BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9277

Length=702
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57286.1|  V-type proton ATPase subunit                           395   3e-134   Ipomoea nil [qian niu]
ref|XP_006363973.1|  PREDICTED: V-type proton ATPase subunit C-like     365   2e-122   Solanum tuberosum [potatoes]
ref|XP_009786911.1|  PREDICTED: V-type proton ATPase subunit C          363   5e-122   Nicotiana sylvestris
ref|XP_004235295.1|  PREDICTED: V-type proton ATPase subunit C          363   1e-121   Solanum lycopersicum
ref|XP_009618992.1|  PREDICTED: V-type proton ATPase subunit C          362   3e-121   Nicotiana tomentosiformis
ref|XP_002512862.1|  vacuolar ATP synthase subunit C, putative          351   5e-117   Ricinus communis
emb|CDP15722.1|  unnamed protein product                                350   1e-116   Coffea canephora [robusta coffee]
gb|KDO47366.1|  hypothetical protein CISIN_1g017251mg                   342   4e-115   Citrus sinensis [apfelsine]
ref|XP_011083360.1|  PREDICTED: V-type proton ATPase subunit C-like     345   1e-114   Sesamum indicum [beniseed]
ref|XP_008231040.1|  PREDICTED: V-type proton ATPase subunit C          345   1e-114   Prunus mume [ume]
ref|XP_007215551.1|  hypothetical protein PRUPE_ppa007256mg             345   1e-114   Prunus persica
gb|KDO47363.1|  hypothetical protein CISIN_1g017251mg                   342   2e-114   Citrus sinensis [apfelsine]
gb|KCW64319.1|  hypothetical protein EUGRSUZ_G01949                     338   3e-114   Eucalyptus grandis [rose gum]
ref|XP_010096044.1|  V-type proton ATPase subunit C                     343   1e-113   
gb|EYU24479.1|  hypothetical protein MIMGU_mgv1a006812mg                344   2e-113   Erythranthe guttata [common monkey flower]
gb|KEH23490.1|  vacuolar H+-ATPase subunit C                            342   2e-113   Medicago truncatula
ref|XP_003624472.1|  V-type proton ATPase subunit C                     342   2e-113   Medicago truncatula
ref|XP_012067332.1|  PREDICTED: V-type proton ATPase subunit C          342   3e-113   Jatropha curcas
gb|ABD32569.1|  V-ATPase subunit C                                      342   3e-113   Medicago truncatula
ref|XP_003518129.1|  PREDICTED: V-type proton ATPase subunit C-like     341   3e-113   Glycine max [soybeans]
ref|XP_007031994.1|  Vacuolar ATP synthase subunit C (VATC) / V-A...    341   5e-113   Theobroma cacao [chocolate]
ref|XP_006446960.1|  hypothetical protein CICLE_v10015638mg             340   7e-113   Citrus clementina [clementine]
ref|XP_011073132.1|  PREDICTED: V-type proton ATPase subunit C-like     340   7e-113   Sesamum indicum [beniseed]
ref|XP_003553974.1|  PREDICTED: V-type proton ATPase subunit C-like     340   9e-113   Glycine max [soybeans]
gb|KHN28568.1|  V-type proton ATPase subunit C                          339   3e-112   Glycine soja [wild soybean]
ref|XP_010663792.1|  PREDICTED: V-type proton ATPase subunit C is...    337   3e-112   
gb|ABH07428.1|  vacuolar H+-ATPase subunit C                            339   3e-112   Gossypium hirsutum [American cotton]
ref|XP_008341246.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    336   4e-112   
ref|XP_009378027.1|  PREDICTED: V-type proton ATPase subunit C          338   5e-112   Pyrus x bretschneideri [bai li]
ref|XP_010068642.1|  PREDICTED: V-type proton ATPase subunit C-like     337   5e-112   
ref|XP_007161646.1|  hypothetical protein PHAVU_001G086700g             338   5e-112   Phaseolus vulgaris [French bean]
gb|KJB40647.1|  hypothetical protein B456_007G072500                    336   5e-112   Gossypium raimondii
ref|XP_011468207.1|  PREDICTED: V-type proton ATPase subunit C          338   6e-112   Fragaria vesca subsp. vesca
gb|KCW64313.1|  hypothetical protein EUGRSUZ_G019431                    332   7e-112   Eucalyptus grandis [rose gum]
gb|KJB40646.1|  hypothetical protein B456_007G072500                    336   8e-112   Gossypium raimondii
emb|CDY19421.1|  BnaC05g09300D                                          337   1e-111   Brassica napus [oilseed rape]
ref|XP_006599411.1|  PREDICTED: V-type proton ATPase subunit C-like     337   2e-111   Glycine max [soybeans]
gb|KJB40645.1|  hypothetical protein B456_007G072500                    337   2e-111   Gossypium raimondii
gb|KJB40648.1|  hypothetical protein B456_007G072500                    337   2e-111   Gossypium raimondii
ref|XP_002284444.1|  PREDICTED: V-type proton ATPase subunit C is...    335   6e-111   Vitis vinifera
ref|XP_006373109.1|  hypothetical protein POPTR_0017s08810g             335   7e-111   
gb|KJB76317.1|  hypothetical protein B456_012G082900                    333   7e-111   Gossypium raimondii
ref|XP_008775428.1|  PREDICTED: V-type proton ATPase subunit C-li...    334   8e-111   
ref|XP_011001967.1|  PREDICTED: V-type proton ATPase subunit C          335   9e-111   Populus euphratica
ref|XP_007151733.1|  hypothetical protein PHAVU_004G070900g             335   1e-110   Phaseolus vulgaris [French bean]
gb|KJB76320.1|  hypothetical protein B456_012G082900                    334   1e-110   Gossypium raimondii
ref|XP_006373110.1|  hypothetical protein POPTR_0017s08810g             335   1e-110   Populus trichocarpa [western balsam poplar]
gb|KJB76319.1|  hypothetical protein B456_012G082900                    333   1e-110   Gossypium raimondii
ref|XP_003548919.2|  PREDICTED: V-type proton ATPase subunit C-like     335   1e-110   Glycine max [soybeans]
ref|XP_008775427.1|  PREDICTED: V-type proton ATPase subunit C-li...    334   2e-110   Phoenix dactylifera
ref|XP_010528136.1|  PREDICTED: V-type proton ATPase subunit C-like     334   3e-110   Tarenaya hassleriana [spider flower]
gb|EPS62747.1|  hypothetical protein M569_12043                         332   3e-110   Genlisea aurea
ref|XP_010249179.1|  PREDICTED: V-type proton ATPase subunit C-like     333   3e-110   Nelumbo nucifera [Indian lotus]
gb|KJB76315.1|  hypothetical protein B456_012G082900                    333   4e-110   Gossypium raimondii
ref|XP_004150739.1|  PREDICTED: V-type proton ATPase subunit C          333   4e-110   Cucumis sativus [cucumbers]
ref|XP_010693540.1|  PREDICTED: V-type proton ATPase subunit C          333   5e-110   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW64312.1|  hypothetical protein EUGRSUZ_G019431                    332   7e-110   Eucalyptus grandis [rose gum]
ref|XP_004493016.1|  PREDICTED: V-type proton ATPase subunit C-like     333   7e-110   Cicer arietinum [garbanzo]
ref|XP_008808181.1|  PREDICTED: V-type proton ATPase subunit C-like     332   1e-109   Phoenix dactylifera
ref|XP_008463120.1|  PREDICTED: V-type proton ATPase subunit C          332   1e-109   Cucumis melo [Oriental melon]
ref|XP_002275510.1|  PREDICTED: V-type proton ATPase subunit C          332   1e-109   Vitis vinifera
ref|NP_563916.1|  V-type proton ATPase subunit C                        331   3e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008379060.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    331   3e-109   
ref|XP_009148561.1|  PREDICTED: V-type proton ATPase subunit C          331   3e-109   Brassica rapa
ref|XP_010066422.1|  PREDICTED: V-type proton ATPase subunit C          331   4e-109   Eucalyptus grandis [rose gum]
ref|XP_002889973.1|  de-etiolated 3                                     331   4e-109   
emb|CDY66539.1|  BnaCnng51300D                                          330   6e-109   Brassica napus [oilseed rape]
emb|CDY21070.1|  BnaA08g24550D                                          330   7e-109   Brassica napus [oilseed rape]
ref|XP_006417188.1|  hypothetical protein EUTSA_v10007948mg             330   7e-109   Eutrema salsugineum [saltwater cress]
gb|KHM99227.1|  V-type proton ATPase subunit C                          330   1e-108   Glycine soja [wild soybean]
gb|AIY85415.1|  V-ATPase subunit C1                                     330   1e-108   Eriobotrya japonica [loquat]
ref|XP_010939292.1|  PREDICTED: V-type proton ATPase subunit C-li...    328   2e-108   Elaeis guineensis
gb|KFK43549.1|  hypothetical protein AALP_AA1G141200                    329   2e-108   Arabis alpina [alpine rockcress]
ref|XP_006369829.1|  Vacuolar ATP synthase subunit C family protein     328   6e-108   
ref|XP_010939209.1|  PREDICTED: V-type proton ATPase subunit C-li...    328   6e-108   Elaeis guineensis
ref|XP_009110617.1|  PREDICTED: V-type proton ATPase subunit C-like     327   1e-107   Brassica rapa
ref|XP_010925033.1|  PREDICTED: V-type proton ATPase subunit C-like     326   3e-107   Elaeis guineensis
ref|XP_010556324.1|  PREDICTED: V-type proton ATPase subunit C          326   4e-107   Tarenaya hassleriana [spider flower]
ref|XP_002441624.1|  hypothetical protein SORBIDRAFT_09g030620          326   4e-107   Sorghum bicolor [broomcorn]
ref|XP_009118052.1|  PREDICTED: V-type proton ATPase subunit C-like     325   7e-107   Brassica rapa
ref|XP_011045799.1|  PREDICTED: V-type proton ATPase subunit C-li...    325   9e-107   Populus euphratica
ref|NP_001147632.1|  LOC100281241                                       325   9e-107   Zea mays [maize]
ref|XP_011045798.1|  PREDICTED: V-type proton ATPase subunit C-li...    325   1e-106   Populus euphratica
ref|NP_001056500.1|  Os05g0593100                                       325   1e-106   
gb|AAO72561.1|  putative vacuolar ATP synthase subunit C                325   1e-106   
tpg|DAA59221.1|  TPA: hypothetical protein ZEAMMB73_061434              318   2e-106   
ref|XP_006655657.1|  PREDICTED: V-type proton ATPase subunit C-like     323   4e-106   Oryza brachyantha
emb|CDY16036.1|  BnaC08g40870D                                          326   5e-106   Brassica napus [oilseed rape]
ref|XP_010458722.1|  PREDICTED: V-type proton ATPase subunit C-like     322   8e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010494723.1|  PREDICTED: V-type proton ATPase subunit C          322   8e-106   Camelina sativa [gold-of-pleasure]
ref|XP_006305100.1|  hypothetical protein CARUB_v10009467mg             322   9e-106   
emb|CDX71966.1|  BnaC08g29080D                                          322   2e-105   
ref|XP_010554131.1|  PREDICTED: V-type proton ATPase subunit C-li...    321   2e-105   Tarenaya hassleriana [spider flower]
ref|XP_010554130.1|  PREDICTED: V-type proton ATPase subunit C-li...    322   5e-105   Tarenaya hassleriana [spider flower]
ref|XP_004977299.1|  PREDICTED: V-type proton ATPase subunit C-like     320   6e-105   Setaria italica
gb|KGN50885.1|  hypothetical protein Csa_5G312840                       319   1e-104   
ref|XP_002441755.1|  hypothetical protein SORBIDRAFT_08g001880          320   1e-104   Sorghum bicolor [broomcorn]
ref|XP_010476263.1|  PREDICTED: V-type proton ATPase subunit C-like     319   1e-104   Camelina sativa [gold-of-pleasure]
ref|XP_009386009.1|  PREDICTED: V-type proton ATPase subunit C-like     319   2e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006844509.1|  PREDICTED: V-type proton ATPase subunit C          318   5e-104   Amborella trichopoda
emb|CDY26596.1|  BnaA09g46810D                                          325   5e-104   Brassica napus [oilseed rape]
ref|NP_001142247.1|  uncharacterized protein LOC100274416               318   6e-104   Zea mays [maize]
ref|XP_008654564.1|  PREDICTED: hypothetical protein isoform X1         316   3e-103   
ref|XP_009395792.1|  PREDICTED: V-type proton ATPase subunit C-like     315   8e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003567787.1|  PREDICTED: V-type proton ATPase subunit C          314   2e-102   Brachypodium distachyon [annual false brome]
ref|XP_010250562.1|  PREDICTED: V-type proton ATPase subunit C          310   8e-101   Nelumbo nucifera [Indian lotus]
sp|Q9SCB9.1|VATC_HORVU  RecName: Full=V-type proton ATPase subuni...    306   1e-99    Hordeum vulgare [barley]
gb|KJB76316.1|  hypothetical protein B456_012G082900                    306   1e-99    Gossypium raimondii
gb|ABG23314.1|  vacuolar proton-ATPase C subunit                        305   5e-99    Triticum aestivum [Canadian hard winter wheat]
gb|ACT34062.1|  vacuolar ATP synthetase subunit C                       305   6e-99    Aegilops tauschii
gb|ADE77882.1|  unknown                                                 288   2e-92    Picea sitchensis
ref|XP_002980160.1|  hypothetical protein SELMODRAFT_111716             266   8e-84    Selaginella moellendorffii
ref|XP_001773067.1|  predicted protein                                  259   5e-81    
gb|KHG11234.1|  V-type proton ATPase subunit C -like protein            242   4e-75    Gossypium arboreum [tree cotton]
gb|EMS67397.1|  V-type proton ATPase subunit C                          237   1e-72    Triticum urartu
gb|EMT09400.1|  V-type proton ATPase subunit C                          228   8e-69    
gb|AGJ98217.1|  DET3                                                    224   1e-68    Petunia x hybrida [garden petunia]
ref|XP_001756840.1|  predicted protein                                  197   7e-57    
ref|XP_001696429.1|  vacuolar H+ ATPase V1 sector, subunit C            179   3e-50    Chlamydomonas reinhardtii
gb|ABE96876.1|  putative vacuolar ATP synthase subunit C                169   4e-49    Triticum monococcum [einkorn wheat]
gb|ADI46924.1|  ATPvC1m                                                 174   4e-48    Volvox carteri f. nagariensis
ref|XP_005651974.1|  vacuolar H+ ATPase V1 sector, subunit C            171   6e-47    Coccomyxa subellipsoidea C-169
ref|XP_002503957.1|  H+-or Na+-translocating f-type, v-type and A...    169   3e-46    Micromonas commoda
gb|KJB40644.1|  hypothetical protein B456_007G072500                    165   5e-46    Gossypium raimondii
ref|XP_002954527.1|  vacuolar ATP synthase, subunit C                   165   9e-45    Volvox carteri f. nagariensis
dbj|BAE98945.1|  vacuolar ATP sythase subunit C                         160   4e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_005847214.1|  hypothetical protein CHLNCDRAFT_35880              162   7e-44    Chlorella variabilis
gb|KHN24290.1|  V-type proton ATPase subunit C                          152   8e-42    Glycine soja [wild soybean]
gb|AFW81321.1|  hypothetical protein ZEAMMB73_736936                    149   4e-41    
gb|AFW81322.1|  hypothetical protein ZEAMMB73_736936                    150   4e-40    
ref|XP_008362171.1|  PREDICTED: V-type proton ATPase subunit C-like     149   5e-40    
ref|XP_001418773.1|  F-ATPase family transporter: protons (vacuolar)    146   7e-38    Ostreococcus lucimarinus CCE9901
ref|XP_007513767.1|  V-type proton ATPase subunit C 1                   145   6e-37    Bathycoccus prasinos
ref|XP_004340673.1|  Vtype proton ATPase subunit C, putative            144   1e-36    Acanthamoeba castellanii str. Neff
ref|XP_003080507.1|  putative vacuolar ATP synthase subunit C (ISS)     143   2e-36    Ostreococcus tauri
ref|XP_011399399.1|  V-type proton ATPase subunit C                     142   2e-36    Auxenochlorella protothecoides
ref|XP_007886138.1|  PREDICTED: V-type proton ATPase subunit C 1        141   5e-36    Callorhinchus milii [Australian ghost shark]
ref|XP_006028579.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    140   1e-35    Alligator sinensis
dbj|BAE87614.1|  unnamed protein product                                138   1e-35    Macaca fascicularis [crab eating macaque]
ref|XP_006028578.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    140   2e-35    
gb|EPY74837.1|  V-type proton ATPase subunit C 1                        137   3e-35    Camelus ferus
ref|XP_004903962.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    139   4e-35    
ref|XP_002733333.1|  PREDICTED: V-type proton ATPase subunit C 1-...    139   7e-35    Saccoglossus kowalevskii
ref|XP_006760332.1|  PREDICTED: V-type proton ATPase subunit C 1        138   8e-35    Myotis davidii
emb|CAH93171.1|  hypothetical protein                                   138   9e-35    Pongo abelii [orang utan]
ref|XP_005627900.1|  PREDICTED: V-type proton ATPase subunit C 1        138   1e-34    
gb|AIC48333.1|  ATP6V1C1                                                138   1e-34    synthetic construct
ref|NP_001686.1|  V-type proton ATPase subunit C 1                      138   1e-34    Homo sapiens [man]
ref|XP_005231036.1|  PREDICTED: V-type proton ATPase subunit C 1        138   1e-34    
emb|CAH93365.1|  hypothetical protein                                   138   1e-34    Pongo abelii [orang utan]
ref|XP_009918407.1|  PREDICTED: V-type proton ATPase subunit C 1        138   1e-34    Haliaeetus albicilla
ref|XP_010139291.1|  PREDICTED: V-type proton ATPase subunit C 1        138   1e-34    Buceros rhinoceros silvestris
ref|XP_009890115.1|  PREDICTED: V-type proton ATPase subunit C 1        138   1e-34    Charadrius vociferus
emb|CDQ87771.1|  unnamed protein product                                137   1e-34    Oncorhynchus mykiss
ref|XP_004275371.1|  PREDICTED: V-type proton ATPase subunit C 1        138   1e-34    Orcinus orca [Orca]
ref|XP_008934370.1|  PREDICTED: V-type proton ATPase subunit C 1        138   1e-34    Merops nubicus
ref|XP_004663082.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    137   1e-34    Jaculus jaculus
ref|XP_003480143.1|  PREDICTED: V-type proton ATPase subunit C 1        137   1e-34    Cavia porcellus [guinea pig]
ref|XP_011600484.1|  PREDICTED: V-type proton ATPase subunit C 1        137   1e-34    Aquila chrysaetos canadensis
ref|XP_004679736.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    137   1e-34    
ref|XP_005879352.1|  PREDICTED: V-type proton ATPase subunit C 1        137   2e-34    Myotis brandtii
ref|XP_008146706.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    137   2e-34    Eptesicus fuscus
ref|XP_003055517.1|  H+-or Na+-translocating f-type, v-type and A...    137   2e-34    Micromonas pusilla CCMP1545
ref|XP_005499457.1|  PREDICTED: V-type proton ATPase subunit C 1        137   2e-34    Columba livia [carrier pigeon]
ref|XP_008051075.1|  PREDICTED: V-type proton ATPase subunit C 1        137   2e-34    Carlito syrichta
ref|XP_004697744.1|  PREDICTED: V-type proton ATPase subunit C 1        135   2e-34    
ref|XP_007932994.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    137   2e-34    Orycteropus afer afer
gb|AAB51350.1|  C subunit of V-ATPase                                   137   2e-34    Amblyomma americanum
ref|XP_005316338.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    137   2e-34    Ictidomys tridecemlineatus
ref|XP_006145636.1|  PREDICTED: V-type proton ATPase subunit C 1        137   2e-34    Tupaia chinensis
ref|XP_002759363.1|  PREDICTED: V-type proton ATPase subunit C 1        137   2e-34    Callithrix jacchus [common marmoset]
ref|XP_012039419.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    137   2e-34    Ovis aries [domestic sheep]
ref|XP_010954093.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    137   2e-34    Camelus bactrianus [camel]
ref|XP_006212223.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    137   2e-34    Vicugna pacos
ref|XP_004607741.1|  PREDICTED: V-type proton ATPase subunit C 1        137   2e-34    Sorex araneus [Eurasian shrew]
ref|XP_006192890.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    137   2e-34    Camelus ferus
ref|XP_010980173.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    137   2e-34    
ref|XP_004402384.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    137   2e-34    Odobenus rosmarus divergens
ref|XP_004768925.1|  PREDICTED: V-type proton ATPase subunit C 1        137   2e-34    Mustela putorius furo [black ferret]
ref|XP_003408473.1|  PREDICTED: V-type proton ATPase subunit C 1        137   2e-34    Loxodonta africana [African bush elephant]
ref|XP_002922648.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    137   2e-34    Ailuropoda melanoleuca
ref|XP_002710769.1|  PREDICTED: V-type proton ATPase subunit C 1        137   2e-34    Oryctolagus cuniculus [domestic rabbit]
gb|EKC32287.1|  V-type proton ATPase subunit C 1                        137   3e-34    
ref|XP_007075876.1|  PREDICTED: V-type proton ATPase subunit C 1        137   3e-34    Panthera tigris altaica
ref|XP_008574309.1|  PREDICTED: V-type proton ATPase subunit C 1        137   3e-34    Galeopterus variegatus [Malayan flying lemur]
ref|XP_009510884.1|  PREDICTED: V-type proton ATPase subunit C 1        137   3e-34    Phalacrocorax carbo [common cormorant]
ref|NP_001177134.1|  ATPase, H+ transporting, lysosomal 42kDa, V1...    137   3e-34    Sus scrofa [pigs]
ref|XP_009864623.1|  PREDICTED: V-type proton ATPase subunit C 1        137   3e-34    Apaloderma vittatum
ref|XP_007518917.1|  PREDICTED: V-type proton ATPase subunit C 1        136   4e-34    Erinaceus europaeus [common hedgehog]
ref|XP_009700298.1|  PREDICTED: V-type proton ATPase subunit C 1        136   4e-34    Cariama cristata
ref|NP_788849.1|  V-type proton ATPase subunit C 1                      136   4e-34    Bos taurus [bovine]
ref|XP_001494151.1|  PREDICTED: V-type proton ATPase subunit C 1        136   4e-34    
ref|XP_004011849.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    136   4e-34    Ovis aries [domestic sheep]
ref|XP_004431292.1|  PREDICTED: V-type proton ATPase subunit C 1        136   4e-34    Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|ELR53809.1|  V-type proton ATPase subunit C 1                        137   5e-34    Bos mutus
ref|XP_006916693.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    136   5e-34    
ref|XP_011414828.1|  PREDICTED: V-type proton ATPase subunit C 1-...    136   5e-34    Crassostrea gigas
ref|XP_003782477.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    136   6e-34    Otolemur garnettii
ref|XP_010898239.1|  PREDICTED: V-type proton ATPase subunit C 1-...    136   6e-34    
ref|XP_003509877.1|  PREDICTED: V-type proton ATPase subunit C 1        136   7e-34    Cricetulus griseus [Chinese hamsters]
ref|XP_007634426.1|  PREDICTED: V-type proton ATPase subunit C 1        135   7e-34    
dbj|BAE40727.1|  unnamed protein product                                135   7e-34    Mus musculus [mouse]
gb|AAC83084.1|  vacuolar adenosine triphosphatase subunit C             135   8e-34    Mus musculus [mouse]
ref|NP_001011992.1|  V-type proton ATPase subunit C 1                   135   9e-34    Rattus norvegicus [brown rat]
ref|NP_079770.2|  V-type proton ATPase subunit C 1                      135   9e-34    Mus musculus [mouse]
ref|XP_010148071.1|  PREDICTED: V-type proton ATPase subunit C 1        135   9e-34    Eurypyga helias
ref|XP_005367598.1|  PREDICTED: V-type proton ATPase subunit C 1        135   9e-34    Microtus ochrogaster [prairie voles]
ref|XP_005382051.1|  PREDICTED: V-type proton ATPase subunit C 1        136   1e-33    
ref|XP_006830685.1|  PREDICTED: V-type proton ATPase subunit C 1        135   1e-33    Chrysochloris asiatica
ref|XP_003760346.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    135   1e-33    Sarcophilus harrisii
ref|XP_006982882.1|  PREDICTED: V-type proton ATPase subunit C 1        135   1e-33    Peromyscus maniculatus bairdii
ref|XP_009556284.1|  PREDICTED: V-type proton ATPase subunit C 1        135   1e-33    Cuculus canorus
ref|XP_003940719.1|  PREDICTED: V-type proton ATPase subunit C 1        135   1e-33    Saimiri boliviensis boliviensis
ref|XP_009275405.1|  PREDICTED: V-type proton ATPase subunit C 1        135   1e-33    Aptenodytes forsteri
ref|XP_005306086.1|  PREDICTED: V-type proton ATPase subunit C 1        135   1e-33    Chrysemys picta bellii
ref|XP_010302959.1|  PREDICTED: V-type proton ATPase subunit C 1        135   2e-33    Balearica regulorum gibbericeps
ref|XP_009321363.1|  PREDICTED: V-type proton ATPase subunit C 1        135   2e-33    Pygoscelis adeliae
gb|ETE73899.1|  V-type proton ATPase subunit C 1                        134   2e-33    Ophiophagus hannah
ref|XP_009029568.1|  hypothetical protein HELRODRAFT_103807             135   2e-33    Helobdella robusta
ref|XP_007463323.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    135   2e-33    Lipotes vexillifer [baiji]
ref|XP_010223600.1|  PREDICTED: V-type proton ATPase subunit C 1        135   2e-33    Tinamus guttatus
ref|XP_009896480.1|  PREDICTED: V-type proton ATPase subunit C 1        134   2e-33    Picoides pubescens
ref|XP_008849773.1|  PREDICTED: V-type proton ATPase subunit C 1        134   2e-33    Nannospalax galili
ref|XP_006796085.1|  PREDICTED: V-type proton ATPase subunit C 1-...    134   2e-33    Neolamprologus brichardi [lyretail cichlid]
ref|XP_006122461.1|  PREDICTED: V-type proton ATPase subunit C 1        134   2e-33    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_001506621.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    134   2e-33    
ref|XP_418370.1|  PREDICTED: V-type proton ATPase subunit C 1 iso...    134   3e-33    Gallus gallus [bantam]
ref|XP_003459431.1|  PREDICTED: V-type proton ATPase subunit C 1-...    134   3e-33    Oreochromis niloticus
ref|XP_007488240.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    134   4e-33    Monodelphis domestica
gb|KDR10550.1|  V-type proton ATPase subunit C                          134   4e-33    Zootermopsis nevadensis
ref|NP_001088261.1|  V-type proton ATPase subunit C 1                   133   5e-33    Xenopus laevis [clawed frog]
ref|XP_010017126.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    133   5e-33    Nestor notabilis
gb|KFQ53504.1|  V-type proton ATPase subunit C 1                        133   5e-33    Nestor notabilis
ref|XP_003219499.1|  PREDICTED: V-type proton ATPase subunit C 1        133   6e-33    Anolis carolinensis [Carolina anole]
ref|XP_001369362.2|  PREDICTED: V-type proton ATPase subunit C 1 ...    134   6e-33    
ref|XP_007056164.1|  PREDICTED: V-type proton ATPase subunit C 1        133   7e-33    Chelonia mydas [green seaturtle]
ref|XP_008430009.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    131   7e-33    Poecilia reticulata
ref|XP_009076362.1|  PREDICTED: V-type proton ATPase subunit C 1        133   7e-33    Acanthisitta chloris
ref|XP_006636047.1|  PREDICTED: V-type proton ATPase subunit C 1-...    133   8e-33    Lepisosteus oculatus
ref|XP_005042435.1|  PREDICTED: V-type proton ATPase subunit C 1        133   8e-33    Ficedula albicollis
ref|XP_007488239.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    134   8e-33    
ref|NP_989172.1|  V-type proton ATPase subunit C 1                      133   9e-33    Xenopus tropicalis [western clawed frog]
ref|XP_010017127.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    132   1e-32    Nestor notabilis
ref|XP_009680642.1|  PREDICTED: V-type proton ATPase subunit C 1        132   1e-32    Struthio camelus australis
ref|XP_010883497.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    132   1e-32    Esox lucius
gb|KFO20049.1|  V-type proton ATPase subunit C 1                        132   1e-32    Fukomys damarensis [Damara mole rat]
ref|XP_010610418.1|  PREDICTED: V-type proton ATPase subunit C 1        132   1e-32    Fukomys damarensis [Damara mole rat]
ref|XP_005803508.1|  PREDICTED: V-type proton ATPase subunit C 1-...    132   1e-32    Xiphophorus maculatus
dbj|BAB24526.1|  unnamed protein product                                132   1e-32    Mus musculus [mouse]
ref|XP_005917491.1|  PREDICTED: V-type proton ATPase subunit C 1-...    132   1e-32    Haplochromis burtoni
ref|XP_010744926.1|  PREDICTED: V-type proton ATPase subunit C 1-...    132   1e-32    
ref|XP_005728447.1|  PREDICTED: V-type proton ATPase subunit C 1-...    132   2e-32    Pundamilia nyererei
ref|XP_008922269.1|  PREDICTED: V-type proton ATPase subunit C 1        132   2e-32    
ref|XP_008430008.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    130   2e-32    Poecilia reticulata
ref|XP_003444114.1|  PREDICTED: V-type proton ATPase subunit C 1-...    132   2e-32    Oreochromis niloticus
sp|Q9U5N1.1|VATC_MANSE  RecName: Full=V-type proton ATPase subuni...    132   2e-32    Manduca sexta [Carolina sphinx]
ref|XP_004074259.1|  PREDICTED: V-type proton ATPase subunit C 1-...    132   2e-32    Oryzias latipes [Japanese rice fish]
ref|XP_003375717.1|  vacuolar proton pump subunit C                     132   3e-32    Trichinella spiralis
ref|XP_005797406.1|  PREDICTED: V-type proton ATPase subunit C 1-...    131   3e-32    Xiphophorus maculatus
ref|XP_007550566.1|  PREDICTED: V-type proton ATPase subunit C 1-...    131   3e-32    Poecilia formosa
ref|XP_005150964.1|  PREDICTED: V-type proton ATPase subunit C 1        131   4e-32    
ref|XP_010004766.1|  PREDICTED: V-type proton ATPase subunit C 1        131   4e-32    Chaetura pelagica
ref|XP_001960901.1|  GF11269                                            131   4e-32    Drosophila ananassae
gb|KFQ17703.1|  V-type proton ATPase subunit C 1                        131   4e-32    Merops nubicus
ref|XP_007550565.1|  PREDICTED: V-type proton ATPase subunit C 1-A      131   4e-32    Poecilia formosa
ref|XP_008290531.1|  PREDICTED: V-type proton ATPase subunit C 1        130   5e-32    Stegastes partitus
ref|XP_005238220.1|  PREDICTED: V-type proton ATPase subunit C 2        130   6e-32    Falco peregrinus [peregrine]
gb|ERL87116.1|  hypothetical protein D910_04516                         130   7e-32    Dendroctonus ponderosae
gb|KFM68542.1|  V-type proton ATPase subunit C                          130   7e-32    Stegodyphus mimosarum
ref|XP_004077677.1|  PREDICTED: V-type proton ATPase subunit C 1        130   7e-32    Oryzias latipes [Japanese rice fish]
ref|XP_008420198.1|  PREDICTED: V-type proton ATPase subunit C 1-A      130   8e-32    Poecilia reticulata
ref|XP_007423656.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    130   8e-32    Python bivittatus
ref|NP_001040138.1|  vacuolar ATPase subunit C                          130   8e-32    Bombyx mori [silk moth]
ref|XP_007427660.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    130   9e-32    Python bivittatus
ref|XP_008321927.1|  PREDICTED: V-type proton ATPase subunit C 1        130   1e-31    Cynoglossus semilaevis [half-smooth tongue sole]
ref|NP_958479.1|  V-type proton ATPase subunit C 1-A                    130   1e-31    Danio rerio [leopard danio]
ref|XP_012137366.1|  PREDICTED: V-type proton ATPase subunit C          130   1e-31    Megachile rotundata
ref|XP_009809784.1|  PREDICTED: V-type proton ATPase subunit C 2        128   1e-31    Gavia stellata
ref|XP_003760347.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    130   1e-31    
gb|AAB62571.1|  V-ATPase C subunit                                      129   1e-31    
ref|NP_477266.1|  vacuolar H[+] ATPase 44kD subunit, isoform A          129   2e-31    
ref|XP_002408654.1|  C subunit of V-ATPase, putative                    129   2e-31    
dbj|BAM20425.1|  vacuolar H[+] ATPase 44kD C subunit                    129   2e-31    
gb|KFP35023.1|  V-type proton ATPase subunit C 1                        129   2e-31    
ref|NP_001005772.2|  V-type proton ATPase subunit C 1-B                 129   2e-31    
ref|XP_008195426.1|  PREDICTED: V-type proton ATPase subunit C is...    129   2e-31    
ref|XP_010280691.1|  PREDICTED: V-type proton ATPase subunit C 2        129   2e-31    
ref|XP_011879957.1|  PREDICTED: V-type proton ATPase subunit C          129   3e-31    
ref|XP_001814187.1|  PREDICTED: V-type proton ATPase subunit C is...    129   3e-31    
ref|XP_008500896.1|  PREDICTED: V-type proton ATPase subunit C 1        129   3e-31    
ref|XP_010751636.1|  PREDICTED: V-type proton ATPase subunit C 1-A      129   3e-31    
gb|KFQ65953.1|  V-type proton ATPase subunit C 2                        129   3e-31    
ref|XP_007547766.1|  PREDICTED: V-type proton ATPase subunit C 1-...    129   3e-31    
ref|XP_010391623.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    127   3e-31    
ref|XP_011067212.1|  PREDICTED: V-type proton ATPase subunit C          129   3e-31    
ref|XP_010391621.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    127   4e-31    
ref|XP_009888075.1|  PREDICTED: V-type proton ATPase subunit C 2        128   4e-31    
ref|XP_002015982.1|  GL11349                                            128   4e-31    
ref|XP_009898136.1|  PREDICTED: V-type proton ATPase subunit C 2        128   5e-31    
ref|XP_008329974.1|  PREDICTED: V-type proton ATPase subunit C 1-...    128   5e-31    
ref|XP_005014174.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    128   5e-31    
ref|XP_003968986.1|  PREDICTED: V-type proton ATPase subunit C 1-A      127   6e-31    
ref|XP_008493333.1|  PREDICTED: V-type proton ATPase subunit C 2        127   6e-31    
ref|XP_011332474.1|  PREDICTED: V-type proton ATPase subunit C is...    127   7e-31    
gb|EOB05348.1|  Vacuolar proton pump subunit C 2                        128   7e-31    
ref|XP_009961798.1|  PREDICTED: V-type proton ATPase subunit C 2        127   8e-31    
ref|XP_009012372.1|  hypothetical protein HELRODRAFT_156435             127   8e-31    
ref|XP_009273855.1|  PREDICTED: V-type proton ATPase subunit C 2        127   8e-31    
ref|XP_011268884.1|  PREDICTED: V-type proton ATPase subunit C          127   9e-31    
ref|XP_010206381.1|  PREDICTED: V-type proton ATPase subunit C 2        127   9e-31    
gb|KFO95890.1|  V-type proton ATPase subunit C 2                        127   9e-31    
ref|XP_008115724.1|  PREDICTED: V-type proton ATPase subunit C 2        127   9e-31    
ref|XP_011144745.1|  PREDICTED: V-type proton ATPase subunit C          127   1e-30    
ref|XP_009946938.1|  PREDICTED: V-type proton ATPase subunit C 2        127   1e-30    
ref|XP_007249407.1|  PREDICTED: V-type proton ATPase subunit C 1-...    127   1e-30    
ref|XP_010114737.1|  PREDICTED: V-type proton ATPase subunit C 2        127   1e-30    
ref|XP_008639998.1|  PREDICTED: V-type proton ATPase subunit C 2        127   1e-30    
ref|XP_315870.4|  AGAP005845-PA                                         127   1e-30    
ref|XP_010304194.1|  PREDICTED: V-type proton ATPase subunit C 2        127   1e-30    
ref|XP_011575234.1|  PREDICTED: V-type proton ATPase subunit C 2        127   1e-30    
ref|XP_006138599.1|  PREDICTED: V-type proton ATPase subunit C 2        127   1e-30    
ref|XP_005044330.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    127   1e-30    
ref|XP_008559568.1|  PREDICTED: V-type proton ATPase subunit C          127   1e-30    
ref|XP_006562159.1|  PREDICTED: V-type proton ATPase subunit C is...    127   1e-30    
ref|XP_005521918.1|  PREDICTED: V-type proton ATPase subunit C 2        127   1e-30    
gb|ADK26726.1|  ATPase, H+ transporting, lysosomal 42kDa, V1 subu...    127   1e-30    
ref|XP_010166958.1|  PREDICTED: V-type proton ATPase subunit C 2        127   2e-30    
ref|XP_005420348.1|  PREDICTED: V-type proton ATPase subunit C 2        126   2e-30    
ref|XP_005487252.1|  PREDICTED: V-type proton ATPase subunit C 2        126   2e-30    
ref|XP_009330763.1|  PREDICTED: V-type proton ATPase subunit C 2        126   2e-30    
ref|XP_009463723.1|  PREDICTED: V-type proton ATPase subunit C 2        126   2e-30    
gb|ACO11255.1|  Vacuolar proton pump subunit C                          126   2e-30    
ref|XP_011305233.1|  PREDICTED: V-type proton ATPase subunit C          126   2e-30    
ref|XP_010222647.1|  PREDICTED: V-type proton ATPase subunit C 2        126   2e-30    
gb|KFB48532.1|  AGAP005845-PA-like protein                              126   2e-30    
ref|XP_005506895.1|  PREDICTED: V-type proton ATPase subunit C 2        126   2e-30    
gb|KFQ83262.1|  V-type proton ATPase subunit C 2                        127   2e-30    
ref|XP_006611433.1|  PREDICTED: V-type proton ATPase subunit C-li...    126   2e-30    
ref|XP_009513285.1|  PREDICTED: V-type proton ATPase subunit C 2        126   2e-30    
ref|XP_008935556.1|  PREDICTED: V-type proton ATPase subunit C 2        126   2e-30    
ref|XP_009940357.1|  PREDICTED: V-type proton ATPase subunit C 2        126   2e-30    
ref|XP_010706218.1|  PREDICTED: V-type proton ATPase subunit C 2        126   2e-30    
ref|XP_010018610.1|  PREDICTED: V-type proton ATPase subunit C 2        126   2e-30    
ref|XP_009666472.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    125   2e-30    
ref|XP_010189303.1|  PREDICTED: V-type proton ATPase subunit C 2        126   2e-30    
ref|XP_001946227.1|  PREDICTED: V-type proton ATPase subunit C          126   3e-30    
ref|XP_011504285.1|  PREDICTED: V-type proton ATPase subunit C is...    126   3e-30    
ref|XP_006626108.1|  PREDICTED: V-type proton ATPase subunit C 1-...    126   3e-30    
ref|XP_003965909.1|  PREDICTED: V-type proton ATPase subunit C 1        126   3e-30    
gb|KFW86282.1|  V-type proton ATPase subunit C 2                        126   3e-30    
gb|EGI57447.1|  V-type proton ATPase subunit C                          126   3e-30    
ref|XP_010073164.1|  PREDICTED: V-type proton ATPase subunit C 2        126   3e-30    
ref|XP_002585525.1|  hypothetical protein BRAFLDRAFT_60009              126   3e-30    
gb|ELT96241.1|  hypothetical protein CAPTEDRAFT_179819                  126   3e-30    
ref|XP_009557935.1|  PREDICTED: V-type proton ATPase subunit C 2        126   3e-30    
ref|XP_005174884.1|  PREDICTED: V-type proton ATPase subunit C          126   3e-30    
ref|XP_008930944.1|  PREDICTED: V-type proton ATPase subunit C 2        125   3e-30    
gb|ERG84842.1|  v-type proton atpase subunit c                          125   3e-30    
ref|XP_009913271.1|  PREDICTED: V-type proton ATPase subunit C 2        125   3e-30    
ref|XP_009981654.1|  PREDICTED: V-type proton ATPase subunit C 2        125   4e-30    
ref|XP_011631232.1|  PREDICTED: V-type proton ATPase subunit C is...    125   4e-30    
ref|XP_011553183.1|  PREDICTED: V-type proton ATPase subunit C is...    125   4e-30    
ref|XP_008211658.1|  PREDICTED: V-type proton ATPase subunit C is...    125   4e-30    
gb|KFV15258.1|  V-type proton ATPase subunit C 2                        125   4e-30    
ref|XP_009093493.1|  PREDICTED: V-type proton ATPase subunit C 2        125   4e-30    
ref|XP_001201267.2|  PREDICTED: V-type proton ATPase subunit C          125   4e-30    
ref|XP_009997448.1|  PREDICTED: V-type proton ATPase subunit C 2        125   5e-30    
ref|XP_419951.1|  PREDICTED: V-type proton ATPase subunit C 2 iso...    125   5e-30    
gb|KFO75224.1|  V-type proton ATPase subunit C 2                        125   5e-30    
ref|XP_005146159.1|  PREDICTED: V-type proton ATPase subunit C 2        125   5e-30    
ref|XP_011181512.1|  PREDICTED: V-type proton ATPase subunit C          125   5e-30    
ref|XP_011205545.1|  PREDICTED: V-type proton ATPase subunit C          125   5e-30    
ref|XP_004533485.1|  PREDICTED: V-type proton ATPase subunit C-li...    125   6e-30    
ref|XP_009666385.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    125   6e-30    
ref|XP_011687853.1|  PREDICTED: V-type proton ATPase subunit C          125   6e-30    
ref|XP_008304955.1|  PREDICTED: V-type proton ATPase subunit C 1-A      125   6e-30    
ref|XP_002196413.1|  PREDICTED: V-type proton ATPase subunit C 2        125   6e-30    
gb|KFU90777.1|  V-type proton ATPase subunit C 2                        125   6e-30    
ref|XP_002107808.1|  hypothetical protein TRIADDRAFT_19844              125   6e-30    
ref|XP_011553182.1|  PREDICTED: V-type proton ATPase subunit C is...    125   6e-30    
ref|XP_003741777.1|  PREDICTED: V-type proton ATPase subunit C 1-...    125   7e-30    
ref|XP_009702306.1|  PREDICTED: V-type proton ATPase subunit C 2        124   8e-30    
ref|XP_009824064.1|  hypothetical protein H257_02220                    125   9e-30    
gb|EFA81774.1|  H+-transporting ATPase                                  124   1e-29    
gb|AAA36803.1|  H+ -ATPase C subunit                                    124   1e-29    
ref|XP_006219905.1|  PREDICTED: V-type proton ATPase subunit C-like     124   1e-29    
ref|XP_008865718.1|  hypothetical protein H310_03575                    124   2e-29    
ref|XP_007895280.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    122   2e-29    
ref|XP_001899274.1|  V-ATPase subunit C family protein                  123   2e-29    
ref|XP_010771260.1|  PREDICTED: V-type proton ATPase subunit C 1        123   2e-29    
gb|KDO34219.1|  hypothetical protein SPRG_01434                         123   3e-29    
emb|CDQ00984.1|  Protein Bm13998, isoform h                             123   4e-29    
ref|XP_009585692.1|  PREDICTED: V-type proton ATPase subunit C 2        123   4e-29    
ref|XP_010890715.1|  PREDICTED: V-type proton ATPase subunit C 1-...    123   4e-29    
ref|XP_009638104.1|  PREDICTED: V-type proton ATPase subunit C 2        123   4e-29    
gb|EFX90034.1|  hypothetical protein DAPPUDRAFT_205240                  122   4e-29    
ref|XP_009482486.1|  PREDICTED: V-type proton ATPase subunit C 1-...    119   4e-29    
ref|XP_010130330.1|  PREDICTED: V-type proton ATPase subunit C 2        122   4e-29    
gb|KFV98778.1|  V-type proton ATPase subunit C 2                        123   4e-29    
ref|XP_009051892.1|  hypothetical protein LOTGIDRAFT_206255             122   4e-29    
ref|NP_001279559.1|  ATPase, H+ transporting, lysosomal 42kDa, V1...    122   5e-29    
ref|XP_005293177.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    122   5e-29    
gb|ABO61291.1|  vacuolar ATPase subunit C                               122   5e-29    
ref|XP_008178102.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    122   7e-29    
ref|XP_006012217.1|  PREDICTED: V-type proton ATPase subunit C 1-...    122   7e-29    
ref|XP_004993351.1|  hypothetical protein PTSG_05481                    122   8e-29    
ref|XP_009068581.1|  PREDICTED: V-type proton ATPase subunit C 2        122   8e-29    
emb|CEF66863.1|  V-type proton ATPase subunit C 2                       122   1e-28    
ref|XP_001503588.2|  PREDICTED: V-type proton ATPase subunit C 2 ...    121   1e-28    
ref|XP_009291607.1|  PREDICTED: V-type proton ATPase subunit C 1-...    121   1e-28    
ref|XP_008611986.1|  hypothetical protein SDRG_07905                    121   1e-28    
gb|AIJ50380.1|  V-ATPase subunit C                                      121   2e-28    
gb|AEZ56896.1|  ATPase H+ transporting lysosomal V1 subunit C           120   2e-28    
ref|XP_001503590.2|  PREDICTED: V-type proton ATPase subunit C 2 ...    121   2e-28    
ref|XP_005600280.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    121   2e-28    
ref|XP_001639878.1|  predicted protein                                  120   3e-28    
gb|EMT31457.1|  V-type proton ATPase subunit C                          118   3e-28    
gb|ETN76972.1|  v-ATPase subunit C                                      119   4e-28    
ref|XP_006191924.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    120   4e-28    
ref|XP_004745856.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    120   4e-28    
ref|XP_007476197.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    119   5e-28    
ref|XP_006191923.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    120   5e-28    
ref|XP_007476196.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    120   6e-28    
ref|XP_006197175.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    120   6e-28    
emb|CEF60497.1|  V-type proton ATPase subunit C 2                       119   6e-28    
ref|XP_004401844.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    119   6e-28    
ref|XP_004745855.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    120   6e-28    
gb|EFB24562.1|  hypothetical protein PANDA_010456                       120   6e-28    
ref|XP_005366579.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    119   6e-28    
ref|XP_004401843.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    119   7e-28    
gb|KHJ99251.1|  v-ATPase subunit C                                      119   8e-28    
ref|XP_007053234.1|  PREDICTED: V-type proton ATPase subunit C 2        119   9e-28    
ref|XP_004356034.1|  H(+)-transporting ATPase                           119   1e-27    
ref|XP_001505940.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    119   1e-27    
ref|XP_008480724.1|  PREDICTED: V-type proton ATPase subunit C          119   1e-27    
ref|XP_005366577.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    119   1e-27    
gb|KJH47284.1|  V-type ATPase, C subunit                                120   1e-27    
ref|XP_532875.2|  PREDICTED: V-type proton ATPase subunit C 2 iso...    119   1e-27    
gb|EDM03150.1|  ATPase, H+ transporting, V1 subunit C, isoform 2,...    116   1e-27    
ref|XP_005044329.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    119   1e-27    
ref|XP_008528126.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    118   1e-27    
ref|XP_001505973.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    119   1e-27    
ref|XP_009170324.1|  hypothetical protein T265_06723                    119   1e-27    
gb|EFN75043.1|  Vacuolar proton pump subunit C                          118   1e-27    
ref|XP_005630177.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    118   1e-27    
gb|KKA74191.1|  vha-11                                                  117   2e-27    
ref|XP_856922.1|  PREDICTED: V-type proton ATPase subunit C 2 iso...    119   2e-27    
ref|XP_008528124.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    118   2e-27    
gb|KIH46288.1|  v-ATPase subunit C                                      117   2e-27    
gb|EPB69204.1|  v-ATPase subunit C                                      118   2e-27    
gb|EGT48628.1|  CBN-VHA-11 protein                                      118   2e-27    
ref|XP_006515262.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    117   2e-27    
ref|XP_007257384.1|  PREDICTED: V-type proton ATPase subunit C 1-...    117   3e-27    
ref|XP_005010664.1|  PREDICTED: V-type proton ATPase subunit C 1        117   3e-27    
ref|XP_005717787.1|  V-type ATP synthase, Subunit V1C                   117   3e-27    
ref|XP_003290514.1|  H(+)-transporting ATPase                           117   3e-27    
ref|NP_598460.1|  V-type proton ATPase subunit C 2 isoform 2            117   3e-27    
gb|EYC06042.1|  hypothetical protein Y032_0078g1163                     117   3e-27    
gb|EOB07902.1|  Vacuolar proton pump subunit C 1                        117   3e-27    
gb|EPY75601.1|  V-type proton ATPase subunit C 2 isoform 1              117   4e-27    
ref|XP_003462750.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    117   4e-27    
ref|XP_003501279.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    117   4e-27    
gb|EDK98490.1|  ATPase, H+ transporting, lysosomal V1 subunit C2,...    117   4e-27    
ref|XP_004373118.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    117   4e-27    
dbj|GAA48137.1|  V-type proton ATPase subunit C 1-A                     118   5e-27    
ref|XP_005327420.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    117   5e-27    
emb|CCA27664.1|  H or Na translocating Ftype putative                   117   5e-27    
ref|XP_008686356.1|  PREDICTED: V-type proton ATPase subunit C 2        118   5e-27    
ref|XP_003139516.1|  V-ATPase subunit C family protein                  117   5e-27    
ref|XP_004373117.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    117   6e-27    
ref|XP_003501278.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    117   6e-27    
ref|XP_005867290.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    117   6e-27    
ref|XP_004642383.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    116   6e-27    
ref|XP_005327419.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    117   7e-27    
ref|XP_006021843.1|  PREDICTED: V-type proton ATPase subunit C 2        116   7e-27    
ref|XP_005867289.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    117   7e-27    
ref|XP_003462751.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    117   7e-27    
ref|XP_006257984.1|  PREDICTED: V-type proton ATPase subunit C 2        116   7e-27    
ref|XP_004436528.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    116   8e-27    
ref|XP_004436527.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    116   8e-27    
emb|CCI43247.1|  unnamed protein product                                116   1e-26    
ref|XP_011900022.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    116   1e-26    
ref|XP_004642382.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    116   1e-26    
ref|XP_005967907.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    115   1e-26    
ref|NP_001014221.1|  V-type proton ATPase subunit C 2                   116   1e-26    
ref|XP_011900018.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    116   1e-26    
ref|XP_004665751.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    115   1e-26    
ref|XP_008248062.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    116   1e-26    
ref|XP_005687059.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    116   1e-26    
ref|XP_005576619.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    115   1e-26    
ref|XP_005967906.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    116   1e-26    
ref|XP_007529903.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    115   1e-26    
ref|XP_005687060.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    116   1e-26    
ref|XP_011975262.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    116   1e-26    
ref|XP_004665750.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    116   1e-26    
ref|XP_005576617.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    115   1e-26    
ref|XP_001095057.1|  PREDICTED: v-type proton ATPase subunit C 2-...    115   2e-26    
gb|EMT10509.1|  hypothetical protein F775_43622                         109   2e-26    
ref|XP_003094835.1|  CRE-VHA-11 protein                                 115   2e-26    
ref|XP_007969683.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    115   2e-26    



>dbj|BAO57286.1| V-type proton ATPase subunit [Ipomoea nil]
Length=376

 Score =   395 bits (1014),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 208/208 (100%), Positives = 208/208 (100%), Gaps = 0/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTLDLLLALSDD
Sbjct  1    MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTLDLLLALSDD  60

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  61   LVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  120

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS
Sbjct  121  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  180

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHLTTLLAVVSKFSQKDWLASYETLTSY
Sbjct  181  EHLTTLLAVVSKFSQKDWLASYETLTSY  208



>ref|XP_006363973.1| PREDICTED: V-type proton ATPase subunit C-like [Solanum tuberosum]
Length=376

 Score =   365 bits (936),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQQ+SS TSLWSRLQ+SIS++SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQQNSSTTSLWSRLQESISRHSFDTPLYRFNIPNLRVGTLDSLLALSDD  60

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVKSN+FIEGVCSK RRQIEELER SGV SSSLTVDGVPVDSYLTRF WDEAKYPTMSPL
Sbjct  61   LVKSNSFIEGVCSKTRRQIEELERVSGVLSSSLTVDGVPVDSYLTRFAWDEAKYPTMSPL  120

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VDG+HSQVAKIEDDLKVRV+EYSNVRSQLNAINRKQTGSLAVRDLSNLVKP D++TS
Sbjct  121  KEIVDGIHSQVAKIEDDLKVRVSEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPADVVTS  180

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHLTTLLAVVSK+SQKDWL+SYETLT+Y
Sbjct  181  EHLTTLLAVVSKYSQKDWLSSYETLTTY  208



>ref|XP_009786911.1| PREDICTED: V-type proton ATPase subunit C [Nicotiana sylvestris]
Length=376

 Score =   363 bits (933),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQQ+SS TSLWSRLQ+SIS++SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQQNSSTTSLWSRLQESISRHSFDTPLYRFNIPNLRVGTLDSLLALSDD  60

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVKSNNFIEGVCSK RRQIEELER SGV SSSLTVDGVPVDSYLTRF WDEAKYPTMSPL
Sbjct  61   LVKSNNFIEGVCSKTRRQIEELERVSGVLSSSLTVDGVPVDSYLTRFAWDEAKYPTMSPL  120

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VDG+H+QVAKIEDDLKVRV+EY+NVRSQLNAINRKQ GSLAVRDLSNLVKPED++TS
Sbjct  121  KEIVDGIHTQVAKIEDDLKVRVSEYNNVRSQLNAINRKQAGSLAVRDLSNLVKPEDIVTS  180

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHLTTLLAVVSK+SQKDWL+SYE LT+Y
Sbjct  181  EHLTTLLAVVSKYSQKDWLSSYENLTTY  208



>ref|XP_004235295.1| PREDICTED: V-type proton ATPase subunit C [Solanum lycopersicum]
Length=376

 Score =   363 bits (931),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQQ+SS TSLWSRLQ+SIS++SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQQNSSTTSLWSRLQESISRHSFDTPLYRFNIPNLRVGTLDSLLALSDD  60

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+FIEGVCSK RRQIEELER SGV SSSLTVDGVPVDSYLTRF WDEAKYPTMSPL
Sbjct  61   LIKSNSFIEGVCSKTRRQIEELERVSGVLSSSLTVDGVPVDSYLTRFAWDEAKYPTMSPL  120

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VDG+HSQVAKIEDDLKVRV+EY+NVRSQLNAINRKQTGSLAVRDLSNLVKP D++TS
Sbjct  121  KEIVDGIHSQVAKIEDDLKVRVSEYNNVRSQLNAINRKQTGSLAVRDLSNLVKPADVVTS  180

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHLTTLLAVVSK+SQKDWL+SYETLT+Y
Sbjct  181  EHLTTLLAVVSKYSQKDWLSSYETLTTY  208



>ref|XP_009618992.1| PREDICTED: V-type proton ATPase subunit C [Nicotiana tomentosiformis]
Length=376

 Score =   362 bits (928),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 199/208 (96%), Gaps = 0/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQQ+SS TSLWSRLQ+SIS++SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQQNSSTTSLWSRLQESISRHSFDTPLYRFNIPNLRVGTLDSLLALSDD  60

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVKSN+FIEGVCSK RRQIEELER SGV SSSLTVDGVPVDSYLTRF WDEAKYPTMSPL
Sbjct  61   LVKSNSFIEGVCSKTRRQIEELERVSGVLSSSLTVDGVPVDSYLTRFAWDEAKYPTMSPL  120

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VDG+H+QVAKIEDDLKVRV+EY+NVRSQLNAINRKQ GSLAVRDLSNLVKPED++TS
Sbjct  121  KEIVDGIHTQVAKIEDDLKVRVSEYNNVRSQLNAINRKQAGSLAVRDLSNLVKPEDIVTS  180

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHLTTLLAVVSK+SQKDWL+SYE LT+Y
Sbjct  181  EHLTTLLAVVSKYSQKDWLSSYENLTTY  208



>ref|XP_002512862.1| vacuolar ATP synthase subunit C, putative [Ricinus communis]
 gb|EEF49365.1| vacuolar ATP synthase subunit C, putative [Ricinus communis]
Length=376

 Score =   351 bits (901),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 198/208 (95%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  +SA++LW+RLQD ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPVQ--NSASTLWNRLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVKSN+FIEGV  KIRRQIEELER SGV SS+LTVDGVPVDSYLTRFVWDEAKYPT+SPL
Sbjct  59   LVKSNSFIEGVSHKIRRQIEELERVSGVESSALTVDGVPVDSYLTRFVWDEAKYPTISPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +ETVD +H+QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  119  RETVDSIHTQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHLTTLLAVV K+SQKDWLASYETLTSY
Sbjct  179  EHLTTLLAVVPKYSQKDWLASYETLTSY  206



>emb|CDP15722.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   350 bits (898),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/208 (85%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M +RYW+VSLP+Q +SS +SLWSRLQ+SISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MTTRYWIVSLPIQNNSSPSSLWSRLQESISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  60

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+K+N+FIEGV  KIRRQIEELE+ SGV SSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  61   LLKNNSFIEGVSHKIRRQIEELEKVSGVVSSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  120

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H+Q+AKIEDDLKVRVAEY+NVRSQLNAINRKQTGSLAVRDLSNLVKPED++TS
Sbjct  121  REIVDGIHTQIAKIEDDLKVRVAEYNNVRSQLNAINRKQTGSLAVRDLSNLVKPEDIVTS  180

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHLTTLLA+V K+SQKDWLASYETL++Y
Sbjct  181  EHLTTLLAIVPKYSQKDWLASYETLSTY  208



>gb|KDO47366.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
Length=257

 Score =   342 bits (876),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 194/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  +SA S+W+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSAASVWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVKSN+F+E V  KIRRQIEELER SG+ SSSL+VDGVPVD+YLTRFVWDEAKYPTMSPL
Sbjct  59   LVKSNSFVESVSHKIRRQIEELERVSGIESSSLSVDGVPVDTYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLASYETLTSY
Sbjct  179  EHLVTLLAVVPKYSQKDWLASYETLTSY  206



>ref|XP_011083360.1| PREDICTED: V-type proton ATPase subunit C-like [Sesamum indicum]
Length=376

 Score =   345 bits (885),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M +RYWV SLPV Q SSA++LWSRLQ+SISK +FDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MTTRYWVASLPVGQGSSASTLWSRLQESISKQAFDTPLYRFNIPNLRVGTLDSLLALSDD  60

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+K+N+FIEGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLTRFVWD+AKYPTMSPL
Sbjct  61   LLKANSFIEGVSHKIRRQIEELERVSGVVSSSLTVDGVPVDSYLTRFVWDDAKYPTMSPL  120

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H Q+AKIEDDLKVRVAEY+NVRSQLNAINRKQ GSLAVRDLSNLVKPED+I+S
Sbjct  121  REIVDGIHVQIAKIEDDLKVRVAEYNNVRSQLNAINRKQAGSLAVRDLSNLVKPEDIISS  180

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHLTTL+A+VSK+SQKDWL+SYETLT+Y
Sbjct  181  EHLTTLVAIVSKYSQKDWLSSYETLTTY  208



>ref|XP_008231040.1| PREDICTED: V-type proton ATPase subunit C [Prunus mume]
Length=376

 Score =   345 bits (885),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 195/208 (94%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  +SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPVQ--NSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSNNF+EGV  KIRRQIEELER SGV SS+LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNNFVEGVSHKIRRQIEELERVSGVESSALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD +H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED++TS
Sbjct  119  KEVVDSIHGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIVTS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTNY  206



>ref|XP_007215551.1| hypothetical protein PRUPE_ppa007256mg [Prunus persica]
 gb|EMJ16750.1| hypothetical protein PRUPE_ppa007256mg [Prunus persica]
Length=376

 Score =   345 bits (884),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 195/208 (94%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  +SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPVQ--NSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSNNF+EGV  KIRRQIEELER SGV SS+LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNNFVEGVSHKIRRQIEELERVSGVESSALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD +H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED++TS
Sbjct  119  KEVVDSIHGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIVTS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTNY  206



>gb|KDO47363.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47364.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47365.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
Length=303

 Score =   342 bits (876),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 194/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  +SA S+W+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSAASVWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVKSN+F+E V  KIRRQIEELER SG+ SSSL+VDGVPVD+YLTRFVWDEAKYPTMSPL
Sbjct  59   LVKSNSFVESVSHKIRRQIEELERVSGIESSSLSVDGVPVDTYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLASYETLTSY
Sbjct  179  EHLVTLLAVVPKYSQKDWLASYETLTSY  206



>gb|KCW64319.1| hypothetical protein EUGRSUZ_G01949 [Eucalyptus grandis]
Length=218

 Score =   338 bits (867),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 193/209 (92%), Gaps = 1/209 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  255
            MASRYWVVSLPVQQ S+SA SLW+RLQ+ IS++SFDTPLYRFNIPNLRVGTLD LLALSD
Sbjct  1    MASRYWVVSLPVQQGSASAASLWNRLQEQISRHSFDTPLYRFNIPNLRVGTLDSLLALSD  60

Query  256  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  435
            DL KSN F+EGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLTRFVWD+AKYP M+P
Sbjct  61   DLQKSNTFVEGVSHKIRRQIEELERVSGVESSSLTVDGVPVDSYLTRFVWDDAKYPAMAP  120

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            L+ETVD +  QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED++ 
Sbjct  121  LRETVDTIQGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIVI  180

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SE+LTTLLAVV K+SQKDWL+SYETLTSY
Sbjct  181  SENLTTLLAVVPKYSQKDWLSSYETLTSY  209



>ref|XP_010096044.1| V-type proton ATPase subunit C [Morus notabilis]
 gb|EXB62850.1| V-type proton ATPase subunit C [Morus notabilis]
Length=384

 Score =   343 bits (879),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 194/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWV+SL VQ   SA+SLW+RLQ+ ISK+SFDTPLYRFNIPN+RVGTLD LL+LSDD
Sbjct  1    MASRYWVISLTVQ--GSASSLWNRLQEQISKHSFDTPLYRFNIPNIRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSHKIRRQIEELERVSGVESSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+HSQVAKIEDDLKVR+AEY+NVRSQLNAINRKQ GSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDGIHSQVAKIEDDLKVRIAEYNNVRSQLNAINRKQAGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLTSY
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTSY  206



>gb|EYU24479.1| hypothetical protein MIMGU_mgv1a006812mg [Erythranthe guttata]
Length=430

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWV SLPV Q +SA+SLWSRLQ+SISK SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  55   MATRYWVASLPVGQGTSASSLWSRLQESISKQSFDTPLYRFNIPNLRVGTLDSLLSLSDD  114

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L K+N+FIEGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  115  LSKANSFIEGVSHKIRRQIEELERVSGVVSSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  174

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KETVDG+H Q+A+IEDDLKVRVAEY NVRSQLN I+RKQ GSLAVRDLSN+VKP+D+IT+
Sbjct  175  KETVDGIHVQIARIEDDLKVRVAEYGNVRSQLNTISRKQAGSLAVRDLSNMVKPQDIITT  234

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHLTTLLAVV  +SQKDWL+SYETLT++
Sbjct  235  EHLTTLLAVVPSYSQKDWLSSYETLTTF  262



>gb|KEH23490.1| vacuolar H+-ATPase subunit C [Medicago truncatula]
Length=386

 Score =   342 bits (878),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWVVSLPVQ ++S++S+W++LQ +ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MANRYWVVSLPVQNNNSSSSIWNQLQQNISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  60

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSN F+EGV SKIRRQIEELER SGV ++ LTVDGVPVDSYLTRFVWD+AKYPTMSPL
Sbjct  61   LTKSNAFMEGVSSKIRRQIEELERVSGVNTAGLTVDGVPVDSYLTRFVWDDAKYPTMSPL  120

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVKPED+ITS
Sbjct  121  KEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVKPEDIITS  180

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHLTTLLA+VSK+SQKDWL SYETLTSY
Sbjct  181  EHLTTLLAIVSKYSQKDWLESYETLTSY  208



>ref|XP_003624472.1| V-type proton ATPase subunit C [Medicago truncatula]
 gb|AES80690.1| vacuolar H+-ATPase subunit C [Medicago truncatula]
Length=378

 Score =   342 bits (876),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWVVSLPVQ ++S++S+W++LQ +ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MANRYWVVSLPVQNNNSSSSIWNQLQQNISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  60

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSN F+EGV SKIRRQIEELER SGV ++ LTVDGVPVDSYLTRFVWD+AKYPTMSPL
Sbjct  61   LTKSNAFMEGVSSKIRRQIEELERVSGVNTAGLTVDGVPVDSYLTRFVWDDAKYPTMSPL  120

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVKPED+ITS
Sbjct  121  KEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVKPEDIITS  180

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHLTTLLA+VSK+SQKDWL SYETLTSY
Sbjct  181  EHLTTLLAIVSKYSQKDWLESYETLTSY  208



>ref|XP_012067332.1| PREDICTED: V-type proton ATPase subunit C [Jatropha curcas]
 gb|KDP41839.1| hypothetical protein JCGZ_26857 [Jatropha curcas]
Length=376

 Score =   342 bits (876),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/208 (85%), Positives = 194/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYW+VSLPVQ  +SA++LW+RLQD ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWMVSLPVQ--NSASTLWNRLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN FIEGV  KIRRQIEELER SGV SS+LTVDG+PVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFIEGVSHKIRRQIEELERVSGVESSALTVDGIPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VD +HSQVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLS+LVKP+D+I S
Sbjct  119  REIVDNIHSQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSDLVKPQDIIAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLASYETLTSY
Sbjct  179  EHLVTLLAVVPKYSQKDWLASYETLTSY  206



>gb|ABD32569.1| V-ATPase subunit C [Medicago truncatula]
Length=382

 Score =   342 bits (876),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWVVSLPVQ ++S++S+W++LQ +ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MANRYWVVSLPVQNNNSSSSIWNQLQQNISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  60

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSN F+EGV SKIRRQIEELER SGV ++ LTVDGVPVDSYLTRFVWD+AKYPTMSPL
Sbjct  61   LTKSNAFMEGVSSKIRRQIEELERVSGVNTAGLTVDGVPVDSYLTRFVWDDAKYPTMSPL  120

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVKPED+ITS
Sbjct  121  KEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVKPEDIITS  180

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHLTTLLA+VSK+SQKDWL SYETLTSY
Sbjct  181  EHLTTLLAIVSKYSQKDWLESYETLTSY  208



>ref|XP_003518129.1| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
 gb|KHN00618.1| V-type proton ATPase subunit C [Glycine soja]
Length=375

 Score =   341 bits (875),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 195/208 (94%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWVVSLPVQ  +SA++LW++LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MATRYWVVSLPVQ--NSASTLWNKLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
             VKSN+F+EGV  KIRRQIEELER SGV SS LTVDGVPVDSYLTRFVWDEA+YPTMSPL
Sbjct  59   TVKSNSFVEGVSHKIRRQIEELERVSGVVSSGLTVDGVPVDSYLTRFVWDEARYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE +DG+H QVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVKPED+ITS
Sbjct  119  KEIIDGIHGQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            E+LTTLLA+V K+SQKDWL+SYETLT+Y
Sbjct  179  ENLTTLLAIVPKYSQKDWLSSYETLTNY  206



>ref|XP_007031994.1| Vacuolar ATP synthase subunit C (VATC) / V-ATPase C subunit / 
vacuolar proton pump C subunit (DET3) [Theobroma cacao]
 gb|EOY02920.1| Vacuolar ATP synthase subunit C (VATC) / V-ATPase C subunit / 
vacuolar proton pump C subunit (DET3) [Theobroma cacao]
Length=375

 Score =   341 bits (874),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 195/208 (94%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  +SA++LW+ LQD ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSASTLWNSLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+FIEGV  KIRRQIEELER SG+ S++LTVDGVP+DSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFIEGVSHKIRRQIEELERVSGMESNALTVDGVPIDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H+QVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDGIHTQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLA+V K+SQKDWL+SYETLTSY
Sbjct  179  EHLVTLLAIVPKYSQKDWLSSYETLTSY  206



>ref|XP_006446960.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 ref|XP_006446961.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 ref|XP_006446962.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 ref|XP_006468875.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Citrus 
sinensis]
 ref|XP_006468876.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Citrus 
sinensis]
 ref|XP_006468877.1| PREDICTED: V-type proton ATPase subunit C-like isoform X3 [Citrus 
sinensis]
 gb|ESR60200.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 gb|ESR60201.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 gb|ESR60202.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 gb|KDO47360.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47361.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47362.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
Length=375

 Score =   340 bits (873),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 194/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  +SA S+W+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSAASVWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVKSN+F+E V  KIRRQIEELER SG+ SSSL+VDGVPVD+YLTRFVWDEAKYPTMSPL
Sbjct  59   LVKSNSFVESVSHKIRRQIEELERVSGIESSSLSVDGVPVDTYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLASYETLTSY
Sbjct  179  EHLVTLLAVVPKYSQKDWLASYETLTSY  206



>ref|XP_011073132.1| PREDICTED: V-type proton ATPase subunit C-like [Sesamum indicum]
Length=376

 Score =   340 bits (873),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWV SLPV Q SSA+SLWSRLQ+SISK +FDT LYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MATRYWVASLPVSQGSSASSLWSRLQESISKQAFDTSLYRFNIPNLRVGTLDSLLALSDD  60

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+K+N+FIEGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLTRF+WDEAKYPTMSPL
Sbjct  61   LLKANSFIEGVSHKIRRQIEELERVSGVVSSSLTVDGVPVDSYLTRFMWDEAKYPTMSPL  120

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H Q+AKIEDDLKVRVAEY+NVRSQLNAINRKQ GSLAVRDLSNLVK ED+I S
Sbjct  121  REIVDGIHVQIAKIEDDLKVRVAEYNNVRSQLNAINRKQAGSLAVRDLSNLVKQEDIINS  180

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHLTTLLA+V K+SQKDWL+SYETLT+Y
Sbjct  181  EHLTTLLAIVPKYSQKDWLSSYETLTTY  208



>ref|XP_003553974.1| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
Length=377

 Score =   340 bits (873),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 194/208 (93%), Gaps = 1/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYW VSLPV  S+S + LW++LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWAVSLPVHNSAS-SQLWNQLQERISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  59

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSNNF+EGV  KIRRQIEELER SG+ S +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  60   LAKSNNFVEGVTHKIRRQIEELERVSGIDSGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  119

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVKPED++TS
Sbjct  120  KEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVKPEDIVTS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            E+LTTLLA+VSK+SQKDWL+SYETLT+Y
Sbjct  180  ENLTTLLAIVSKYSQKDWLSSYETLTNY  207



>gb|KHN28568.1| V-type proton ATPase subunit C [Glycine soja]
Length=383

 Score =   339 bits (870),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 194/208 (93%), Gaps = 1/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYW VSLPV  S+S + LW++LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWAVSLPVHNSAS-SQLWNQLQERISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  59

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSNNF+EGV  KIRRQIEELER SG+ + +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  60   LAKSNNFVEGVTHKIRRQIEELERVSGIDTGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  119

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVKPED++TS
Sbjct  120  KEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVKPEDIVTS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            E+LTTLLA+VSK+SQKDWL+SYETLT+Y
Sbjct  180  ENLTTLLAIVSKYSQKDWLSSYETLTNY  207



>ref|XP_010663792.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Vitis vinifera]
Length=319

 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWVVSLPV   +SA+SLWSRLQ+SISK+SFDTPLYRFN P+LRVGTLD LL+LSDD
Sbjct  1    MATRYWVVSLPV--PTSASSLWSRLQESISKHSFDTPLYRFNTPDLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SG  S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVTHKIRRQIEELERGSGGESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQTGSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDGIHVQVAKIEDDLKVRVAEYNNVRSQLNAINRKQTGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL++YETL +Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSTYETLATY  206



>gb|ABH07428.1| vacuolar H+-ATPase subunit C [Gossypium hirsutum]
Length=377

 Score =   339 bits (869),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  SSA++LW+ LQD ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--SSASTLWNNLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN FIEGV  KIRRQIEELER SG+ +++LTVDGVPVDSYLTRFVWDEAKYP MSPL
Sbjct  59   LLKSNTFIEGVSHKIRRQIEELERVSGLETNALTVDGVPVDSYLTRFVWDEAKYPIMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H+QVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDGIHTQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTY  206



>ref|XP_008341246.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C-like [Malus domestica]
Length=299

 Score =   336 bits (861),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 190/208 (91%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLP Q  +SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPAQ--NSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSNNF+EGV  KIR QIEELER SGV SS+LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNNFVEGVSHKIRXQIEELERVSGVESSALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD +H QVAKIEDDLKVRVAEY+NVRSQLN INRKQ+GSLAVRDLS LVKPED+I S
Sbjct  119  KEIVDSIHGQVAKIEDDLKVRVAEYNNVRSQLNXINRKQSGSLAVRDLSGLVKPEDIIIS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLA+V K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAIVPKYSQKDWLSSYETLTNY  206



>ref|XP_009378027.1| PREDICTED: V-type proton ATPase subunit C [Pyrus x bretschneideri]
Length=376

 Score =   338 bits (868),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 192/208 (92%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLP Q  +SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPAQ--NSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSNNF+EGV  KIRRQIEELER SGV SS+LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNNFVEGVSHKIRRQIEELERVSGVESSALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD +H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLS LVKPED+I S
Sbjct  119  KEIVDSIHGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSGLVKPEDIIIS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLA+V K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAIVPKYSQKDWLSSYETLTNY  206



>ref|XP_010068642.1| PREDICTED: V-type proton ATPase subunit C-like [Eucalyptus grandis]
Length=329

 Score =   337 bits (863),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 193/209 (92%), Gaps = 1/209 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  255
            MASRYWVVSLPVQQ S+SA SLW+RLQ+ IS++SFDTPLYRFNIPNLRVGTLD LLALSD
Sbjct  1    MASRYWVVSLPVQQGSASAASLWNRLQEQISRHSFDTPLYRFNIPNLRVGTLDSLLALSD  60

Query  256  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  435
            DL KSN F+EGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLTRFVWD+AKYP M+P
Sbjct  61   DLQKSNTFVEGVSHKIRRQIEELERVSGVESSSLTVDGVPVDSYLTRFVWDDAKYPAMAP  120

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            L+ETVD +  QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED++ 
Sbjct  121  LRETVDTIQGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIVI  180

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SE+LTTLLAVV K+SQKDWL+SYETLTSY
Sbjct  181  SENLTTLLAVVPKYSQKDWLSSYETLTSY  209



>ref|XP_007161646.1| hypothetical protein PHAVU_001G086700g [Phaseolus vulgaris]
 gb|ESW33640.1| hypothetical protein PHAVU_001G086700g [Phaseolus vulgaris]
Length=376

 Score =   338 bits (867),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 191/208 (92%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYW VSLPV   +SA+ LW+++Q+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWAVSLPVH--NSASQLWNQVQERISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSNNF+EGV  KIRRQIEELER SGV    LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LAKSNNFVEGVTQKIRRQIEELERVSGVDGGGLTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVKPED+ITS
Sbjct  119  KEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            E+LTTLLA+VSK+SQKDWL+SYETLT Y
Sbjct  179  ENLTTLLAIVSKYSQKDWLSSYETLTDY  206



>gb|KJB40647.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=323

 Score =   336 bits (862),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWVVSLPVQ+S  A++LW+ LQD ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MANRYWVVSLPVQKS--ASTLWNSLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSN FIEGV  KIRRQIEELER SG+ S++LTVDGVP+DSYLTRFVWDEAKYPTMSPL
Sbjct  59   LFKSNTFIEGVSQKIRRQIEELERVSGLESNALTVDGVPIDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSN+VKPED+ITS
Sbjct  119  REIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNMVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTY  206



>ref|XP_011468207.1| PREDICTED: V-type proton ATPase subunit C [Fragaria vesca subsp. 
vesca]
Length=375

 Score =   338 bits (867),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  +SA+SLW+RLQD ISK+SFDTPLYRF+IPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPVQ--NSASSLWNRLQDQISKHSFDTPLYRFHIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSNNF+EGV  KIRRQIEELE+ SGV SS+LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNNFVEGVSHKIRRQIEELEKISGVESSALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE +D +H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK ED++ S
Sbjct  119  KEIIDSIHGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKSEDIVVS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLTSY
Sbjct  179  EHLVTLLAVVLKYSQKDWLSSYETLTSY  206



>gb|KCW64313.1| hypothetical protein EUGRSUZ_G019431, partial [Eucalyptus grandis]
Length=228

 Score =   332 bits (852),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 192/209 (92%), Gaps = 1/209 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  255
            MASRYWVVSLPVQQ S+SA SLW+RL + IS++SFDTPLYRFNIPNLRVGTLD LLALSD
Sbjct  1    MASRYWVVSLPVQQGSASAASLWNRLLEQISRHSFDTPLYRFNIPNLRVGTLDSLLALSD  60

Query  256  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  435
            DL KSN F+EGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLT+FVWD+AKYP M+P
Sbjct  61   DLQKSNTFVEGVSHKIRRQIEELERVSGVESSSLTVDGVPVDSYLTKFVWDDAKYPAMAP  120

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            L+ETVD +  QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED++ 
Sbjct  121  LRETVDTIQGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIVI  180

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SE+LTTLLAVV K+SQKDWL+SYETLTSY
Sbjct  181  SENLTTLLAVVPKYSQKDWLSSYETLTSY  209



>gb|KJB40646.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=336

 Score =   336 bits (862),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWVVSLPVQ+S  A++LW+ LQD ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MANRYWVVSLPVQKS--ASTLWNSLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSN FIEGV  KIRRQIEELER SG+ S++LTVDGVP+DSYLTRFVWDEAKYPTMSPL
Sbjct  59   LFKSNTFIEGVSQKIRRQIEELERVSGLESNALTVDGVPIDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSN+VKPED+ITS
Sbjct  119  REIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNMVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTY  206



>emb|CDY19421.1| BnaC05g09300D [Brassica napus]
Length=377

 Score =   337 bits (865),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV++ SS+T+LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKEDSSSTTLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  60

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  61   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  120

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVKPED++TS
Sbjct  121  KEVVDSIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVKPEDVVTS  180

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLA YETLT +
Sbjct  181  EHLLTLLAVVPKYSQKDWLACYETLTDF  208



>ref|XP_006599411.1| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
 gb|KHN13381.1| V-type proton ATPase subunit C [Glycine soja]
Length=375

 Score =   337 bits (863),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 195/208 (94%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWVVSLPVQ  +SA++LW++LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MATRYWVVSLPVQ--NSASTLWNKLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVKSN+F+EGV  KIRRQIEELER SGV SS LTVDGVPVDSYLTRFVWDEA+YPTMSPL
Sbjct  59   LVKSNSFVEGVSHKIRRQIEELERVSGVMSSGLTVDGVPVDSYLTRFVWDEARYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE +DG+H QVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLS+LVKPED+ITS
Sbjct  119  KEIIDGIHGQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSDLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            E+LTTLLA+V K+SQKDWL+SYE LT+Y
Sbjct  179  ENLTTLLAIVPKYSQKDWLSSYEILTNY  206



>gb|KJB40645.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=387

 Score =   337 bits (864),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWVVSLPVQ+S  A++LW+ LQD ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MANRYWVVSLPVQKS--ASTLWNSLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSN FIEGV  KIRRQIEELER SG+ S++LTVDGVP+DSYLTRFVWDEAKYPTMSPL
Sbjct  59   LFKSNTFIEGVSQKIRRQIEELERVSGLESNALTVDGVPIDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSN+VKPED+ITS
Sbjct  119  REIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNMVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTY  206



>gb|KJB40648.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=375

 Score =   337 bits (863),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWVVSLPVQ+S  A++LW+ LQD ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MANRYWVVSLPVQKS--ASTLWNSLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSN FIEGV  KIRRQIEELER SG+ S++LTVDGVP+DSYLTRFVWDEAKYPTMSPL
Sbjct  59   LFKSNTFIEGVSQKIRRQIEELERVSGLESNALTVDGVPIDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSN+VKPED+ITS
Sbjct  119  REIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNMVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTY  206



>ref|XP_002284444.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Vitis vinifera]
 emb|CBI15738.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   335 bits (860),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWVVSLPV   +SA+SLWSRLQ+SISK+SFDTPLYRFN P+LRVGTLD LL+LSDD
Sbjct  1    MATRYWVVSLPV--PTSASSLWSRLQESISKHSFDTPLYRFNTPDLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SG  S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVTHKIRRQIEELERGSGGESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQTGSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDGIHVQVAKIEDDLKVRVAEYNNVRSQLNAINRKQTGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL++YETL +Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSTYETLATY  206



>ref|XP_006373109.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
 gb|ERP50906.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
Length=366

 Score =   335 bits (859),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYW VSLPVQ  +SA+S+W+ LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWAVSLPVQ--NSASSVWNNLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LV+SN+FIEGV  KIRRQIEEL+R SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LVRSNSFIEGVAQKIRRQIEELQRVSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD +H+QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED+I S
Sbjct  119  KEIVDSIHTQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIIVS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            E+L TLLA+V K+SQKDWLASYETLTSY
Sbjct  179  ENLVTLLAIVPKYSQKDWLASYETLTSY  206



>gb|KJB76317.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=323

 Score =   333 bits (855),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 192/208 (92%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  +SA++LW+ LQD ISK+SFDTPLYRFN+ NLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSASTLWNNLQDQISKHSFDTPLYRFNMSNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN FIEGV  KIRRQIEELER SG+  ++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFIEGVSHKIRRQIEELERVSGLEINALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H+QVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDGIHTQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTY  206



>ref|XP_008775428.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Phoenix 
dactylifera]
Length=335

 Score =   334 bits (856),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 189/208 (91%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYW+VSLPVQ  +SA+S WSRLQ+SISK+SFDTPLYRFN P+LRVGTLD LL LSDD
Sbjct  1    MAARYWIVSLPVQ--ASASSHWSRLQESISKHSFDTPLYRFNTPDLRVGTLDSLLFLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSN FIEGV  KIRRQIEE+ERASGV   +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LAKSNTFIEGVSHKIRRQIEEMERASGVEGGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +ETVD +H QVAKIEDD+KVR AEY+N+R QLNAINRKQ+GSLAVRDLSNL+KPED+ITS
Sbjct  119  RETVDSIHVQVAKIEDDMKVRAAEYNNIRGQLNAINRKQSGSLAVRDLSNLIKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTY  206



>ref|XP_011001967.1| PREDICTED: V-type proton ATPase subunit C [Populus euphratica]
Length=376

 Score =   335 bits (859),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYW VSLPVQ  +SA+S+W+ LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWAVSLPVQ--NSASSVWNNLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LV+SN+FIEGV  KIRRQIEEL+R SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LVRSNSFIEGVAQKIRRQIEELQRVSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD +H+QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED+I S
Sbjct  119  KEIVDSIHTQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIIIS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            E+L TLLA+V K+SQKDWLASYETLTSY
Sbjct  179  ENLVTLLAIVPKYSQKDWLASYETLTSY  206



>ref|XP_007151733.1| hypothetical protein PHAVU_004G070900g [Phaseolus vulgaris]
 gb|ESW23727.1| hypothetical protein PHAVU_004G070900g [Phaseolus vulgaris]
Length=376

 Score =   335 bits (859),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 195/208 (94%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWVVSLPV   +SA++LW++LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MATRYWVVSLPV--PNSASTLWNKLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVKSN+F+EGV  KIRRQIE+LER SGV SSSLTVDGVPVDSYLTRFVWDEAKYPTMS L
Sbjct  59   LVKSNSFVEGVSLKIRRQIEDLERVSGVLSSSLTVDGVPVDSYLTRFVWDEAKYPTMSSL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KETVDG+H QVAKIEDDLKVRV+EY+N+RSQLN INRKQTGSLAVRDLSNLVKPED+ITS
Sbjct  119  KETVDGIHGQVAKIEDDLKVRVSEYNNIRSQLNTINRKQTGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            E+LTTLLA+V K+SQKDWL+SYETLT+Y
Sbjct  179  ENLTTLLAIVPKYSQKDWLSSYETLTNY  206



>gb|KJB76320.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=345

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 192/208 (92%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  +SA++LW+ LQD ISK+SFDTPLYRFN+ NLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSASTLWNNLQDQISKHSFDTPLYRFNMSNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN FIEGV  KIRRQIEELER SG+  ++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFIEGVSHKIRRQIEELERVSGLEINALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H+QVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDGIHTQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTY  206



>ref|XP_006373110.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
 gb|ERP50907.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
Length=376

 Score =   335 bits (858),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYW VSLPVQ  +SA+S+W+ LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWAVSLPVQ--NSASSVWNNLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LV+SN+FIEGV  KIRRQIEEL+R SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LVRSNSFIEGVAQKIRRQIEELQRVSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD +H+QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED+I S
Sbjct  119  KEIVDSIHTQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIIVS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            E+L TLLA+V K+SQKDWLASYETLTSY
Sbjct  179  ENLVTLLAIVPKYSQKDWLASYETLTSY  206



>gb|KJB76319.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=349

 Score =   333 bits (855),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 192/208 (92%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  +SA++LW+ LQD ISK+SFDTPLYRFN+ NLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSASTLWNNLQDQISKHSFDTPLYRFNMSNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN FIEGV  KIRRQIEELER SG+  ++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFIEGVSHKIRRQIEELERVSGLEINALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H+QVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDGIHTQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTY  206



>ref|XP_003548919.2| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
Length=384

 Score =   335 bits (858),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 192/208 (92%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYW VSLPV   +SA+ LW++ Q+ ISK+SFDTPLYRFNIPNLR+GTLD LL+LSDD
Sbjct  9    MASRYWAVSLPV--PNSASQLWNQFQERISKHSFDTPLYRFNIPNLRIGTLDSLLSLSDD  66

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSNNF+EGV  KIRRQIEELER SG+ + +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  67   LAKSNNFVEGVTHKIRRQIEELERVSGIDTGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  126

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVKPED++TS
Sbjct  127  KEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVKPEDIVTS  186

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            E+LTTLLA+VSK+SQKDWL+SYETL +Y
Sbjct  187  ENLTTLLAIVSKYSQKDWLSSYETLINY  214



>ref|XP_008775427.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Phoenix 
dactylifera]
Length=374

 Score =   334 bits (857),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 189/208 (91%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYW+VSLPVQ  +SA+S WSRLQ+SISK+SFDTPLYRFN P+LRVGTLD LL LSDD
Sbjct  1    MAARYWIVSLPVQ--ASASSHWSRLQESISKHSFDTPLYRFNTPDLRVGTLDSLLFLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSN FIEGV  KIRRQIEE+ERASGV   +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LAKSNTFIEGVSHKIRRQIEEMERASGVEGGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +ETVD +H QVAKIEDD+KVR AEY+N+R QLNAINRKQ+GSLAVRDLSNL+KPED+ITS
Sbjct  119  RETVDSIHVQVAKIEDDMKVRAAEYNNIRGQLNAINRKQSGSLAVRDLSNLIKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTY  206



>ref|XP_010528136.1| PREDICTED: V-type proton ATPase subunit C-like [Tarenaya hassleriana]
Length=376

 Score =   334 bits (856),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPV+ S  A+SLW+RLQD ISK+SFDTP+YRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVKDS--ASSLWNRLQDQISKHSFDTPVYRFNIPNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSHKIRRQIEELERVSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD V +QVAKIEDDLKVR AEY+N+RSQLNAINRKQ+GSLAVRDLS+LVKPED+ITS
Sbjct  119  KEIVDSVQTQVAKIEDDLKVRAAEYNNIRSQLNAINRKQSGSLAVRDLSSLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTNY  206



>gb|EPS62747.1| hypothetical protein M569_12043, partial [Genlisea aurea]
Length=310

 Score =   332 bits (850),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWV SL V   SS++SLW RLQ+ IS+ +FDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  20   MATRYWVSSLAVGHGSSSSSLWIRLQELISRQAFDTPLYRFNIPNLRVGTLDSLLALSDD  79

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+FIEGV  KIRRQIEELE+ SGV SSSLTVDGVPVDSYLTRF WDEAKYPTMSPL
Sbjct  80   LLKSNSFIEGVSHKIRRQIEELEKISGVFSSSLTVDGVPVDSYLTRFSWDEAKYPTMSPL  139

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H Q+AKIEDDLKVRVAEY+NVRSQLNAINRKQ GSLAVRDLSNLVKPEDL+ S
Sbjct  140  REIVDGIHGQIAKIEDDLKVRVAEYNNVRSQLNAINRKQAGSLAVRDLSNLVKPEDLVVS  199

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHLTTLL +V K+SQKDWL+SYETLT+Y
Sbjct  200  EHLTTLLVIVLKYSQKDWLSSYETLTTY  227



>ref|XP_010249179.1| PREDICTED: V-type proton ATPase subunit C-like [Nelumbo nucifera]
Length=375

 Score =   333 bits (855),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 192/206 (93%), Gaps = 2/206 (1%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            +RYWVVSLPVQ  +SA+SLW RLQ++ISKNSFDTPLYRFN P+LRVGTLD LL+LSDD++
Sbjct  5    ARYWVVSLPVQ--TSASSLWGRLQEAISKNSFDTPLYRFNTPDLRVGTLDSLLSLSDDIL  62

Query  265  KSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKE  444
            KSN+FIEGV  KIRRQIE+LER SGV SS+LTVDGVPVDSYLTRFVWDEAKYPTMSPL+E
Sbjct  63   KSNSFIEGVSQKIRRQIEDLERTSGVESSALTVDGVPVDSYLTRFVWDEAKYPTMSPLRE  122

Query  445  TVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEH  624
             VD +H QV+KIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED+ITSEH
Sbjct  123  IVDSIHVQVSKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIITSEH  182

Query  625  LTTLLAVVSKFSQKDWLASYETLTSY  702
            L TLLA+V K+SQKDWL+SYETLTSY
Sbjct  183  LVTLLAIVPKYSQKDWLSSYETLTSY  208



>gb|KJB76315.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
 gb|KJB76318.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
 gb|KJB76321.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=375

 Score =   333 bits (855),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 192/208 (92%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  +SA++LW+ LQD ISK+SFDTPLYRFN+ NLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSASTLWNNLQDQISKHSFDTPLYRFNMSNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN FIEGV  KIRRQIEELER SG+  ++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFIEGVSHKIRRQIEELERVSGLEINALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H+QVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDGIHTQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTY  206



>ref|XP_004150739.1| PREDICTED: V-type proton ATPase subunit C [Cucumis sativus]
Length=376

 Score =   333 bits (855),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 192/208 (92%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYW+VSLPVQ   SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWMVSLPVQ--GSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN F+EGV  KIRRQIEELE+ SGV S+ LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFVEGVSQKIRRQIEELEKVSGVESNVLTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            ++ VD +HSQVAKIEDDLK+RVAEY+NVRSQLNAINRKQ+GSLAVRD+SNLVKPED+ITS
Sbjct  119  RDIVDSIHSQVAKIEDDLKIRVAEYNNVRSQLNAINRKQSGSLAVRDISNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLL ++ K+SQK+WL+SYETLTSY
Sbjct  179  EHLATLLVIIPKYSQKEWLSSYETLTSY  206



>ref|XP_010693540.1| PREDICTED: V-type proton ATPase subunit C [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   333 bits (854),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYW+VSLPVQ  SSA++LWS+LQ+S+SK SFDTPLYRFN+PNLRVGTLD LLAL+D+
Sbjct  1    MATRYWMVSLPVQ--SSASNLWSQLQESVSKQSFDTPLYRFNVPNLRVGTLDSLLALADE  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+++N F+EGV  KIRRQI+ELER+SGV   +LTVDGVP+DSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLRANAFVEGVTHKIRRQIDELERSSGVDGGALTVDGVPIDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VDG+HS VAK+EDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED++ S
Sbjct  119  KEVVDGIHSFVAKVEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDVVAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLL+VVSKFSQKDWL+SYETLT Y
Sbjct  179  EHLVTLLSVVSKFSQKDWLSSYETLTDY  206



>gb|KCW64312.1| hypothetical protein EUGRSUZ_G019431, partial [Eucalyptus grandis]
Length=345

 Score =   332 bits (850),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 192/209 (92%), Gaps = 1/209 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  255
            MASRYWVVSLPVQQ S+SA SLW+RL + IS++SFDTPLYRFNIPNLRVGTLD LLALSD
Sbjct  1    MASRYWVVSLPVQQGSASAASLWNRLLEQISRHSFDTPLYRFNIPNLRVGTLDSLLALSD  60

Query  256  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  435
            DL KSN F+EGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLT+FVWD+AKYP M+P
Sbjct  61   DLQKSNTFVEGVSHKIRRQIEELERVSGVESSSLTVDGVPVDSYLTKFVWDDAKYPAMAP  120

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            L+ETVD +  QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED++ 
Sbjct  121  LRETVDTIQGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIVI  180

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SE+LTTLLAVV K+SQKDWL+SYETLTSY
Sbjct  181  SENLTTLLAVVPKYSQKDWLSSYETLTSY  209



>ref|XP_004493016.1| PREDICTED: V-type proton ATPase subunit C-like [Cicer arietinum]
Length=378

 Score =   333 bits (853),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWVVSLPVQ ++S++S+W++LQ +ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MANRYWVVSLPVQNNNSSSSIWNQLQQNISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  60

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSN F+EGV  KIRRQIEELER SGV ++ LTVDGVPVDSYLTRFVWD+AKYPTMSPL
Sbjct  61   LTKSNAFMEGVSLKIRRQIEELERVSGVNTAGLTVDGVPVDSYLTRFVWDDAKYPTMSPL  120

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VDG+H  VAKIEDDLKVRV+EY+N+RSQLN+INRKQTGSLAVRD+SNLVKPED+ITS
Sbjct  121  KEIVDGIHGLVAKIEDDLKVRVSEYNNIRSQLNSINRKQTGSLAVRDISNLVKPEDIITS  180

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHLTTLLAVVSK+SQK+WLASYETLTSY
Sbjct  181  EHLTTLLAVVSKYSQKEWLASYETLTSY  208



>ref|XP_008808181.1| PREDICTED: V-type proton ATPase subunit C-like [Phoenix dactylifera]
Length=374

 Score =   332 bits (852),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 190/208 (91%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYW+VSLPVQ  SSA+SLWSRLQ+SISK+SFDTPLYRFN P+LRVGTLD LLALSDD
Sbjct  1    MATRYWIVSLPVQ--SSASSLWSRLQESISKHSFDTPLYRFNTPDLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSN FIEGV  KIRRQIE+LERASGV   +LTVDGVPVDSYLTRFVWDE+KYPTMSPL
Sbjct  59   LAKSNAFIEGVSHKIRRQIEDLERASGVEGGALTVDGVPVDSYLTRFVWDESKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VD +H QVAKIEDD+KVR AEY+N+R QLNAINRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDTIHVQVAKIEDDMKVRAAEYNNIRGQLNAINRKQSGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTY  206



>ref|XP_008463120.1| PREDICTED: V-type proton ATPase subunit C [Cucumis melo]
Length=376

 Score =   332 bits (852),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 192/208 (92%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYW+VSLPVQ   SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWMVSLPVQ--GSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN F+EGV  KIRRQIEELE+ SGV S+ LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFVEGVSQKIRRQIEELEKVSGVESNVLTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            ++ VD +HSQVAKIEDDLK+RVAEY+NVRSQLNAINRKQ+GSLAVRD+SNLVKP+D+ITS
Sbjct  119  RDIVDSIHSQVAKIEDDLKIRVAEYNNVRSQLNAINRKQSGSLAVRDISNLVKPDDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLL +V K+SQK+WL+SYETLTSY
Sbjct  179  EHLATLLVIVPKYSQKEWLSSYETLTSY  206



>ref|XP_002275510.1| PREDICTED: V-type proton ATPase subunit C [Vitis vinifera]
 emb|CBI21291.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   332 bits (851),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 194/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYW VSLPV+  +SA+SLW+RLQD+ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MATRYWSVSLPVR--TSASSLWNRLQDAISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSN+F+EGV  KIRRQIE+LE+ASGV +S+LTVDGVPVDSYLTRFVWDEAK+PTMSPL
Sbjct  59   LQKSNSFVEGVTHKIRRQIEDLEKASGVETSALTVDGVPVDSYLTRFVWDEAKFPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VD +H QV+KIEDDLKVR+AEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED+I S
Sbjct  119  REIVDSIHHQVSKIEDDLKVRIAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIIAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLA+V K+SQKDWL++YETLTSY
Sbjct  179  EHLVTLLAIVPKYSQKDWLSTYETLTSY  206



>ref|NP_563916.1| V-type proton ATPase subunit C [Arabidopsis thaliana]
 sp|Q9SDS7.1|VATC_ARATH RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar H(+)-ATPase subunit C; AltName: 
Full=Vacuolar proton pump subunit C [Arabidopsis thaliana]
 gb|AAF20146.1|AF208261_1 vacuolar ATP synthase subunit C [Arabidopsis thaliana]
 gb|AAF78489.1|AC012187_9 Identical to vacuolar ATP sythase subunit C (DET3) from Arabidopsis 
thaliana gb|AF208261. ESTs gb|AA067533, gb|Z37481, gb|AA721838, 
gb|Z37180, gb|T21206 come from this gene [Arabidopsis 
thaliana]
 gb|AAG50103.1|AF334725_1 putative vacuolar ATP synthase subunit C [Arabidopsis thaliana]
 gb|AAL24354.1| Identical to vacuolar ATP sythase subunit C (DET3) [Arabidopsis 
thaliana]
 gb|AAM13333.1| vacuolar ATP sythase subunit C [Arabidopsis thaliana]
 dbj|BAH30291.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28936.1| V-type proton ATPase subunit C [Arabidopsis thaliana]
Length=375

 Score =   331 bits (849),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 188/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+   SA+SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVK--DSASSLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLSNLVKPED++ S
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVKPEDIVES  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLA YETLT Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLACYETLTDY  206



>ref|XP_008379060.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C [Malus domestica]
Length=376

 Score =   331 bits (849),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 191/208 (92%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  +SA+SLW+RLQ+ ISK+SFDTPL  FNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPVQ--NSASSLWNRLQEKISKHSFDTPLLXFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSNNF+EGV  KIRRQIEELER SGV SS+LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNNFVEGVSHKIRRQIEELERVSGVESSALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE +D +H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLS+LVK ED+I S
Sbjct  119  KEVIDSIHGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSSLVKSEDIIVS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLA+V K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAIVPKYSQKDWLSSYETLTNY  206



>ref|XP_009148561.1| PREDICTED: V-type proton ATPase subunit C [Brassica rapa]
 emb|CDX98037.1| BnaA06g07880D [Brassica napus]
Length=375

 Score =   331 bits (848),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 189/208 (91%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+ SSS  +LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKDSSS--TLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVKPED++TS
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVKPEDVVTS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLA YETLT +
Sbjct  179  EHLVTLLAVVPKYSQKDWLACYETLTDF  206



>ref|XP_010066422.1| PREDICTED: V-type proton ATPase subunit C [Eucalyptus grandis]
Length=378

 Score =   331 bits (849),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 192/209 (92%), Gaps = 1/209 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  255
            MASRYWVVSLPVQQ S+SA SLW+RL + IS++SFDTPLYRFNIPNLRVGTLD LLALSD
Sbjct  1    MASRYWVVSLPVQQGSASAASLWNRLLEQISRHSFDTPLYRFNIPNLRVGTLDSLLALSD  60

Query  256  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  435
            DL KSN F+EGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLT+FVWD+AKYP M+P
Sbjct  61   DLQKSNTFVEGVSHKIRRQIEELERVSGVESSSLTVDGVPVDSYLTKFVWDDAKYPAMAP  120

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            L+ETVD +  QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVKPED++ 
Sbjct  121  LRETVDTIQGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIVI  180

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SE+LTTLLAVV K+SQKDWL+SYETLTSY
Sbjct  181  SENLTTLLAVVPKYSQKDWLSSYETLTSY  209



>ref|XP_002889973.1| de-etiolated 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66232.1| de-etiolated 3 [Arabidopsis lyrata subsp. lyrata]
Length=378

 Score =   331 bits (848),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 188/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+   SA++LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVK--DSASTLWNRLQEQISKHSFDTPIYRFNIPNLRVGTLDSLLALGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLSNLVKPED++ S
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVKPEDIVVS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLA YETLT Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLACYETLTEY  206



>emb|CDY66539.1| BnaCnng51300D [Brassica napus]
Length=376

 Score =   330 bits (847),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 188/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+ SSS  SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKDSSS--SLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE V+ + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVKPED++ S
Sbjct  119  KEVVENIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVKPEDIVAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLA YETLT Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLACYETLTEY  206



>emb|CDY21070.1| BnaA08g24550D [Brassica napus]
Length=376

 Score =   330 bits (847),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 188/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+ SSS  SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKDSSS--SLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE V+ + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVKPED++ S
Sbjct  119  KEVVENIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVKPEDIVAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLA YETLT Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLACYETLTEY  206



>ref|XP_006417188.1| hypothetical protein EUTSA_v10007948mg [Eutrema salsugineum]
 gb|ESQ35541.1| hypothetical protein EUTSA_v10007948mg [Eutrema salsugineum]
Length=375

 Score =   330 bits (847),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 189/208 (91%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV++S  A+SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKES--ASSLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLS+LVKPED++ S
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSSLVKPEDIVAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLA YETLT Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLACYETLTEY  206



>gb|KHM99227.1| V-type proton ATPase subunit C [Glycine soja]
Length=376

 Score =   330 bits (846),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 192/209 (92%), Gaps = 3/209 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYW VSLPV   +SA+ LW++ Q+ ISK+SFDTPLYRFNIPNLR+GTLD LL+LSDD
Sbjct  1    MASRYWAVSLPV--PNSASQLWNQFQERISKHSFDTPLYRFNIPNLRIGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTR-FVWDEAKYPTMSP  435
            L KSNNF+EGV  KIRRQIEELER SG+ + +LTVDGVPVDSYLTR FVWDEAKYPTMSP
Sbjct  59   LAKSNNFVEGVTHKIRRQIEELERVSGIDTGALTVDGVPVDSYLTRLFVWDEAKYPTMSP  118

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            LKE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVKPED++T
Sbjct  119  LKEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVKPEDIVT  178

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SE+LTTLLA+VSK+SQKDWL+SYETL +Y
Sbjct  179  SENLTTLLAIVSKYSQKDWLSSYETLINY  207



>gb|AIY85415.1| V-ATPase subunit C1 [Eriobotrya japonica]
Length=376

 Score =   330 bits (845),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 189/208 (91%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLP Q  +SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPAQ--NSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSNNF+EGV  KI RQIEELER SGV SS+LTVDGVPVDSYLTRFVWDEA YPT+SPL
Sbjct  59   LLKSNNFVEGVSHKIGRQIEELERVSGVESSALTVDGVPVDSYLTRFVWDEAMYPTISPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD +H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLS LVKPED+I S
Sbjct  119  KEIVDSIHGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSGLVKPEDIIIS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLA+V K+ QKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAIVPKYPQKDWLSSYETLTNY  206



>ref|XP_010939292.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Elaeis 
guineensis]
Length=347

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 187/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYW+VSLPVQ  SSA+S WSRLQ+SISK SFDTP+YRFN P+LRVGTLD LLALSDD
Sbjct  1    MATRYWIVSLPVQ--SSASSRWSRLQESISKRSFDTPVYRFNTPDLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSN F+EGV  KIRRQIEELERASGV   +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LAKSNAFLEGVSHKIRRQIEELERASGVEGGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VD +H  VAKIEDD+KVR AEY+N+R QLNAINRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDSIHVLVAKIEDDMKVRAAEYNNIRGQLNAINRKQSGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTY  206



>gb|KFK43549.1| hypothetical protein AALP_AA1G141200 [Arabis alpina]
Length=376

 Score =   329 bits (843),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 188/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+   SA++LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVK--DSASTLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLSNLVKP+D++ S
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVKPDDIVAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLA YETLT Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLACYETLTEY  206



>ref|XP_006369829.1| Vacuolar ATP synthase subunit C family protein [Populus trichocarpa]
 gb|ERP66398.1| Vacuolar ATP synthase subunit C family protein [Populus trichocarpa]
Length=376

 Score =   328 bits (841),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 190/208 (91%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+  +SA+S+W+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLDLLLALSDD
Sbjct  1    MTSRYWVVSLPVE--NSASSVWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDLLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVKS+NFIEGV  K RRQIEE ER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LVKSSNFIEGVSHKTRRQIEEFERVSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD +HSQVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLS+LVK ED+I S
Sbjct  119  KEIVDSIHSQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSDLVKTEDIIIS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TL A+V K+SQKDWLASYETLT Y
Sbjct  179  EHLITLPAIVPKYSQKDWLASYETLTDY  206



>ref|XP_010939209.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Elaeis 
guineensis]
Length=374

 Score =   328 bits (840),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 187/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYW+VSLPVQ  SSA+S WSRLQ+SISK SFDTP+YRFN P+LRVGTLD LLALSDD
Sbjct  1    MATRYWIVSLPVQ--SSASSRWSRLQESISKRSFDTPVYRFNTPDLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSN F+EGV  KIRRQIEELERASGV   +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LAKSNAFLEGVSHKIRRQIEELERASGVEGGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VD +H  VAKIEDD+KVR AEY+N+R QLNAINRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDSIHVLVAKIEDDMKVRAAEYNNIRGQLNAINRKQSGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTY  206



>ref|XP_009110617.1| PREDICTED: V-type proton ATPase subunit C-like [Brassica rapa]
Length=376

 Score =   327 bits (838),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 187/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SR WVVSLPV+ SSS  SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRCWVVSLPVKDSSS--SLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE V+ + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVKPED++ S
Sbjct  119  KEVVENIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVKPEDIVAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLA YETLT Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLACYETLTEY  206



>ref|XP_010925033.1| PREDICTED: V-type proton ATPase subunit C-like [Elaeis guineensis]
Length=374

 Score =   326 bits (835),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 187/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYW+VSLPVQ  SSA+SLWSRLQ+SISK SFDT LYRFN P+LRVGTLD LLALSDD
Sbjct  1    MATRYWIVSLPVQ--SSASSLWSRLQESISKRSFDTLLYRFNTPDLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L KSN FIEGV  KIRRQIE+LERASGV   +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LAKSNAFIEGVSHKIRRQIEDLERASGVEGGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VD +H  VAKIEDD+KVR AEY+N+RSQLN INRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  119  REIVDSIHVLVAKIEDDMKVRAAEYNNIRSQLNIINRKQSGSLAVRDLSNLVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTY  206



>ref|XP_010556324.1| PREDICTED: V-type proton ATPase subunit C [Tarenaya hassleriana]
Length=377

 Score =   326 bits (835),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 190/208 (91%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPV+ S  A+SLW+ LQ  ISK+SFDTP+YRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVKDS--ASSLWNGLQGQISKHSFDTPVYRFNIPNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELERASGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSHKIRRQIEELERASGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD + +QVAKIEDDLKVR AEY+N+R QLNAINRKQ+GSLAVRDLS+LVKPED+I S
Sbjct  119  KEIVDSIQTQVAKIEDDLKVRGAEYNNIRGQLNAINRKQSGSLAVRDLSSLVKPEDIIAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTNY  206



>ref|XP_002441624.1| hypothetical protein SORBIDRAFT_09g030620 [Sorghum bicolor]
 gb|EES20054.1| hypothetical protein SORBIDRAFT_09g030620 [Sorghum bicolor]
Length=377

 Score =   326 bits (835),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 190/209 (91%), Gaps = 1/209 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  255
            MA+RYW+VSLPVQ   ++A+SLWSRLQDSIS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQSPGATASSLWSRLQDSISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  256  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  435
            DLVKSN F+EGV  KIRRQIE+LERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMSP
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEDLERAGGVESGTLTVDGVPVDTYLTRFVWDEGKYPTMSP  120

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            LKE V  + SQVAKIEDD+KVR AEY+NVRSQL+AINRKQ+GSLAVRDLSNLVKPED+IT
Sbjct  121  LKEIVGSIQSQVAKIEDDMKVRAAEYNNVRSQLSAINRKQSGSLAVRDLSNLVKPEDMIT  180

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SEHL TLLA+V K+SQKDWL+SYETL ++
Sbjct  181  SEHLVTLLAIVPKYSQKDWLSSYETLDTF  209



>ref|XP_009118052.1| PREDICTED: V-type proton ATPase subunit C-like [Brassica rapa]
Length=378

 Score =   325 bits (834),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 188/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+ SSS  +LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKDSSS--TLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE V+ + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLS+LVKPED++ S
Sbjct  119  KEVVENIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSSLVKPEDIVAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLA YETLT +
Sbjct  179  EHLETLLAVVPKYSQKDWLACYETLTDF  206



>ref|XP_011045799.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Populus 
euphratica]
 ref|XP_011045800.1| PREDICTED: V-type proton ATPase subunit C-like isoform X3 [Populus 
euphratica]
Length=375

 Score =   325 bits (833),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 189/208 (91%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+  +SA+S+W+RLQ+ ISK+SFDTPLYRFNIP+LRVGTLD LLALSDD
Sbjct  1    MTSRYWVVSLPVE--NSASSVWNRLQEQISKHSFDTPLYRFNIPSLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVKSNNFIEGV  K RRQIEE ER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LVKSNNFIEGVSHKTRRQIEEFERLSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD +HSQV KIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLS+LVK ED+I S
Sbjct  119  KEIVDSIHSQVVKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSDLVKTEDIIIS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TL A+V K+SQKDWLASYETLT+Y
Sbjct  179  EHLITLPAIVPKYSQKDWLASYETLTNY  206



>ref|NP_001147632.1| LOC100281241 [Zea mays]
 gb|ACF83479.1| unknown [Zea mays]
 gb|ACG28176.1| vacuolar ATP synthase subunit C [Zea mays]
 gb|AFW79360.1| Vacuolar ATP synthase subunit C [Zea mays]
Length=377

 Score =   325 bits (833),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 189/209 (90%), Gaps = 1/209 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSS-ATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  255
            MA+RYW+VSLPVQ   + A+SLWSRLQDSIS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQSPGAIASSLWSRLQDSISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  256  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  435
            DLVKSN F+EGV  KIRRQIE+LERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMSP
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEDLERAGGVESGTLTVDGVPVDTYLTRFVWDEGKYPTMSP  120

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            LKE V  + SQVAKIEDD+KVR AEY+NVRSQL+AINRKQ+GSLAVRDLSNLVKPED+IT
Sbjct  121  LKEIVGSIQSQVAKIEDDMKVRAAEYNNVRSQLSAINRKQSGSLAVRDLSNLVKPEDMIT  180

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SEHL TLLA+V K+SQKDWL+SYETL ++
Sbjct  181  SEHLVTLLAIVPKYSQKDWLSSYETLDTF  209



>ref|XP_011045798.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Populus 
euphratica]
Length=389

 Score =   325 bits (833),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 189/208 (91%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+  +SA+S+W+RLQ+ ISK+SFDTPLYRFNIP+LRVGTLD LLALSDD
Sbjct  1    MTSRYWVVSLPVE--NSASSVWNRLQEQISKHSFDTPLYRFNIPSLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVKSNNFIEGV  K RRQIEE ER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LVKSNNFIEGVSHKTRRQIEEFERLSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD +HSQV KIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLS+LVK ED+I S
Sbjct  119  KEIVDSIHSQVVKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSDLVKTEDIIIS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TL A+V K+SQKDWLASYETLT+Y
Sbjct  179  EHLITLPAIVPKYSQKDWLASYETLTNY  206



>ref|NP_001056500.1| Os05g0593100 [Oryza sativa Japonica Group]
 gb|AAT44305.1| putative vacuolar ATP synthase subunit C [Oryza sativa Japonica 
Group]
 dbj|BAF18414.1| Os05g0593100 [Oryza sativa Japonica Group]
 dbj|BAG88149.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94456.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79794.1| hypothetical protein OsI_21221 [Oryza sativa Indica Group]
 gb|EEE64903.1| hypothetical protein OsJ_19763 [Oryza sativa Japonica Group]
Length=377

 Score =   325 bits (832),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 189/209 (90%), Gaps = 1/209 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  255
            MA+RYW+VSLPVQ   S+A SLW+RLQDSIS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQTPGSTANSLWARLQDSISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  256  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  435
            DLVKSN FIEGV  KIRRQIEELERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMSP
Sbjct  61   DLVKSNVFIEGVSHKIRRQIEELERAGGVESGALTVDGVPVDTYLTRFVWDEGKYPTMSP  120

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            LKE V  + SQV+KIEDD+KVR AEY+NVRSQL+AINRKQTGSLAVRDLSNLVKPED++T
Sbjct  121  LKEIVGSIQSQVSKIEDDMKVRGAEYNNVRSQLSAINRKQTGSLAVRDLSNLVKPEDMVT  180

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SEHL TLLAVV K+SQKDWL+SYE+L ++
Sbjct  181  SEHLVTLLAVVPKYSQKDWLSSYESLDTF  209



>gb|AAO72561.1| putative vacuolar ATP synthase subunit C [Oryza sativa Japonica 
Group]
Length=408

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 189/210 (90%), Gaps = 1/210 (0%)
 Frame = +1

Query  76   EMASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllals  252
            EMA+RYW+VSLPVQ   S+A SLW+RLQDSIS++SFDTPLYRFN+P+LRVGTLD LLALS
Sbjct  40   EMATRYWIVSLPVQTPGSTANSLWARLQDSISRHSFDTPLYRFNVPDLRVGTLDSLLALS  99

Query  253  ddlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMS  432
            DDLVKSN FIEGV  KIRRQIEELERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMS
Sbjct  100  DDLVKSNVFIEGVSHKIRRQIEELERAGGVESGALTVDGVPVDTYLTRFVWDEGKYPTMS  159

Query  433  PLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI  612
            PLKE    + SQV+KIEDD+KVR AEY+NVRSQLNAINRKQTGSLAVRDLSNLVKPED++
Sbjct  160  PLKEIAGSIQSQVSKIEDDMKVRGAEYNNVRSQLNAINRKQTGSLAVRDLSNLVKPEDMV  219

Query  613  TSEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            TSEHL TLLAVV ++SQKDWL+SYE+L ++
Sbjct  220  TSEHLVTLLAVVPQYSQKDWLSSYESLDTF  249



>tpg|DAA59221.1| TPA: hypothetical protein ZEAMMB73_061434 [Zea mays]
Length=212

 Score =   318 bits (815),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 186/209 (89%), Gaps = 1/209 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  255
            MA+RYW+VSLPVQ   ++ATSLWSRLQD IS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQSPGATATSLWSRLQDGISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  256  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  435
            DLVKSN F+EGV  KIRRQIE+LERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMS 
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEDLERAGGVDSGALTVDGVPVDTYLTRFVWDEGKYPTMSS  120

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            LKE V  + SQVAKIEDD+KVR AEY+NVRSQL AINRKQ+GSLAVRDLSNLVKPED++ 
Sbjct  121  LKEIVGSIQSQVAKIEDDMKVRAAEYNNVRSQLTAINRKQSGSLAVRDLSNLVKPEDMVC  180

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SEHL TLLA+V K+SQKDWL+SYE+L ++
Sbjct  181  SEHLVTLLAIVPKYSQKDWLSSYESLDTF  209



>ref|XP_006655657.1| PREDICTED: V-type proton ATPase subunit C-like [Oryza brachyantha]
Length=377

 Score =   323 bits (829),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 190/209 (91%), Gaps = 1/209 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  255
            MA+RYW+VSLPVQ  +++A SLW+RLQDSIS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQTPAATANSLWARLQDSISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  256  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  435
            DLVKSN F+EGV  KIRRQIEELERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMSP
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEELERAGGVESGALTVDGVPVDTYLTRFVWDEGKYPTMSP  120

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            LKE +  + SQVAKIEDD+KVR AEY+NVRSQL+AINRKQ+GSLAVRDLSNLVKPED++T
Sbjct  121  LKEIIGSIQSQVAKIEDDMKVRAAEYNNVRSQLSAINRKQSGSLAVRDLSNLVKPEDMVT  180

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SEHL TLLA+V K+SQKDWL+SYE+L ++
Sbjct  181  SEHLVTLLAIVPKYSQKDWLSSYESLDTF  209



>emb|CDY16036.1| BnaC08g40870D [Brassica napus]
Length=474

 Score =   326 bits (836),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 188/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+ SSS  +LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKDSSS--TLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE V+ + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLS+LVKPED++ S
Sbjct  119  KEVVENIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSSLVKPEDIVAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLA YETLT +
Sbjct  179  EHLETLLAVVPKYSQKDWLACYETLTDF  206



>ref|XP_010458722.1| PREDICTED: V-type proton ATPase subunit C-like [Camelina sativa]
Length=375

 Score =   322 bits (826),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 184/208 (88%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+   SA+SLW RLQD ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVK--DSASSLWQRLQDQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLSNLVKPED++ S
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVKPEDIVAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQK+W  +YE  T Y
Sbjct  179  EHLVTLLAVVPKYSQKEWKDNYEKFTEY  206



>ref|XP_010494723.1| PREDICTED: V-type proton ATPase subunit C [Camelina sativa]
Length=375

 Score =   322 bits (826),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 184/208 (88%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+   SA+SLW RLQD ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVK--DSASSLWQRLQDQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLSNLVKPED++ S
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVKPEDIVAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQK+W  +YE  T Y
Sbjct  179  EHLVTLLAVVPKYSQKEWKDNYEKFTEY  206



>ref|XP_006305100.1| hypothetical protein CARUB_v10009467mg [Capsella rubella]
 gb|EOA37998.1| hypothetical protein CARUB_v10009467mg [Capsella rubella]
Length=375

 Score =   322 bits (826),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 184/208 (88%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+   SA+SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LL L DD
Sbjct  1    MTSRYWVVSLPVK--DSASSLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLGLGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFVEGVSQKIRRQIEELERTSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLS+LVKPED++ S
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSDLVKPEDIVAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQK+W  +YET T Y
Sbjct  179  EHLVTLLAVVPKYSQKEWKENYETFTEY  206



>emb|CDX71966.1| BnaC08g29080D [Brassica napus]
Length=378

 Score =   322 bits (825),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 187/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+ SSS  +LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKDSSS--TLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE V+ + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLS+LVKPED++ S
Sbjct  119  KEVVENIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSSLVKPEDIVAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQK WLA YETLT +
Sbjct  179  EHLETLLAVVPKYSQKYWLACYETLTDF  206



>ref|XP_010554131.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Tarenaya 
hassleriana]
Length=377

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 188/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWV SLPV+ S  A+SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LL LSDD
Sbjct  1    MASRYWVASLPVKDS--ASSLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLTLSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SG  S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSHKIRRQIEELERVSGAESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD V +QV KIEDDLKVR AEY+N+RSQLNAINRKQ+GSLAVRDLS+LVKPED++TS
Sbjct  119  KEIVDSVQTQVMKIEDDLKVRSAEYNNIRSQLNAINRKQSGSLAVRDLSSLVKPEDIVTS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL T+LAVV K+SQKDWL+ YETLT+Y
Sbjct  179  EHLVTVLAVVPKYSQKDWLSCYETLTNY  206



>ref|XP_010554130.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Tarenaya 
hassleriana]
Length=426

 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 188/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWV SLPV+ S  A+SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LL LSDD
Sbjct  50   MASRYWVASLPVKDS--ASSLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLTLSDD  107

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SG  S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  108  LLKSNSFVEGVSHKIRRQIEELERVSGAESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  167

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD V +QV KIEDDLKVR AEY+N+RSQLNAINRKQ+GSLAVRDLS+LVKPED++TS
Sbjct  168  KEIVDSVQTQVMKIEDDLKVRSAEYNNIRSQLNAINRKQSGSLAVRDLSSLVKPEDIVTS  227

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL T+LAVV K+SQKDWL+ YETLT+Y
Sbjct  228  EHLVTVLAVVPKYSQKDWLSCYETLTNY  255



>ref|XP_004977299.1| PREDICTED: V-type proton ATPase subunit C-like [Setaria italica]
Length=377

 Score =   320 bits (820),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 190/209 (91%), Gaps = 1/209 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  255
            MA+RYW+VSLPVQ   ++A+S+WSRLQD+IS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQSPGATASSIWSRLQDNISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  256  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  435
            DLVKSN F+EGV  KIRRQIE+LERA GV S +LTVDGVPVD+YLTRFVWDE +YPTMSP
Sbjct  61   DLVKSNIFVEGVSHKIRRQIEDLERAGGVESGALTVDGVPVDTYLTRFVWDEGRYPTMSP  120

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            LKE V  + SQVAKIEDD+KVR AEY+NVRSQL+AINRKQ+GSLAVRDLSNLVKPED+IT
Sbjct  121  LKEIVGSIQSQVAKIEDDMKVRAAEYNNVRSQLSAINRKQSGSLAVRDLSNLVKPEDMIT  180

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SEHL TLLA+V K+SQKDW++SYE+L ++
Sbjct  181  SEHLVTLLAIVPKYSQKDWMSSYESLDTF  209



>gb|KGN50885.1| hypothetical protein Csa_5G312840 [Cucumis sativus]
Length=370

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 186/202 (92%), Gaps = 2/202 (1%)
 Frame = +1

Query  97   VVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVKSNN  276
            +VSLPVQ   SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDDL+KSN 
Sbjct  1    MVSLPVQ--GSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDDLLKSNT  58

Query  277  FIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKETVDG  456
            F+EGV  KIRRQIEELE+ SGV S+ LTVDGVPVDSYLTRFVWDEAKYPTMSPL++ VD 
Sbjct  59   FVEGVSQKIRRQIEELEKVSGVESNVLTVDGVPVDSYLTRFVWDEAKYPTMSPLRDIVDS  118

Query  457  VHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEHLTTL  636
            +HSQVAKIEDDLK+RVAEY+NVRSQLNAINRKQ+GSLAVRD+SNLVKPED+ITSEHL TL
Sbjct  119  IHSQVAKIEDDLKIRVAEYNNVRSQLNAINRKQSGSLAVRDISNLVKPEDIITSEHLATL  178

Query  637  LAVVSKFSQKDWLASYETLTSY  702
            L ++ K+SQK+WL+SYETLTSY
Sbjct  179  LVIIPKYSQKEWLSSYETLTSY  200



>ref|XP_002441755.1| hypothetical protein SORBIDRAFT_08g001880 [Sorghum bicolor]
 gb|EES15593.1| hypothetical protein SORBIDRAFT_08g001880 [Sorghum bicolor]
Length=377

 Score =   320 bits (819),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 189/209 (90%), Gaps = 1/209 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  255
            MA+RYW+VSLPVQ   ++ATSLW RLQD+IS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQSPGATATSLWPRLQDAISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  256  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  435
            DLVKSN F+EGV  KIRRQIE+LERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMSP
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEDLERAGGVDSGALTVDGVPVDTYLTRFVWDEGKYPTMSP  120

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            LKE V  + +QVAKIEDD+KVR AEY+NVRSQL+AINRKQ+GSLAVRDLSNLVKPED+++
Sbjct  121  LKEIVGSIQTQVAKIEDDMKVRAAEYNNVRSQLSAINRKQSGSLAVRDLSNLVKPEDMVS  180

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SEHL TLLA+V K+SQKDWL+SYE+L ++
Sbjct  181  SEHLVTLLAIVPKYSQKDWLSSYESLDTF  209



>ref|XP_010476263.1| PREDICTED: V-type proton ATPase subunit C-like [Camelina sativa]
Length=375

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 183/208 (88%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+   SA+SLW RLQD ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVK--DSASSLWQRLQDQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER S V S++LTVDGVPVDSYLTRF+WDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISEVESNALTVDGVPVDSYLTRFMWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLSNLVKPED++ S
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVKPEDIVAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQK+W  SYE  T Y
Sbjct  179  EHLVTLLAVVPKYSQKEWKDSYEKFTEY  206



>ref|XP_009386009.1| PREDICTED: V-type proton ATPase subunit C-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 184/205 (90%), Gaps = 2/205 (1%)
 Frame = +1

Query  88   RYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVK  267
            RYW+VSLPV  S+SAT  W+RL+ SISKNSFDTPLYRF +P+LRVGTLD LLALSDDLVK
Sbjct  6    RYWIVSLPVHTSASAT--WNRLRQSISKNSFDTPLYRFTMPDLRVGTLDSLLALSDDLVK  63

Query  268  SNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKET  447
            SN FIEGV  KIRRQIEELE+ASGV   +LTVDGVP+DSYLTRFVWDE KYPTMSPL+E 
Sbjct  64   SNAFIEGVTHKIRRQIEELEKASGVEVGALTVDGVPIDSYLTRFVWDEGKYPTMSPLREL  123

Query  448  VDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEHL  627
            VD +H QVAKIEDD+KVRVAEYSN+RSQLNAINRKQ+GSLAVRD+SNLV PED++ SEHL
Sbjct  124  VDSIHVQVAKIEDDMKVRVAEYSNIRSQLNAINRKQSGSLAVRDISNLVNPEDIVASEHL  183

Query  628  TTLLAVVSKFSQKDWLASYETLTSY  702
             TLLAVV K+SQKDWL+SYETLT++
Sbjct  184  VTLLAVVPKYSQKDWLSSYETLTTF  208



>ref|XP_006844509.1| PREDICTED: V-type proton ATPase subunit C [Amborella trichopoda]
 gb|ERN06184.1| hypothetical protein AMTR_s00016p00139220 [Amborella trichopoda]
Length=374

 Score =   318 bits (814),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 194/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYWV+SLPV+  +SA+SLWSRL++SIS+++FDTPLYRFNIP+LRVGTLD LLALSDD
Sbjct  1    MATRYWVISLPVE--NSASSLWSRLRESISRHAFDTPLYRFNIPDLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVKSN+F+EGV  K+RRQIEELER+SGV + +LTVDGVPVDSY+TRFVWDEAKYPTMSPL
Sbjct  59   LVKSNSFVEGVSHKLRRQIEELERSSGVETGTLTVDGVPVDSYITRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VD + + V++IEDDLKVRVAE++NVRSQLNAI RKQ+GSLAVRDLS++VKPED+ITS
Sbjct  119  REIVDNILAHVSRIEDDLKVRVAEFNNVRSQLNAIKRKQSGSLAVRDLSDIVKPEDIITS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLA+V K+SQKDWL+SYETLT++
Sbjct  179  EHLVTLLAIVPKYSQKDWLSSYETLTTF  206



>emb|CDY26596.1| BnaA09g46810D [Brassica napus]
Length=614

 Score =   325 bits (834),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 188/208 (90%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M SRYWVVSLPV+ SSS  +LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKDSSS--TLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KE V+ + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLS+LVKPED++ S
Sbjct  119  KEVVENIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSSLVKPEDIVAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWLA YETLT +
Sbjct  179  EHLETLLAVVPKYSQKDWLACYETLTDF  206



>ref|NP_001142247.1| uncharacterized protein LOC100274416 [Zea mays]
 gb|ACF87983.1| unknown [Zea mays]
 tpg|DAA59220.1| TPA: hypothetical protein ZEAMMB73_061434 [Zea mays]
Length=377

 Score =   318 bits (814),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 186/209 (89%), Gaps = 1/209 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  255
            MA+RYW+VSLPVQ   ++ATSLWSRLQD IS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQSPGATATSLWSRLQDGISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  256  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  435
            DLVKSN F+EGV  KIRRQIE+LERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMS 
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEDLERAGGVDSGALTVDGVPVDTYLTRFVWDEGKYPTMSS  120

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            LKE V  + SQVAKIEDD+KVR AEY+NVRSQL AINRKQ+GSLAVRDLSNLVKPED++ 
Sbjct  121  LKEIVGSIQSQVAKIEDDMKVRAAEYNNVRSQLTAINRKQSGSLAVRDLSNLVKPEDMVC  180

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SEHL TLLA+V K+SQKDWL+SYE+L ++
Sbjct  181  SEHLVTLLAIVPKYSQKDWLSSYESLDTF  209



>ref|XP_008654564.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF85084.1| unknown [Zea mays]
 gb|ACG35170.1| vacuolar ATP synthase subunit C [Zea mays]
 gb|AFW81320.1| Vacuolar ATP synthase subunit C [Zea mays]
Length=377

 Score =   316 bits (809),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 188/209 (90%), Gaps = 1/209 (0%)
 Frame = +1

Query  79   MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  255
            MA+RY +VSLPVQ   ++A+SLWSRLQDSIS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYLIVSLPVQSPGATASSLWSRLQDSISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  256  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  435
            DLVKSN F+EGV  KIRRQIE+LERA GV + +LTVDGVPVD+YLTRFVWDE KYPTMSP
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEDLERAGGVETGTLTVDGVPVDTYLTRFVWDEGKYPTMSP  120

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            LKE V  + SQVAKIEDD+KVR +EY+NVRSQL+AINRKQ+GSLAVRDLSNLVKPED+IT
Sbjct  121  LKEIVGSIQSQVAKIEDDMKVRASEYNNVRSQLSAINRKQSGSLAVRDLSNLVKPEDMIT  180

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SEHL TLLA+V K+SQKDWL+SYE + ++
Sbjct  181  SEHLVTLLAIVPKYSQKDWLSSYEKIDTF  209



>ref|XP_009395792.1| PREDICTED: V-type proton ATPase subunit C-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   315 bits (806),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 183/208 (88%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MA+RYW+ SLPV  S+SA   W+RL++SISKNSFDT LYRFN P+LRVGTLD LLALSDD
Sbjct  1    MATRYWIASLPVHTSASAH--WNRLRESISKNSFDTLLYRFNTPDLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVKSN FIEGV  KIRRQIEELE+ASGV   +LTVDGVPVDSYLTRF WDE KYPTMSPL
Sbjct  59   LVKSNAFIEGVTHKIRRQIEELEKASGVEVGALTVDGVPVDSYLTRFDWDEGKYPTMSPL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VD +H QVAKIEDD+KVR AEYSN+RSQLNAINRKQ+GSLAVRDLSNLV PED++ S
Sbjct  119  REIVDSIHVQVAKIEDDMKVRAAEYSNIRSQLNAINRKQSGSLAVRDLSNLVNPEDIVAS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT++
Sbjct  179  EHLVTLLAVVPKYSQKDWLSSYETLTTF  206



>ref|XP_003567787.1| PREDICTED: V-type proton ATPase subunit C [Brachypodium distachyon]
 gb|ACU01766.1| vacuolar ATP synthetase subunit C [Brachypodium distachyon]
Length=382

 Score =   314 bits (804),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 186/213 (87%), Gaps = 5/213 (2%)
 Frame = +1

Query  79   MASRYWVVSLPVQ-----QSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlll  243
            MA+RYW+ SLPVQ      SS+ ++LW+RLQDSIS++SFDTPLYRFN+P+LR GTLD LL
Sbjct  1    MATRYWIASLPVQSAGGGDSSAKSALWARLQDSISRHSFDTPLYRFNVPDLRPGTLDSLL  60

Query  244  alsddlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYP  423
            ALSDDLVKSN FIEGV  KIRRQ+E+LERA GV   +LTVDGVPVDSYLTRFVWDE KYP
Sbjct  61   ALSDDLVKSNIFIEGVSHKIRRQVEDLERAGGVEGGALTVDGVPVDSYLTRFVWDEGKYP  120

Query  424  TMSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPE  603
               PLKETV  + SQVAKIEDD+KVRVAEY+NV+SQL+AINRKQTGSLAVRDLSNL+KPE
Sbjct  121  PHGPLKETVASIQSQVAKIEDDMKVRVAEYTNVKSQLSAINRKQTGSLAVRDLSNLIKPE  180

Query  604  DLITSEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            D++TSEHL TLLA+V K+SQKDWLASYE+L ++
Sbjct  181  DMVTSEHLVTLLAIVPKYSQKDWLASYESLDTF  213



>ref|XP_010250562.1| PREDICTED: V-type proton ATPase subunit C [Nelumbo nucifera]
Length=376

 Score =   310 bits (793),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 182/204 (89%), Gaps = 2/204 (1%)
 Frame = +1

Query  91   YWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVKS  270
            YWVVSLPVQ  +SA+SLW+RL++ ISK+SFDT +YRFN P+LRVGTLD LL+LSDDL+KS
Sbjct  7    YWVVSLPVQ--ASASSLWTRLREEISKHSFDTLVYRFNTPDLRVGTLDSLLSLSDDLLKS  64

Query  271  NNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKETV  450
            N+F+EGV  KIRRQIEELER SGV   +L VDGVP+DSYLTRFVWDE KYPTMSPL+E V
Sbjct  65   NSFVEGVSHKIRRQIEELERTSGVEGGALRVDGVPIDSYLTRFVWDETKYPTMSPLQEIV  124

Query  451  DGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEHLT  630
            D +H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ GSLAVRDLSNL KPED+IT+EHL 
Sbjct  125  DSIHVQVAKIEDDLKVRVAEYNNVRSQLNAINRKQGGSLAVRDLSNLAKPEDIITTEHLV  184

Query  631  TLLAVVSKFSQKDWLASYETLTSY  702
            TLLA+V K+SQKDWL+SYE LT+Y
Sbjct  185  TLLAIVPKYSQKDWLSSYEKLTNY  208



>sp|Q9SCB9.1|VATC_HORVU RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar proton pump subunit C [Hordeum 
vulgare]
 emb|CAB65127.1| vacuolar H+-ATPase subunit C [Hordeum vulgare subsp. vulgare]
Length=354

 Score =   306 bits (784),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 182/211 (86%), Gaps = 3/211 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSA---TSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllal  249
            MA+RYW+ +LPV   + A   T+LW+RLQ++IS++SFDTPLYRF +P+LR GTLD LLAL
Sbjct  1    MATRYWIAALPVADDNVAAGKTALWARLQEAISRHSFDTPLYRFTVPDLRPGTLDSLLAL  60

Query  250  sddlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTM  429
            SDDLVKSN FIEGV  KIRRQIE+LERA GV   +LTVDGVPVDSYLTRFVWDE KYP  
Sbjct  61   SDDLVKSNIFIEGVSHKIRRQIEDLERAGGVEPGTLTVDGVPVDSYLTRFVWDEGKYPVN  120

Query  430  SPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDL  609
            +PLKETV  + SQVAKIEDD+KVRVAEY NV+SQL AINRKQTGSLAVRDLSNL+KPED+
Sbjct  121  APLKETVASIQSQVAKIEDDMKVRVAEYGNVKSQLGAINRKQTGSLAVRDLSNLIKPEDM  180

Query  610  ITSEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            +TSEHL TLL++V K+SQKDWLASYE+L ++
Sbjct  181  VTSEHLVTLLSIVPKYSQKDWLASYESLDTF  211



>gb|KJB76316.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=352

 Score =   306 bits (783),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 171/208 (82%), Gaps = 25/208 (12%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  +SA++LW+ LQD ISK+SFDTPLYR                    
Sbjct  1    MASRYWVVSLPVQ--NSASTLWNNLQDQISKHSFDTPLYR--------------------  38

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
               SN FIEGV  KIRRQIEELER SG+  ++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  39   ---SNTFIEGVSHKIRRQIEELERVSGLEINALTVDGVPVDSYLTRFVWDEAKYPTMSPL  95

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            +E VDG+H+QVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  96   REIVDGIHTQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVKPEDIITS  155

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  156  EHLVTLLAVVPKYSQKDWLSSYETLTTY  183



>gb|ABG23314.1| vacuolar proton-ATPase C subunit [Triticum aestivum]
Length=380

 Score =   305 bits (782),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 182/211 (86%), Gaps = 3/211 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSA---TSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllal  249
            MA+RYW+ +LPV   + A   T+LW+RLQD+IS++SFDTPLYRF +P+LR GTLD LLAL
Sbjct  1    MATRYWIAALPVADDNVAAGKTALWARLQDAISRHSFDTPLYRFTVPDLRPGTLDSLLAL  60

Query  250  sddlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTM  429
            SDDLVKSN FIEGV  KIRRQIE+LERA GV   +LTVDGVPVDSYLTRFVWDE KYP  
Sbjct  61   SDDLVKSNIFIEGVSHKIRRQIEDLERAGGVEPGTLTVDGVPVDSYLTRFVWDEGKYPVN  120

Query  430  SPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDL  609
            +PLKETV  + SQVAKIEDD+KVRVAEY NV+SQL AINRKQTGSLAVRDLSNL+KPED+
Sbjct  121  APLKETVASIQSQVAKIEDDMKVRVAEYGNVKSQLGAINRKQTGSLAVRDLSNLIKPEDM  180

Query  610  ITSEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            +TSEHL TLL++V K+SQKDWL+SYE+L ++
Sbjct  181  VTSEHLVTLLSIVPKYSQKDWLSSYESLDTF  211



>gb|ACT34062.1| vacuolar ATP synthetase subunit C [Aegilops tauschii]
Length=380

 Score =   305 bits (781),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 182/211 (86%), Gaps = 3/211 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSA---TSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllal  249
            MA+RYW+ +LPV   + A   T+LW+RLQD+IS++SFDTPLYRF +P+LR GTLD LLAL
Sbjct  1    MATRYWIAALPVADDNVAAGKTALWARLQDAISRHSFDTPLYRFTVPDLRPGTLDSLLAL  60

Query  250  sddlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTM  429
            SDDLVKSN FIEGV  KIRRQIE+LERA GV   +LTVDGVPVDSYLTRFVWDE KYP  
Sbjct  61   SDDLVKSNIFIEGVSHKIRRQIEDLERAGGVEPGTLTVDGVPVDSYLTRFVWDEGKYPVN  120

Query  430  SPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDL  609
            +PLKETV  + SQVAKIEDD+KVRVAEY NV+SQL AINRKQTGSLAVRDLSNL+KPED+
Sbjct  121  APLKETVASIQSQVAKIEDDMKVRVAEYGNVKSQLGAINRKQTGSLAVRDLSNLIKPEDM  180

Query  610  ITSEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            +TSEHL TLL++V K+SQKDWL+SYE+L ++
Sbjct  181  VTSEHLVTLLSIVPKYSQKDWLSSYESLDTF  211



>gb|ADE77882.1| unknown [Picea sitchensis]
Length=379

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 177/206 (86%), Gaps = 2/206 (1%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            SRY +VSLPVQ  +SATS W  LQD I K++FDT  YR NIP+LRVGTLD LLALSDDL 
Sbjct  6    SRYCLVSLPVQ--NSATSTWHLLQDGIFKSAFDTSTYRLNIPDLRVGTLDSLLALSDDLN  63

Query  265  KSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKE  444
            K+N+F+E V  KIRRQIEELE+ASGV S  LTV GVPVDSY+TRF WDEAKYP MSPL+E
Sbjct  64   KANSFVEAVTHKIRRQIEELEKASGVESGVLTVHGVPVDSYITRFTWDEAKYPVMSPLRE  123

Query  445  TVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEH  624
             VD +H  V K+ED LKVRVAEY+NV+SQLNAINRKQ+GS+AVRDLSNLV+ ED+I+SEH
Sbjct  124  LVDAIHDGVGKLEDALKVRVAEYNNVKSQLNAINRKQSGSMAVRDLSNLVRAEDIISSEH  183

Query  625  LTTLLAVVSKFSQKDWLASYETLTSY  702
            LTTLLAVVSK+SQKDWL+SYETL+++
Sbjct  184  LTTLLAVVSKYSQKDWLSSYETLSTF  209



>ref|XP_002980160.1| hypothetical protein SELMODRAFT_111716 [Selaginella moellendorffii]
 ref|XP_002992900.1| hypothetical protein SELMODRAFT_187073 [Selaginella moellendorffii]
 gb|EFJ05989.1| hypothetical protein SELMODRAFT_187073 [Selaginella moellendorffii]
 gb|EFJ19030.1| hypothetical protein SELMODRAFT_111716 [Selaginella moellendorffii]
Length=380

 Score =   266 bits (680),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 171/206 (83%), Gaps = 2/206 (1%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            +RY +VSLPV +S++AT  W+ LQ  IS+ +FDTP Y+FNIP LR+GTLD L+ LSDDLV
Sbjct  6    TRYCLVSLPVLESAAAT--WAALQQGISRVAFDTPTYKFNIPELRIGTLDALMVLSDDLV  63

Query  265  KSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKE  444
            K N  +EGV  KIRRQIE+L+  +GV +S+LTVDGVPVD+Y+T+F WDEAKYP M+PL+E
Sbjct  64   KINGVVEGVTHKIRRQIEDLDHHAGVEASALTVDGVPVDTYITKFTWDEAKYPLMNPLRE  123

Query  445  TVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEH  624
            T D +   V+K EDDLK+RVAEY+NV++QL+AINR+QTGS+A RD+SNLVKP D+I++EH
Sbjct  124  TADMIQDNVSKHEDDLKIRVAEYTNVKTQLSAINRRQTGSMAARDISNLVKPSDVISTEH  183

Query  625  LTTLLAVVSKFSQKDWLASYETLTSY  702
            L TL+ VVSKFSQ +WL SYE+LT +
Sbjct  184  LVTLVVVVSKFSQNEWLKSYESLTDF  209



>ref|XP_001773067.1| predicted protein [Physcomitrella patens]
 gb|EDQ62107.1| predicted protein [Physcomitrella patens]
Length=379

 Score =   259 bits (662),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 171/207 (83%), Gaps = 3/207 (1%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            ++Y +VSLP+Q SS+ T  W  LQ  +S+ +FDTP Y+F+IP LRVGTLD LL LSDDL 
Sbjct  4    NKYLLVSLPLQGSSNQT--WESLQSGVSRAAFDTPTYKFHIPELRVGTLDSLLTLSDDLT  61

Query  265  KSNNFIEGVCSKIRRQIEELERASGV-ASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K+N  +E V  K+RRQI++LERAS    SS+L+VDGVP+DSY+TRF WDEAKYPTM+PL+
Sbjct  62   KANQVVETVTQKVRRQIDDLERASNSDNSSALSVDGVPIDSYITRFSWDEAKYPTMTPLR  121

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSE  621
            E VD +   V+K+EDDLKVRV+EYSNV++QL  + RKQ GS+AVRDLSN+VKPED++ +E
Sbjct  122  EIVDTIQESVSKLEDDLKVRVSEYSNVKTQLTTMLRKQGGSMAVRDLSNVVKPEDIVNTE  181

Query  622  HLTTLLAVVSKFSQKDWLASYETLTSY  702
            HLTTLL VVSK+SQKDWLASYETL+++
Sbjct  182  HLTTLLVVVSKYSQKDWLASYETLSTF  208



>gb|KHG11234.1| V-type proton ATPase subunit C -like protein [Gossypium arboreum]
Length=328

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 155/208 (75%), Gaps = 42/208 (20%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            MASRYWVVSLPVQ  SSA++LW+ LQD ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--SSASTLWNNLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            L+KSN FIEGV  KIRRQIEELER SG+ +++LTVDGVP                     
Sbjct  59   LLKSNTFIEGVSHKIRRQIEELERVSGLETNALTVDGVP---------------------  97

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
                               VRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVKPED+ITS
Sbjct  98   -------------------VRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVKPEDIITS  138

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            EHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  139  EHLVTLLAVVPKYSQKDWLSSYETLTTY  166



>gb|EMS67397.1| V-type proton ATPase subunit C [Triticum urartu]
Length=374

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 147/189 (78%), Gaps = 21/189 (11%)
 Frame = +1

Query  199  FNIPNLRVGTldlllalsddlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPV  378
            F +P+LR GTLD LLALSDDLVKSN FIEGV  KIRRQIE+LERA GV   +LTVDGVPV
Sbjct  17   FTVPDLRPGTLDSLLALSDDLVKSNIFIEGVSHKIRRQIEDLERAGGVEPGTLTVDGVPV  76

Query  379  DSYLTRFVWDEAKYPTMSPLKETVDGVHSQVAKIEDDLK---------------------  495
            DSYLTRFVWDE KYP  +PLKETV  + SQVAKIEDD+K                     
Sbjct  77   DSYLTRFVWDEGKYPVNAPLKETVASIQSQVAKIEDDMKMQISVLVGCYIYRRTEYALFQ  136

Query  496  VRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEHLTTLLAVVSKFSQKDWL  675
            VRVAEY NV+SQL AINRKQTGSLAVRDLSNL+KPED++TSEHL TLL++V K+SQKDWL
Sbjct  137  VRVAEYGNVKSQLGAINRKQTGSLAVRDLSNLIKPEDMVTSEHLVTLLSIVPKYSQKDWL  196

Query  676  ASYETLTSY  702
            +SYE+L ++
Sbjct  197  SSYESLDTF  205



>gb|EMT09400.1| V-type proton ATPase subunit C [Aegilops tauschii]
Length=377

 Score =   228 bits (580),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 166/215 (77%), Gaps = 7/215 (3%)
 Frame = +1

Query  79   MASRYWVVSLPVQQS-----SSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlll  243
            M ++Y + +LPVQ +     ++  SLW  L+DS+S+++ DTPLYRF +P L+ GTLD LL
Sbjct  1    MPTKYLIAALPVQSAGGDPAAAENSLWRSLEDSLSQHAIDTPLYRFTVPALKGGTLDSLL  60

Query  244  alsddlVKSNNFIEGVCSKIRRQIEELERASGVAS--SSLTVDGVPVDSYLTRFVWDEAK  417
            ALSDDL++SN FIEG   +IRRQIE+LERA G     S +TVDGVPVDSYL+RFVWDE K
Sbjct  61   ALSDDLIRSNLFIEGASHRIRRQIEDLERAGGAGEGGSLITVDGVPVDSYLSRFVWDERK  120

Query  418  YPTMSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  597
            YPT SPLK+ +  + S++ KIED++KV+ A+Y++ ++ L  + RKQ+ SL VRDLSNLVK
Sbjct  121  YPTKSPLKDIIASILSRITKIEDEIKVQAAKYNSCKNHLRTVYRKQSVSLVVRDLSNLVK  180

Query  598  PEDLITSEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            PED+ITSEHL TLLA+V K SQKDWL+ YE+L ++
Sbjct  181  PEDIITSEHLATLLAIVPKCSQKDWLSCYESLDTF  215



>gb|AGJ98217.1| DET3, partial [Petunia x hybrida]
Length=268

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  313  IEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKETVDGVHSQVAKIEDDL  492
            IEELER SGV SSSLTVDGVPVDSYLTRF WDEAKYP MSPLKE VDG+H+QVAKIEDDL
Sbjct  10   IEELERVSGVLSSSLTVDGVPVDSYLTRFAWDEAKYPKMSPLKEIVDGIHTQVAKIEDDL  69

Query  493  KVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEHLTTLLAVVSKFSQKDW  672
            KVRV+EY+NVRSQLNAI RKQTGSLAVRDLSNL KP D+++SEHLTTLLAVVSK++QKD 
Sbjct  70   KVRVSEYNNVRSQLNAIIRKQTGSLAVRDLSNLGKPRDIVSSEHLTTLLAVVSKYTQKDC  129

Query  673  LASYETLTSY  702
            L+SY+TLT++
Sbjct  130  LSSYKTLTAF  139



>ref|XP_001756840.1| predicted protein [Physcomitrella patens]
 gb|EDQ78437.1| predicted protein [Physcomitrella patens]
Length=395

 Score =   197 bits (501),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 150/206 (73%), Gaps = 2/206 (1%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            +R  +VSLP+  + +AT  W+ LQ  IS+ SFDTP YRF IPNLRVGTL+ LL L D+L 
Sbjct  2    TRLILVSLPLCGTVAAT--WASLQQRISEVSFDTPTYRFQIPNLRVGTLNSLLTLGDELA  59

Query  265  KSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKE  444
            K  +F+E V  K+RRQIE+LE+ +   S+SL+V GVPV+ ++TRF W+ AKYPT +PLK+
Sbjct  60   KFGSFVESVAMKVRRQIEDLEKTTSSVSTSLSVHGVPVEIFVTRFGWNLAKYPTETPLKD  119

Query  445  TVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEH  624
            T   +   V+K+++DLKVR +EYS V+SQL    RKQ GSL+ RDL+ LV+ ED+I +EH
Sbjct  120  TTAIIQGAVSKLDEDLKVRASEYSAVKSQLGTTLRKQMGSLSGRDLTTLVRDEDIINTEH  179

Query  625  LTTLLAVVSKFSQKDWLASYETLTSY  702
            +TTL  VV K +Q++W+ +YE L  Y
Sbjct  180  MTTLAVVVPKAAQQEWMLNYEKLCDY  205



>ref|XP_001696429.1| vacuolar H+ ATPase V1 sector, subunit C [Chlamydomonas reinhardtii]
 gb|EDP08406.1| vacuolar H+ ATPase V1 sector, subunit C [Chlamydomonas reinhardtii]
Length=373

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 140/204 (69%), Gaps = 4/204 (2%)
 Frame = +1

Query  91   YWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVKS  270
            YW+VSL +  +    + W  LQ+  S  +  +  Y+  IP+LRVGTLD L+ALSD+L K+
Sbjct  3    YWLVSLQLP-NKRKDACWELLQEKTSAAALGSN-YKLEIPDLRVGTLDSLMALSDELSKT  60

Query  271  NNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKETV  450
            +  +E V +K++RQ+ +   A G+    L V+G+  +SY+ RF WDEAK+P   PLKETV
Sbjct  61   STMMEAVVNKVKRQVNDAAGAKGLVG--LKVEGMSTESYVQRFKWDEAKFPARRPLKETV  118

Query  451  DGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEHLT  630
            D +   V++IEDDLKV+ +EY+N++SQLN I RK  GSLAVRD+S LVKP  +I +EHLT
Sbjct  119  DRMQELVSRIEDDLKVKASEYNNLKSQLNQITRKAQGSLAVRDVSTLVKPAQVIDTEHLT  178

Query  631  TLLAVVSKFSQKDWLASYETLTSY  702
            TL  ++SKFS K+W   YE + ++
Sbjct  179  TLFVIISKFSLKEWEEGYEKMCNF  202



>gb|ABE96876.1| putative vacuolar ATP synthase subunit C [Triticum monococcum]
Length=131

 Score =   169 bits (427),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +1

Query  394  RFVWDEAKYPTMSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAV  573
            RFVWDE KYP  +PLKETV  + SQVAKIEDD+KVRVAEY NV+SQL AINRKQTGSLAV
Sbjct  1    RFVWDEGKYPVNAPLKETVASIQSQVAKIEDDMKVRVAEYGNVKSQLGAINRKQTGSLAV  60

Query  574  RDLSNLVKPEDLITSEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            RDLSNL+KPED++TSEHL TLL++V K+SQKDWL+SYE+  ++
Sbjct  61   RDLSNLIKPEDMVTSEHLVTLLSIVPKYSQKDWLSSYESPDTF  103



>gb|ADI46924.1| ATPvC1m [Volvox carteri f. nagariensis]
Length=376

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 139/205 (68%), Gaps = 6/205 (3%)
 Frame = +1

Query  91   YWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVKS  270
            YW+VSL + +     ++W  LQ+  S +   T  ++ ++P LR+GTLD LLALSD+L KS
Sbjct  3    YWLVSLKLHEKRK-DAVWELLQERTSASMLCTT-HKLDVPELRIGTLDSLLALSDELSKS  60

Query  271  NNFIEGVCSKIRRQIEELERASGV-ASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKET  447
            +N IE V +K+RRQI E   + GV A + LTV+G+  D Y+ RF WDEA++PT   LKE 
Sbjct  61   SNTIEAVLAKVRRQINE---SGGVKALAGLTVEGMSTDVYVQRFRWDEARFPTRRVLKEM  117

Query  448  VDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEHL  627
            VD +   V ++EDDLKV+ +EY+N++SQL+   RK  GSLAVRD+S +VKP  +I +EHL
Sbjct  118  VDKMTDLVIRVEDDLKVKASEYNNIKSQLSQATRKAQGSLAVRDISTVVKPHHIIDTEHL  177

Query  628  TTLLAVVSKFSQKDWLASYETLTSY  702
             TL  VVSKFS KDW   Y  L ++
Sbjct  178  VTLFVVVSKFSMKDWEDCYANLANF  202



>ref|XP_005651974.1| vacuolar H+ ATPase V1 sector, subunit C [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27430.1| vacuolar H+ ATPase V1 sector, subunit C [Coccomyxa subellipsoidea 
C-169]
Length=372

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 139/204 (68%), Gaps = 2/204 (1%)
 Frame = +1

Query  91   YWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVKS  270
            YW+VSLP+ +S   +  W+ +Q+  +  +  +  ++F IP+LRVGTLD L+ LSDDLVK 
Sbjct  2    YWLVSLPLLESEDRS--WTLVQNKTTYENDYSINFKFAIPDLRVGTLDSLMVLSDDLVKV  59

Query  271  NNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKETV  450
            N  +E V +KIRRQ+ ++          ++V+GV  D YL RF W+EAKYP   PL ETV
Sbjct  60   NALVESVVNKIRRQLFDMGSGRAEDFQEVSVEGVSPDQYLERFSWNEAKYPPRRPLSETV  119

Query  451  DGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEHLT  630
              +   + ++EDDLKVR++EY+ ++  + A  RKQTGSLAVRDL+ LVK +D + +E+L 
Sbjct  120  SAITETIQRLEDDLKVRMSEYNQLKGLVTAAARKQTGSLAVRDLTGLVKADDAVNTENLI  179

Query  631  TLLAVVSKFSQKDWLASYETLTSY  702
            TL AVV+K  + +WL++YETL+ +
Sbjct  180  TLFAVVTKQDKSEWLSTYETLSDF  203



>ref|XP_002503957.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
 gb|ACO65215.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
Length=375

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 138/210 (66%), Gaps = 8/210 (4%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M + +W+V+LP++   SA + W+ LQ   S+     P   FN+P LRVGTLD LLALSDD
Sbjct  1    MDTTFWLVALPLE-GGSAENTWNTLQQKTSRGR--VP---FNLPELRVGTLDSLLALSDD  54

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGV--ASSSLTVDGVPVDSYLTRFVWDEAKYPTMS  432
            LVK ++ + G   KIRR I E   A G    ++ L VDG+  + +LT F WDEAK+P   
Sbjct  55   LVKVSSLVAGTTQKIRRHIMESASAEGENEVNAELVVDGISAERFLTAFTWDEAKHPARR  114

Query  433  PLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI  612
            PL+ET++ +   VAKIEDD +V+  + ++ ++QL A++RK  GSLA RDL  +V+  DL+
Sbjct  115  PLRETMERLQESVAKIEDDFRVKTGDLASAKTQLGALSRKAAGSLATRDLGEIVQDSDLV  174

Query  613  TSEHLTTLLAVVSKFSQKDWLASYETLTSY  702
             +E+LTTL   V K++QK+WL +YETL  +
Sbjct  175  NTENLTTLCVAVPKYNQKEWLDTYETLAQF  204



>gb|KJB40644.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=261

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  427  MSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPED  606
            MSPL+E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSN+VKPED
Sbjct  1    MSPLREIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNMVKPED  60

Query  607  LITSEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            +ITSEHL TLLAVV K+SQKDWL+SYETLT+Y
Sbjct  61   IITSEHLVTLLAVVPKYSQKDWLSSYETLTTY  92



>ref|XP_002954527.1| vacuolar ATP synthase, subunit C [Volvox carteri f. nagariensis]
 gb|ADI46857.1| ATPvC1f [Volvox carteri f. nagariensis]
 gb|EFJ44420.1| vacuolar ATP synthase, subunit C [Volvox carteri f. nagariensis]
Length=376

 Score =   165 bits (417),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 140/204 (69%), Gaps = 4/204 (2%)
 Frame = +1

Query  91   YWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVKS  270
            YW+VSL +  +    ++W  LQ+  S +   T  ++ +IP LRVGTLD L+ALSD+L KS
Sbjct  3    YWLVSLQLH-NKRKDAVWELLQERTSASMLCTN-FKLDIPGLRVGTLDSLMALSDELSKS  60

Query  271  NNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKETV  450
            +  IE V +K++RQ+ E   A  +A+  LTV+GV  D Y+ RF WD+AK+PT   LK+ V
Sbjct  61   STMIEAVLAKVKRQVNESGGAKAMAA--LTVEGVSTDLYVQRFHWDDAKFPTRRLLKDMV  118

Query  451  DGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEHLT  630
            D +   V++I+DDLKV+V+E +N++SQ++ + RK  GSLAVRD++ +VKP  +I +EHL 
Sbjct  119  DKITELVSRIDDDLKVKVSELNNLKSQMSQVTRKAQGSLAVRDVATVVKPHHIIDTEHLA  178

Query  631  TLLAVVSKFSQKDWLASYETLTSY  702
            T+  VVSKF+ +DW  SY  + ++
Sbjct  179  TVFVVVSKFALRDWEDSYTKMANF  202



>dbj|BAE98945.1| vacuolar ATP sythase subunit C [Arabidopsis thaliana]
Length=263

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  424  TMSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPE  603
            TMSPLKE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLSNLVKPE
Sbjct  2    TMSPLKEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVKPE  61

Query  604  DLITSEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            D++ SEHL TLLAVV K+SQKDWL  YETLT Y
Sbjct  62   DIVESEHLVTLLAVVPKYSQKDWLECYETLTDY  94



>ref|XP_005847214.1| hypothetical protein CHLNCDRAFT_35880 [Chlorella variabilis]
 gb|EFN55112.1| hypothetical protein CHLNCDRAFT_35880 [Chlorella variabilis]
Length=367

 Score =   162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 136/206 (66%), Gaps = 4/206 (2%)
 Frame = +1

Query  91   YWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIP-NLRVGTldlllalsddlVK  267
            YW+VSLP      A   W+RLQ++ +  +  +  ++F +P + RVGTLD LLALSDDL K
Sbjct  2    YWLVSLP--HDGGADQAWTRLQEATTYTNDYSSNFKFALPESFRVGTLDSLLALSDDLAK  59

Query  268  SNNFIEGVCSKIRRQIEELERASGVAS-SSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKE  444
             N  +EG  +K+RRQ+ EL+ +      + + V+    + YL RF W+EAKYP+  PLKE
Sbjct  60   VNQAVEGTVNKVRRQLMELQASVAPEDRADVWVETQTPEGYLQRFAWNEAKYPSRRPLKE  119

Query  445  TVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEH  624
             V  +   V K++DDLKV+V E+  +RS L A  RKQ GSLAVRD+S+LV P  L+ +E+
Sbjct  120  IVASIMDNVQKLDDDLKVKVTEFGQLRSTLQAAARKQGGSLAVRDVSSLVPPSQLVYTEN  179

Query  625  LTTLLAVVSKFSQKDWLASYETLTSY  702
            LTTLL VV K ++ DWLA YE+L+ +
Sbjct  180  LTTLLVVVPKSAKGDWLAQYESLSEF  205



>gb|KHN24290.1| V-type proton ATPase subunit C [Glycine soja]
Length=176

 Score =   152 bits (383),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 99/131 (76%), Gaps = 10/131 (8%)
 Frame = +1

Query  313  IEELERASGVASSSLT-VDGVPVDSYLTRFVWDEAKYPTMSPLKETVDGVHSQVAKIEDD  489
            I+E+ R  G  +S ++  D V    +L+ F W    YPTM PLKE +DG+H QVAK EDD
Sbjct  46   IKEIVRLHGFPTSIVSDRDKV----FLSNF-W----YPTMLPLKEIIDGIHGQVAKNEDD  96

Query  490  LKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEHLTTLLAVVSKFSQKD  669
            LKV V+EY+N+ SQLNAINRKQ GSLAV DLSNLVKPED+IT E+LTTLLA+  K+SQKD
Sbjct  97   LKVHVSEYNNICSQLNAINRKQIGSLAVCDLSNLVKPEDIITLENLTTLLAIDPKYSQKD  156

Query  670  WLASYETLTSY  702
            WL  YETLT+Y
Sbjct  157  WLFGYETLTNY  167



>gb|AFW81321.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
Length=164

 Score =   149 bits (377),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  255
            MA+RY +VSLPVQ   ++A+SLWSRLQDSIS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYLIVSLPVQSPGATASSLWSRLQDSISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  256  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTR  396
            DLVKSN F+EGV  KIRRQIE+LERA GV + +LTVDGVPVD+YLTR
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEDLERAGGVETGTLTVDGVPVDTYLTR  107



>gb|AFW81322.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
 gb|AFW81323.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
Length=260

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  427  MSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPED  606
            MSPLKE V  + SQVAKIEDD+KVR +EY+NVRSQL+AINRKQ+GSLAVRDLSNLVKPED
Sbjct  1    MSPLKEIVGSIQSQVAKIEDDMKVRASEYNNVRSQLSAINRKQSGSLAVRDLSNLVKPED  60

Query  607  LITSEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            +ITSEHL TLLA+V K+SQKDWL+SYE + ++
Sbjct  61   MITSEHLVTLLAIVPKYSQKDWLSSYEKIDTF  92



>ref|XP_008362171.1| PREDICTED: V-type proton ATPase subunit C-like [Malus domestica]
Length=262

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +1

Query  427  MSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPED  606
            MS L E VD +H Q  KIEDDLKVRVAEY+NVRSQLN INRKQ+GSLAVRDLS LVKPED
Sbjct  1    MSXLXEXVDXIHGQXXKIEDDLKVRVAEYNNVRSQLNXINRKQSGSLAVRDLSGLVKPED  60

Query  607  LITSEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            +I SEHL TLLA+V K+SQKDWL+SYETLT+Y
Sbjct  61   IIISEHLVTLLAIVPKYSQKDWLSSYETLTNY  92



>ref|XP_001418773.1| F-ATPase family transporter: protons (vacuolar) [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO97066.1| F-ATPase family transporter: protons (vacuolar) [Ostreococcus 
lucimarinus CCE9901]
Length=374

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 132/208 (63%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M + YW+VSLP++  SSA + W+ LQ     ++  +  Y+   P+LRVGTLD LLALSDD
Sbjct  1    MTTTYWLVSLPLR-GSSADAAWATLQRHTGGSNDLSLNYKMRCPDLRVGTLDSLLALSDD  59

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  438
            LVK N   E V  K+RRQ  EL  A+  +   L VDG  V+ YLT F WDEAK P    L
Sbjct  60   LVKVNALAEQVVEKVRRQFGELGDAT-TSERELRVDGESVERYLTTFEWDEAKNPARRAL  118

Query  439  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITS  618
            KETV+ +  ++++I+++ K++  + +  ++ LNAI RK    +  +DLS+ V PEDL+ +
Sbjct  119  KETVEKLSERLSRIDEEFKLKCGQLATSKNHLNAIVRKVGSGVNAQDLSDKVNPEDLVQT  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLTSY  702
            E+LTTL+  V K   + W +SYETL S+
Sbjct  179  ENLTTLVVQVPKLKTEVWTSSYETLASF  206



>ref|XP_007513767.1| V-type proton ATPase subunit C 1 [Bathycoccus prasinos]
 emb|CCO16292.1| V-type proton ATPase subunit C 1 [Bathycoccus prasinos]
Length=433

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 96/243 (40%), Positives = 139/243 (57%), Gaps = 39/243 (16%)
 Frame = +1

Query  91   YWVVSLPVQQ---SSSATSLWSR------LQDSISKNSFDTPLY-----RFNIPNLRVGT  228
            YW+VSLP+ +   S +  ++  R      L ++ ++   +  L      +  +P L++GT
Sbjct  13   YWIVSLPLTERNHSINGQTIQERKDIAFQLLEAKTRGKENGELCARENRKLFVPELKIGT  72

Query  229  ldlllalsddlVKSNNFIEGVCSKIRRQIEEL-------------------------ERA  333
            LD LLALSDDL K N  IE V  KI+RQI+E+                            
Sbjct  73   LDSLLALSDDLQKINGQIENVTQKIKRQIQEIGEHFAKESQQQRRRDNMENNNNSNNNNE  132

Query  334  SGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKETVDGVHSQVAKIEDDLKVRVAEY  513
            +  A + LTVDGVP + YLT F WDEAK P    L+ETV+ +   V KI+D+LK++++EY
Sbjct  133  AFTAQTILTVDGVPTEEYLTDFKWDEAKNPAKRQLRETVEKITEHVMKIDDELKMKLSEY  192

Query  514  SNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLITSEHLTTLLAVVSKFSQKDWLASYETL  693
               ++ L+ I RK  GSLA RDL ++V+ ED++ +E+LTTLL  + KFS +DWL SYETL
Sbjct  193  VMAKNSLSTIARKTQGSLATRDLGDVVREEDMVETENLTTLLVTIPKFSAQDWLDSYETL  252

Query  694  TSY  702
              +
Sbjct  253  AQF  255



>ref|XP_004340673.1| Vtype proton ATPase subunit C, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR18631.1| Vtype proton ATPase subunit C, putative [Acanthamoeba castellanii 
str. Neff]
Length=394

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 131/212 (62%), Gaps = 13/212 (6%)
 Frame = +1

Query  88   RYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVK  267
            ++W+VS+P   S      + +L+ ++        + +F IP+LRVG+LD LLALS+DL +
Sbjct  13   QFWLVSVP--NSEVGPHGFEQLRSAVGGAGV---VSKFKIPSLRVGSLDSLLALSEDLGR  67

Query  268  SNNFIEGVCSKIRRQIEEL--------ERASGVASSSLTVDGVPVDSYLTRFVWDEAKYP  423
             + F EGV +KI RQ+ +L            G     L V+ + +DSYL+ F WDEAKY 
Sbjct  68   KDQFFEGVVNKIARQLRDLYTDPETGNNEGPGAGERILAVNNIGLDSYLSTFEWDEAKYK  127

Query  424  TMSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPE  603
              SPLK+ +D V + + KI+++L+ + A + +V   + A  +K TG+L VRDLS+L+KPE
Sbjct  128  LTSPLKDVIDAVSTTMTKIDEELRTKSASFQSVTQAIAAEKKKATGNLMVRDLSDLIKPE  187

Query  604  DLITSEHLTTLLAVVSKFSQKDWLASYETLTS  699
            D I +++LTTL  VV+K   K+WL  YET+ S
Sbjct  188  DAIDTDYLTTLFVVVNKAGAKEWLDEYETIVS  219



>ref|XP_003080507.1| putative vacuolar ATP synthase subunit C (ISS) [Ostreococcus 
tauri]
 emb|CAL54674.1| ATPase, V1 complex, subunit C [Ostreococcus tauri]
Length=376

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 130/209 (62%), Gaps = 2/209 (1%)
 Frame = +1

Query  79   MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  258
            M + YW+VSLP+  +S+     +  + +   N   T + R  +P LRVGTLD LLALSDD
Sbjct  1    MTTTYWLVSLPLLGTSAEEQFGTLRRHTSGANELSTNV-RVRVPELRVGTLDSLLALSDD  59

Query  259  lVKSNNFIEGVCSKIRRQIEELERASGVASS-SLTVDGVPVDSYLTRFVWDEAKYPTMSP  435
            LVK+    E    K+RRQ  +L   S  ++   LT+DG  V+ +LT F WDE K+P    
Sbjct  60   LVKTCALAESTLDKVRRQHVDLTSTSDRSTGRELTIDGESVEKFLTTFEWDEGKHPCRRA  119

Query  436  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT  615
            L+ETV+ +  ++ +IED+ K++  + S  R+ LN++ R+  G +  +DLS L+ P DL+ 
Sbjct  120  LRETVEKLSERLGRIEDEFKLKCGQLSTSRNHLNSLGRRTGGGVNSKDLSELINPADLVE  179

Query  616  SEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            SE+LTTL+  V K   +DW+++YETL+++
Sbjct  180  SENLTTLVVQVPKMRTEDWVSNYETLSNF  208



>ref|XP_011399399.1| V-type proton ATPase subunit C [Auxenochlorella protothecoides]
 gb|KFM26467.1| V-type proton ATPase subunit C [Auxenochlorella protothecoides]
Length=374

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 132/211 (63%), Gaps = 9/211 (4%)
 Frame = +1

Query  91   YWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVKS  270
            YW+V+LP   S+     W+ LQ+  + +S  +  ++F +P  +VGTLD LL LSDDLVK 
Sbjct  3    YWLVALPAP-STGMEGAWASLQEDTTYSSDLSVNFKFAVPEFKVGTLDSLLGLSDDLVKV  61

Query  271  NNFIEGVCSKIRRQIEELERASGVASSSLTVDGV-------PVDSYLTRFVWDEAKYPTM  429
            N  +EG  +K+RRQ+ EL+ A+    S     G        P D YL  F W EAKYP+ 
Sbjct  62   NGAVEGSVNKVRRQLFELQSAAPTDRSEEEEGGEVRVEGTSPPD-YLQHFEWQEAKYPSK  120

Query  430  SPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDL  609
             PLK+TV  +     K++DDLK+R  EY+  R+ L A  RK+TGSLAVRDLS+LV P +L
Sbjct  121  RPLKDTVAAITEVTQKLDDDLKLRTTEYTQQRTLLQAQLRKRTGSLAVRDLSDLVPPGEL  180

Query  610  ITSEHLTTLLAVVSKFSQKDWLASYETLTSY  702
            + +E+L TL+ V+++ +  +++ SYE LT +
Sbjct  181  VETENLVTLVVVIARSNTPEFMKSYEGLTEW  211



>ref|XP_007886138.1| PREDICTED: V-type proton ATPase subunit C 1 [Callorhinchus milii]
Length=382

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 131/206 (64%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + ++N+  +  ++F IP+L+VGTLD+L+ LSD+L 
Sbjct  2    AEFWLISAPGEKTCQQT--WDKLNSATTRNNHLSTNFKFAIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K ++F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDL-ITS  618
               + +  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED  I S
Sbjct  120  NICEIIAKQVTQIDNDLKARASAYNNLKGNLQNLERKNVGSLMTRSLADIVKKEDFVIDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+LTTLL VV K +  +W  +YETL 
Sbjct  180  EYLTTLLVVVPKINYTEWEKTYETLA  205



>ref|XP_006028579.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Alligator 
sinensis]
 ref|XP_006277390.1| PREDICTED: V-type proton ATPase subunit C 1 [Alligator mississippiensis]
Length=382

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 129/206 (63%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETLT
Sbjct  180  EYLITLLVVVPKLNYSDWVKQYETLT  205



>dbj|BAE87614.1| unnamed protein product [Macaca fascicularis]
Length=287

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/205 (40%), Positives = 126/205 (61%), Gaps = 4/205 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI-TS  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETL  693
            E+L TLL VV K +  DW+  YETL
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETL  204



>ref|XP_006028578.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Alligator 
sinensis]
Length=400

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 129/206 (63%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  20   TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  77

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  78   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  137

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  138  NISEIIAKGVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  197

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETLT
Sbjct  198  EYLITLLVVVPKLNYSDWVKQYETLT  223



>gb|EPY74837.1| V-type proton ATPase subunit C 1 [Camelus ferus]
Length=287

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_004903962.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004903963.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004850298.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004850299.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Heterocephalus 
glaber]
Length=382

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHTATTKNNNLAATSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK ED +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_002733333.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Saccoglossus 
kowalevskii]
Length=384

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 132/206 (64%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W R+ ++ +K    +  ++FNIP+L+VGTLD L+ LSDDL 
Sbjct  2    AEFWLISAPGEKTCQQT--WERMNNATAKQQSLSINHKFNIPDLKVGTLDTLVGLSDDLG  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+E V  K+   + + LE      + +L  +GV + +YLTRF WD AKYP   PL+
Sbjct  60   KLDAFVEVVARKVANYLGDVLEDQRDKLAENLLANGVDLTTYLTRFQWDVAKYPIKQPLR  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI-TS  618
               + +  QV++I+ DLK + A Y++++  L+++ RK TGSL  R++++LV+ ED +  S
Sbjct  120  SIAEIISKQVSQIDSDLKAKSAAYNSLKGNLHSLERKSTGSLITRNVADLVRKEDFVLQS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+LTTLL VV K    DW + YETLT
Sbjct  180  EYLTTLLVVVQKAMFPDWRSKYETLT  205



>ref|XP_006760332.1| PREDICTED: V-type proton ATPase subunit C 1 [Myotis davidii]
Length=355

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI-TS  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R LS +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLSEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWMKQYETLA  205



>emb|CAH93171.1| hypothetical protein [Pongo abelii]
Length=382

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_005627900.1| PREDICTED: V-type proton ATPase subunit C 1 [Canis lupus familiaris]
Length=382

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAVASKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>gb|AIC48333.1| ATP6V1C1, partial [synthetic construct]
Length=382

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|NP_001686.1| V-type proton ATPase subunit C 1 [Homo sapiens]
 ref|NP_001125006.1| V-type proton ATPase subunit C 1 [Pongo abelii]
 ref|NP_001247698.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [Macaca 
mulatta]
 ref|NP_001271984.1| V-type proton ATPase subunit C 1 [Macaca fascicularis]
 ref|XP_001155312.1| PREDICTED: V-type proton ATPase subunit C 1 [Pan troglodytes]
 ref|XP_003256129.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 1 [Nomascus 
leucogenys]
 ref|XP_003821776.1| PREDICTED: V-type proton ATPase subunit C 1 [Pan paniscus]
 ref|XP_003903096.1| PREDICTED: V-type proton ATPase subunit C 1 [Papio anubis]
 ref|XP_004047448.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004047449.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_005563904.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Macaca 
fascicularis]
 ref|XP_007999459.1| PREDICTED: V-type proton ATPase subunit C 1 [Chlorocebus sabaeus]
 ref|XP_009211717.1| PREDICTED: V-type proton ATPase subunit C 1 [Papio anubis]
 ref|XP_009454031.1| PREDICTED: V-type proton ATPase subunit C 1 [Pan troglodytes]
 ref|XP_010352829.1| PREDICTED: V-type proton ATPase subunit C 1 [Rhinopithecus roxellana]
 ref|XP_011786642.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Colobus 
angolensis palliatus]
 ref|XP_011786650.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Colobus 
angolensis palliatus]
 ref|XP_011838890.1| PREDICTED: V-type proton ATPase subunit C 1 [Mandrillus leucophaeus]
 ref|XP_011917101.1| PREDICTED: V-type proton ATPase subunit C 1 [Cercocebus atys]
 ref|XP_011917103.1| PREDICTED: V-type proton ATPase subunit C 1 [Cercocebus atys]
 ref|XP_011729941.1| PREDICTED: V-type proton ATPase subunit C 1 [Macaca nemestrina]
 ref|XP_011729942.1| PREDICTED: V-type proton ATPase subunit C 1 [Macaca nemestrina]
 sp|P21283.4|VATC1_HUMAN RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Homo sapiens]
 sp|Q5RDQ7.1|VATC1_PONAB RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Pongo abelii]
 sp|Q4R5H9.1|VATC1_MACFA RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Macaca fascicularis]
 emb|CAA48903.1| vacuolar proton-ATPase [Homo sapiens]
 gb|AAH10960.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [Homo 
sapiens]
 gb|AAL50383.1| ATPase H+ transporting lysosomal protein [Homo sapiens]
 emb|CAH90100.1| hypothetical protein [Pongo abelii]
 dbj|BAE01646.1| unnamed protein product [Macaca fascicularis]
 gb|EAW91859.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1, isoform 
CRA_a [Homo sapiens]
 gb|EAW91860.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1, isoform 
CRA_a [Homo sapiens]
 gb|ACE86916.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 protein 
[synthetic construct]
 gb|ACE87603.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 protein 
[synthetic construct]
 dbj|BAJ17803.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [synthetic 
construct]
 gb|ADQ31698.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [synthetic 
construct]
 gb|EHH28693.1| V-type proton ATPase subunit C 1 [Macaca mulatta]
 gb|EHH64350.1| V-type proton ATPase subunit C 1 [Macaca fascicularis]
Length=382

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_005231036.1| PREDICTED: V-type proton ATPase subunit C 1 [Falco peregrinus]
 ref|XP_005431876.1| PREDICTED: V-type proton ATPase subunit C 1 [Falco cherrug]
 ref|XP_009488822.1| PREDICTED: V-type proton ATPase subunit C 1 [Pelecanus crispus]
 ref|XP_009636672.1| PREDICTED: V-type proton ATPase subunit C 1 [Egretta garzetta]
 ref|XP_009947737.1| PREDICTED: V-type proton ATPase subunit C 1 [Leptosomus discolor]
 ref|XP_009988359.1| PREDICTED: V-type proton ATPase subunit C 1 [Tauraco erythrolophus]
 ref|XP_010174217.1| PREDICTED: V-type proton ATPase subunit C 1 [Caprimulgus carolinensis]
 ref|XP_010181473.1| PREDICTED: V-type proton ATPase subunit C 1 [Mesitornis unicolor]
Length=382

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 128/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKLNYNDWVKQYETLA  205



>emb|CAH93365.1| hypothetical protein [Pongo abelii]
Length=382

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_009918407.1| PREDICTED: V-type proton ATPase subunit C 1 [Haliaeetus albicilla]
 ref|XP_010575320.1| PREDICTED: V-type proton ATPase subunit C 1 [Haliaeetus leucocephalus]
 ref|XP_010575321.1| PREDICTED: V-type proton ATPase subunit C 1 [Haliaeetus leucocephalus]
Length=382

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 128/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKLNYNDWVKQYETLA  205



>ref|XP_010139291.1| PREDICTED: V-type proton ATPase subunit C 1 [Buceros rhinoceros 
silvestris]
Length=382

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 128/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  SISEIIGKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKLNYNDWVKQYETLA  205



>ref|XP_009890115.1| PREDICTED: V-type proton ATPase subunit C 1 [Charadrius vociferus]
Length=382

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 128/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKLNYNDWVKQYETLA  205



>emb|CDQ87771.1| unnamed protein product [Oncorhynchus mykiss]
Length=332

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 131/206 (64%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W ++  + ++N+  +   +FNIP+L+VGTLD+L+ LSDDL 
Sbjct  2    TEFWLISAPGEKTCQQT--WDQMMVATTRNNNLSTNNKFNIPDLKVGTLDVLVGLSDDLA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K ++FIEGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFIEGVVKKVSQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDL-ITS  618
               D +   +++I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED  I S
Sbjct  120  NISDIISKAISQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVIDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L T+L VV K S  DW  +YETL+
Sbjct  180  EYLITMLVVVPKTSYVDWQKTYETLS  205



>ref|XP_004275371.1| PREDICTED: V-type proton ATPase subunit C 1 [Orcinus orca]
 ref|XP_004316544.1| PREDICTED: V-type proton ATPase subunit C 1-like isoform 1 [Tursiops 
truncatus]
Length=382

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAATSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_008934370.1| PREDICTED: V-type proton ATPase subunit C 1 [Merops nubicus]
Length=382

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 128/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKINYNDWVKQYETLA  205



>ref|XP_004663082.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Jaculus 
jaculus]
Length=382

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAATSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_003480143.1| PREDICTED: V-type proton ATPase subunit C 1 [Cavia porcellus]
Length=382

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 126/205 (61%), Gaps = 4/205 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAATAKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETL  693
            E+L TLL VV K +  DW+  YETL
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETL  204



>ref|XP_011600484.1| PREDICTED: V-type proton ATPase subunit C 1 [Aquila chrysaetos 
canadensis]
 ref|XP_011600485.1| PREDICTED: V-type proton ATPase subunit C 1 [Aquila chrysaetos 
canadensis]
Length=382

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 128/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKINYNDWVKQYETLA  205



>ref|XP_004679736.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Condylura 
cristata]
Length=382

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNTLATTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_005879352.1| PREDICTED: V-type proton ATPase subunit C 1 [Myotis brandtii]
 ref|XP_006093414.1| PREDICTED: V-type proton ATPase subunit C 1 [Myotis lucifugus]
 gb|EPQ15830.1| V-type proton ATPase subunit C 1 [Myotis brandtii]
Length=382

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R LS +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLSEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWMKQYETLA  205



>ref|XP_008146706.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Eptesicus 
fuscus]
Length=382

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R LS +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLSEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLITLLVVVPKLNHNDWMKQYETLA  205



>ref|XP_003055517.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas pusilla CCMP1545]
 gb|EEH60769.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas pusilla CCMP1545]
Length=365

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 110/170 (65%), Gaps = 1/170 (1%)
 Frame = +1

Query  196  RFNIPNLRVGTldlllalsddlVKS-NNFIEGVCSKIRRQIEELERASGVASSSLTVDGV  372
            +FN+P LRVG  D L+ L D + +  +  ++ V  +I++Q  EL  + G+    LTVDG+
Sbjct  32   QFNVPELRVGAFDDLIELGDTISEVVSPLLDAVARRIQKQFVELHSSDGMDEQELTVDGI  91

Query  373  PVDSYLTRFVWDEAKYPTMSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRK  552
            P D +LT F WD AK PT  P+K+ V  +   VA I+++LKV+ +EY+  ++QL+ I+RK
Sbjct  92   PPDQFLTSFEWDGAKNPTHRPIKKIVQELRENVATIDEELKVKTSEYAAAKAQLSGISRK  151

Query  553  QTGSLAVRDLSNLVKPEDLITSEHLTTLLAVVSKFSQKDWLASYETLTSY  702
               SLA RDL ++V+  D+I +++L TL   V  FS+KDWL SYETL  +
Sbjct  152  TGWSLATRDLGDIVQESDIIETDNLVTLFVAVPIFSKKDWLKSYETLAHF  201



>ref|XP_005499457.1| PREDICTED: V-type proton ATPase subunit C 1 [Columba livia]
Length=382

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 128/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADVVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKLNYNDWVKQYETLA  205



>ref|XP_008051075.1| PREDICTED: V-type proton ATPase subunit C 1 [Tarsius syrichta]
 ref|XP_008051076.1| PREDICTED: V-type proton ATPase subunit C 1 [Tarsius syrichta]
Length=382

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTCKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_004697744.1| PREDICTED: V-type proton ATPase subunit C 1 [Echinops telfairi]
Length=288

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 125/205 (61%), Gaps = 4/205 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EG   K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGAVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETL  693
            E+L TLL VV K +  DW+  YETL
Sbjct  180  EYLITLLVVVPKLNHNDWIKQYETL  204



>ref|XP_007932994.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Orycteropus 
afer afer]
Length=382

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSITSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLITLLVVVPKLNHNDWIKQYETLA  205



>gb|AAB51350.1| C subunit of V-ATPase, partial [Amblyomma americanum]
Length=382

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 130/206 (63%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            S +W++S P +++   T  + +L    SK +  +  Y+F++P+L+VGTLD L+ LSDDL 
Sbjct  1    SEFWLISAPGEKTCQQT--YEKLCSVTSKQNNLSTNYKFHLPDLKVGTLDQLVGLSDDLG  58

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + ++EGV  K+   + + L+      + +L  +G+ +++YLTRF WD AKYP    LK
Sbjct  59   KLDTYVEGVTRKVATYLGDVLDDQRDKLADNLLANGMEMEAYLTRFQWDMAKYPIKQSLK  118

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI-TS  618
               D +  QV +I+ DLK + A Y+N+++QL +I RK TGSL VR L++LV+ E  +  S
Sbjct  119  NITDIISKQVGQIDADLKSKSAAYNNLKTQLQSIERKSTGSLLVRSLADLVRKEHFVLGS  178

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K   KDW + YE L+
Sbjct  179  EYLITLLVVVPKMMYKDWYSKYEKLS  204



>ref|XP_005316338.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Ictidomys 
tridecemlineatus]
Length=382

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAISSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_006145636.1| PREDICTED: V-type proton ATPase subunit C 1 [Tupaia chinensis]
Length=382

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWMKQYETLA  205



>ref|XP_002759363.1| PREDICTED: V-type proton ATPase subunit C 1 [Callithrix jacchus]
Length=382

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_012039419.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Ovis 
aries]
 ref|XP_012012112.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Ovis 
aries musimon]
Length=352

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_010954093.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C 1 [Camelus bactrianus]
Length=381

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_006212223.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Vicugna 
pacos]
Length=382

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_004607741.1| PREDICTED: V-type proton ATPase subunit C 1 [Sorex araneus]
Length=382

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDRVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL+
Sbjct  180  EYLITLLVVVPKLNHNDWIKQYETLS  205



>ref|XP_006192890.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Camelus 
ferus]
 ref|XP_007173450.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007173451.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007173452.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X3 [Balaenoptera 
acutorostrata scammoni]
Length=382

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_010980173.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C 1 [Camelus dromedarius]
Length=382

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_004402384.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 1 [Odobenus 
rosmarus divergens]
 ref|XP_006744695.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Leptonychotes 
weddellii]
 ref|XP_008687450.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Ursus 
maritimus]
Length=382

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAIASKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_004768925.1| PREDICTED: V-type proton ATPase subunit C 1 [Mustela putorius 
furo]
 ref|XP_004796128.1| PREDICTED: V-type proton ATPase subunit C 1 [Mustela putorius 
furo]
Length=382

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLALASKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_003408473.1| PREDICTED: V-type proton ATPase subunit C 1 [Loxodonta africana]
 ref|XP_010586740.1| PREDICTED: V-type proton ATPase subunit C 1 [Loxodonta africana]
Length=382

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLGTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_002922648.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Ailuropoda 
melanoleuca]
 gb|EFB15735.1| hypothetical protein PANDA_011625, partial [Ailuropoda melanoleuca]
Length=382

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAAATKNNNLAIASKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_002710769.1| PREDICTED: V-type proton ATPase subunit C 1 [Oryctolagus cuniculus]
 ref|XP_004580712.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Ochotona 
princeps]
 ref|XP_007112273.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Physeter 
catodon]
 ref|XP_007112274.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Physeter 
catodon]
 ref|XP_007112275.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X3 [Physeter 
catodon]
 ref|XP_007112276.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X4 [Physeter 
catodon]
Length=382

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>gb|EKC32287.1| V-type proton ATPase subunit C 1 [Crassostrea gigas]
Length=419

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 130/210 (62%), Gaps = 5/210 (2%)
 Frame = +1

Query  73   IEMASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllals  252
            I+MA  YW++S+P +++   +  W  L ++  +N   +  Y+F IP+L+VGTLD+L+ LS
Sbjct  35   IKMAE-YWLISVPGEKTLQQS--WETLNNATMRNQVLSTNYKFAIPDLKVGTLDVLVGLS  91

Query  253  ddlVKSNNFIEGVCSKIRRQI-EELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTM  429
            DD+ K + + E V  KI + + E LE  S     +L V+GV + +YLTRF WD AKYP  
Sbjct  92   DDMGKLDIYCESVTRKIAQYLGETLEDRSDKLQGNLQVNGVDMVTYLTRFQWDLAKYPIK  151

Query  430  SPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDL  609
              LK   + +  QV++IE DLK +   Y+N++  L  + RK TGSL  R+L+ LVK ED 
Sbjct  152  QSLKNIAEIIGKQVSQIETDLKTKATAYNNLKGNLQNLERKSTGSLFTRNLTELVKREDF  211

Query  610  IT-SEHLTTLLAVVSKFSQKDWLASYETLT  696
            +  SE+L TLL VV K    DW A YE+LT
Sbjct  212  VLDSEYLQTLLVVVPKNIIHDWQAKYESLT  241



>ref|XP_007075876.1| PREDICTED: V-type proton ATPase subunit C 1 [Panthera tigris 
altaica]
 ref|XP_011289721.1| PREDICTED: V-type proton ATPase subunit C 1 [Felis catus]
 ref|XP_011289722.1| PREDICTED: V-type proton ATPase subunit C 1 [Felis catus]
Length=382

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAITSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_008574309.1| PREDICTED: V-type proton ATPase subunit C 1 [Galeopterus variegatus]
 ref|XP_008574310.1| PREDICTED: V-type proton ATPase subunit C 1 [Galeopterus variegatus]
Length=382

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLITLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_009510884.1| PREDICTED: V-type proton ATPase subunit C 1 [Phalacrocorax carbo]
Length=382

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 128/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYVTRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKVNYNDWVKQYETLA  205



>ref|NP_001177134.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [Sus 
scrofa]
Length=382

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLALTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHHDWIKQYETLA  205



>ref|XP_009864623.1| PREDICTED: V-type proton ATPase subunit C 1 [Apaloderma vittatum]
Length=382

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 128/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKSNYNDWVKQYETLA  205



>ref|XP_007518917.1| PREDICTED: V-type proton ATPase subunit C 1 [Erinaceus europaeus]
Length=382

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAISSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_009700298.1| PREDICTED: V-type proton ATPase subunit C 1 [Cariama cristata]
Length=382

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 128/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYVTRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI-TS  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLNS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKSNYNDWVKQYETLA  205



>ref|NP_788849.1| V-type proton ATPase subunit C 1 [Bos taurus]
 ref|XP_005899431.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Bos mutus]
 ref|XP_005954637.1| PREDICTED: V-type proton ATPase subunit C 1 [Pantholops hodgsonii]
 ref|XP_006041489.1| PREDICTED: V-type proton ATPase subunit C 1-like isoform X1 [Bubalus 
bubalis]
 ref|XP_006041490.1| PREDICTED: V-type proton ATPase subunit C 1-like isoform X2 [Bubalus 
bubalis]
 ref|XP_010861798.1| PREDICTED: V-type proton ATPase subunit C 1 [Bison bison bison]
 sp|P21282.3|VATC1_BOVIN RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Bos taurus]
 gb|AAA30803.1| H+ -ATPase C subunit [Bos taurus]
 gb|AAI19958.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [Bos 
taurus]
 tpg|DAA22615.1| TPA: V-type proton ATPase subunit C 1 [Bos taurus]
Length=382

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_001494151.1| PREDICTED: V-type proton ATPase subunit C 1 [Equus caballus]
 ref|XP_008539280.1| PREDICTED: V-type proton ATPase subunit C 1 [Equus przewalskii]
 ref|XP_008539287.1| PREDICTED: V-type proton ATPase subunit C 1 [Equus przewalskii]
Length=382

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAISSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLITLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_004011849.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Ovis 
aries]
 ref|XP_005689239.1| PREDICTED: V-type proton ATPase subunit C 1 [Capra hircus]
 ref|XP_012012111.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Ovis 
aries musimon]
Length=382

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_004431292.1| PREDICTED: V-type proton ATPase subunit C 1 [Ceratotherium simum 
simum]
Length=382

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAISSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>gb|ELR53809.1| V-type proton ATPase subunit C 1 [Bos mutus]
Length=428

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_006916693.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Pteropus 
alecto]
 ref|XP_006916694.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Pteropus 
alecto]
 ref|XP_011371558.1| PREDICTED: V-type proton ATPase subunit C 1 [Pteropus vampyrus]
 gb|ELK08624.1| V-type proton ATPase subunit C 1 [Pteropus alecto]
Length=382

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 125/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAITSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_011414828.1| PREDICTED: V-type proton ATPase subunit C 1-like [Crassostrea 
gigas]
 ref|XP_011414829.1| PREDICTED: V-type proton ATPase subunit C 1-like [Crassostrea 
gigas]
Length=383

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + YW++S+P +++   +  W  L ++  +N   +  Y+F IP+L+VGTLD+L+ LSDD+ 
Sbjct  2    AEYWLISVPGEKTLQQS--WETLNNATMRNQVLSTNYKFAIPDLKVGTLDVLVGLSDDMG  59

Query  265  KSNNFIEGVCSKIRRQI-EELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + + E V  KI + + E LE  S     +L V+GV + +YLTRF WD AKYP    LK
Sbjct  60   KLDIYCESVTRKIAQYLGETLEDRSDKLQGNLQVNGVDMVTYLTRFQWDLAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +  QV++IE DLK +   Y+N++  L  + RK TGSL  R+L+ LVK ED +  S
Sbjct  120  NIAEIIGKQVSQIETDLKTKATAYNNLKGNLQNLERKSTGSLFTRNLTELVKREDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K    DW A YE+LT
Sbjct  180  EYLQTLLVVVPKNIIHDWQAKYESLT  205



>ref|XP_003782477.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 1 [Otolemur 
garnettii]
Length=382

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLITLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_010898239.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Esox lucius]
Length=381

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 130/206 (63%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W ++  + + ++  +  ++FNIP+L+VGTLD+L+ LSD++ 
Sbjct  2    TEFWLISAPGEKTCQQT--WDKMMVATTHSNNLSTNHKFNIPDLKVGTLDVLVGLSDEMA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K ++F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYVTRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +  QVA+I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIISKQVAQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L T+L VV K    DW   YETL+
Sbjct  180  EYLITMLVVVPKTGYADWQKCYETLS  205



>ref|XP_003509877.1| PREDICTED: V-type proton ATPase subunit C 1 [Cricetulus griseus]
 gb|EGW12831.1| V-type proton ATPase subunit C 1 [Cricetulus griseus]
Length=382

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL+
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLS  205



>ref|XP_007634426.1| PREDICTED: V-type proton ATPase subunit C 1 [Cricetulus griseus]
 gb|ERE52432.1| V-type proton ATPase subunit C 1 [Cricetulus griseus]
Length=382

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL+
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLS  205



>dbj|BAE40727.1| unnamed protein product [Mus musculus]
Length=382

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 125/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WGKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>gb|AAC83084.1| vacuolar adenosine triphosphatase subunit C [Mus musculus]
Length=382

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 125/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|NP_001011992.1| V-type proton ATPase subunit C 1 [Rattus norvegicus]
 sp|Q5FVI6.1|VATC1_RAT RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Rattus norvegicus]
 gb|AAH89961.1| ATPase, H+ transporting, lysosomal V1 subunit C1 [Rattus norvegicus]
Length=382

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 125/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|NP_079770.2| V-type proton ATPase subunit C 1 [Mus musculus]
 sp|Q9Z1G3.4|VATC1_MOUSE RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Mus musculus]
 gb|AAH10217.1| ATPase, H+ transporting, lysosomal V1 subunit C1 [Mus musculus]
 dbj|BAC35953.1| unnamed protein product [Mus musculus]
 dbj|BAC57953.1| proton-translocating ATPase C subunit isoform C1 [Mus musculus]
 dbj|BAE30229.1| unnamed protein product [Mus musculus]
 gb|EDL08791.1| \ATPase, H+ transporting, lysosomal V1 subunit C1, isoform CRA_a 
[Mus musculus]
Length=382

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 125/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_010148071.1| PREDICTED: V-type proton ATPase subunit C 1 [Eurypyga helias]
Length=382

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +K +  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKTNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKLNYNDWVKQYETLA  205



>ref|XP_005367598.1| PREDICTED: V-type proton ATPase subunit C 1 [Microtus ochrogaster]
Length=382

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 125/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_005382051.1| PREDICTED: V-type proton ATPase subunit C 1 [Chinchilla lanigera]
Length=450

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAATSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI-TS  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_006830685.1| PREDICTED: V-type proton ATPase subunit C 1 [Chrysochloris asiatica]
Length=382

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +K++  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKSNNLSVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLITLLVVVPKLNHNDWMKQYETLA  205



>ref|XP_003760346.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 1 [Sarcophilus 
harrisii]
Length=382

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 128/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            S +W++S P +++   T  W +L  + +K++  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    SEFWLISAPGEKTCQQT--WEKLHAATTKSNNLSINSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K ++F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLITYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGSLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLITLLVVVPKLNHNDWVKQYETLA  205



>ref|XP_006982882.1| PREDICTED: V-type proton ATPase subunit C 1 [Peromyscus maniculatus 
bairdii]
Length=382

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 125/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWVKQYETLA  205



>ref|XP_009556284.1| PREDICTED: V-type proton ATPase subunit C 1 [Cuculus canorus]
Length=382

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKLNYNDWVKQYETLA  205



>ref|XP_003940719.1| PREDICTED: V-type proton ATPase subunit C 1 [Saimiri boliviensis 
boliviensis]
Length=382

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + SK++      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKSNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_009275405.1| PREDICTED: V-type proton ATPase subunit C 1 [Aptenodytes forsteri]
 ref|XP_009467614.1| PREDICTED: V-type proton ATPase subunit C 1 [Nipponia nippon]
 ref|XP_010128174.1| PREDICTED: V-type proton ATPase subunit C 1 [Chlamydotis macqueenii]
 ref|XP_010281571.1| PREDICTED: V-type proton ATPase subunit C 1 [Phaethon lepturus]
Length=382

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKLNYNDWVKQYETLA  205



>ref|XP_005306086.1| PREDICTED: V-type proton ATPase subunit C 1 [Chrysemys picta 
bellii]
Length=382

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 129/206 (63%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDILVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI-TS  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TL+ VV K +  DW+  YETL+
Sbjct  180  EYLITLVVVVPKSNYNDWVKQYETLS  205



>ref|XP_010302959.1| PREDICTED: V-type proton ATPase subunit C 1 [Balearica regulorum 
gibbericeps]
Length=382

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKLNYNDWVKQYETLA  205



>ref|XP_009321363.1| PREDICTED: V-type proton ATPase subunit C 1 [Pygoscelis adeliae]
Length=382

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKLNYNDWVKQYETLA  205



>gb|ETE73899.1| V-type proton ATPase subunit C 1 [Ophiophagus hannah]
Length=362

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 131/213 (62%), Gaps = 5/213 (2%)
 Frame = +1

Query  64   SNSIEMASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlll  243
            SN  +MA  +W++S P +++   T  W +L  +  KN+  +   +FNIP+L+VGTLD+L+
Sbjct  7    SNVTKMAE-FWLISAPGEKTCQQT--WEKLCAATIKNNNLSINAKFNIPDLKVGTLDVLV  63

Query  244  alsddlVKSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKY  420
             LSD+L K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKY
Sbjct  64   GLSDELAKLDTFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLITYITRFQWDMAKY  123

Query  421  PTMSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKP  600
            P    LK   + +   V +I++DLK R + Y++++  L  + RK  GSL  R L+ +VK 
Sbjct  124  PIKQSLKNISEIIAKGVTQIDNDLKARASAYNSLKGNLQNLERKNAGSLLTRSLAEIVKK  183

Query  601  EDLIT-SEHLTTLLAVVSKFSQKDWLASYETLT  696
            +D +  SE+L TLL VV K +  DW+  YETLT
Sbjct  184  DDFVLDSEYLITLLVVVPKTNYTDWMKQYETLT  216



>ref|XP_009029568.1| hypothetical protein HELRODRAFT_103807 [Helobdella robusta]
 gb|ESN92328.1| hypothetical protein HELRODRAFT_103807 [Helobdella robusta]
Length=392

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 131/205 (64%), Gaps = 4/205 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++ + T  W  + +  SK +  +  ++F+IP+L+VGTLD+L+ LSDDL 
Sbjct  12   TEFWLISAPGEKTCAQT--WENMNNVTSKQNNLSINFKFHIPDLKVGTLDVLVGLSDDLA  69

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + ++E +  KI   + + +E  +     SL V+G  + SYLT+F WD AKY T  P+K
Sbjct  70   KLDGYVEIIVRKIAHYMGDVMEGETDKLHESLLVNGYSMASYLTKFQWDLAKYSTNQPIK  129

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               D +  Q+ +IE DLK R A Y+N++  L  + +K TGSL  R+LS+LVK ED +  S
Sbjct  130  NISDFIAKQMTQIESDLKARSAAYNNLKGNLQILEKKSTGSLLTRNLSDLVKKEDFVLGS  189

Query  619  EHLTTLLAVVSKFSQKDWLASYETL  693
            ++L T+L VV +  QKD+L +YET+
Sbjct  190  DYLITILIVVPRSLQKDFLENYETI  214



>ref|XP_007463323.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Lipotes 
vexillifer]
Length=382

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +F+IP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFSIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_010223600.1| PREDICTED: V-type proton ATPase subunit C 1 [Tinamus guttatus]
Length=382

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 128/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +K++  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKHNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMGDVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKSNYNDWVKQYETLA  205



>ref|XP_009896480.1| PREDICTED: V-type proton ATPase subunit C 1 [Picoides pubescens]
Length=382

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 128/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +K++  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKHNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKSNYNDWVKQYETLA  205



>ref|XP_008849773.1| PREDICTED: V-type proton ATPase subunit C 1 [Nannospalax galili]
Length=382

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +K++      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKSNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_006796085.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Neolamprologus 
brichardi]
Length=358

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 128/205 (62%), Gaps = 4/205 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P  ++   T  W ++  + ++ +  +  ++FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGDKTCQQT--WDKMMAATTRTNNLSTNHKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K ++F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK +D +  S
Sbjct  120  NISEIISKQVTQIDNDLKTRASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETL  693
            E+L TLL VV K    DW  +YETL
Sbjct  180  EYLITLLVVVPKTGYSDWQKAYETL  204



>ref|XP_006122461.1| PREDICTED: V-type proton ATPase subunit C 1 [Pelodiscus sinensis]
Length=382

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 128/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHTATTKNNNLSTNSKFNIPDLKVGTLDILVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMSDVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI-TS  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TL+ V+ K +  DW+  YETL 
Sbjct  180  EYLITLVVVIPKSNYNDWVKQYETLA  205



>ref|XP_001506621.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Ornithorhynchus 
anatinus]
Length=382

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +K++  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKSNNLSTNAKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIGKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLITLLVVVPKLNHNDWVKQYETLA  205



>ref|XP_418370.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X3 [Gallus 
gallus]
 ref|XP_004940040.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X4 [Gallus 
gallus]
 ref|XP_010707494.1| PREDICTED: V-type proton ATPase subunit C 1 [Meleagris gallopavo]
Length=382

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKVNYNDWVKQYETLA  205



>ref|XP_003459431.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X1 
[Oreochromis niloticus]
 ref|XP_004560058.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Maylandia 
zebra]
 ref|XP_005464958.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X2 
[Oreochromis niloticus]
 ref|XP_005742954.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Pundamilia 
nyererei]
 ref|XP_005930197.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X1 
[Haplochromis burtoni]
 ref|XP_005930198.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X2 
[Haplochromis burtoni]
Length=383

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 128/205 (62%), Gaps = 4/205 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P  ++   T  W ++  + ++ +  +  ++FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGDKTCQQT--WDKMMAATTRTNNLSTNHKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K ++F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI-TS  618
               + +  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK +D +  S
Sbjct  120  NISEIISKQVTQIDNDLKTRASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETL  693
            E+L TLL VV K    DW  +YETL
Sbjct  180  EYLITLLVVVPKTGYSDWQKAYETL  204



>ref|XP_007488240.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X3 [Monodelphis 
domestica]
 ref|XP_007488241.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X4 [Monodelphis 
domestica]
Length=382

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + ++ +  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHSATTRINNLSHNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIGKGVNQIDNDLKARASAYNNLKGSLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K + KDW+  YETL 
Sbjct  180  EYLITLLVVVPKLNHKDWVKQYETLA  205



>gb|KDR10550.1| V-type proton ATPase subunit C [Zootermopsis nevadensis]
Length=385

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 123/206 (60%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + YW++S P  ++   T  W  + +  SK +  +  Y+F+IP+L+VGTLD L+ LSDDL 
Sbjct  2    TEYWLISAPGDKTCQQT--WETMNNVTSKQNNLSANYKFHIPDLKVGTLDQLVGLSDDLG  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K +NF+E V  K+   + E LE        +L  +   + +Y+TRF WD AKYP    L+
Sbjct  60   KLDNFVEQVTKKVAVYLGEVLEDQRDKLHENLLANNSDLPAYITRFQWDMAKYPIKQSLR  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI-TS  618
               D +  QVA+I+ DLK +   Y+N++  L  + +KQTGSL  R+L++LVK E  I  S
Sbjct  120  NIADIISKQVAQIDADLKTKSTAYNNLKGNLQNLEKKQTGSLLTRNLADLVKKEHFILDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+LTTLL +V K S  DW   YE LT
Sbjct  180  EYLTTLLVIVPKASFTDWHQGYEKLT  205



>ref|NP_001088261.1| V-type proton ATPase subunit C 1 [Xenopus laevis]
 sp|Q5XH14.1|VATC1_XENLA RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Xenopus laevis]
 gb|AAH84262.1| Atp6v1c1 protein [Xenopus laevis]
Length=382

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLMAATTKNNNLSTNAKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EG   K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGAVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI-TS  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLITRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL+
Sbjct  180  EYLITLLVVVPKNNYTDWMKEYETLS  205



>ref|XP_010017126.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Nestor 
notabilis]
Length=382

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKSNYNDWVKQYETLA  205



>gb|KFQ53504.1| V-type proton ATPase subunit C 1, partial [Nestor notabilis]
Length=388

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  8    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  65

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  66   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  125

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI-TS  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  126  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  185

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  186  EYLVTLLVIVPKSNYNDWVKQYETLA  211



>ref|XP_003219499.1| PREDICTED: V-type proton ATPase subunit C 1 [Anolis carolinensis]
Length=382

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  +  KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLCAATIKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y++++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIISKGVTQIDNDLKARASAYNSLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETLT
Sbjct  180  EYLITLLVVVPKLNFNDWMKQYETLT  205



>ref|XP_001369362.2| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Monodelphis 
domestica]
Length=414

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + ++ +  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  34   TEFWLISAPGEKTCQQT--WEKLHSATTRINNLSHNSKFNIPDLKVGTLDVLVGLSDELA  91

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  92   KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  151

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  152  NISEIIGKGVNQIDNDLKARASAYNNLKGSLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  211

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K + KDW+  YETL 
Sbjct  212  EYLITLLVVVPKLNHKDWVKQYETLA  237



>ref|XP_007056164.1| PREDICTED: V-type proton ATPase subunit C 1 [Chelonia mydas]
Length=382

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 128/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDILVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+ RF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYIIRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI-TS  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TL+ VV K +  DW+  YETL+
Sbjct  180  EYLITLVVVVPKSNYNDWVKQYETLS  205



>ref|XP_008430009.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Poecilia 
reticulata]
Length=279

 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 129/205 (63%), Gaps = 4/205 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + ++ +  +  ++F+IP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WDKLMAATTRTNNLSTNHKFSIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K ++F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI-TS  618
               + +  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIISKQVTQIDNDLKXRASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETL  693
            E+L T+L VV K +  DW  +YETL
Sbjct  180  EYLITMLVVVPKTNYPDWQKTYETL  204



>ref|XP_009076362.1| PREDICTED: V-type proton ATPase subunit C 1 [Acanthisitta chloris]
Length=382

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +K++  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKHNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKMNYNDWVKQYETLA  205



>ref|XP_006636047.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Lepisosteus 
oculatus]
Length=382

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 129/205 (63%), Gaps = 4/205 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + ++N+  +  ++FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WDKLMVATTRNNNLSTNHKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K ++F+E V  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVESVVKKVAQYMADVLEDSRDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +  QV +I++DLK R + Y++++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIISKQVTQIDNDLKSRASAYNSLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETL  693
            E+L TLL VV K S  DW  +YETL
Sbjct  180  EYLITLLVVVPKTSYADWQRTYETL  204



>ref|XP_005042435.1| PREDICTED: V-type proton ATPase subunit C 1 [Ficedula albicollis]
 ref|XP_005479510.1| PREDICTED: V-type proton ATPase subunit C 1 [Zonotrichia albicollis]
 ref|XP_005423522.1| PREDICTED: V-type proton ATPase subunit C 1 [Geospiza fortis]
 ref|XP_005517033.1| PREDICTED: V-type proton ATPase subunit C 1 [Pseudopodoces humilis]
 ref|XP_008628893.1| PREDICTED: V-type proton ATPase subunit C 1 [Corvus brachyrhynchos]
 ref|XP_009085610.1| PREDICTED: V-type proton ATPase subunit C 1 [Serinus canaria]
 ref|XP_010403207.1| PREDICTED: V-type proton ATPase subunit C 1 [Corvus cornix cornix]
Length=382

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +K++  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKHNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKLNYNDWVKQYETLA  205



>ref|XP_007488239.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Monodelphis 
domestica]
Length=444

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + ++ +  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  64   TEFWLISAPGEKTCQQT--WEKLHSATTRINNLSHNSKFNIPDLKVGTLDVLVGLSDELA  121

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  122  KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  181

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  182  NISEIIGKGVNQIDNDLKARASAYNNLKGSLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  241

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K + KDW+  YETL 
Sbjct  242  EYLITLLVVVPKLNHKDWVKQYETLA  267



>ref|NP_989172.1| V-type proton ATPase subunit C 1 [Xenopus (Silurana) tropicalis]
 sp|Q6P4Y9.1|VATC1_XENTR RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Xenopus (Silurana) tropicalis]
 gb|AAH63194.1| ATPase, H+ transporting, lysosomal V1 subunit C1 [Xenopus (Silurana) 
tropicalis]
 emb|CAJ81546.1| ATPase, H+ transporting, lysosomal, V1 subunit C, isoform 1 [Xenopus 
(Silurana) tropicalis]
Length=382

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLMAATTKNNNLSTNAKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EG   K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGTVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLITRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLITLLVVVPKNNYNDWVKQYETLA  205



>ref|XP_010017127.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Nestor 
notabilis]
Length=382

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   + +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKVINQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKSNYNDWVKQYETLA  205



>ref|XP_009680642.1| PREDICTED: V-type proton ATPase subunit C 1 [Struthio camelus 
australis]
 ref|XP_009935815.1| PREDICTED: V-type proton ATPase subunit C 1 [Opisthocomus hoazin]
 ref|XP_009966842.1| PREDICTED: V-type proton ATPase subunit C 1 [Tyto alba]
Length=382

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 127/206 (62%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +K++  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKSNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL +V K +  DW+  YETL 
Sbjct  180  EYLVTLLVIVPKLNYNDWVKQYETLA  205



>ref|XP_010883497.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Esox 
lucius]
Length=382

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 128/205 (62%), Gaps = 4/205 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W ++  + ++ +  +   +FNIP+L+VGTLD+L+ LSDDL 
Sbjct  2    TEFWLISAPGEKTCQQT--WDQMMVATTRTNNLSTNNKFNIPDLKVGTLDVLVGLSDDLA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K ++F EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFTEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLI-TS  618
               + +  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIISKQVTQIDNDLKARASSYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETL  693
            E+L T+L VV K S  DW  +YETL
Sbjct  180  EYLITMLVVVPKTSYADWQKTYETL  204



>gb|KFO20049.1| V-type proton ATPase subunit C 1 [Fukomys damarensis]
Length=382

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +K++      +F+IP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKSNNLAATSKFSIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLITLLVVVPKMNHNDWIKQYETLA  205



>ref|XP_010610418.1| PREDICTED: V-type proton ATPase subunit C 1 [Fukomys damarensis]
 ref|XP_010610419.1| PREDICTED: V-type proton ATPase subunit C 1 [Fukomys damarensis]
 ref|XP_010610420.1| PREDICTED: V-type proton ATPase subunit C 1 [Fukomys damarensis]
 ref|XP_010610421.1| PREDICTED: V-type proton ATPase subunit C 1 [Fukomys damarensis]
Length=384

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 126/206 (61%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +K++      +F+IP+L+VGTLD+L+ LSD+L 
Sbjct  4    TEFWLISAPGEKTCQQT--WEKLHAATTKSNNLAATSKFSIPDLKVGTLDVLVGLSDELA  61

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  62   KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  121

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK +D +  S
Sbjct  122  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDS  181

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  182  EYLITLLVVVPKMNHNDWIKQYETLA  207



>ref|XP_005803508.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Xiphophorus 
maculatus]
Length=383

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 130/205 (63%), Gaps = 4/205 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + ++ +  +  ++F+IP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WDKLMAATTRTNNLSTNHKFSIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K ++F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +  QV++I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIISKQVSQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETL  693
            E+L T+L VV K +  DW  +YETL
Sbjct  180  EYLITMLVVVPKINYPDWQKTYETL  204



>dbj|BAB24526.1| unnamed protein product [Mus musculus]
Length=382

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 124/206 (60%), Gaps = 4/206 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R  + +VK +D +  S
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKENLQNLERKNAGSLLTRSSAEIVKKDDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETLT  696
            E+L TLL VV K +  DW+  YETL 
Sbjct  180  EYLVTLLVVVPKLNHNDWIKQYETLA  205



>ref|XP_005917491.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Haplochromis 
burtoni]
Length=382

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 127/205 (62%), Gaps = 4/205 (2%)
 Frame = +1

Query  85   SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  264
            + +W++S P +++   T  W +L  + ++ +  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WDKLMVATTRTNNLSTNNKFNIPDLKVGTLDVLVGLSDELA  59

Query  265  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  441
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDTFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYVTRFQWDMAKYPIKQSLK  119

Query  442  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVKPEDLIT-S  618
               + +  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK ED +  S
Sbjct  120  NISEIISKQVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLMTRSLADIVKKEDFVLDS  179

Query  619  EHLTTLLAVVSKFSQKDWLASYETL  693
            E+L T+L VV K S  DW  +YETL
Sbjct  180  EYLITMLVVVPKTSYADWQKTYETL  204



Lambda      K        H        a         alpha
   0.316    0.129    0.365    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1239542226394