEHMHKYCFVVTM----GYLSFCHVTRVYVFDYGMY  127

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLK-ENDLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D TG +MVIT KI S      DGL+K E  L+ +QK   + K+PSL EY+ Y      
Sbjct  128  SADFTGPMMVITQKITSLAFEIHDGLVKREEHLKPSQKYLAVRKMPSLLEYLSYNCNFMG  187

Query  590  HFAGPVYEMKAYLEWTERKGI----WKPAGKE-----RPSPSPFVPTLRALLQAAFCMGL  742
              AGP      Y+++ E +G      +  GKE     +  PSP    ++ +   A C+ +
Sbjct  188  ILAGPTCSYNDYIDFIEGRGYESKHLETNGKENGKFKQIEPSPKRDVIQKVCTCALCLTI  247

Query  743  YLYLVPYFPLAR  778
            YL +    P  R
Sbjct  248  YLVIHTACPTER  259



>ref|XP_642430.1| membrane bound O-acyl transferase family protein [Dictyostelium 
discoideum AX4]
 gb|EAL68443.1| membrane bound O-acyl transferase family protein [Dictyostelium 
discoideum AX4]
Length=469

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/218 (28%), Positives = 105/218 (48%), Gaps = 13/218 (6%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFS  259
            ++    A G  V  ++ ++C + + P + + + +P  +  +H+     G      S G  
Sbjct  2    IDSYLEATGFPVDQVKTVICLLLSYPFAAILKKLPNANL-KHIMNICLGVFYCTWSLGEW  60

Query  260  SNLHFLVPMLLGYASMLL----YRPYCGIITFFLAFGYLIGCHVYYMSGD--AWKEGGID  421
            S LH  +  L+ Y  +++    Y+P   +I F    GYL   H+Y +  D   W    +D
Sbjct  61   SWLHSFISSLISYGLLMVIPNRYKP--QLIVFAFCLGYLSISHIYRIYTDYMGWT---LD  115

Query  422  STGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAG  601
             TG  M++TLK+ S   N  DG   +N+L + QK+  + KLP+L E+ G+     +  AG
Sbjct  116  FTGPQMILTLKLTSFAWNLHDGSKADNELSDDQKRRSIKKLPTLLEFFGFVYFFPTFLAG  175

Query  602  PVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRAL  715
            P  E+  YL +T  K +++       +PS  +P L+ L
Sbjct  176  PTLEITDYLNYTSGK-MFQVGQLNGKAPSSLLPALKTL  212



>ref|XP_004353223.1| hypothetical protein ACA1_073390 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR23695.1| hypothetical protein ACA1_073390 [Acanthamoeba castellanii str. 
Neff]
Length=481

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 67/227 (30%), Positives = 115/227 (51%), Gaps = 18/227 (8%)
 Frame = +2

Query  89   MASAIGVSVPVLRFLLCFVATIPVSCLHRFV-PGGSSGRHLYAALTGALLSYLSFGFSSN  265
            +++  G     L++L C +A IP+S + R + PG  + +H+ + +      + S G  S 
Sbjct  11   LSAQTGFPADQLKYLACLLAAIPLSYIFRLLGPGRENAKHVLSIVISIFFCHFSLGEYSW  70

Query  266  LHFLVPMLLGYASMLLYRPYCGII---TFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            +H LV  ++ Y ++L   P+ GI     F  A GYL   H+Y M  D W    +D +G  
Sbjct  71   IHSLVTAMISY-TLLSILPH-GIAHKAVFVFAMGYLSVGHIYRMYTD-WSGWTLDFSGPQ  127

Query  437  MVITLKIISCVMNYQDGLLKEND---LREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPV  607
            M++T+K+ +  M+Y DG   + +   +   QK++R+ +LPS+ E+ GY        AGP 
Sbjct  128  MILTIKLTTIAMDYYDGNRSKAEKEVMSPFQKEHRIERLPSMLEFFGYVYFFPGFLAGPA  187

Query  608  Y---EMKAYLEWTERK--GIWKPAGKERP---SPSPFVPTLRALLQA  724
                + +A++     K     +  G E P   SP+P VP++ AL +A
Sbjct  188  ILFADYRAFITGAMFKVGARIRMGGVEFPGRVSPNPVVPSIIALGKA  234



>emb|CCI43023.1| unnamed protein product [Albugo candida]
Length=442

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 114/249 (46%), Gaps = 16/249 (6%)
 Frame = +2

Query  62   QERDMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSY  241
            +  + ++   +   G+++  LR++LC     P++ ++R +P  ++ +H    + G L++ 
Sbjct  19   ESANSKITEWSDQTGIAMDQLRYVLCLFMVYPLALIYRKIPS-ATFKHTIDVIVGVLIAQ  77

Query  242  LSFGFSSNLHFLVPMLLGYASMLLYRP-YCGIITFFLAFGYLIGCHVYYMSGD--AWKEG  412
            L    S+ +H  +   + Y  +    P Y  +  F   F YL   H+Y +  D   W   
Sbjct  78   LVLQ-SAWIHSFITSTITYFLLCTLPPAYAPVCVFIFNFSYLSASHLYRLYVDYMGWT--  134

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLKENDLRE------AQKQNRLLKLPSLFEYIGYC  574
             +D TG  M++T+K+ S   NY DG   +   +       +++Q  + +LP+  ++ GY 
Sbjct  135  -LDFTGPQMLLTMKLTSLAFNYSDGKQSQKGAKSHDKALASRQQFAIRQLPTPIQFYGYV  193

Query  575  LCCGSHFAGPVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYL  754
                +  AGP +E + YL+ T           +RPS +  V    A+     CM LY + 
Sbjct  194  YNFTTFLAGPAFEFREYLDTTTEIRFRHKNAIQRPSNAFAVSKKCAI--GVLCMALYAHF  251

Query  755  VPYFPLARF  781
               FP++ F
Sbjct  252  GSMFPISNF  260



>ref|XP_002287025.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED96666.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=391

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 114/243 (47%), Gaps = 11/243 (5%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFS  259
            +E ++++ G  V  L +LL  +   P+  +   +P G   +HL++ + GA L   + G  
Sbjct  1    VESLSASTGQDVETLEYLLGMLICYPLGMIMLALPYGKV-KHLFSFILGAFLLQFTIGIQ  59

Query  260  SNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVY--YMSGDAWKEGGIDSTGA  433
               H +  M+     ++L   +        A  Y+   H++  Y++   W    +D TG 
Sbjct  60   WIHHLISSMIAYVMFLVLPAKFAKTAVPVFAMIYITAGHLHRQYINYLGWD---MDFTGP  116

Query  434  LMVITLKIISCVMNYQDG--LLKENDLREAQK--QNRLLKLPSLFEYIGYCLCCGSHFAG  601
             MV+T+K+     N  DG  L K  + R A+K     +  +P + EY+GY  C  S  AG
Sbjct  117  QMVLTMKLYMLAYNLADGDLLKKGKEDRAAKKCADVAISSVPGIIEYLGYTFCFASVLAG  176

Query  602  PVYEMKAYLEWTERKGIWKPAGKERPS-PSPFVPTLRALLQAAFCMGLYLYLVPYFPLAR  778
            P +E K Y +  +   ++  +GK +   PS   PTLR L  +  C+G+++     +PL  
Sbjct  177  PAFEYKFYADACDGSLLYDKSGKPKGKIPSQVWPTLRPLFGSLLCLGIFVVGTGMYPLLD  236

Query  779  FND  787
             ND
Sbjct  237  PND  239



>gb|EJY79920.1| Membrane bound O-acyl transferase family protein [Oxytricha trifallax]
Length=454

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 93/190 (49%), Gaps = 16/190 (8%)
 Frame = +2

Query  185  GGSSGRHLYAALTGALLSYLSFGFSSNLHFLVPMLLGYASMLLY-RPYCGIITFFLAFGY  361
             G + RH+Y+ +TGA L YL +     L F+  ++L Y +M L  R Y     F ++F +
Sbjct  21   NGQNVRHVYSIVTGAFLQYLMYR-EGVLDFMKVIVLSYLAMRLSPRKYVHFSVFAVSFSF  79

Query  362  LIGCHVYYMSGD--AWKEGGIDSTGALMVITLKIISCVMNYQDGLLK---ENDLREAQKQ  526
            L   H+  M  D   W+   +D+    MV+ LK+ S    Y+DG+ +   E +L   Q Q
Sbjct  80   LSYLHIKRMIEDYGGWR---VDTATQCMVLVLKVTSVGFAYRDGMYQKGYEEELFPHQIQ  136

Query  527  NRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTL  706
             R++ +PSL E+  YC  C     GP +E K Y+   ERK  ++        P+  + +L
Sbjct  137  ARIMTIPSLMEFFSYCYSCCGCLLGPYFEYKDYINMIERKEHYQNV------PNTILASL  190

Query  707  RALLQAAFCM  736
            +   Q  F +
Sbjct  191  KTWGQGMFLL  200



>emb|CCA18672.1| lysophospholipid acyltransferase putative [Albugo laibachii Nc14]
Length=478

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/235 (27%), Positives = 106/235 (45%), Gaps = 16/235 (7%)
 Frame = +2

Query  104  GVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSSNLHFLVP  283
            G+++  LR++LC     P++ ++R +P  ++ +H    + G L++ L   F+  +H  + 
Sbjct  33   GIAMDQLRYVLCLFLVYPLALIYRNIPS-TTFKHTADVIVGVLIAQLVLQFAW-IHSFIT  90

Query  284  MLLGYASMLLYRP-YCGIITFFLAFGYLIGCHVYYMSGD--AWKEGGIDSTGALMVITLK  454
              + Y  +    P Y  I  F   F YL G H+Y +  D   W    +D TG  M++T+K
Sbjct  91   STITYLLLCTLPPAYAPICVFIFNFSYLSGSHLYRLYVDYMGWT---LDFTGPQMLLTMK  147

Query  455  IISCVMNYQDGLLKENDLREAQK------QNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            + S   NY DG   + + + + K      Q  + KLP+  ++ GY     +  AGP +E 
Sbjct  148  LTSLAFNYSDGKQSQKEGKSSDKVIASRQQFAIQKLPTPLQFYGYVYNFTTFLAGPAFEF  207

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARF  781
            + YL+ T             PS +  V   R       CM LY      FP++ F
Sbjct  208  REYLDTTTEIRFRHKNVTRVPSNAFAVA--RKCAVGVTCMALYARFASLFPISNF  260



>gb|EJY80788.1| Membrane bound O-acyl transferase family protein [Oxytricha trifallax]
Length=466

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 82/160 (51%), Gaps = 10/160 (6%)
 Frame = +2

Query  185  GGSSGRHLYAALTGALLSYLSFGFSSNLHFLVPMLLGYASMLLY-RPYCGIITFFLAFGY  361
             G + RH+Y+ +TGA L YL +     L F+  ++L Y +M L  R Y     F ++F +
Sbjct  21   NGQNVRHVYSIVTGAFLQYLMYR-EGVLDFMKVIVLSYLAMRLSPRKYVHFSVFAVSFSF  79

Query  362  LIGCHVYYMSGD--AWKEGGIDSTGALMVITLKIISCVMNYQDGLLK---ENDLREAQKQ  526
            L   H+  M  D   W+   +D+    MV+ LK+ S    Y+DG+ +   E +L   Q Q
Sbjct  80   LSYLHIKRMIEDYGGWR---VDTATQCMVLVLKVTSVGFAYRDGMYQKGYEEELFPHQIQ  136

Query  527  NRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYLEWTERK  646
             R++ +PSL E+  YC  C     GP +E K Y+   ERK
Sbjct  137  ARIMTIPSLMEFFSYCYSCCGCLLGPYFEYKDYINMIERK  176



>gb|ENN75377.1| hypothetical protein YQE_08152, partial [Dendroctonus ponderosae]
 gb|ERL90435.1| hypothetical protein D910_07784 [Dendroctonus ponderosae]
Length=492

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 116/253 (46%), Gaps = 21/253 (8%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLS  247
            LE ++    + +  L FL+  +  + ++ L+R + G +      RH++  L G  +SY  
Sbjct  14   LEGLSGYTSLHLDQLNFLVSQLVALTIAALYRTLLGPAKVSPKVRHVFGLLFGLWMSYFC  73

Query  248  FGFSSNLHFLVPMLLGYASMLLYRPYC--GIITFFLAFGYLIGCHVYYMSGDAWKEGGID  421
            FG+ + LH        Y  +L   P    G +  F A  YL   H+Y    D     G+D
Sbjct  74   FGYQA-LHLAGLPAACYLVILTQNPSIMHGAV-LFTAILYLSMIHLYRQLFDD-SSFGLD  130

Query  422  STGALMVITLKIISCVMNYQDGLLKEND--LREAQKQNRLLKLPSLFEYIGYCLCCGSHF  595
             +G LMVIT K+ S   +  DG++ END  L E Q+   L K+P+L E+  Y L   S  
Sbjct  131  ISGPLMVITQKVTSLAFSLHDGMV-ENDEKLTETQRSYALKKVPNLLEFFSYSLMFPSLM  189

Query  596  AGPVYEMKAYLEWTERKGIWKPAGKERPSPSPFV---PTL-----RALLQAAFCMGLYLY  751
            AGP    K Y+E+ E   +     K  PS  P V   P L     + L  A  C  +++ 
Sbjct  190  AGPAMFYKDYIEFIEGNSL-MDLKKSTPSSKPVVVHEPNLMKVVFKKLALAIVCALVFVL  248

Query  752  LVPYFPLARFNDS  790
             +P FP+ R  D 
Sbjct  249  FLPRFPITRLKDE  261



>ref|XP_008992148.1| PREDICTED: LOW QUALITY PROTEIN: lysophospholipid acyltransferase 
1 [Callithrix jacchus]
Length=495

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 71/224 (32%), Positives = 103/224 (46%), Gaps = 26/224 (12%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHR--FVPGGSSG--RHLYAALTGALLSYLS  247
            L P++  +G+ +  + F+ C +A +  +   R    PG +S   RH  AA+ G       
Sbjct  20   LHPLSELLGIPLDQVNFVACQLAALFAAFWFRVYLRPGQTSSDVRHAVAAIFGIYFVIFC  79

Query  248  FGFSSNLHFLVPMLLGYASML------LYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKE  409
            FG+ S +H  V +LLGYA M+      ++R      +FF+A GYL  CH+  +    +  
Sbjct  80   FGWYS-VHLFVLVLLGYAIMVSASVSNIHR-----YSFFVAMGYLTICHISRIYIFHYGI  133

Query  410  GGIDSTGALMVITLKIISCVMNYQDGL-LKENDLREAQKQNRLLKLPSLFEYIGYCLCCG  586
               D +G LM++T KI +      DGL  +  DL   Q Q  +   PS  EY+ Y L   
Sbjct  134  LTTDFSGPLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHQLAIKVKPSFLEYLSYLLNFM  193

Query  587  SHFAGPVYEMKAYLEWTERKGI--------WKPAG-KERPSPSP  691
            S  AGP    K Y+ + E K I        WK  G    P PSP
Sbjct  194  SVIAGPCNNYKDYVAFIEGKHIHMKLLEVNWKQKGFHSLPEPSP  237



>ref|XP_005723976.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Pundamilia nyererei]
Length=505

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 79/257 (31%), Positives = 115/257 (45%), Gaps = 25/257 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L+P++  I + +  + F+ C +  + ++   R    P  +S   RH+ A L G  L+   
Sbjct  15   LQPLSEIINLPLDQVNFVACQLFALLMAVWFRIYLHPSKTSPFIRHVVATLLGFYLALFC  74

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ S LHFLV   L Y+ M+         YC I+T     GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYSVMVFAGLENMHKYCFIVTL----GYLILCQITRVYVFDYGMY  129

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLK-ENDLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D TG +MVIT KI S      DGL K E  L   QK   + ++PSL EY+ Y      
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLTKREGQLTPGQKYFAISRMPSLLEYLSYNCNFMG  189

Query  590  HFAGPV---YEMKAYLEWT------ERKGIWKPAGK-ERPSPSPFVPTLRALLQAAFCMG  739
              AGP     + KA++E T      +     K  GK ++  PSP    +  L   A  + 
Sbjct  190  ILAGPTCSYNDYKAFIEGTCYQPRHQENANGKENGKYKQTEPSPKNDVISKLCTCAISLA  249

Query  740  LYLYLVPYFPLARFNDS  790
            +YL L    P+ R  D 
Sbjct  250  VYLSLYKLLPVERSIDD  266



>ref|XP_004540559.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Maylandia zebra]
Length=505

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 79/257 (31%), Positives = 115/257 (45%), Gaps = 25/257 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L+P++  I + +  + F+ C +  + ++   R    P  +S   RH+ A L G  L+   
Sbjct  15   LQPLSEIINLPLDQVNFVACQLFALLMAVWFRIYLHPSKTSPFIRHVVATLLGFYLALFC  74

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ S LHFLV   L Y+ M+         YC I+T     GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYSVMVFAGLENMHKYCFIVTL----GYLILCQITRVYVFDYGMY  129

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLK-ENDLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D TG +MVIT KI S      DGL K E  L   QK   + ++PSL EY+ Y      
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLTKREGQLTPGQKYFAISRMPSLLEYLSYNCNFMG  189

Query  590  HFAGPV---YEMKAYLEWT------ERKGIWKPAGK-ERPSPSPFVPTLRALLQAAFCMG  739
              AGP     + KA++E T      +     K  GK ++  PSP    +  L   A  + 
Sbjct  190  ILAGPTCSYNDYKAFIEGTCYQPRHQENANGKENGKYKQTEPSPKNDVISKLCTCAISLA  249

Query  740  LYLYLVPYFPLARFNDS  790
            +YL L    P+ R  D 
Sbjct  250  VYLSLYKLLPVERSIDD  266



>ref|XP_005942406.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Haplochromis burtoni]
Length=505

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 79/257 (31%), Positives = 115/257 (45%), Gaps = 25/257 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L+P++  I + +  + F+ C +  + ++   R    P  +S   RH+ A L G  L+   
Sbjct  15   LQPLSEIINLPLDQVNFVACQLFALLMAVWFRIYLHPSKTSPFIRHVVATLLGFYLALFC  74

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ S LHFLV   L Y+ M+         YC I+T     GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYSVMVFAGLENMHKYCFIVTL----GYLILCQITRVYVFDYGMY  129

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLK-ENDLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D TG +MVIT KI S      DGL K E  L   QK   + ++PSL EY+ Y      
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLTKREGQLTPGQKYFAISRMPSLLEYLSYNCNFMG  189

Query  590  HFAGPV---YEMKAYLEWT------ERKGIWKPAGK-ERPSPSPFVPTLRALLQAAFCMG  739
              AGP     + KA++E T      +     K  GK ++  PSP    +  L   A  + 
Sbjct  190  ILAGPTCSYNDYKAFIEGTCYQPRHQENANGKENGKYKQTEPSPKNDVISKLCTCAISLA  249

Query  740  LYLYLVPYFPLARFNDS  790
            +YL L    P+ R  D 
Sbjct  250  VYLSLYKLLPVERSIDD  266



>gb|KKA64414.1| hypothetical protein PRIPAC_13276 [Pristionchus pacificus]
Length=477

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 71/246 (29%), Positives = 112/246 (46%), Gaps = 19/246 (8%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSS--GRHLYAALTGALLSYLSFG  253
            L+P+A  +GV V  + F+ C   ++P +  +  V G +S   R +Y    G  L Y  F 
Sbjct  14   LQPLADMVGVGVDKINFVGCLAVSVPYALFYSRVLGKASERTRQIYPLFIG--LCYCCFC  71

Query  254  F-SSNLHFLVPMLLGYASMLLYRPYCGI--ITFFLAFGYLIGCHVY---YMSGDAWKEGG  415
            F S+  H L   L+ YA ++ + P   I  + F  +  YL   H Y   Y+S     E  
Sbjct  72   FGSATKHLLANSLISYA-LMSFAPAKHIHWLIFTFSMSYLTWVHFYRWNYIS-----EYT  125

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
            ID TG  MV   ++ +   +  DGL+ KE +L   QK+  + ++P L  ++ Y     S 
Sbjct  126  IDITGPFMVCVQRLTTLAFSLHDGLVKKEEELSPLQKREAIKRVPDLLPFLSYIFHFQSI  185

Query  593  FAGPVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPL  772
              GP+     Y+  T    + K    E P  S     L  L++A F +G+  +L P FP 
Sbjct  186  LTGPLSYFTDYINLTRGTHVKKNENGELPDAS--AEALVKLVKAGFFIGIIAFLEPRFPP  243

Query  773  ARFNDS  790
            +  N +
Sbjct  244  SAINRT  249



>ref|XP_005477146.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like isoform X1 [Oreochromis niloticus]
 ref|XP_005477147.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like isoform X2 [Oreochromis niloticus]
 ref|XP_005477148.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like isoform X3 [Oreochromis niloticus]
Length=505

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 116/257 (45%), Gaps = 25/257 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L+P++  I + +  + F+ C +  + ++   R    P  +S   RH+ A L G  L+   
Sbjct  15   LQPLSEIINLPLDQVNFVACQLFALLMAVWFRIYLHPSKTSPFIRHVVATLLGFYLALFC  74

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ S LHFLV   L Y+ M+         YC I+T     GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYSVMVFAGLENMHKYCFIVTL----GYLILCQITRVYVFDYGMY  129

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLKEN-DLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D TG +MVIT KI S      DGL K +  L  +QK   + ++PSL EY+ Y      
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLTKRDGQLTPSQKYLAISRMPSLLEYLSYNCNFMG  189

Query  590  HFAGPV---YEMKAYLEWT------ERKGIWKPAGK-ERPSPSPFVPTLRALLQAAFCMG  739
              AGP     + KA++E T      +     K  GK ++  PSP    +  L   A  + 
Sbjct  190  ILAGPTCSYNDYKAFIEGTCYQPRHQENANGKENGKYKQTEPSPKNDVISKLCTCAISLA  249

Query  740  LYLYLVPYFPLARFNDS  790
            +YL L    P+ R  D 
Sbjct  250  IYLSLYKLLPVERSIDD  266



>ref|XP_005101404.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Aplysia californica]
Length=544

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 71/255 (28%), Positives = 113/255 (44%), Gaps = 20/255 (8%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATI----PVSCLHRFVPGGSSGRHLYAALTGALLSYLS  247
            L P+A  IG+ +  + FL+C +  +    P   L      G+  RH+  A+ G LL+   
Sbjct  14   LTPVADTIGLPIDQINFLVCQLVALGFAFPFRSLFSVEKVGAQTRHIIEAVVGVLLTLFC  73

Query  248  FGFSSNLHFLVPMLLGYASMLLY-RPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG--I  418
            FG+    H LV  L+ YA M      +     F  +  YL  CH+Y      +  GG  +
Sbjct  74   FGYQI-WHLLVQSLVSYAFMAYGGSRFSHAFVFVFSMLYLSVCHIYR---QVYDYGGYTL  129

Query  419  DSTGALMVITLKIISCVMNYQDGLLKEN-DLREAQKQNRLLKLPSLFEYIGYCLCCGSHF  595
            D TG LM+ T K+ S      DG  KE   L + QKQ+ + KLP++ +Y+ +        
Sbjct  130  DITGPLMIQTQKLTSLAFALHDGRYKEEAKLSQDQKQHAVRKLPNVVQYLSFMFYFHGVM  189

Query  596  AGPVYEMKAYLEWTERKGIWKPAG-------KERPSPSPFVPTLRALLQA-AFCMGLYLY  751
             GP+     Y+ + +     KP G       K+ P+       ++ L+ A A C+G+ + 
Sbjct  190  VGPLTFYNDYIAFIDGTHFKKPGGSSTNAGSKKHPADDLNRVVIKKLVVASACCLGMMIL  249

Query  752  LVPYFPLARFNDSLY  796
               +FP  + N   Y
Sbjct  250  PGLFFPPEKLNTPEY  264



>ref|XP_003962745.1| PREDICTED: lysophospholipid acyltransferase 2 [Takifugu rubripes]
Length=479

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 116/257 (45%), Gaps = 25/257 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L+P++  I + +  + F+ C +  + ++   R    P  +S   RH+ A L G+ L+   
Sbjct  15   LQPISEIINLPLDQVNFVACQLFALLMAVWFRIYLHPSKTSPFIRHVVATLLGSYLALFC  74

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ S LHFLV   L Y+ M+         YC I+T     GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYSVMVFSGLENMHKYCFIVTL----GYLILCQITRVYVFDYGMY  129

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLKEN-DLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D TG +MVIT KI S      DGL K +  L   QK   + ++PSL EY+ Y      
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLTKRDAQLNPNQKYLAIRRMPSLLEYLSYNCNFMG  189

Query  590  HFAGPV---YEMKAYLEWT------ERKGIWKPAGK-ERPSPSPFVPTLRALLQAAFCMG  739
              AGP     + KA++E T      +     K  GK ++  PSP    +  L   A  + 
Sbjct  190  ILAGPTCSYNDYKAFIEGTGFQPRHQENANGKENGKCKQNEPSPKNAVISKLSTCAISLF  249

Query  740  LYLYLVPYFPLARFNDS  790
            +YL L    P+ R  D 
Sbjct  250  VYLSLCKLLPVERAIDD  266



>ref|XP_005177952.1| PREDICTED: lysophospholipid acyltransferase 1 [Musca domestica]
 ref|XP_005177953.1| PREDICTED: lysophospholipid acyltransferase 1 [Musca domestica]
 ref|XP_005177954.1| PREDICTED: lysophospholipid acyltransferase 1 [Musca domestica]
 ref|XP_011290228.1| PREDICTED: lysophospholipid acyltransferase 1 [Musca domestica]
Length=666

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/250 (28%), Positives = 116/250 (46%), Gaps = 20/250 (8%)
 Frame = +2

Query  89   MASAIGVSVPVLRFLLCFVATIPVSCLHRFV----PGGSSGRHLYAALTGALLSYLSFGF  256
            +A   G+SV ++ FL+C ++ I ++ L+R V       S+ RH+ A   G +  Y  FG 
Sbjct  18   LADLSGLSVDLVNFLICQISAIFLASLYRSVLHPSKVSSNVRHIVALSIGLVFGYFCFGP  77

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFL-AFGYLIGCHVYYMSGDAWKEGG--IDST  427
             + +H        Y ++    P     T  + A  YL+  HV     D   +G   +D T
Sbjct  78   QA-IHIAGLPSACYVAIRTQSPKVVQRTVMVVAMAYLLTIHVLRQIYD---DGSCSLDIT  133

Query  428  GALMVITLKIISCVMNYQDGLLKE-NDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGP  604
            G LM+IT K+ S   +  DG +++  DL +AQ+ + + KLPS  EY  Y L      AGP
Sbjct  134  GPLMIITQKVTSLAFSIHDGFVRQTKDLTKAQQYHAVNKLPSALEYFSYVLNFQGLMAGP  193

Query  605  VYEMKAYLEWTE----RKGIWKPAGKERP----SPSPFVPTLRALLQAAFCMGLYLYLVP  760
            +   K Y+++ E    R  +   A K +      PSP    ++ ++ +  C  +++  V 
Sbjct  194  LVFYKDYIDFIEGYNLRPAVNTSADKGKSQVVLEPSPVKTVVKKVIGSFICAFIFMKFVQ  253

Query  761  YFPLARFNDS  790
             +P+    D 
Sbjct  254  LYPIKNLKDD  263



>gb|EFQ28671.1| MBOAT family protein [Colletotrichum graminicola M1.001]
Length=538

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/246 (28%), Positives = 114/246 (46%), Gaps = 20/246 (8%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGS-SGRHLYAALTGALLSYLSFGF  256
             E +AS +G S   L+ +  F+ + P++ L + VP      ++L+   T        F  
Sbjct  9    FELLASRLGASSDELKLIFSFLISYPLAGLLKRVPDARPDQKNLFIICTSTFYLVGLFDL  68

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIG----CHVYYMSGDAWKEGGIDS  424
               +  L    +G  S+  Y      + + + FG+L+G     H+   + +      +D 
Sbjct  69   WDGVRTLAIASIGVYSIAKYLRTSSFMPW-IGFGFLMGHMSINHISRQTAN--NPSSVDI  125

Query  425  TGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGP  604
            TGA MV+ +K+ +   N  DG L E+ L + Q++ RL+ LP + +Y GY L   S FAGP
Sbjct  126  TGAQMVLLMKLSAFCWNVADGQLPEDQLSDYQRERRLVDLPDILDYAGYVLFFPSLFAGP  185

Query  605  VYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLR--------ALLQAAF---CMGLYLY  751
             ++   Y +W +      PA  + PS +P V   R        A L+AA     +GL++ 
Sbjct  186  AFDYIDYRKWIDTTMFDLPAQVD-PSKAPPVRKKRKIPRSGTPATLKAASGLGWIGLFML  244

Query  752  LVPYFP  769
            L  Y+P
Sbjct  245  LSNYYP  250



>gb|EJY76231.1| Membrane bound O-acyl transferase family protein [Oxytricha trifallax]
Length=475

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 95/218 (44%), Gaps = 13/218 (6%)
 Frame = +2

Query  122  LRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSSNLHFLVPMLLGYA  301
            +R +LC     P+  +      G   RHL+A +TG LL    +     +H L+  L+ Y 
Sbjct  25   IRIMLCMFMVYPLGWIMNLFLNGRVTRHLFATITGFLLQIYMYK-DQVIHPLLMTLITYI  83

Query  302  SM-LLYRPYCGIITFFLAFGYLIGCHVYYMSGD--AWKEGGIDSTGALMVITLKIISCVM  472
             + +L R  C    F    GYL G H+Y M  +   W    +D T   M++T K+ S   
Sbjct  84   LLNVLPRNQCHKAVFVFTMGYLSGSHIYRMLTNFGGWD---LDITTYTMILTAKLSSLGF  140

Query  473  NYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYLEWTERKGI  652
             Y+DG  KE +L   QK+ ++ K+P+  E + Y   C     GP YE   Y+ + E++  
Sbjct  141  CYKDGGEKEENLIPDQKERKVEKMPTPLEMLSYVFFCCGCLCGPFYEYSDYINFIEKRAH  200

Query  653  WKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYF  766
            +         P     +L  L     C+   L +  YF
Sbjct  201  YAKI------PVSIWQSLVRLFHGLLCLAFNLIVGQYF  232



>ref|XP_001381215.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Monodelphis 
domestica]
Length=521

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 115/250 (46%), Gaps = 24/250 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLS  247
            L+P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  LS   
Sbjct  13   LQPLSNAVQLPIDQVNFVVCQLFALLAAVWFRTYLHSSKTSSFIRHVVATLLGLYLSLFC  72

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ + LHFLV   + Y+ M++        YC    F  A GYL  C +  +    + + 
Sbjct  73   FGWYA-LHFLVQSGISYSIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQY  127

Query  413  GIDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D +G +M+IT KI S      DG+  KE +L  +Q+   + ++PSL EY+ Y      
Sbjct  128  SADFSGPMMIITQKITSLAYEIHDGMFRKEEELTPSQRGLAVRRMPSLLEYLSYNCNFMG  187

Query  590  HFAGPVYEMKAYLEWTERKGIW----KPAGK-----ERPSPSPFVPTLRALLQAAFCMGL  742
              AGP+   K Y+ + E +       +  GK     ER  PSP +  ++ LL     +  
Sbjct  188  ILAGPLCSYKDYITFIEGRSYQVTQTEANGKEERQYERTEPSPNIAVMQKLLVCGLSLLF  247

Query  743  YLYLVPYFPL  772
            +L +    P+
Sbjct  248  HLTVSKTLPV  257



>emb|CDJ83922.1| Membrane bound O-acyl transferase domain containing protein [Haemonchus 
contortus]
Length=320

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 103/221 (47%), Gaps = 11/221 (5%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCL-HRFVPGG---SSGRHLYAALTGALLSYLS  247
            L+P+A+   V V  + F++C  +++P++C+  RF   G      R ++  L G +  +  
Sbjct  14   LQPIATYFEVQVDRINFVICMFSSLPLACVFKRFCAPGVVTRQTRTIFPLLIGIVFCFFC  73

Query  248  FGFSSNLHFLVPMLLGYASMLLYRP-YCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDS  424
            FG +S  H L   LL YA M    P     + F  + GYL+  H  +          +D 
Sbjct  74   FGRASK-HLLANALLNYAIMRWSPPKLVHKLVFGFSMGYLLFIH--FFRWLVLTRYYLDI  130

Query  425  TGALMVITLKIISCVMNYQDGLLKEND-LREAQKQNRLLKLPSLFEYIGYCLCCGSHFAG  601
            TG +MV   KI +   +  DG +K+ + L E QK+  + ++PSL EY+ Y     +   G
Sbjct  131  TGPMMVAVQKITTLAFSLHDGKVKKKEELSEVQKREAITEVPSLVEYMSYVFNFQTALTG  190

Query  602  PVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQA  724
            PV     Y+ +    G+    GK+   PS     +R L ++
Sbjct  191  PVNFFSDYVAFLS--GVHVTPGKDGKEPSALGAAVRKLAES  229



>ref|XP_009526166.1| hypothetical protein PHYSODRAFT_314590 [Phytophthora sojae]
 gb|EGZ17108.1| hypothetical protein PHYSODRAFT_314590 [Phytophthora sojae]
Length=492

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/254 (24%), Positives = 121/254 (48%), Gaps = 25/254 (10%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGF  256
            +++ +++++G+    LR++LC  A  P++ +++ +PG S  +H+   + G  ++    G 
Sbjct  29   QVDTLSASLGLGSDQLRYVLCLFAAYPLALVYKLLPGASL-KHVMDVVLGVAIAQFVLG-  86

Query  257  SSNLHFLVPMLLGYASMLLYRP--YCGIITFFLAFGYLIGCHVYYMSGD--AWKEGGIDS  424
            S  +H  V   L Y  ++ + P  +   + F     Y+   H+Y +  D   W    +D 
Sbjct  87   SGWVHSFVSSFLTYL-LVKFGPSKHAPALVFLFNMLYMSASHIYRLYVDYMGWT---LDF  142

Query  425  TGALMVITLKIISCVMNYQDGLLKE-------------NDLREAQKQNRLLKLPSLFEYI  565
            TG  M++ +K+ S   NY DG++ +               + E +++  + ++PSL E+ 
Sbjct  143  TGPQMLLVIKLTSFAYNYYDGVVDKTFEKKGAEMSPGKKKVFEGRQKLAIHEIPSLLEFF  202

Query  566  GYCLCCGSHFAGPVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLY  745
            GY     +  AGP +E++ YL+ T  K  ++  GK +  PS  +      L  +  M  +
Sbjct  203  GYVYSFTTFLAGPAFEIREYLDVTSGKK-FQLDGKTK-QPSSVLAAFSKFLVGSLLMAAF  260

Query  746  LYLVPYFPLARFND  787
                P +PL+  +D
Sbjct  261  AVYGPMYPLSNLHD  274



>ref|XP_007252280.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Astyanax mexicanus]
Length=475

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 113/248 (46%), Gaps = 16/248 (6%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L+P++  I + +  + F++C +  +  +C  R    P  +S   RH+ A L G  L+   
Sbjct  14   LQPISEMIDLPLDQVNFVVCQLFVLFTACWFRLYLHPSKTSPFIRHVVATLLGFYLALFC  73

Query  248  FGFSSNLHFLVPMLLGYASMLLY-RPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDS  424
            FG+ + LHFLV   L Y  M+     +    +F +A GYL+ C +  +    +     D 
Sbjct  74   FGWYA-LHFLVQSGLTYGIMIFTGLEHMHRYSFVVALGYLMLCQITRVYVFDYGMYSADF  132

Query  425  TGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAG  601
            TG +MVIT KI S      DGL  KE  L+ +QK   + K+PSL EY+ Y        AG
Sbjct  133  TGPMMVITQKITSLAFEIHDGLTKKEEHLKPSQKYLAVRKMPSLLEYLSYNCNFLGILAG  192

Query  602  PVYEMKAYLEWTERKGIW----KPAGKE-----RPSPSPFVPTLRALLQAAFCMGLYLYL  754
            P      Y+ + E  G      +  GKE     +  PSP    +  +   + C+ +YL  
Sbjct  193  PTCSYNDYIAFIEGTGYQHKHLESNGKENGKCKQSDPSPKRDVILKMSTCSLCLLVYLTF  252

Query  755  VPYFPLAR  778
                P+ R
Sbjct  253  YRICPVDR  260



>gb|EEZ99452.1| hypothetical protein TcasGA2_TC030770, partial [Tribolium castaneum]
Length=441

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 111/248 (45%), Gaps = 15/248 (6%)
 Frame = +2

Query  89   MASAIGVSVPVLRFLLCFVATIPVSCLHRFV----PGGSSGRHLYAALTGALLSYLSFGF  256
            ++  +G+SV  + F++  V  + ++ L R V       ++ RH +  +   ++ Y  FG 
Sbjct  18   LSEYLGISVDKVNFVISQVGALFLASLFRNVLHPSKANAATRHAFGLVFALIIGYFCFGT  77

Query  257  SSNLHFLVPMLLGYASMLLYRPYC-GIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
               +H        Y  +    P     +   +A  YL   H++    D +    +D TG 
Sbjct  78   RQAIHLAALPAACYIVIRTQSPEVMQRMVLAVALVYLSVIHLHRQIYD-YGSYNLDITGP  136

Query  434  LMVITLKIISCVMNYQDGLLKEND-LREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            LMVIT K+ S   N  DGL K  + L ++QK   + K+P+  EY  + L   S  AGP  
Sbjct  137  LMVITQKVTSLAFNIHDGLTKHQEKLSKSQKSYAVTKIPNPLEYFSFVLHFPSLMAGPAM  196

Query  611  EMKAYLEWTERKGIWKPAGKERPS--------PSPFVPTLRALLQAAFCMGLYLYLVPYF  766
              K Y+++ +   +  P   + P+        PSP     + +  AA C  +++  +P F
Sbjct  197  LYKEYMDFIDGSNLKSPVLADTPTRNAPIVVEPSPTWAVCKKVAIAAGCAAIFVKFLPMF  256

Query  767  PLARFNDS  790
            P++R  ++
Sbjct  257  PISRVKEN  264



>ref|XP_003757931.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like isoform 1 [Sarcophilus harrisii]
Length=521

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 69/250 (28%), Positives = 114/250 (46%), Gaps = 24/250 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLS  247
            L+P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  LS   
Sbjct  13   LQPLSNAVQLPIDQVNFVVCQLFALLAAVWFRIYLHSSKTSSFIRHVVATLLGLYLSLFC  72

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ + LHFLV   + Y  M++        YC    F  A GYL  C +  +    + + 
Sbjct  73   FGWYA-LHFLVQSGISYYIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQY  127

Query  413  GIDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D +G +M+IT KI S      DG+  KE +L  +Q+   + ++PSL EY+ Y      
Sbjct  128  SADFSGPMMIITQKITSLAYEIHDGMFRKEEELTPSQRGLAVRRMPSLLEYLSYNCNFMG  187

Query  590  HFAGPVYEMKAYLEWTERKGIW----KPAGK-----ERPSPSPFVPTLRALLQAAFCMGL  742
              AGP+   K Y+ + E +       +  GK     E+  PSP V  L+ LL     +  
Sbjct  188  ILAGPLCSYKDYITFIEGRSYQLTQSEANGKEEIQYEKTEPSPNVAVLQKLLICGLSLLF  247

Query  743  YLYLVPYFPL  772
            +L +    P+
Sbjct  248  HLTISKSLPV  257



>ref|XP_002059375.1| GJ17620 [Drosophila virilis]
 gb|EDW58787.1| GJ17620 [Drosophila virilis]
Length=744

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 72/250 (29%), Positives = 116/250 (46%), Gaps = 18/250 (7%)
 Frame = +2

Query  89   MASAIGVSVPVLRFLLCFVATIPVSCLHR--FVPGGSS--GRHLYAALTGALLSYLSFGF  256
            +A A+G+SV ++ FL+C ++ + ++ L R    P   S   RH +A   G    Y  FG 
Sbjct  22   LADAVGLSVDLVNFLVCQISALFLASLFRSWLHPSKVSYEVRHAFAMSLGLAFGYFCFGQ  81

Query  257  SSNLHFLVPMLLGYASMLLYRPYCGIITFFL-AFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
             + +H      L Y  +    P     +  L A GYL+  H+     D +    +D TG 
Sbjct  82   QA-IHIAGLPALCYIVIRTQDPRIVQRSVLLVAMGYLLCVHLMRQIYD-YGSYALDITGP  139

Query  434  LMVITLKIISCVMNYQDGLLKEN-DLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            LM+IT K+ S   +  DG ++++ DL  AQ+ + + K+PS  EY  Y     S  AGP+ 
Sbjct  140  LMIITQKVTSLAFSIHDGFVRQDEDLTRAQQYHAIRKMPSALEYFSYVWHFQSLMAGPLV  199

Query  611  EMKAYLEWTERKGIWK-PA-------GKER--PSPSPFVPTLRALLQAAFCMGLYLYLVP  760
              K Y+E+ E   + K PA       GK      PSP    +R +L +  C  +++  V 
Sbjct  200  FYKDYIEFVEGYNLLKRPASNASLDNGKSELVVEPSPTKTVIRKVLGSMVCAFIFMKFVK  259

Query  761  YFPLARFNDS  790
             +P+    + 
Sbjct  260  IYPVKNMKED  269



>ref|XP_011498420.1| PREDICTED: lysophospholipid acyltransferase 1 isoform X1 [Ceratosolen 
solmsi marchali]
Length=506

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 62/250 (25%), Positives = 113/250 (45%), Gaps = 18/250 (7%)
 Frame = +2

Query  89   MASAIGVSVPVLRFLLCFVATIPVSCLHRF----VPGGSSGRHLYAALTGALLSYLSFGF  256
            ++  IG+ +  + FL+     + ++   R          S RHL+  + G +L Y SFG 
Sbjct  18   VSDLIGLPIDQVNFLITQFTALGLAGFLRLSLDPTSSSPSSRHLFGLVIGLMLGYFSFG-  76

Query  257  SSNLHFLVPMLLGYASMLLYRPY-CGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
               +H      + YA+M    P+    +   +A  YL   H +    D +    +D TG 
Sbjct  77   KQAMHLAGLPAICYAAMRTLDPHHMQRVVLAVALIYLSCIHFHRQMYD-YGSYTLDITGP  135

Query  434  LMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            LMVIT K+ S   +  DGL  KE +L   Q+ + + K+P++ EY  Y     +   GP+ 
Sbjct  136  LMVITQKVTSLAYSVHDGLTCKEEELTPTQRDHAVQKMPTMLEYFSYIFHFQALMVGPII  195

Query  611  EMKAYLEWTERKG--IWKPAGKERP--------SPSPFVPTLRALLQAAFCMGLYLYLVP  760
              + Y+++   +G  +   A  E+          PSP V  ++ ++ +  C  +++ L+P
Sbjct  196  FYRDYIDFIHGRGHKLLTNASDEQNGQVNKIIMEPSPNVVVIKKVIASLICALIFIILLP  255

Query  761  YFPLARFNDS  790
             +P+ +  D 
Sbjct  256  SYPIKKIKDE  265



>ref|XP_005801344.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Xiphophorus maculatus]
Length=505

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 77/252 (31%), Positives = 110/252 (44%), Gaps = 26/252 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L+P++  I + V  + F+ C +  + ++   R    P  +S   RH+ A L G  L+   
Sbjct  15   LQPISDIINLPVDQVNFVACQLFALLMAVWFRIYLHPSKTSPFIRHVVATLLGLYLALFC  74

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ S +HFLV   L Y  M+         YC I+T     GYLI C +  +    +   
Sbjct  75   FGWYS-VHFLVQSGLSYGVMIFASLEHMHKYCFIVTL----GYLILCQITRVYVFDYGMY  129

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLK--ENDLREAQKQNRLLKLPSLFEYIGYCLCCG  586
              D TG +MVIT KI S      DGL K  E  L  +QK   + ++PSL EY+ Y     
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLSKHREGQLTPSQKYLAISRMPSLLEYLSYNCNFM  189

Query  587  SHFAGPVYEMKAYLEWTE-----RKGIWKPAGKE-----RPSPSPFVPTLRALLQAAFCM  736
               AGP      Y+ + E     R+   K  GKE     +  PSP    +  L   A  +
Sbjct  190  GILAGPTCSYNDYMAFMEGTSYQRRHQEKANGKENGKAKQAEPSPKRAVVSKLCTCAISL  249

Query  737  GLYLYLVPYFPL  772
              YL L    P+
Sbjct  250  TTYLSLYRLLPV  261



>ref|XP_011228196.1| PREDICTED: lysophospholipid acyltransferase 2 [Ailuropoda melanoleuca]
Length=523

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 113/249 (45%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLC----FVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C     +A I      R     S  RH+ A L G  L+   F
Sbjct  16   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLRSSKTSSFIRHVVATLLGLYLALFCF  75

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C +  +    + +  
Sbjct  76   GWYA-LHFLVQSGISYCIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQYS  130

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  131  ADFSGPMMIITQKITSLAYEIHDGMFRKDEELTSSQRGLAVRRMPSLLEYLSYTCNFMGI  190

Query  593  FAGPVYEMKAYLEWTE----RKGIWKPAGK-----ERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   + Y+ + E    R      +GK     ER  PSP V  ++ LL     +  +
Sbjct  191  LAGPLCSYRDYITFIEGRAHRGAQPGASGKDGLPCERAEPSPNVAVIQKLLVCGLSLFFH  250

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  251  LTISRTLPV  259



>ref|XP_007893047.1| PREDICTED: lysophospholipid acyltransferase 2-like [Callorhinchus 
milii]
Length=558

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 115/255 (45%), Gaps = 16/255 (6%)
 Frame = +2

Query  77   ELEPMASAIGVSVPVLRFLLCFVATIPVSCLHR--FVPGGSSG--RHLYAALTGALLSYL  244
            +  P++  + +    + F++C +  +  + L R    P  +S   RH  A L G   ++ 
Sbjct  44   QFVPLSEKLHLPTEQVNFVVCQLFGLLTAFLFRKYLHPSKTSPIVRHTVATLFGLYFAFF  103

Query  245  SFGFSSNLHFLVPMLLGYASMLLYR-PYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGID  421
             FG    +HFL+ ++L Y  ++          +F  A GYL  C +  +     KE   D
Sbjct  104  CFG-RFVVHFLLEVMLSYCVLVTIDVKRVHKYSFVAAMGYLTVCQIIRVYALDGKEHSAD  162

Query  422  STGALMVITLKIISCVMNYQDGLLKEN-DLREAQKQNRLLKLPSLFEYIGYCLCCGSHFA  598
             +G LMVIT K+        DGL +++  L  +QK+  + ++PSL EY+ Y L      A
Sbjct  163  FSGPLMVITQKVTKLAFEIHDGLARDDVQLSPSQKRLAVRRVPSLLEYLSYNLNFMGILA  222

Query  599  GPVYEMKAYLEWTERKGIW-KPA--------GKERPSPSPFVPTLRALLQAAFCMGLYLY  751
            GP      Y+++ E   +  KP           ++  PSP     R +L ++  + ++L 
Sbjct  223  GPAVSFNHYIDFIEGSKVEVKPVCPPGINSDNCQKHDPSPLSAVGRKVLSSSVSLLMHLT  282

Query  752  LVPYFPLARFNDSLY  796
            L+  FPLA   D  +
Sbjct  283  LLKTFPLAYNTDEEF  297



>ref|XP_007565592.1| PREDICTED: lysophospholipid acyltransferase 2 [Poecilia formosa]
Length=505

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 77/258 (30%), Positives = 111/258 (43%), Gaps = 26/258 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L+P++  I + +  + F+ C +  + ++   R    P  +S   RH+ A L G  L+   
Sbjct  15   LQPISEIIDLPLDQVNFVACQLFALLMAVWFRLYLHPSKTSPFIRHVVATLLGLYLALFC  74

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ S +HFLV   L Y  M+         YC I+T     GYLI C +  +    +   
Sbjct  75   FGWYS-VHFLVQSGLSYGVMIFASLEHMHKYCFIVTL----GYLILCQITRVYVFDYGMY  129

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLK--ENDLREAQKQNRLLKLPSLFEYIGYCLCCG  586
              D TG +MVIT KI S      DGL K  E  L  +QK   + ++PSL EY+ Y     
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLSKRREGQLTPSQKYLAISRMPSLLEYLSYNCNFM  189

Query  587  SHFAGPVYEMKAYLEWTE-----RKGIWKPAGKE-----RPSPSPFVPTLRALLQAAFCM  736
               AGP      Y+ + E     R+      GKE     +P PSP    +  L   A  +
Sbjct  190  GILAGPTCSYNDYMAFMEGTSYQRRHQENANGKENGKAKQPEPSPKRAVVSKLCTCAISL  249

Query  737  GLYLYLVPYFPLARFNDS  790
              YL L    P+    D 
Sbjct  250  TTYLSLYRLLPVDHSIDE  267



>ref|XP_006715063.1| PREDICTED: lysophospholipid acyltransferase 1 isoform X2 [Homo 
sapiens]
Length=248

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 104/226 (46%), Gaps = 26/226 (12%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L P++  +G+ +  + F++C +  +  +   R    PG +S   RH  A + G       
Sbjct  20   LHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFC  79

Query  248  FGFSSNLHFLVPMLLGYASML------LYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKE  409
            FG+ S +H  V +L+ YA M+      ++R      +FF+A GYL  CH+  +    +  
Sbjct  80   FGWYS-VHLFVLVLMCYAIMVTASVSNIHR-----YSFFVAMGYLTICHISRIYIFHYGI  133

Query  410  GGIDSTGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKL-PSLFEYIGYCLCCG  586
               D +G LM++T KI +      DGL +  +   A++    +K+ PS  EY+ Y L   
Sbjct  134  LTTDFSGPLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFM  193

Query  587  SHFAGPVYEMKAYLEWTERKGI--------WKPAG-KERPSPSPFV  697
            S  AGP    K Y+ + E K I        WK  G    P PSP V
Sbjct  194  SVIAGPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTV  239



>ref|XP_008299182.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Stegastes partitus]
Length=510

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 77/259 (30%), Positives = 113/259 (44%), Gaps = 26/259 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L+P++  I + +  + F+ C +  + ++   R    P  +S   RH+ A L G  L+   
Sbjct  15   LQPISEIINLPLDQVNFVACQLFALLMAVWFRLYLHPSKTSPFIRHVVATLLGFYLALFC  74

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ S LHFLV   L Y+ M+         YC I+T     GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYSVMVFAGLEHMHKYCFIVTL----GYLILCQITRVYVFDYGMY  129

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLK-ENDLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D TG +MVIT KI S      DGL K ++ L  +QK   + ++PSL EY+ Y      
Sbjct  130  SADFTGPMMVITQKITSLAFEIHDGLTKRDSQLTPSQKYLAISRMPSLLEYLSYNCNFMG  189

Query  590  HFAGPVYEMKAYLEWTE---------RKGIWKPAGKERPS-PSPFVPTLRALLQAAFCMG  739
              AGP      Y+ + E              K  GK + S PSP    +  L   A  + 
Sbjct  190  ILAGPTCSYNDYMAFIEGTCYQPRHQENANGKENGKYKQSEPSPKNDVISKLCTCAVSLA  249

Query  740  LYLYLVPYFPLAR-FNDSL  793
            +YL L    P+    ND  
Sbjct  250  IYLSLCKVLPVEHSINDDF  268



>ref|XP_004401863.1| PREDICTED: lysophospholipid acyltransferase 2 [Odobenus rosmarus 
divergens]
Length=519

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 112/249 (45%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLC----FVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C     +A I      R     S  RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLRSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C +  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLAYEIHDGMFRKDEELTSSQRGLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTE-RKGIWKPAGK--------ERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   + Y+ + E R     P G         ER  PSP V  ++ LL     +  +
Sbjct  188  LAGPLCSYRDYITFIEGRVHHRAPPGASGKEDMPCERAEPSPNVAVIQKLLVCGLSLFFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTISKTLPV  256



>gb|EFA78146.1| membrane bound O-acyl transferase family protein [Polysphondylium 
pallidum PN500]
Length=462

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 99/217 (46%), Gaps = 10/217 (5%)
 Frame = +2

Query  104  GVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSSNLHFLVP  283
            G  +  ++F+LC + + P++ + R +P  S+ +H+ +   G    + S G  S +H    
Sbjct  11   GFPLDQVKFVLCMLFSYPMAMVLRSLPNAST-KHMMSIALGIFYCHFSLGAFSWIHSFAS  69

Query  284  MLLGYASM-LLYRPYCGIITFFLAFGYLIGCHVYYMSGD--AWKEGGIDSTGALMVITLK  454
             L+ Y  + +L R    I  F  A  YL   H Y M  D   W    +D T   MV+TLK
Sbjct  70   SLVCYIMVSVLPRRVSHIWVFVFAMAYLSISHWYRMYTDYMGWT---MDFTSPQMVLTLK  126

Query  455  IISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYLEW  634
            + S   N  DG     +L   Q++  + K+PSL E+ G+     +  AGP  E+  YL +
Sbjct  127  LTSFAWNLYDGSRPATELTSDQQRRSIKKVPSLLEFFGFIYFFPTFLAGPTIEIGDYLRY  186

Query  635  TERKGIWKPAGKERP-SPSPFVPTLRALLQAAFCMGL  742
            T   G+    GK     PSP   +LR  +    C  L
Sbjct  187  TS--GLMFKDGKSNGIMPSPNFASLRTFVYGILCFPL  221



>ref|XP_007457003.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X2 [Lipotes 
vexillifer]
Length=401

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 114/249 (46%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C +  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTE-RKGIWKPAGK--------ERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E R     P+G+        E+  PSP +  ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSHHMTPSGERGKEDTQCEKTEPSPNIAVIQKLLVCGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTISKTLPV  256



>ref|XP_011512615.1| PREDICTED: lysophospholipid acyltransferase 1 isoform X3 [Homo 
sapiens]
 dbj|BAG65506.1| unnamed protein product [Homo sapiens]
Length=241

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 103/224 (46%), Gaps = 26/224 (12%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L P++  +G+ +  + F++C +  +  +   R    PG +S   RH  A + G       
Sbjct  20   LHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFC  79

Query  248  FGFSSNLHFLVPMLLGYASML------LYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKE  409
            FG+ S +H  V +L+ YA M+      ++R      +FF+A GYL  CH+  +    +  
Sbjct  80   FGWYS-VHLFVLVLMCYAIMVTASVSNIHR-----YSFFVAMGYLTICHISRIYIFHYGI  133

Query  410  GGIDSTGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKL-PSLFEYIGYCLCCG  586
               D +G LM++T KI +      DGL +  +   A++    +K+ PS  EY+ Y L   
Sbjct  134  LTTDFSGPLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFM  193

Query  587  SHFAGPVYEMKAYLEWTERKGI--------WKPAG-KERPSPSP  691
            S  AGP    K Y+ + E K I        WK  G    P PSP
Sbjct  194  SVIAGPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSP  237



>gb|EAR97515.2| membrane-bound O-acyltransferase family MBOAT protein [Tetrahymena 
thermophila SB210]
Length=297

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 107/238 (45%), Gaps = 16/238 (7%)
 Frame = +2

Query  80   LEPMASAI---GVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            LE +A  +    V+   ++ LLCFV  IP+  +  F       RH+Y++L G +LS+L +
Sbjct  38   LEKIAKEVFDNDVTSDQIKLLLCFVGIIPLGFI-LFQIKSPLLRHVYSSLLGFILSFLVY  96

Query  251  GFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGD--AWKEGGIDS  424
            G  + +   V  L+ Y    ++  +   + F     +L   H+Y    D   W+   +D 
Sbjct  97   G-GNVISSHVMTLVTYILCAIFGRHSQKVVFVFCLTFLSVHHIYRQITDYGGWR---MDV  152

Query  425  TGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGP  604
            +  LM+   K++S    Y DG   E  L E QK+ R+ KLP++F +  Y    GS  AGP
Sbjct  153  SVILMMNFCKLVSFAFCYSDGFKDEKQLSEDQKERRIQKLPNIFSFFSYINFLGSAIAGP  212

Query  605  VYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLAR  778
             ++   +  +   K  +         P P + T + L      + +   ++P FPL  
Sbjct  213  TFDYYEFDNFINLKNGYANI------PHPILDTFKNLGIGMVYLFITARVLPKFPLEH  264



>ref|XP_004082306.1| PREDICTED: lysophospholipid acyltransferase 2 [Oryzias latipes]
Length=504

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 75/251 (30%), Positives = 110/251 (44%), Gaps = 25/251 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L+P++  I + +  + F+ C +  + ++   R    P  +S   RH+ A L G  L+   
Sbjct  15   LQPLSEIINLPLDQVNFVACQLFALLMAMWFRIYLHPSKTSPFIRHVVATLLGFYLALFC  74

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ S LHFLV   L Y  M+         YC I+T     GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYGVMIFAGLEHMHKYCFIVTL----GYLIVCQITRVYVFDYGMY  129

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLK-ENDLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D TG +MVIT KI S      DGL K E+ L   QK   + ++PSL EY+ Y      
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLAKKESQLTPNQKYLAISRMPSLLEYLSYNCNFMG  189

Query  590  HFAGPVYEMKAYLEWTE---------RKGIWKPAGK-ERPSPSPFVPTLRALLQAAFCMG  739
              AGP    + Y+ + E              K  GK ++  PSP    +  L   A  + 
Sbjct  190  ILAGPTCSYRDYMAFIEGTCYQARHQENANGKENGKFKQSEPSPKNDVISKLCTCAISLA  249

Query  740  LYLYLVPYFPL  772
            +YL L    P+
Sbjct  250  VYLSLYKLLPV  260



>ref|XP_007433489.1| PREDICTED: lysophospholipid acyltransferase 1 [Python bivittatus]
Length=496

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 103/227 (45%), Gaps = 16/227 (7%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV---PGGSSG-RHLYAALTGALLSYLS  247
            L P++   G+ +  + F+ C +  +  +   R        SSG RH +A + G   +   
Sbjct  17   LHPLSDQFGIPLDQVNFVACQLFALLAAFWFRLYLRPSQASSGVRHAFATILGIYFAVFC  76

Query  248  FGFSSNLHFLVPMLLGYASMLLYR-PYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDS  424
            FG+ S +H  + +++ Y  M +   P     +F +A GYL  CH+  +    +     D 
Sbjct  77   FGWYS-IHIFILVMISYGIMNMASIPNVHRYSFLVAMGYLTLCHISRIFIFQYGILTTDF  135

Query  425  TGALMVITLKIISCVMNYQDGLLKE-NDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAG  601
            +G LM++T KI +      DG+ K+  DL   Q Q+ + + PSL EY+ Y L   S  AG
Sbjct  136  SGPLMIVTQKITTLAFQIHDGIGKKAEDLTSEQNQHAIKRRPSLLEYLSYQLNFMSIIAG  195

Query  602  PVYEMKAYLEWTERKGI--------WKPAGKERPS-PSPFVPTLRAL  715
            P    K Y+ + E + +        WK    +R S PSP    L  L
Sbjct  196  PCSNFKDYIAFIEGRHVQMKLLEVNWKQRSCDRLSDPSPLGAILHKL  242



>ref|XP_003701761.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Megachile 
rotundata]
Length=500

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/253 (27%), Positives = 110/253 (43%), Gaps = 30/253 (12%)
 Frame = +2

Query  101  IGVSVPVLRFLLC-FVATIPVSCLHRFVPGGS---SGRHLYAALTGALLSYLSFGFSSNL  268
            + V +  + FL+  F A I    L  F+       + RH++  + G LL Y  FG    +
Sbjct  22   LDVPLDQVNFLVTQFTALILAGVLRNFLSPDRVSPTTRHVFGLVNGLLLGYFCFG-RQVI  80

Query  269  HFLVPMLLGYASMLLYRPYCGIITFFL--AFGYLIGCHVYYMSGDAWKEGGIDSTGALMV  442
            H     +L Y  M    P   + +F L  A  YL   H +    D +    +D TG LMV
Sbjct  81   HLAGLSILSYIVMYTQNP-RNMQSFVLVTALFYLSCVHFHRQIYD-YASYTLDITGPLMV  138

Query  443  ITLKIISCVMNYQDGLLK-ENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMK  619
            IT K+ S   N  DGL++ E +L   Q+   + ++P+  EY  +     +  AGPV   +
Sbjct  139  ITQKVTSLAYNVHDGLIRSEKELTPTQRHQAVKQMPTPLEYFSFVFHFQALMAGPVIYYR  198

Query  620  AYLEWTERKGIWKPAGKERPS----------------PSPFVPTLRALLQAAFCMGLYLY  751
             Y+++   + + KP    RPS                PSP    ++ +L +  C   ++ 
Sbjct  199  DYMDFIHGRNLSKP----RPSTANDQNSNDRNAIVQLPSPIFVVIKKVLASLLCALAFVI  254

Query  752  LVPYFPLARFNDS  790
             +P FP+ R  D+
Sbjct  255  FIPLFPIDRLKDN  267



>ref|XP_003927360.1| PREDICTED: lysophospholipid acyltransferase 1 isoform X1 [Saimiri 
boliviensis boliviensis]
Length=495

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/224 (31%), Positives = 100/224 (45%), Gaps = 26/224 (12%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L P++  +G+ +  + F+ C +  +  +   R    PG +S   RH  A + G   +   
Sbjct  20   LHPLSELLGIPLDQVNFVACQLVALFAAFWFRIYLRPGKTSSDVRHAVATIFGIYFAIFC  79

Query  248  FGFSSNLHFLVPMLLGYASML------LYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKE  409
            FG+ S LH  V +LL YA M       ++R      +FF+A GYL  CH+  +    +  
Sbjct  80   FGWYS-LHLFVLVLLCYAIMATASASNIHR-----YSFFVAMGYLTICHISRIYIFHYGI  133

Query  410  GGIDSTGALMVITLKIISCVMNYQDGL-LKENDLREAQKQNRLLKLPSLFEYIGYCLCCG  586
               D +G LM++T KI +      DGL  +  DL   Q Q  +   PS  EY+ Y L   
Sbjct  134  LTTDFSGPLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHQLAIKVKPSFLEYLSYLLNFM  193

Query  587  SHFAGPVYEMKAYLEWTERKGI--------WKPAG-KERPSPSP  691
            S  AGP    K Y+ + E K I        WK  G    P PSP
Sbjct  194  SVIAGPCNNFKDYVAFIEGKHIHMKLLEVNWKQKGFHSLPDPSP  237



>ref|XP_010336319.1| PREDICTED: lysophospholipid acyltransferase 1 isoform X2 [Saimiri 
boliviensis boliviensis]
Length=397

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 97/219 (44%), Gaps = 16/219 (7%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L P++  +G+ +  + F+ C +  +  +   R    PG +S   RH  A + G   +   
Sbjct  20   LHPLSELLGIPLDQVNFVACQLVALFAAFWFRIYLRPGKTSSDVRHAVATIFGIYFAIFC  79

Query  248  FGFSSNLHFLVPMLLGYASMLLYR-PYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDS  424
            FG+ S LH  V +LL YA M           +FF+A GYL  CH+  +    +     D 
Sbjct  80   FGWYS-LHLFVLVLLCYAIMATASASNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDF  138

Query  425  TGALMVITLKIISCVMNYQDGL-LKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAG  601
            +G LM++T KI +      DGL  +  DL   Q Q  +   PS  EY+ Y L   S  AG
Sbjct  139  SGPLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHQLAIKVKPSFLEYLSYLLNFMSVIAG  198

Query  602  PVYEMKAYLEWTERKGI--------WKPAG-KERPSPSP  691
            P    K Y+ + E K I        WK  G    P PSP
Sbjct  199  PCNNFKDYVAFIEGKHIHMKLLEVNWKQKGFHSLPDPSP  237



>gb|ETE68526.1| Lysophospholipid acyltransferase 1, partial [Ophiophagus hannah]
Length=418

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 96/229 (42%), Gaps = 27/229 (12%)
 Frame = +2

Query  188  GSSGRHLYAALTGALLSYLSFGFSSNLHFLVPMLLGYASMLL----------------YR  319
             S+ RH +A + G   +   FG+ S +H    +++GY  M +                  
Sbjct  27   NSAVRHAFATILGIYFALFCFGWYS-IHIFTLVMIGYFIMNMASISNIHSVLAKMFHTIN  85

Query  320  PYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGALMVITLKIISCVMNYQDGL-LK  496
             Y    +F +A GYL  CH+  +    +     D +G LM++T KI +      DG+  K
Sbjct  86   AYDSRYSFLVAMGYLTLCHISRIYIFQYGILTTDFSGPLMIVTQKITTLAFQVHDGIGRK  145

Query  497  ENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYLEWTERKGI--------  652
              DL   QKQ  +   PSL EY+ Y L   S  AGP    K Y+E+ E + +        
Sbjct  146  AEDLTSEQKQLAIKTRPSLLEYLSYHLNFMSIIAGPCSNFKDYIEFIEGRHVQMKLLKVS  205

Query  653  WKPAGKER-PSPSPFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDSLY  796
            WK    +R P PSP    L+ L      + ++L L   FP     D  +
Sbjct  206  WKQRNCDRFPDPSPVGVILQKLGITLLSLVVFLTLTKTFPATYIVDDQF  254



>ref|XP_001083917.2| PREDICTED: lysophospholipid acyltransferase 2 isoform 2 [Macaca 
mulatta]
 ref|XP_005576659.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X2 [Macaca 
fascicularis]
Length=401

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 67/249 (27%), Positives = 112/249 (45%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTE-RKGIWKPAGK--------ERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E R      AG+        ER  PSP    ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHMTQAGENGKEETQYERTEPSPNTAVIQKLLICGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTICTTLPV  256



>gb|KDN66214.1| putative MBOAT family protein [Colletotrichum sublineola]
Length=556

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/251 (28%), Positives = 112/251 (45%), Gaps = 19/251 (8%)
 Frame = +2

Query  62   QERDMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGS-SGRHLYAALTGALLS  238
             ER   L     A  V V  ++ +  F+ + P++ L + +P      ++L+   T AL  
Sbjct  21   DERQSSLSRRNIA-DVGVSTVKLVFSFLISYPLAGLLKRIPDTRPDQKNLFIICTSALYL  79

Query  239  YLSFGFSSNLHFLVPMLLGY---ASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKE  409
               F     +  L    +G    A  L   P+   I F    G++   H+   + +    
Sbjct  80   VGLFDLWDGVRTLAIASVGVYVIAKYLRTSPFMPWIGFGFLMGHMSINHIARQTAN--NP  137

Query  410  GGIDSTGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              +D TGA MV+ +K+ +   N  DG L E+ L + QK+ RL+ LP + +Y GY L   S
Sbjct  138  SSVDITGAQMVLLMKLSAFCWNVADGQLPEDQLSDYQKERRLVDLPGILDYAGYVLFFPS  197

Query  590  HFAGPVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLR--------ALLQAAF---CM  736
             FAGP ++   Y +W +      PA  + PS +P V   R        A L+AA     +
Sbjct  198  LFAGPAFDYADYRKWIDTTMFDLPAQVD-PSKAPPVRKKRKIPRSGTPATLKAASGLGWI  256

Query  737  GLYLYLVPYFP  769
            GL++ L  Y+P
Sbjct  257  GLFMLLSNYYP  267



>emb|CCF46357.1| MBOAT family protein [Colletotrichum higginsianum]
Length=539

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 110/244 (45%), Gaps = 18/244 (7%)
 Frame = +2

Query  89   MASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGS-SGRHLYAALTGALLSYLSFGFSSN  265
            +A  +G S   L+ +  F+ + P++ L + VP      ++L+   T        F     
Sbjct  12   LALRLGASSDELKLVFSFLISYPLAGLLKRVPDARPDQKNLFIICTSTFYLVGLFDLWDG  71

Query  266  LHFLVPMLLGYASMLLY---RPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGAL  436
            +  L    +G   +  Y    P+   I F    G++   H+     +      +D TGA 
Sbjct  72   VRTLAIASVGVYCITKYMRTSPFMPWIGFGFLMGHMSINHIARQVAN--NPSSVDITGAQ  129

Query  437  MVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEM  616
            MV+ +K+ +   N  DG L E+ L + QK+ RL+ LP L +Y GY L   S FAGP ++ 
Sbjct  130  MVLLMKLSAFCWNVADGQLPEDQLSDYQKERRLVDLPGLLDYAGYVLFFPSLFAGPAFDY  189

Query  617  KAYLEWTERKGIWKPAGKERPSPSPFVPTLR--------ALLQAAF---CMGLYLYLVPY  763
              Y +W +      PA  + PS +P V   R        A L+AA     +GL+++L  Y
Sbjct  190  IDYRKWIDTTMFNLPAQVD-PSKAPPVRKKRKIPRSGTPATLKAASGLGWIGLFMFLSNY  248

Query  764  FPLA  775
            +P+ 
Sbjct  249  YPIT  252



>ref|XP_009967143.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like, partial [Tyto alba]
Length=238

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 106/231 (46%), Gaps = 24/231 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P++SAI   V  + F++C +  +  +   R     S      RH+ A L G  L+   F
Sbjct  4    KPISSAIRTPVNQVNFVVCQLFALLAAIWFRTYLHSSKTSPFIRHVVATLLGLYLALFCF  63

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHF++   + Y  M++        YC    F  A GYL  C +  +    + +  
Sbjct  64   GWYA-LHFVIQSGISYYIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQYS  118

Query  416  IDSTGALMVITLKIISCVMNYQDGLLKEN-DLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+ ++N DL  +Q+   + ++PSL EY+ Y       
Sbjct  119  ADFSGPMMIITQKITSLAFEIHDGMFRKNEDLTPSQRCLAVRRMPSLLEYLSYNCNFMGI  178

Query  593  FAGPVYEMKAYLEWTERKGIW----KPAGK-----ERPSPSPFVPTLRALL  718
             AGP+   K Y+ + E +       +  GK     E+  PSP +   R LL
Sbjct  179  LAGPLCSYKDYITFIEGRSYQLQQSEANGKEDTKYEQTDPSPNISVSRYLL  229



>ref|XP_007457002.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Lipotes 
vexillifer]
Length=520

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 114/249 (46%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C +  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTE-RKGIWKPAGK--------ERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E R     P+G+        E+  PSP +  ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSHHMTPSGERGKEDTQCEKTEPSPNIAVIQKLLVCGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTISKTLPV  256



>ref|XP_008400149.1| PREDICTED: lysophospholipid acyltransferase 2 [Poecilia reticulata]
Length=522

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 70/214 (33%), Positives = 92/214 (43%), Gaps = 22/214 (10%)
 Frame = +2

Query  200  RHLYAALTGALLSYLSFGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYL  364
            RH+ A L G  L+   FG+ S +HFLV   L Y  M+         YC I+T     GYL
Sbjct  76   RHVVATLLGLYLALFCFGWYS-VHFLVQSGLSYGVMIFASLEHMHKYCFIVTL----GYL  130

Query  365  IGCHVYYMSGDAWKEGGIDSTGALMVITLKIISCVMNYQDGLLK--ENDLREAQKQNRLL  538
            I C +  +    +     D TG +MVIT KI S      DGL K  E  L  +QK   + 
Sbjct  131  IVCQITRVYVFDYGMYSADFTGPMMVITQKITSMAFEIHDGLSKRREGQLTPSQKYLAIS  190

Query  539  KLPSLFEYIGYCLCCGSHFAGPVYEMKAYLEWTE-----RKGIWKPAGKE-----RPSPS  688
            ++PSL EY+ Y        AGP      Y+ + E     R+      GKE     +P PS
Sbjct  191  RMPSLLEYLSYNCNFMGILAGPTCSYNDYMAFMEGTSYQRRRQESANGKENGKAKQPEPS  250

Query  689  PFVPTLRALLQAAFCMGLYLYLVPYFPLARFNDS  790
            P    +  L   A  +  YL L    P+ R  D 
Sbjct  251  PKRAVVAKLCTCAISLTTYLSLYRLLPVVRSIDE  284



>ref|XP_004363935.1| hypothetical protein CAOG_03096 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE92069.1| hypothetical protein CAOG_003096 [Capsaspora owczarzaki ATCC 
30864]
Length=500

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 101/226 (45%), Gaps = 12/226 (5%)
 Frame = +2

Query  65   ERDMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYL  244
            + D  LEP A  +G SV  L+ ++C +A   +S  H+ +P  ++ +HLY+A  G L    
Sbjct  5    DVDAWLEPHALTLGFSVDKLKLVICLLAAYLISFGHKMLPSPTT-KHLYSATAGFLFGIF  63

Query  245  SFGFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG--I  418
             FG +     L   +  YA   +  P   +++F     ++  CH   M    +  GG  +
Sbjct  64   CFGLTQMALPLAMAIPVYALSFVPNPKVPLVSFVFCLFFMCICH---MVRQYYDYGGYTL  120

Query  419  DSTGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFA  598
            D TG LM++T K+ +      DG   E    + QK     ++PS+ E+ G+    G   +
Sbjct  121  DVTGPLMILTTKLTAYAFTVADGRRFEKCTPDQQKY-ATRQVPSVLEFAGFVFFYGGFLS  179

Query  599  GPVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLRALLQAAFCM  736
            GP  E + Y+ +T       P GK    PS   P L   L   F M
Sbjct  180  GPGIEFQDYMRFTNLTVF--PNGK---IPSTIKPALMRFLAGIFFM  220



>ref|XP_008306774.1| PREDICTED: lysophospholipid acyltransferase 2 [Cynoglossus semilaevis]
Length=509

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 77/257 (30%), Positives = 109/257 (42%), Gaps = 25/257 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L+P++  I + +  + F+ C +  + ++   R    P  +S   RH+ A L G  L+   
Sbjct  15   LQPISDIINLPLDQVNFVACQLFALLMAVWFRLYLHPSKTSPFIRHVVATLLGFYLALFC  74

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ S LHFLV   L Y  M+         YC I+T     GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYGVMVFAGLERMHRYCFIVTM----GYLIICQITRVYVFDYGMY  129

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLK-ENDLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D TG +MVIT KI S      DGL K E  L   QK   + ++PSL EY+ Y      
Sbjct  130  SADFTGPMMVITQKITSMAFELHDGLTKREGQLTPNQKYLAISRMPSLLEYLSYNCNFMG  189

Query  590  HFAGPVYEMKAYLEWTE---------RKGIWKPAGKERPS-PSPFVPTLRALLQAAFCMG  739
              AGP      Y+ + E              K  GK + S PSP    +  L   A  + 
Sbjct  190  ILAGPTCSYNDYMAFIEGTCYEPRHQENANGKENGKYKQSEPSPKNDVISKLCTCALSLA  249

Query  740  LYLYLVPYFPLARFNDS  790
            +YL L    P+    D 
Sbjct  250  VYLSLCKLLPVEHSIDD  266



>ref|XP_011747724.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X2 [Macaca 
nemestrina]
Length=520

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 67/249 (27%), Positives = 112/249 (45%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTE-RKGIWKPAGK--------ERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E R      AG+        ER  PSP    ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHMTQAGENGKEETQYERTEPSPNTAVIQKLLICGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTICTTLPV  256



>ref|XP_005576658.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Macaca 
fascicularis]
Length=520

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 111/249 (45%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLC----FVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C     +A I            S  RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTE-RKGIWKPAGK--------ERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E R      AG+        ER  PSP    ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHMTQAGENGKEETQYERTEPSPNTAVIQKLLICGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTICTTLPV  256



>ref|XP_004868363.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Heterocephalus 
glaber]
Length=520

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 106/224 (47%), Gaps = 26/224 (12%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLC-----FVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYL  244
            L+P+++A+ + +  + F++C     F A    + LH      S  RH+ A L G  L++ 
Sbjct  12   LQPLSNAVQLPIDQVNFVVCQLFALFAAIWFRTYLHS-SKTSSFIRHVVATLLGLYLAFF  70

Query  245  SFGFSSNLHFLVPMLLGYASMLLY-----RPYCGIITFFLAFGYLIGCHVYYMSGDAWKE  409
             FG+ + LHFLV   + Y  M++        YC    F  A GYL  C +  +    + +
Sbjct  71   CFGWYA-LHFLVQSGISYCIMIVTGVESMHKYC----FVFALGYLTVCQITRVYIFDYGQ  125

Query  410  GGIDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCG  586
               D +G +M+IT KI S      DG+  K+ DL  +Q+   + ++PSL EY+ Y     
Sbjct  126  YSADFSGPMMIITQKITSLACEIHDGMFRKDEDLTPSQRGLAVRRMPSLLEYVSYTCNFM  185

Query  587  SHFAGPVYEMKAYLEWTERKGIWKP----AGK-----ERPSPSP  691
               AGP+   K Y+ + E +   +     +GK     ER  PSP
Sbjct  186  GILAGPLCSYKDYVTFIEGRAHHRAQPGHSGKEAAPWERADPSP  229



>gb|AAI28938.1| LOC100037100 protein [Xenopus laevis]
Length=497

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 110/252 (44%), Gaps = 14/252 (6%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLS  247
            L+P++  +   +  + F+ C +  + ++   R     S+     RH +A   G   +   
Sbjct  15   LQPLSQLLHTPLDQVNFVACQLVALLIAFWFRIYLNPSNAHPAVRHAFATFVGVYFAVFC  74

Query  248  FGFSSNLHFLVPMLLGYASMLLYR-PYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDS  424
            FG+ S LH    +LL Y  M+          +F +A GYL  C +  +    +     D 
Sbjct  75   FGWYS-LHIFTLVLLCYCIMITASVTNIHRYSFIMAMGYLTLCQINRVYIFNYGILSTDF  133

Query  425  TGALMVITLKIISCVMNYQDGLLKE-NDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAG  601
            +G LM+IT KI +      DGL +    L + Q+Q  + K PS  EY+ Y L   S  AG
Sbjct  134  SGPLMIITQKITTLAFQLHDGLGRSFKSLTKDQQQYSIKKKPSFLEYLSYHLNFMSVLAG  193

Query  602  PVYEMKAYLEWTERKGIW------KPAGKER-PSPSPFVPTLRALLQAAFCMGLYLYLVP  760
            P    + Y+ + E + I       K  G  + P+PSP    L  L  AA C+ ++L L  
Sbjct  194  PCSNFQDYIAFIEGRHIQSKLLNSKANGYTKLPNPSPNEVVLYKLCVAAACLVVFLTLTK  253

Query  761  YFPLARFNDSLY  796
             FP+    D  +
Sbjct  254  AFPILYVVDETF  265



>ref|XP_008201126.1| PREDICTED: lysophospholipid acyltransferase 1 [Tribolium castaneum]
Length=500

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 112/248 (45%), Gaps = 16/248 (6%)
 Frame = +2

Query  89   MASAIGVSVPVLRFLLCFVATIPVSCLHRFV----PGGSSGRHLYAALTGALLSYLSFGF  256
            ++  +G+SV  + F++  V  + ++ L R V       ++ RH +  +   ++ Y  FG 
Sbjct  18   LSEYLGISVDKVNFVISQVGALFLASLFRNVLHPSKANAATRHAFGLVFALIIGYFCFG-  76

Query  257  SSNLHFLVPMLLGYASMLLYRPYC-GIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
            +  +H        Y  +    P     +   +A  YL   H++    D +    +D TG 
Sbjct  77   TQAIHLAALPAACYIVIRTQSPEVMQRMVLAVALVYLSVIHLHRQIYD-YGSYNLDITGP  135

Query  434  LMVITLKIISCVMNYQDGLLKEND-LREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            LMVIT K+ S   N  DGL K  + L ++QK   + K+P+  EY  + L   S  AGP  
Sbjct  136  LMVITQKVTSLAFNIHDGLTKHQEKLSKSQKSYAVTKIPNPLEYFSFVLHFPSLMAGPAM  195

Query  611  EMKAYLEWTERKGIWKPAGKERPS--------PSPFVPTLRALLQAAFCMGLYLYLVPYF  766
              K Y+++ +   +  P   + P+        PSP     + +  AA C  +++  +P F
Sbjct  196  LYKEYMDFIDGSNLKSPVLADTPTRNAPIVVEPSPTWAVCKKVAIAAGCAAIFVKFLPMF  255

Query  767  PLARFNDS  790
            P++R  ++
Sbjct  256  PISRVKEN  263



>ref|XP_011508614.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X4 [Homo 
sapiens]
 ref|XP_011508615.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X4 [Homo 
sapiens]
 ref|XP_011508616.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X4 [Homo 
sapiens]
Length=343

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 64/249 (26%), Positives = 110/249 (44%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLLY-----RPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTERKGIW---------KPAGKERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E +            +    ER  PSP    ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTICTTLPV  256



>ref|XP_007296108.1| MBOAT family protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD13501.1| MBOAT family protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=553

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 62/124 (50%), Gaps = 5/124 (4%)
 Frame = +2

Query  344  FLAFGYLIGCHVYYMSGDAWKE--GGIDSTGALMVITLKIISCVMNYQDGLLKENDLREA  517
            ++ F +L+G       G  W    G +D TGA MV+ +K+ +   N  DG L E DL E 
Sbjct  98   WIGFLFLMGHMSINQLGRQWANDPGSVDITGAQMVLVMKLTAFCWNVADGRLPEKDLSEF  157

Query  518  QKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYLEWTERKGIWKPAGKERPSPSPFV  697
            Q++  L KLPSL  Y GY L   S FAGP ++   Y  W E      PAG +   PS   
Sbjct  158  QRERALKKLPSLLNYAGYVLFFPSLFAGPAFDYVEYRRWIETTMFEVPAGVD---PSKKA  214

Query  698  PTLR  709
            PT +
Sbjct  215  PTRK  218



>ref|XP_011508613.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X3 [Homo 
sapiens]
Length=351

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 64/249 (26%), Positives = 110/249 (44%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTERKGIW---------KPAGKERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E +            +    ER  PSP    ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTICTTLPV  256



>ref|XP_011975217.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X3 [Ovis 
aries musimon]
Length=526

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 67/250 (27%), Positives = 114/250 (46%), Gaps = 24/250 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLS  247
            L+P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   
Sbjct  18   LQPLSNAVRLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFC  77

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ + LHFLV   + Y  M++        YC    F  A GYL  C +  +    + + 
Sbjct  78   FGWYA-LHFLVQSGISYCIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQY  132

Query  413  GIDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y      
Sbjct  133  SADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYLSYNCNFMG  192

Query  590  HFAGPVYEMKAYLEWTE-RKGIWKPAGK--------ERPSPSPFVPTLRALLQAAFCMGL  742
              AGP+   K Y+ + E R      +G+        ER  PSP V  ++ LL     +  
Sbjct  193  ILAGPLCSYKDYITFIEGRSYHMTQSGENGKEEIQYERTEPSPNVAVIQKLLVCGLSLLF  252

Query  743  YLYLVPYFPL  772
            +L +    P+
Sbjct  253  HLTISKMLPV  262



>ref|XP_006898258.1| PREDICTED: lysophospholipid acyltransferase 2 [Elephantulus edwardii]
Length=520

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 66/245 (27%), Positives = 108/245 (44%), Gaps = 16/245 (7%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLC----FVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C     +A I            S  RH+ A L G  L++  F
Sbjct  13   QPLSNALQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFVRHVVATLLGLYLAFFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLLY-RPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDST  427
            G+ + LHFLV   + Y  M++          F  A GYL  C +  +    + +   D +
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGMENMHTCCFVFALGYLTMCQISRVYIFDYGQYSADFS  131

Query  428  GALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGP  604
            G +MVIT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y        AGP
Sbjct  132  GPMMVITQKITSLAYEIHDGMFRKDEELTPSQRALAVRRMPSLLEYLSYNCNFMGILAGP  191

Query  605  VYEMKAYLEWTERKGIW---------KPAGKERPSPSPFVPTLRALLQAAFCMGLYLYLV  757
            +   K Y+ + E +            K A  ER  PSP V  +  L      +  +L L 
Sbjct  192  LCSYKDYITFIEGRSYQVSKTSEDGKKEAQDERTEPSPNVAVIEKLKICGLALLFHLALS  251

Query  758  PYFPL  772
              F +
Sbjct  252  KIFSV  256



>ref|XP_001253491.3| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Bos 
taurus]
Length=526

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 67/250 (27%), Positives = 114/250 (46%), Gaps = 24/250 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLS  247
            L+P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   
Sbjct  18   LQPLSNAVRLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFC  77

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ + LHFLV   + Y  M++        YC    F  A GYL  C +  +    + + 
Sbjct  78   FGWYA-LHFLVQSGISYCIMVIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQY  132

Query  413  GIDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y      
Sbjct  133  SADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYLSYNCNFMG  192

Query  590  HFAGPVYEMKAYLEWTE-RKGIWKPAGK--------ERPSPSPFVPTLRALLQAAFCMGL  742
              AGP+   K Y+ + E R      +G+        ER  PSP V  ++ LL     +  
Sbjct  193  ILAGPLCSYKDYITFIEGRSYHMTQSGEDGKEEIQYERTEPSPNVAVIQKLLVCGLSLLF  252

Query  743  YLYLVPYFPL  772
            +L +    P+
Sbjct  253  HLIISKMLPV  262



>ref|XP_007969738.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X6 [Chlorocebus 
sabaeus]
 ref|XP_011919318.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X4 [Cercocebus 
atys]
 ref|XP_011919319.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X4 [Cercocebus 
atys]
 ref|XP_011919320.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X4 [Cercocebus 
atys]
Length=401

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 66/249 (27%), Positives = 112/249 (45%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTE-RKGIWKPAGK--------ERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E R      +G+        ER  PSP    ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHMTQSGENGKEETQYERTEPSPNTAVIQKLLICGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTICTTLPV  256



>ref|XP_010590200.1| PREDICTED: LOW QUALITY PROTEIN: lysophospholipid acyltransferase 
2 [Loxodonta africana]
Length=521

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 113/249 (45%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLC----FVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C     +A I      R     S  RH+ A L G  L+   F
Sbjct  13   QPLSNAMQLPIDQVNFVVCQLFALLAAIWFRIYLRSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C +  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRDLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTERKG--IWKPAGK-------ERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E +   + +P          E+  PSP +  ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHMAQPGEDGEEEIRYEKTEPSPNIAVIQKLLVCGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTISKTLPV  256



>ref|XP_002816515.1| PREDICTED: lysophospholipid acyltransferase 1 [Pongo abelii]
Length=495

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 104/224 (46%), Gaps = 26/224 (12%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L P++  +G+ +  + F++C +  +  +   R    PG +S   RH+ A + G       
Sbjct  20   LHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHVVATIFGIYFVIFC  79

Query  248  FGFSSNLHFLVPMLLGYASML------LYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKE  409
            FG+ S +H  V +L+ YA M+      ++R      +FF+A GYL  CH+  +    +  
Sbjct  80   FGWYS-VHLFVLVLMCYAIMVTASVSNIHR-----YSFFVAMGYLTICHISRIYIFHYGI  133

Query  410  GGIDSTGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKL-PSLFEYIGYCLCCG  586
               D +G LM++T KI +      DGL +  +   A++    +K+ PS  EY+ Y L   
Sbjct  134  LTTDFSGPLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFM  193

Query  587  SHFAGPVYEMKAYLEWTERKGI--------WKPAG-KERPSPSP  691
            S  AGP    K Y+ + E K I        WK  G    P PSP
Sbjct  194  SVIAGPCNNFKDYVAFIEGKHIHVKLLEVNWKQKGFHSLPEPSP  237



>ref|XP_004274952.1| PREDICTED: lysophospholipid acyltransferase 2 [Orcinus orca]
Length=520

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 67/249 (27%), Positives = 113/249 (45%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C V  +  +   R     S      RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQVFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C +  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTE-RKGIWKPAGK--------ERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E R      +G+        E+  PSP V  +R LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHVTQSGEHGKEEIQYEKTEPSPNVAVIRKLLVCGLSLFFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTVSKTLPV  256



>ref|XP_006073877.1| PREDICTED: lysophospholipid acyltransferase 2, partial [Bubalus 
bubalis]
Length=521

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 67/250 (27%), Positives = 114/250 (46%), Gaps = 24/250 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLS  247
            L+P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   
Sbjct  13   LQPLSNAVRLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFC  72

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ + LHFLV   + Y  M++        YC    F  A GYL  C +  +    + + 
Sbjct  73   FGWYA-LHFLVQSGISYCIMVIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQY  127

Query  413  GIDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y      
Sbjct  128  SADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYLSYNCNFMG  187

Query  590  HFAGPVYEMKAYLEWTE-RKGIWKPAGK--------ERPSPSPFVPTLRALLQAAFCMGL  742
              AGP+   K Y+ + E R      +G+        ER  PSP V  ++ LL     +  
Sbjct  188  ILAGPLCSYKDYITFIEGRSYHMTQSGENGKEEIQYERTEPSPNVAVIQKLLVCGLSLLF  247

Query  743  YLYLVPYFPL  772
            +L +    P+
Sbjct  248  HLIISKMLPV  257



>ref|XP_007287206.1| mboat family protein [Colletotrichum gloeosporioides Nara gc5]
 gb|ELA23747.1| mboat family protein [Colletotrichum gloeosporioides Nara gc5]
Length=539

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 107/246 (43%), Gaps = 18/246 (7%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGS-SGRHLYAALTGALLSYLSFGFS  259
            E ++S +G S   L+ +  F+ + P++ L + VP      ++L+   T A      F   
Sbjct  10   ELLSSRLGASPDELKLVFSFLISYPLAGLLKRVPDARPDQKNLFIICTSAFYLVGLFDLW  69

Query  260  SNLHFLVPMLLGY---ASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTG  430
            S +  L    +G    A  L   P+   I F    G++   H+     D+     +D TG
Sbjct  70   SGVRTLAISSIGVYCIAKYLRSSPFMPWIGFAFVMGHMSISHIARQLADS--PSSVDITG  127

Query  431  ALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            A MV+ +K+ +   N  DG L E+ L + QK+ RL++LP L +Y GY L      AGP +
Sbjct  128  AQMVLLMKLSAFCWNVADGRLSEDKLSDFQKERRLVELPGLLDYAGYVLFFPGLLAGPAF  187

Query  611  EMKAYLEWTERKGIWKPAGKERPS-----------PSPFVPTLRALLQAAFCMGLYLYLV  757
            +   Y +W +      PA  + PS           P    P           +GL++ L 
Sbjct  188  DYAEYRKWIDTTMFDLPAQVD-PSKKPPVRKKRKIPRSGTPAAWKAASGLGWIGLFMVLS  246

Query  758  PYFPLA  775
             Y+P++
Sbjct  247  GYYPIS  252



>ref|XP_003219829.1| PREDICTED: lysophospholipid acyltransferase 1 [Anolis carolinensis]
Length=496

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 105/227 (46%), Gaps = 16/227 (7%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHR--FVPGG-SSG-RHLYAALTGALLSYLS  247
            L P++  +G+ +  + F  C +  +  +   R    P   SSG RH +A + G   +   
Sbjct  17   LHPVSLLLGIPLDQVNFFACQLFALLAAFWFRSYLSPSHVSSGVRHAFATIFGVYFAVFC  76

Query  248  FGFSSNLHFLVPMLLGYASMLLYR-PYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDS  424
            FG+ S +H  V +++ Y+ M+L   P     +F +A GYL  CHV  +   ++     D 
Sbjct  77   FGWYS-IHIFVLVMISYSIMVLASIPNIHRYSFMVAMGYLTLCHVSRIYIFSYGILTTDF  135

Query  425  TGALMVITLKIISCVMNYQDGL-LKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAG  601
            +G LM+IT KI        DG+  K  +L + QK+  +   PSL EY+ Y L   S  AG
Sbjct  136  SGPLMIITQKITILAFQVHDGIGRKLEELTKEQKELAIKTKPSLLEYLSYQLNFLSILAG  195

Query  602  PVYEMKAYLEWTERKGI--------WKPAGKER-PSPSPFVPTLRAL  715
            P    K Y+ + E + +        WK    ER P PSP    L  L
Sbjct  196  PCSNYKDYIAFIEGRHVQMKLLEVNWKERNCERLPDPSPVGAVLHKL  242



>ref|XP_011508611.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Homo 
sapiens]
 dbj|BAH12219.1| unnamed protein product [Homo sapiens]
Length=401

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 64/249 (26%), Positives = 110/249 (44%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTERKGIW---------KPAGKERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E +            +    ER  PSP    ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTICTTLPV  256



>ref|XP_011406119.1| PREDICTED: lysophospholipid acyltransferase 1-like [Amphimedon 
queenslandica]
Length=244

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 105/223 (47%), Gaps = 16/223 (7%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGS----SGRHLYAALTGALLS  238
            D   E +++ + V V  +R++  F+ + P++ L R V   S    + RH  +AL G    
Sbjct  2    DKLFEELSTILSVPVDKVRYVTLFLVSFPLATLLRVVLHYSYTSPTIRHTVSALLGLFFG  61

Query  239  YLSFGFSSNLHFLVPMLLGYASMLLYRPYCGIITFFLAFGYLIGC---HVYYMSGDAWKE  409
            ++ F +    + +  +L+GY  ++   P   I+  +     LI     H+Y +  D    
Sbjct  62   WICFQWQV-FYLIGFVLIGYILLVTLPP--SIVQRYSMIYALISISTGHIYRLITDY---  115

Query  410  GG--IDSTGALMVITLKIISCVMNYQDGLLK-ENDLREAQKQNRLLKLPSLFEYIGYCLC  580
            GG  +D TG LM++  ++      Y DG+ + E+ L E QK++++  +PSL EY  Y  C
Sbjct  116  GGYTLDFTGPLMLLVQRVSYVAYAYHDGVARDESKLTEDQKRHKIDSIPSLLEYFSYNFC  175

Query  581  CGSHFAGPVYEMKAYLEWTERKGIWKPAGKERPSPSPFVPTLR  709
              +  AGP    + Y ++     + +        PSP VP L+
Sbjct  176  FMTFLAGPTTTYREYDDFITGNNMIRAKQVTGSDPSPLVPVLK  218



>ref|XP_002016308.1| GL10561 [Drosophila persimilis]
 gb|EDW32198.1| GL10561 [Drosophila persimilis]
Length=728

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 67/250 (27%), Positives = 112/250 (45%), Gaps = 18/250 (7%)
 Frame = +2

Query  89   MASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLSFGF  256
            +A  +G+SV ++ FLLC ++ + ++ L R +  P   S   RH +A   G    Y  FG 
Sbjct  22   LADMVGLSVDLVNFLLCQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCFGQ  81

Query  257  SSNLHFLVPMLLGYASMLLYRPY-CGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
             + +H      + Y  +    P         +A  YL+  H+     D +    +D TG 
Sbjct  82   QA-IHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYD-YGSYALDITGP  139

Query  434  LMVITLKIISCVMNYQDGLLKEN-DLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            LM+IT K+ S   +  DG ++E  DL +AQ+ + + K+PS  EY  Y     S  AGP+ 
Sbjct  140  LMIITQKVTSLAFSIHDGFVREEEDLTKAQQYHAIRKMPSALEYFSYVWHFQSILAGPLV  199

Query  611  EMKAYLEWTERKGIWK--------PAGKER--PSPSPFVPTLRALLQAAFCMGLYLYLVP  760
              K Y+E+ E   + K          GK      PSP    +R ++ +  C  +++  V 
Sbjct  200  FYKDYIEFVEGYNLLKRPSTNGSLDNGKRELVLEPSPTKTVIRKVIGSLVCAFIFMKFVK  259

Query  761  YFPLARFNDS  790
             +P+    + 
Sbjct  260  LYPVKNMKED  269



>ref|XP_008560197.1| PREDICTED: lysophospholipid acyltransferase 1 isoform X1 [Microplitis 
demolitor]
Length=511

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 105/256 (41%), Gaps = 21/256 (8%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLC-FVATIPVSCLHRFVPGGS---SGRHLYAALTGALLSYLS  247
             E ++  +G+ V    F+L  F A      L  F+  G+   + RHL+  + G LL Y  
Sbjct  15   FEKLSDTVGLPVDQTNFVLSQFTALFFAGILRVFLKPGNVRPATRHLFGLVIGLLLGYFC  74

Query  248  FGFSSNLHFLVPMLLGYASMLLYRPYC-GIITFFLAFGYLIGCHVYYMSGDAWKEGGIDS  424
            FG     H      L + +M    P C   +   LA GYL  C  YY    A+    +D 
Sbjct  75   FG-KQAAHLAGLPALCFIAMRTQDPRCVQRVVLTLALGYL-SCVHYYRQIYAYGSYTLDI  132

Query  425  TGALMVITLKIISCVMNYQDGLLK-ENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAG  601
            TG LMVIT K+I    N  DG  + E DL   Q+   +  +P+  EY  Y     +  AG
Sbjct  133  TGPLMVITQKVIGLAYNIHDGFTRLEKDLTPLQRHQAVKIMPTTLEYFSYIFHFQALMAG  192

Query  602  PVYEMKAYLEWTER---------KGIWKPAGKERP----SPSPFVPTLRALLQAAFCMGL  742
            PV   + Y+++             G +  + KE       PSP    ++ +  +     L
Sbjct  193  PVIFYRDYMDFINGTRLKGGKSFSGFYDDSSKELEEIVLEPSPTKAVIKKITASLTFAVL  252

Query  743  YLYLVPYFPLARFNDS  790
            ++     FP+ R  D 
Sbjct  253  FVSFSSLFPIQRVKDQ  268



>ref|XP_003908301.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Papio 
anubis]
Length=520

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 66/249 (27%), Positives = 112/249 (45%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTE-RKGIWKPAGK--------ERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E R      +G+        ER  PSP    ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHMTQSGENGKEETQYERTEPSPNTAVIQKLLICGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTICTTLPV  256



>ref|XP_004609428.1| PREDICTED: lysophospholipid acyltransferase 2 [Sorex araneus]
Length=522

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 67/249 (27%), Positives = 115/249 (46%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLC----FVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C     +A +      R     S  RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAVWFRTYLRASKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHKYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTERKG--IWKPA--GK-----ERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E +   + +P   GK     E+  PSP +  ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHMAQPGENGKEEVQYEKTEPSPNIAVVQKLLVCGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTISKTLPV  256



>ref|XP_006864041.1| PREDICTED: lysophospholipid acyltransferase 2 [Chrysochloris 
asiatica]
Length=520

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 109/231 (47%), Gaps = 24/231 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFV----ATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C V    A I      R     S  RH+ A L G  L+   F
Sbjct  13   QPLSNAMQLPIDQVNFVVCQVFALLAAIWFRTYLRSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C +  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTERKG--IWKPA--GK-----ERPSPSPFVPTLRALL  718
             AGP+   K Y+ + E +   + +P   GK     ER  PSP V  ++ L+
Sbjct  188  LAGPLCSYKDYITFIEGRSYHMTQPGEDGKEETQYERTEPSPNVAVIQKLV  238



>ref|XP_001360700.2| GA14938 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL25275.2| GA14938 [Drosophila pseudoobscura pseudoobscura]
Length=729

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 67/250 (27%), Positives = 112/250 (45%), Gaps = 18/250 (7%)
 Frame = +2

Query  89   MASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLSFGF  256
            +A  +G+SV ++ FLLC ++ + ++ L R +  P   S   RH +A   G    Y  FG 
Sbjct  22   LADMVGLSVDLVNFLLCQISALFLASLFRSMLHPSKVSSKLRHTFALSIGLAFGYFCFGQ  81

Query  257  SSNLHFLVPMLLGYASMLLYRPY-CGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDSTGA  433
             + +H      + Y  +    P         +A  YL+  H+     D +    +D TG 
Sbjct  82   QA-IHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYD-YGSYALDITGP  139

Query  434  LMVITLKIISCVMNYQDGLLKEN-DLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVY  610
            LM+IT K+ S   +  DG ++E  DL +AQ+ + + K+PS  EY  Y     S  AGP+ 
Sbjct  140  LMIITQKVTSLAFSIHDGFVREEEDLTKAQQYHAIRKMPSALEYFSYVWHFQSILAGPLV  199

Query  611  EMKAYLEWTERKGIWK--------PAGKER--PSPSPFVPTLRALLQAAFCMGLYLYLVP  760
              K Y+E+ E   + K          GK      PSP    +R ++ +  C  +++  V 
Sbjct  200  FYKDYIEFVEGYNLLKRPSTNGSLDNGKRELVLEPSPTKTVIRKVIGSLVCAFIFMKFVK  259

Query  761  YFPLARFNDS  790
             +P+    + 
Sbjct  260  LYPVKNMKED  269



>ref|XP_011919313.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Cercocebus 
atys]
Length=520

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 66/249 (27%), Positives = 112/249 (45%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTE-RKGIWKPAGK--------ERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E R      +G+        ER  PSP    ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHMTQSGENGKEETQYERTEPSPNTAVIQKLLICGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTICTTLPV  256



>ref|XP_004025015.1| mboat family protein, putative [Ichthyophthirius multifiliis]
 gb|EGR27563.1| mboat family protein, putative [Ichthyophthirius multifiliis]
Length=465

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 67/227 (30%), Positives = 100/227 (44%), Gaps = 17/227 (7%)
 Frame = +2

Query  104  GVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSFGFSSNLHFLVP  283
            G+ V  +R  +  + TIP   +  F+ G    RHL  +  G  L YL +     +  L  
Sbjct  19   GMEVDQIRLAVSLIMTIPFGLIFYFIRGFFI-RHLIGSALGIFLQYLVYQ-DGLIFLLFQ  76

Query  284  MLLGYASMLLYRPYCGIITFFLAFGYLIGCHVYYMSGD--AWKEGGIDSTGALMVITLKI  457
             +  Y  +L+++    +I F  +  YL   H+Y    D   WK   +D T  LM+   K 
Sbjct  77   TVFVYIIILIFQRKSALIVFSSSLFYLSLHHLYRQYNDYGGWK---MDITTILMMTMCKY  133

Query  458  ISCVMNYQDGLLK-ENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAGPVYEMKAYLEW  634
             S    YQDG  K ++ L E QK  ++ KLP+ FEY  Y    GS   GP ++   Y   
Sbjct  134  TSFAWCYQDGDQKLQDQLSEDQKLRKIEKLPNFFEYFSYIHFFGSAICGPTFDFHEY---  190

Query  635  TERKGIWKPAGKERPSPSPFVPTLRALLQA-AFCMGLYLYLVPYFPL  772
                 I+      +    P   +L  LLQ  AF   + ++L+P FPL
Sbjct  191  ----KIYMRTSSTKSISFPLKNSLNWLLQGLAFTFTI-IFLLPKFPL  232



>ref|XP_010377990.1| PREDICTED: lysophospholipid acyltransferase 2 [Rhinopithecus 
roxellana]
Length=520

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 113/255 (44%), Gaps = 24/255 (9%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTE-RKGIWKPAGK--------ERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E R      +G+        ER  PSP    ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHMTQSGENGKEETQYERTEPSPNTAVIQKLLICGLSLLFH  247

Query  746  LYLVPYFPLARFNDS  790
            L +    P+    D 
Sbjct  248  LTVCTTLPVEHNIDE  262



>ref|XP_007969727.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Chlorocebus 
sabaeus]
Length=520

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 66/249 (27%), Positives = 112/249 (45%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTE-RKGIWKPAGK--------ERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E R      +G+        ER  PSP    ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHMTQSGENGKEETQYERTEPSPNTAVIQKLLICGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTICTTLPV  256



>ref|XP_001032451.1| MBOAT family protein [Tetrahymena thermophila]
 gb|EAR84788.1| membrane-bound O-acyltransferase family MBOAT protein [Tetrahymena 
thermophila SB210]
Length=484

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 104/241 (43%), Gaps = 20/241 (8%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSGRHLYAALTGALLSYLSF  250
            D+  E  +  + +    +R +   +  IP   +  F+ G S  RH  + + G  L YL +
Sbjct  7    DLVFEQFSKVLNIPADQIRLVSALIMAIPFGIVFSFLRG-SFIRHFLSIVLGLFLQYLVY  65

Query  251  GFSSNLHFLVPMLLGYASML--LYRPYCGIITFFLAFGYLIGCHVY--YMSGDAWKEGGI  418
                 + F++   L    ML    R    I+ F  +  Y+   H+Y  + S  +W    +
Sbjct  66   --KDQIVFVLLQTLAVYLMLKIFNRKSVAIVVFVQSLIYMSAHHIYRQWASYGSW---DM  120

Query  419  DSTGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFA  598
            D T  LM+   K       YQDG   E+ L   QK  +L KLPS  EY  Y    GS   
Sbjct  121  DITTILMMTICKWTGFAWCYQDGGKDESKLSVDQKMRQLKKLPSFLEYFSYIHFFGSAIC  180

Query  599  GPVYEMKAYLEWTERKGIWKPAGKERPSPSPFV--PTLRALLQAAFCMGLYLYLVPYFPL  772
            GP ++   +  +  +        KE  S  PF    +L  LL+AA   G+Y+ L+P FPL
Sbjct  181  GPNFDYYEFNLFIHK--------KEHYSKIPFTLFNSLEWLLKAAAFSGIYICLLPRFPL  232

Query  773  A  775
            +
Sbjct  233  S  233



>gb|EAW55418.1| hCG37003, isoform CRA_a [Homo sapiens]
Length=407

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 67/234 (29%), Positives = 106/234 (45%), Gaps = 26/234 (11%)
 Frame = +2

Query  50   LS*QQERDMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAA  217
            LS +      L P++  +G+ +  + F++C +  +  +   R    PG +S   RH  A 
Sbjct  10   LSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVAT  69

Query  218  LTGALLSYLSFGFSSNLHFLVPMLLGYASML------LYRPYCGIITFFLAFGYLIGCHV  379
            + G       FG+ S +H  V +L+ YA M+      ++R      +FF+A GYL  CH+
Sbjct  70   IFGIYFVIFCFGWYS-VHLFVLVLMCYAIMVTASVSNIHR-----YSFFVAMGYLTICHI  123

Query  380  YYMSGDAWKEGGIDSTGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKL-PSLF  556
              +    +     D +G LM++T KI +      DGL +  +   A++    +K+ PS  
Sbjct  124  SRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHRLAIKVKPSFL  183

Query  557  EYIGYCLCCGSHFAGPVYEMKAYLEWTERKGI--------WKPAG-KERPSPSP  691
            EY+ Y L   S  AGP    K Y+ + E K I        WK  G    P PSP
Sbjct  184  EYLSYLLNFMSVIAGPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSP  237



>ref|XP_003071140.1| MBOAT family protein [Coccidioides posadasii C735 delta SOWgp]
 gb|EER28995.1| MBOAT family protein [Coccidioides posadasii C735 delta SOWgp]
Length=557

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 62/252 (25%), Positives = 106/252 (42%), Gaps = 21/252 (8%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSS-GRHLYAALTGALLSYLS  247
            D    P++   G S+  L+ +  F+ + P++ + + +P      ++ +  L         
Sbjct  6    DTPFIPLSELTGASIDELKLVTSFLLSYPLAAILKRLPDSQPWQKNAFIVLVSIFYLVGL  65

Query  248  FGFSSNLHFLVPMLLGYASMLLY-----RPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            F     L  L+   +G  ++  Y      P+ G   F    GY+   H+Y       +  
Sbjct  66   FDLWDGLRTLLYNAVGAYAIAYYIDGSLMPWIG---FLFLMGYMSISHIYRQI--VAEPS  120

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             +D TGA MV+ +K+ +   N  DG L EN L E QK   + ++PS+ ++ GY L   S 
Sbjct  121  AVDITGAQMVLVMKLSAFCWNVHDGRLPENMLSEGQKHAAIRRMPSVLDFAGYVLFFPSL  180

Query  593  FAGPVYEMKAYLEWTERKGIWKPAG----------KERPSPSPFVPTLRALLQAAFCMGL  742
            FAGP ++   Y  W E      P G          K+R  P    P +  +LQ    + L
Sbjct  181  FAGPAFDYVEYKRWIETTMFDHPPGVDPSKVPPTRKKRKIPRSGRPAMWKMLQGLLWILL  240

Query  743  YLYLVPYFPLAR  778
            ++   P +  +R
Sbjct  241  FIQFGPSYGKSR  252



>gb|EAS37304.3| MBOAT family protein [Coccidioides immitis RS]
Length=557

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 62/252 (25%), Positives = 106/252 (42%), Gaps = 21/252 (8%)
 Frame = +2

Query  71   DMELEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSS-GRHLYAALTGALLSYLS  247
            D    P++   G S+  L+ +  F+ + P++ + + +P      ++ +  L         
Sbjct  6    DTPFIPLSELTGASIDELKLVTSFLLSYPLAAILKRLPDSQPWQKNAFIVLVSIFYLVGL  65

Query  248  FGFSSNLHFLVPMLLGYASMLLY-----RPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            F     L  L+   +G  ++  Y      P+ G   F    GY+   H+Y       +  
Sbjct  66   FDLWDGLRTLLYNAVGAYAIAYYIDGSLMPWIG---FLFLMGYMSISHIYRQI--VAEPS  120

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             +D TGA MV+ +K+ +   N  DG L EN L E QK   + ++PS+ ++ GY L   S 
Sbjct  121  AVDITGAQMVLVMKLSAFCWNVHDGRLPENMLSEGQKHAAIRRMPSVLDFAGYVLFFPSL  180

Query  593  FAGPVYEMKAYLEWTERKGIWKPAG----------KERPSPSPFVPTLRALLQAAFCMGL  742
            FAGP ++   Y  W E      P G          K+R  P    P +  +LQ    + L
Sbjct  181  FAGPAFDYVEYKRWIETTMFDHPPGVDPSKIPPTRKKRKIPRSGRPAMWKMLQGLLWILL  240

Query  743  YLYLVPYFPLAR  778
            ++   P +  +R
Sbjct  241  FIQFGPSYGKSR  252



>ref|XP_002197683.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Taeniopygia guttata]
Length=518

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 114/250 (46%), Gaps = 24/250 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLS  247
            L+P+++A+ + V  + F++C +  +  +   R     S      RH+ A L G  L+   
Sbjct  11   LQPLSNAVRLPVDQVNFVVCQLFALLAAIWFRTYLHSSKTSPFIRHVVATLLGLYLALFC  70

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ + LHF+V   + Y  M++        YC    F  A GYL  C +  +    + + 
Sbjct  71   FGWYA-LHFVVQSGISYYIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQY  125

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLKEN-DLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D +G +M+IT KI S      DG+ ++N DL  +Q+   + ++PSL EY+ Y      
Sbjct  126  SADFSGPMMIITQKITSLAFEIHDGMFRKNEDLTPSQRCLAVRRMPSLLEYLSYNCNFMG  185

Query  590  HFAGPVYEMKAYLEWTERKGIW----KPAGK-----ERPSPSPFVPTLRALLQAAFCMGL  742
              AGP+   K Y+ + E +       +  GK     E+  PSP +   + LL     +  
Sbjct  186  ILAGPLCSYKDYITFIEGRSYQLQQSEANGKEDTKYEQTDPSPNIAVAQKLLICGLSLLF  245

Query  743  YLYLVPYFPL  772
            ++ +    P+
Sbjct  246  HMTITKTLPV  255



>ref|XP_008848363.1| PREDICTED: lysophospholipid acyltransferase 2 [Nannospalax galili]
Length=520

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 110/249 (44%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C ++ +  +   R     S      RH+ A L G  L++  F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLSALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLAFFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C +  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVESMHKYC----FVFALGYLTVCQITRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYVSYTCNFMGI  187

Query  593  FAGPVYEMKAYLEWTE---------RKGIWKPAGKERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E          +   +    ER  PSP       LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRPSHMTQSSENGKEEIQHERTDPSPNAAVAEKLLVCGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTISNLLPV  256



>dbj|BAC85105.1| unnamed protein product [Homo sapiens]
Length=520

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/249 (26%), Positives = 110/249 (44%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTERKGIW---------KPAGKERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E +            +    ER  PSP    ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTICTTLPV  256



>ref|XP_004644660.1| PREDICTED: lysophospholipid acyltransferase 2 [Octodon degus]
Length=520

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 95/197 (48%), Gaps = 15/197 (8%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLS  247
            L+P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L++  
Sbjct  12   LQPLSNAVQLPIDQVNFVVCQLFALLAAVWFRTYLHSSKTSSFIRHVVATLLGLYLAFFC  71

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ + LHFLV   + Y  M++        YC    F  A GYL  C V  +    + + 
Sbjct  72   FGWYA-LHFLVQSGVSYCIMIIIGVESMHKYC----FVFALGYLTVCQVTRVYIFDYGQY  126

Query  413  GIDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D +G +M+IT KI S      DGL  K+ DL  +Q+   + ++PSL EY+ Y      
Sbjct  127  SADFSGPMMIITQKITSLAYEIHDGLFRKDEDLTPSQRGLAVRRMPSLLEYVSYTCNFMG  186

Query  590  HFAGPVYEMKAYLEWTE  640
              AGP+   K Y+ + E
Sbjct  187  ILAGPLCSYKDYISFIE  203



>ref|NP_620154.2| lysophospholipid acyltransferase 2 [Homo sapiens]
 sp|Q6ZWT7.2|MBOA2_HUMAN RecName: Full=Lysophospholipid acyltransferase 2; Short=LPLAT 
2; AltName: Full=1-acylglycerophosphate O-acyltransferase; 
AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; 
AltName: Full=Lysophosphatidic acid acyltransferase; Short=LPAAT; 
Short=Lyso-PA acyltransferase; AltName: Full=Lysophosphatidylethanolamine 
acyltransferase; Short=LPEAT; Short=Lyso-PE 
acyltransferase; AltName: Full=Membrane-bound O-acyltransferase 
domain-containing protein 2; Short=O-acyltransferase 
domain-containing protein 2 [Homo sapiens]
 dbj|BAF93900.1| lysophospholipid acyltransferase [Homo sapiens]
 gb|AAI57828.1| Membrane bound O-acyltransferase domain containing 2 [Homo sapiens]
 gb|AAI46872.1| Membrane bound O-acyltransferase domain containing 2 [Homo sapiens]
Length=520

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/249 (26%), Positives = 110/249 (44%), Gaps = 24/249 (10%)
 Frame = +2

Query  83   EPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLSF  250
            +P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  251  GFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEGG  415
            G+ + LHFLV   + Y  M++        YC    F  A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  416  IDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGSH  592
             D +G +M+IT KI S      DG+  K+ +L  +Q+   + ++PSL EY+ Y       
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSYNCNFMGI  187

Query  593  FAGPVYEMKAYLEWTERKGIW---------KPAGKERPSPSPFVPTLRALLQAAFCMGLY  745
             AGP+   K Y+ + E +            +    ER  PSP    ++ LL     +  +
Sbjct  188  LAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVCGLSLLFH  247

Query  746  LYLVPYFPL  772
            L +    P+
Sbjct  248  LTICTTLPV  256



>ref|XP_003263601.1| PREDICTED: lysophospholipid acyltransferase 1 [Nomascus leucogenys]
Length=495

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 100/219 (46%), Gaps = 16/219 (7%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L P++  +G+ +  + F++C +  +  +   R    PG +S   RH  A + G       
Sbjct  20   LHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFC  79

Query  248  FGFSSNLHFLVPMLLGYASMLLYR-PYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDS  424
            FG+ S +H  V +L+ YA M+          +FF+A GYL  CH+  +    +     D 
Sbjct  80   FGWYS-VHLFVLVLMCYAIMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDF  138

Query  425  TGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKL-PSLFEYIGYCLCCGSHFAG  601
            +G LM++T KI +      DGL +  +   A++    +K+ PS  EY+ Y L   S  AG
Sbjct  139  SGPLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFMSVIAG  198

Query  602  PVYEMKAYLEWTERKGI--------WKPAG-KERPSPSP  691
            P    K Y+ + E K I        WK  G    P PSP
Sbjct  199  PCNNFKDYVAFIEGKHIHMKLLEVNWKQKGFHSLPEPSP  237



>ref|XP_007197214.1| PREDICTED: lysophospholipid acyltransferase 1 isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=472

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 98/219 (45%), Gaps = 16/219 (7%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHR--FVPGGSSG--RHLYAALTGALLSYLS  247
            L P++  +G+ +  + F+ C +  +  +   R    PG +S   RH++A + G       
Sbjct  19   LHPLSELLGIPLDQVNFVTCQLFALFAAFWFRSYLSPGKTSPDVRHVFATIFGIYFVIFC  78

Query  248  FGFSSNLHFLVPMLLGYASMLLYR-PYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDS  424
            FG+ S +H  V +L+ Y  M+          +FF+A GYL  CH+  +    +     D 
Sbjct  79   FGWYS-VHLFVLVLMCYGIMVTASASNVHRYSFFVAMGYLTICHISRIYIFHYGILTTDF  137

Query  425  TGALMVITLKIISCVMNYQDGL-LKENDLREAQKQNRLLKLPSLFEYIGYCLCCGSHFAG  601
            +G LM++T KI +      DGL  K  DL   Q +  +   PS  EY+ Y L   S  AG
Sbjct  138  SGPLMIVTQKITTLAFQVHDGLGRKAEDLSTEQHRLAVKAKPSFLEYVSYLLNFMSVIAG  197

Query  602  PVYEMKAYLEWTERKGI--------WKPAG-KERPSPSP  691
            P    K Y+ + E + I        WK  G    P PSP
Sbjct  198  PCNNFKEYIAFIEGRHIHMKLLEVNWKEEGFHSLPEPSP  236



>ref|NP_001073949.1| lysophospholipid acyltransferase 1 [Homo sapiens]
 sp|Q6ZNC8.1|MBOA1_HUMAN RecName: Full=Lysophospholipid acyltransferase 1; Short=LPLAT 
1; AltName: Full=1-acylglycerophosphoserine O-acyltransferase; 
AltName: Full=Lysophosphatidylserine acyltransferase; Short=LPSAT; 
Short=Lyso-PS acyltransferase; AltName: Full=Membrane-bound 
O-acyltransferase domain-containing protein 1; Short=O-acyltransferase 
domain-containing protein 1 [Homo sapiens]
 dbj|BAD18447.1| unnamed protein product [Homo sapiens]
 dbj|BAF93899.1| lysophospholipid acyltransferase [Homo sapiens]
 gb|AAI56594.1| Membrane bound O-acyltransferase domain containing 1 [synthetic 
construct]
 gb|AAI50653.1| Membrane bound O-acyltransferase domain containing 1 [Homo sapiens]
 gb|AAI50651.1| Membrane bound O-acyltransferase domain containing 1 [Homo sapiens]
Length=495

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 100/219 (46%), Gaps = 16/219 (7%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFV--PGGSSG--RHLYAALTGALLSYLS  247
            L P++  +G+ +  + F++C +  +  +   R    PG +S   RH  A + G       
Sbjct  20   LHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATIFGIYFVIFC  79

Query  248  FGFSSNLHFLVPMLLGYASMLLYR-PYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDS  424
            FG+ S +H  V +L+ YA M+          +FF+A GYL  CH+  +    +     D 
Sbjct  80   FGWYS-VHLFVLVLMCYAIMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDF  138

Query  425  TGALMVITLKIISCVMNYQDGLLKENDLREAQKQNRLLKL-PSLFEYIGYCLCCGSHFAG  601
            +G LM++T KI +      DGL +  +   A++    +K+ PS  EY+ Y L   S  AG
Sbjct  139  SGPLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFMSVIAG  198

Query  602  PVYEMKAYLEWTERKGI--------WKPAG-KERPSPSP  691
            P    K Y+ + E K I        WK  G    P PSP
Sbjct  199  PCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSP  237



>ref|XP_008178122.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Chrysemys 
picta bellii]
Length=518

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 114/250 (46%), Gaps = 24/250 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLS  247
            L+P+++A+ + +  + F++C +  +  +   R     S      RH+ A L G  L+   
Sbjct  11   LQPLSNAVRLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFC  70

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ + LHF+V   + Y  M++        YC    F  A GYL  C +  +    + + 
Sbjct  71   FGWYA-LHFVVQSGISYYIMIIIGVENMHKYC----FVFALGYLTMCQITRVYIFDYGQY  125

Query  413  GIDSTGALMVITLKIISCVMNYQDGLL-KENDLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D +G +M+IT KI S      DG+  KE +L  +Q+   + ++PSL EY+ Y      
Sbjct  126  SADFSGPMMIITQKITSLAYEIHDGMFRKEEELTPSQRCLAVRRMPSLLEYLSYNCNFMG  185

Query  590  HFAGPVYEMKAYLEWTERKGIW----KPAGK-----ERPSPSPFVPTLRALLQAAFCMGL  742
              AGP+   K Y+ + E +       +  GK     E+  PSP +   + LL   F +  
Sbjct  186  ILAGPLCSYKDYITFIEGRSYQLTQSEANGKEDVKYEQTDPSPNIAVTQKLLICGFSLLF  245

Query  743  YLYLVPYFPL  772
            ++ +    P+
Sbjct  246  HMTVTKTLPV  255



>ref|XP_005521935.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Pseudopodoces humilis]
Length=518

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/250 (26%), Positives = 114/250 (46%), Gaps = 24/250 (10%)
 Frame = +2

Query  80   LEPMASAIGVSVPVLRFLLCFVATIPVSCLHRFVPGGSSG----RHLYAALTGALLSYLS  247
            L+P+++A+ + V  + F++C +  +  +   R     S      RH+ A L G  L+   
Sbjct  11   LQPLSNAVRLPVDQVNFVVCQLFALLAAIWFRTYLHSSKTSPFIRHVVATLLGLYLALFC  70

Query  248  FGFSSNLHFLVPMLLGYASMLL-----YRPYCGIITFFLAFGYLIGCHVYYMSGDAWKEG  412
            FG+ + LHF++   + Y  M++        YC    F  A GYL  C +  +    + + 
Sbjct  71   FGWYA-LHFVIQSGISYYIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQY  125

Query  413  GIDSTGALMVITLKIISCVMNYQDGLLKEN-DLREAQKQNRLLKLPSLFEYIGYCLCCGS  589
              D +G +M+IT KI S      DG+ ++N DL  +Q+   + ++PSL EY+ Y      
Sbjct  126  SADFSGPMMIITQKITSLAFEIHDGMFRKNEDLTPSQRCLAVRRMPSLLEYLSYNCNFMG  185

Query  590  HFAGPVYEMKAYLEWTERKGIW----KPAGK-----ERPSPSPFVPTLRALLQAAFCMGL  742
              AGP+   K Y+ + E +       +  GK     E+  PSP +   + LL     +  
Sbjct  186  ILAGPLCSYKDYITFIEGRSYQLQQSEANGKEDTKYEQTDPSPNIAVAQKLLICGLSLLF  245

Query  743  YLYLVPYFPL  772
            ++ +    P+
Sbjct  246  HMTITKTLPV  255



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1628027073272