BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9192

Length=1024
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001234317.1|  TBG6 protein precursor                             480   1e-159   Solanum lycopersicum
ref|XP_006340680.1|  PREDICTED: beta-galactosidase 3-like               480   1e-159   Solanum tuberosum [potatoes]
gb|ADO34791.1|  beta-galactosidase STBG6                                477   2e-158   Solanum lycopersicum
ref|XP_009628690.1|  PREDICTED: beta-galactosidase 3                    475   1e-157   Nicotiana tomentosiformis
ref|XP_009789452.1|  PREDICTED: beta-galactosidase 3                    473   7e-157   Nicotiana sylvestris
gb|EYU24087.1|  hypothetical protein MIMGU_mgv1a001258mg                473   9e-157   Erythranthe guttata [common monkey flower]
gb|KHF97862.1|  Beta-galactosidase 3                                    452   7e-153   Gossypium arboreum [tree cotton]
ref|XP_011100972.1|  PREDICTED: beta-galactosidase 3-like               459   2e-151   Sesamum indicum [beniseed]
gb|EYU31167.1|  hypothetical protein MIMGU_mgv1a001956mg                456   2e-151   Erythranthe guttata [common monkey flower]
ref|XP_007046795.1|  Beta-galactosidase 3 isoform 2                     453   6e-151   
gb|KJB43420.1|  hypothetical protein B456_007G198900                    450   9e-151   Gossypium raimondii
gb|KDO71054.1|  hypothetical protein CISIN_1g003044mg                   450   1e-150   Citrus sinensis [apfelsine]
gb|EPS70273.1|  beta-galactosidase                                      449   5e-150   Genlisea aurea
ref|XP_007046794.1|  Beta-galactosidase 3 isoform 1                     454   3e-149   
gb|KJB43418.1|  hypothetical protein B456_007G198900                    449   3e-149   Gossypium raimondii
gb|KDO71053.1|  hypothetical protein CISIN_1g003044mg                   449   6e-148   Citrus sinensis [apfelsine]
gb|KJB43423.1|  hypothetical protein B456_007G198900                    449   6e-148   Gossypium raimondii
gb|KDO71052.1|  hypothetical protein CISIN_1g003044mg                   449   2e-147   Citrus sinensis [apfelsine]
gb|KJB43424.1|  hypothetical protein B456_007G198900                    449   2e-147   Gossypium raimondii
gb|KJB43419.1|  hypothetical protein B456_007G198900                    449   2e-147   Gossypium raimondii
gb|KJB43422.1|  hypothetical protein B456_007G198900                    449   2e-147   Gossypium raimondii
ref|XP_007204246.1|  hypothetical protein PRUPE_ppa002271mg             443   4e-147   
ref|XP_010649088.1|  PREDICTED: beta-galactosidase 3                    447   7e-147   Vitis vinifera
gb|KJB17716.1|  hypothetical protein B456_003G011900                    447   1e-146   Gossypium raimondii
ref|XP_010113483.1|  Beta-galactosidase 3                               446   2e-146   Morus notabilis
ref|XP_006425593.1|  hypothetical protein CICLE_v10024881mg             446   3e-146   Citrus clementina [clementine]
ref|XP_004287850.1|  PREDICTED: beta-galactosidase 3                    446   4e-146   Fragaria vesca subsp. vesca
ref|XP_007158612.1|  hypothetical protein PHAVU_002G1672000g            429   5e-146   Phaseolus vulgaris [French bean]
ref|XP_006380782.1|  hypothetical protein POPTR_0007s13540g             438   6e-146   
gb|AAW47739.1|  beta-galactosidase                                      444   2e-145   Prunus persica
ref|XP_008241765.1|  PREDICTED: beta-galactosidase 3                    442   9e-145   Prunus mume [ume]
gb|KJB58183.1|  hypothetical protein B456_009G198100                    432   3e-144   Gossypium raimondii
ref|XP_006412010.1|  hypothetical protein EUTSA_v10024387mg             433   4e-144   
ref|XP_011025878.1|  PREDICTED: beta-galactosidase 3                    440   4e-144   Populus euphratica
ref|XP_008440778.1|  PREDICTED: beta-galactosidase 3                    440   5e-144   Cucumis melo [Oriental melon]
ref|NP_568001.1|  beta-galactosidase 3                                  440   8e-144   Arabidopsis thaliana [mouse-ear cress]
emb|CAA18137.1|  beta-galactosidase like protein                        439   9e-144   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849506.1|  beta-galactosidase 3                                  439   1e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004149980.1|  PREDICTED: beta-galactosidase 3                    439   1e-143   Cucumis sativus [cucumbers]
ref|XP_011083163.1|  PREDICTED: beta-galactosidase 3                    438   2e-143   Sesamum indicum [beniseed]
ref|XP_008337843.1|  PREDICTED: beta-galactosidase 3                    438   2e-143   
ref|XP_006283100.1|  hypothetical protein CARUB_v10004117mg             437   3e-143   
ref|XP_010029731.1|  PREDICTED: beta-galactosidase 3                    438   3e-143   Eucalyptus grandis [rose gum]
emb|CAN78072.1|  hypothetical protein VITISV_013292                     437   5e-143   Vitis vinifera
ref|NP_001268162.1|  beta-galactosidase BG1-like precursor              437   5e-143   Vitis vinifera
emb|CBI19767.3|  unnamed protein product                                437   6e-143   Vitis vinifera
emb|CDP01954.1|  unnamed protein product                                437   6e-143   Coffea canephora [robusta coffee]
ref|XP_002310279.2|  beta-galactosidase family protein                  437   7e-143   
ref|XP_010531064.1|  PREDICTED: beta-galactosidase 3                    437   8e-143   Tarenaya hassleriana [spider flower]
emb|CAB16852.1|  beta-galactosidase like protein                        436   1e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283101.1|  hypothetical protein CARUB_v10004117mg             437   1e-142   Capsella rubella
ref|XP_010437358.1|  PREDICTED: beta-galactosidase 3-like               436   3e-142   Camelina sativa [gold-of-pleasure]
dbj|BAD91082.1|  beta-D-galactosidase                                   436   3e-142   Pyrus pyrifolia [sha li]
ref|XP_008338023.1|  PREDICTED: beta-galactosidase 3-like               435   4e-142   
gb|KHG23756.1|  Beta-galactosidase 5 -like protein                      432   5e-142   Gossypium arboreum [tree cotton]
gb|KJB58182.1|  hypothetical protein B456_009G198100                    431   6e-142   Gossypium raimondii
ref|XP_012078404.1|  PREDICTED: beta-galactosidase 3                    434   7e-142   Jatropha curcas
ref|XP_010446807.1|  PREDICTED: beta-galactosidase 3                    434   9e-142   Camelina sativa [gold-of-pleasure]
ref|XP_010432182.1|  PREDICTED: beta-galactosidase 3-like               434   9e-142   Camelina sativa [gold-of-pleasure]
gb|KJB63588.1|  hypothetical protein B456_010G007300                    426   1e-141   Gossypium raimondii
ref|XP_002510455.1|  beta-galactosidase, putative                       433   2e-141   Ricinus communis
ref|XP_003520277.1|  PREDICTED: beta-galactosidase 3-like               433   3e-141   Glycine max [soybeans]
ref|XP_009145073.1|  PREDICTED: beta-galactosidase 3                    433   3e-141   Brassica rapa
emb|CDX75569.1|  BnaA01g01330D                                          432   3e-141   
ref|XP_002867020.1|  hypothetical protein ARALYDRAFT_491000             432   4e-141   
gb|KDO84692.1|  hypothetical protein CISIN_1g003076mg                   426   7e-141   Citrus sinensis [apfelsine]
ref|XP_006412011.1|  hypothetical protein EUTSA_v10024387mg             432   7e-141   Eutrema salsugineum [saltwater cress]
ref|XP_010254673.1|  PREDICTED: beta-galactosidase 3-like               432   8e-141   Nelumbo nucifera [Indian lotus]
gb|KJB63586.1|  hypothetical protein B456_010G007300                    422   1e-140   Gossypium raimondii
ref|XP_003538867.1|  PREDICTED: beta-galactosidase 3-like               431   2e-140   Glycine max [soybeans]
ref|XP_007156097.1|  hypothetical protein PHAVU_003G258300g             431   2e-140   Phaseolus vulgaris [French bean]
gb|KHN36067.1|  Beta-galactosidase 3                                    431   3e-140   Glycine soja [wild soybean]
gb|KFK30264.1|  hypothetical protein AALP_AA7G238600                    431   3e-140   Arabis alpina [alpine rockcress]
ref|XP_003517202.1|  PREDICTED: beta-galactosidase 3-like               430   3e-140   
ref|XP_004509327.1|  PREDICTED: beta-galactosidase 3-like               430   3e-140   
ref|XP_003548865.1|  PREDICTED: beta-galactosidase 3-like               430   3e-140   Glycine max [soybeans]
dbj|BAJ34544.1|  unnamed protein product                                431   3e-140   Eutrema halophilum
gb|KHN27041.1|  Beta-galactosidase 3                                    430   4e-140   Glycine soja [wild soybean]
ref|XP_002263382.2|  PREDICTED: beta-galactosidase 3                    429   5e-140   Vitis vinifera
dbj|BAF31234.1|  beta-D-galactosidase                                   429   1e-139   Persea americana
gb|KHG11061.1|  Beta-galactosidase 5 -like protein                      426   1e-139   Gossypium arboreum [tree cotton]
ref|XP_004512085.1|  PREDICTED: beta-galactosidase 3-like               429   1e-139   Cicer arietinum [garbanzo]
gb|KJB63587.1|  hypothetical protein B456_010G007300                    425   1e-139   Gossypium raimondii
gb|KJB63585.1|  hypothetical protein B456_010G007300                    425   2e-139   Gossypium raimondii
ref|XP_010275526.1|  PREDICTED: beta-galactosidase 3-like               428   2e-139   Nelumbo nucifera [Indian lotus]
ref|XP_002305449.1|  beta-galactosidase family protein                  424   3e-139   Populus trichocarpa [western balsam poplar]
ref|XP_007160714.1|  hypothetical protein PHAVU_001G010900g             424   5e-139   Phaseolus vulgaris [French bean]
gb|KDO84691.1|  hypothetical protein CISIN_1g003076mg                   424   6e-139   Citrus sinensis [apfelsine]
ref|XP_012071945.1|  PREDICTED: beta-galactosidase 5                    427   7e-139   Jatropha curcas
ref|XP_006473573.1|  PREDICTED: beta-galactosidase 3-like               427   8e-139   Citrus sinensis [apfelsine]
gb|KDO84689.1|  hypothetical protein CISIN_1g003076mg                   425   1e-138   Citrus sinensis [apfelsine]
gb|KDO84690.1|  hypothetical protein CISIN_1g003076mg                   425   1e-138   Citrus sinensis [apfelsine]
emb|CDY59693.1|  BnaC07g51120D                                          426   2e-138   Brassica napus [oilseed rape]
gb|KHN00504.1|  Beta-galactosidase 3                                    425   3e-138   Glycine soja [wild soybean]
emb|CDX69219.1|  BnaC01g02340D                                          425   3e-138   
gb|KHN12675.1|  Beta-galactosidase 5                                    422   3e-138   Glycine soja [wild soybean]
ref|XP_011037170.1|  PREDICTED: beta-galactosidase 5-like               423   4e-138   Populus euphratica
gb|KDO84688.1|  hypothetical protein CISIN_1g003076mg                   425   4e-138   Citrus sinensis [apfelsine]
ref|XP_006435076.1|  hypothetical protein CICLE_v10000260mg             425   4e-138   Citrus clementina [clementine]
ref|XP_009603021.1|  PREDICTED: beta-galactosidase 5                    421   5e-138   Nicotiana tomentosiformis
emb|CDO97013.1|  unnamed protein product                                421   6e-138   Coffea canephora [robusta coffee]
ref|XP_009761050.1|  PREDICTED: beta-galactosidase 5                    421   8e-138   Nicotiana sylvestris
ref|XP_003589339.1|  Beta-galactosidase                                 421   1e-137   Medicago truncatula
ref|XP_007042084.1|  Beta-galactosidase 3 isoform 2                     416   3e-137   
gb|KHN41933.1|  Beta-galactosidase 3                                    423   3e-137   Glycine soja [wild soybean]
ref|XP_004238611.1|  PREDICTED: beta-galactosidase 5                    419   3e-137   Solanum lycopersicum
ref|NP_001265904.1|  beta-galactosidase 5-like precursor                419   5e-137   Cicer arietinum [garbanzo]
ref|XP_002306893.1|  beta-galactosidase family protein                  422   5e-137   Populus trichocarpa [western balsam poplar]
ref|XP_003612092.1|  Beta-galactosidase                                 422   6e-137   Medicago truncatula
ref|XP_006342225.1|  PREDICTED: beta-galactosidase 3-like               417   1e-136   
gb|KHN20946.1|  Beta-galactosidase 5                                    417   1e-136   Glycine soja [wild soybean]
ref|XP_009129554.1|  PREDICTED: beta-galactosidase 5                    417   2e-136   Brassica rapa
ref|XP_007225291.1|  hypothetical protein PRUPE_ppa001334mg             420   3e-136   Prunus persica
ref|XP_010552493.1|  PREDICTED: beta-galactosidase 5                    417   3e-136   Tarenaya hassleriana [spider flower]
dbj|BAD91085.1|  beta-D-galactosidase                                   420   3e-136   Pyrus pyrifolia [sha li]
ref|XP_011048837.1|  PREDICTED: beta-galactosidase 5                    420   4e-136   Populus euphratica
gb|AAF67342.1|  beta galactosidase                                      416   4e-136   Vigna radiata [mung bean]
ref|XP_004291830.1|  PREDICTED: beta-galactosidase 5                    416   4e-136   Fragaria vesca subsp. vesca
gb|KCW64027.1|  hypothetical protein EUGRSUZ_G01704                     410   5e-136   Eucalyptus grandis [rose gum]
ref|XP_008221339.1|  PREDICTED: beta-galactosidase 5                    419   5e-136   Prunus mume [ume]
gb|KJB32548.1|  hypothetical protein B456_005G246600                    411   5e-136   Gossypium raimondii
ref|XP_007042083.1|  Beta-galactosidase 3 isoform 1                     416   7e-136   Theobroma cacao [chocolate]
ref|XP_008377189.1|  PREDICTED: beta-galactosidase 5-like               419   9e-136   
ref|XP_006393673.1|  hypothetical protein EUTSA_v10011265mg             415   9e-136   Eutrema salsugineum [saltwater cress]
emb|CDY47949.1|  BnaA10g28210D                                          415   1e-135   Brassica napus [oilseed rape]
emb|CDY53959.1|  BnaCnng25850D                                          415   1e-135   Brassica napus [oilseed rape]
ref|XP_010061261.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    415   2e-135   Eucalyptus grandis [rose gum]
ref|XP_011083609.1|  PREDICTED: beta-galactosidase 3-like               418   2e-135   Sesamum indicum [beniseed]
ref|XP_004147848.1|  PREDICTED: beta-galactosidase 5-like               417   2e-135   Cucumis sativus [cucumbers]
ref|XP_012067207.1|  PREDICTED: beta-galactosidase 3-like               414   3e-135   Jatropha curcas
ref|XP_007199661.1|  hypothetical protein PRUPE_ppa001363mg             417   3e-135   Prunus persica
gb|ABF94150.1|  Beta-galactosidase precursor, putative, expressed       416   5e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008466519.1|  PREDICTED: beta-galactosidase 5-like               417   6e-135   Cucumis melo [Oriental melon]
ref|XP_008236954.1|  PREDICTED: beta-galactosidase 3-like               417   6e-135   Prunus mume [ume]
ref|XP_010110010.1|  Beta-galactosidase 3                               416   7e-135   
gb|AGR44466.1|  beta-D-galactosidase 7                                  416   8e-135   Pyrus x bretschneideri [bai li]
ref|XP_008388000.1|  PREDICTED: beta-galactosidase 5                    416   8e-135   
gb|AAM22973.1|AF499737_1  beta-galactosidase                            416   8e-135   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049068.1|  Os03g0165400                                       416   8e-135   
ref|XP_011092826.1|  PREDICTED: beta-galactosidase 3                    412   1e-134   Sesamum indicum [beniseed]
ref|XP_008382310.1|  PREDICTED: beta-galactosidase 5-like               416   1e-134   
ref|XP_008799994.1|  PREDICTED: beta-galactosidase 5-like               416   1e-134   Phoenix dactylifera
ref|XP_009396354.1|  PREDICTED: beta-galactosidase 5-like               416   2e-134   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU42595.1|  hypothetical protein MIMGU_mgv1a001990mg                411   3e-134   Erythranthe guttata [common monkey flower]
ref|XP_006306871.1|  hypothetical protein CARUB_v10008424mg             412   3e-134   Capsella rubella
dbj|BAD91084.1|  beta-D-galactosidase                                   415   3e-134   Pyrus pyrifolia [sha li]
ref|XP_006649450.1|  PREDICTED: beta-galactosidase 5-like               414   3e-134   Oryza brachyantha
ref|XP_009614464.1|  PREDICTED: beta-galactosidase 3-like               411   4e-134   Nicotiana tomentosiformis
ref|XP_010066194.1|  PREDICTED: beta-galactosidase 5-like isoform X3    410   4e-134   
gb|KJB32549.1|  hypothetical protein B456_005G246600                    410   5e-134   Gossypium raimondii
ref|XP_008452119.1|  PREDICTED: beta-galactosidase 3-like               414   5e-134   Cucumis melo [Oriental melon]
ref|XP_010315322.1|  PREDICTED: beta-galactosidase 3-like               410   7e-134   Solanum lycopersicum
gb|KFK36177.1|  hypothetical protein AALP_AA4G088200                    410   9e-134   Arabis alpina [alpine rockcress]
ref|XP_009777047.1|  PREDICTED: beta-galactosidase 3-like               410   1e-133   Nicotiana sylvestris
gb|KJB32547.1|  hypothetical protein B456_005G246600                    410   1e-133   Gossypium raimondii
ref|XP_004146490.1|  PREDICTED: beta-galactosidase 3-like               413   1e-133   Cucumis sativus [cucumbers]
ref|XP_009335672.1|  PREDICTED: beta-galactosidase 5                    413   2e-133   Pyrus x bretschneideri [bai li]
ref|XP_010066191.1|  PREDICTED: beta-galactosidase 5-like isoform X1    409   3e-133   Eucalyptus grandis [rose gum]
ref|XP_010066193.1|  PREDICTED: beta-galactosidase 5-like isoform X2    409   3e-133   Eucalyptus grandis [rose gum]
ref|XP_010917686.1|  PREDICTED: beta-galactosidase 5-like               412   3e-133   Elaeis guineensis
ref|XP_006838689.1|  PREDICTED: beta-galactosidase 5                    412   4e-133   Amborella trichopoda
gb|KEH36209.1|  beta-galactosidase-like protein                         409   4e-133   Medicago truncatula
ref|XP_011457728.1|  PREDICTED: beta-galactosidase 3-like               412   5e-133   Fragaria vesca subsp. vesca
ref|XP_003558743.1|  PREDICTED: beta-galactosidase 5                    411   6e-133   Brachypodium distachyon [annual false brome]
ref|XP_006362025.1|  PREDICTED: beta-galactosidase 3-like               408   7e-133   Solanum tuberosum [potatoes]
ref|XP_007136038.1|  hypothetical protein PHAVU_009G012700g             408   8e-133   Phaseolus vulgaris [French bean]
ref|XP_008660537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    411   8e-133   Zea mays [maize]
ref|XP_009107461.1|  PREDICTED: beta-galactosidase 5-like isoform X1    407   9e-133   
ref|XP_010932916.1|  PREDICTED: beta-galactosidase 5-like               411   9e-133   Elaeis guineensis
ref|XP_002891311.1|  hypothetical protein ARALYDRAFT_473836             407   1e-132   
gb|AAL24206.1|  At1g45130/F27F5_20                                      407   1e-132   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175127.1|  beta-galactosidase 5                                  407   1e-132   Arabidopsis thaliana [mouse-ear cress]
emb|CAB64741.1|  putative beta-galactosidase                            407   1e-132   Arabidopsis thaliana [mouse-ear cress]
gb|EYU32887.1|  hypothetical protein MIMGU_mgv1a001295mg                410   2e-132   Erythranthe guttata [common monkey flower]
ref|XP_008809207.1|  PREDICTED: beta-galactosidase 5-like               410   2e-132   Phoenix dactylifera
ref|XP_007017651.1|  Beta-galactosidase 5 isoform 1                     407   2e-132   
ref|XP_009395554.1|  PREDICTED: beta-galactosidase 5                    410   2e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004500970.1|  PREDICTED: beta-galactosidase 5-like isoform X2    403   2e-132   
ref|XP_003523710.1|  PREDICTED: beta-galactosidase 3-like isoform 1     406   4e-132   Glycine max [soybeans]
gb|KHN45883.1|  Beta-galactosidase 5                                    405   4e-132   Glycine soja [wild soybean]
ref|XP_010679814.1|  PREDICTED: beta-galactosidase 3                    409   9e-132   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008643999.1|  PREDICTED: uncharacterized protein LOC100382...    408   1e-131   Zea mays [maize]
emb|CDY36028.1|  BnaA08g04330D                                          404   1e-131   Brassica napus [oilseed rape]
gb|EEE58382.1|  hypothetical protein OsJ_09539                          408   2e-131   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74580.1|  hypothetical protein OsI_10152                          408   2e-131   Oryza sativa Indica Group [Indian rice]
dbj|BAJ96054.1|  predicted protein                                      405   2e-130   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004500969.1|  PREDICTED: beta-galactosidase 5-like isoform X1    402   2e-130   Cicer arietinum [garbanzo]
dbj|BAK07157.1|  predicted protein                                      405   2e-130   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP07463.1|  unnamed protein product                                405   3e-130   Coffea canephora [robusta coffee]
ref|XP_002465807.1|  hypothetical protein SORBIDRAFT_01g046160          404   4e-130   Sorghum bicolor [broomcorn]
ref|XP_004985588.1|  PREDICTED: beta-galactosidase 5-like isoform X1    403   1e-129   Setaria italica
ref|XP_010107841.1|  Beta-galactosidase 3                               403   1e-129   Morus notabilis
ref|XP_002512959.1|  beta-galactosidase, putative                       399   2e-129   Ricinus communis
gb|ABR16628.1|  unknown                                                 402   2e-129   Picea sitchensis
gb|EMT10014.1|  Beta-galactosidase 5                                    397   2e-127   
gb|AHL69742.1|  beta-galactosidase                                      396   3e-127   Hylocereus undatus [dragon fruit]
ref|XP_009418405.1|  PREDICTED: beta-galactosidase 5-like isoform X2    396   4e-127   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418404.1|  PREDICTED: beta-galactosidase 5-like isoform X1    396   5e-127   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW69753.1|  hypothetical protein EUGRSUZ_F031302                    384   3e-126   Eucalyptus grandis [rose gum]
gb|KDP40776.1|  hypothetical protein JCGZ_24775                         384   5e-126   Jatropha curcas
gb|KCW69752.1|  hypothetical protein EUGRSUZ_F031302                    384   6e-126   Eucalyptus grandis [rose gum]
gb|KCW68186.1|  hypothetical protein EUGRSUZ_F01855                     389   7e-126   Eucalyptus grandis [rose gum]
gb|KJB65165.1|  hypothetical protein B456_010G082900                    387   9e-126   Gossypium raimondii
gb|KDO49473.1|  hypothetical protein CISIN_1g0051602mg                  379   1e-125   Citrus sinensis [apfelsine]
ref|XP_011077976.1|  PREDICTED: beta-galactosidase-like                 389   1e-125   Sesamum indicum [beniseed]
gb|EYU45189.1|  hypothetical protein MIMGU_mgv1a003101mg                385   2e-125   Erythranthe guttata [common monkey flower]
ref|XP_010242207.1|  PREDICTED: beta-galactosidase                      391   3e-125   Nelumbo nucifera [Indian lotus]
ref|XP_006353531.1|  PREDICTED: beta-galactosidase-like                 387   7e-125   Solanum tuberosum [potatoes]
ref|XP_004150073.1|  PREDICTED: beta-galactosidase 5                    390   1e-124   Cucumis sativus [cucumbers]
gb|KJB65166.1|  hypothetical protein B456_010G082900                    385   1e-124   Gossypium raimondii
ref|XP_009409594.1|  PREDICTED: beta-galactosidase-like                 387   1e-124   
gb|AAC25984.1|  beta-galactosidase                                      385   3e-124   Solanum lycopersicum
gb|EPS69033.1|  beta-galactosidase                                      385   4e-124   Genlisea aurea
pdb|3W5F|A  Chain A, Crystal Structure Of Tomato Beta-galactosida...    385   5e-124   Solanum lycopersicum
gb|ADO34789.1|  beta-galactosidase STBG4                                385   6e-124   Solanum lycopersicum
gb|KEH39519.1|  beta-galactosidase                                      380   7e-124   Medicago truncatula
ref|XP_009768469.1|  PREDICTED: beta-galactosidase-like                 387   9e-124   Nicotiana sylvestris
gb|ADV41669.1|  beta-D-galactosidase                                    384   1e-123   Actinidia deliciosa var. deliciosa
ref|NP_001234842.1|  ss-galactosidase precursor                         383   2e-123   
emb|CAA09467.1|  exo galactanase                                        383   3e-123   Lupinus angustifolius
ref|XP_010911412.1|  PREDICTED: beta-galactosidase-like                 378   4e-123   Elaeis guineensis
gb|KJB65169.1|  hypothetical protein B456_010G082900                    385   5e-123   Gossypium raimondii
gb|KDO57768.1|  hypothetical protein CISIN_1g004219mg                   379   5e-123   Citrus sinensis [apfelsine]
ref|XP_009402923.1|  PREDICTED: beta-galactosidase-like                 382   6e-123   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO57767.1|  hypothetical protein CISIN_1g004219mg                   379   6e-123   Citrus sinensis [apfelsine]
gb|KDO57766.1|  hypothetical protein CISIN_1g004219mg                   380   6e-123   Citrus sinensis [apfelsine]
ref|XP_006423393.1|  hypothetical protein CICLE_v10030257mg             382   9e-123   
gb|KJB65167.1|  hypothetical protein B456_010G082900                    385   9e-123   Gossypium raimondii
gb|AAF67341.1|  beta galactosidase                                      381   1e-122   Vigna radiata [mung bean]
ref|XP_006487343.1|  PREDICTED: beta-galactosidase 3-like               381   1e-122   Citrus sinensis [apfelsine]
ref|XP_010479073.1|  PREDICTED: beta-galactosidase 5                    382   1e-122   Camelina sativa [gold-of-pleasure]
gb|KJB65170.1|  hypothetical protein B456_010G082900                    384   1e-122   Gossypium raimondii
ref|XP_003543598.1|  PREDICTED: beta-galactosidase 1-like               384   1e-122   Glycine max [soybeans]
ref|XP_008450853.1|  PREDICTED: beta-galactosidase-like                 381   1e-122   Cucumis melo [Oriental melon]
ref|NP_001266133.1|  beta-galactosidase-like                            381   1e-122   Cicer arietinum [garbanzo]
gb|KCW53602.1|  hypothetical protein EUGRSUZ_J02867                     379   2e-122   Eucalyptus grandis [rose gum]
ref|XP_009388558.1|  PREDICTED: beta-galactosidase-like                 381   2e-122   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009762312.1|  PREDICTED: beta-galactosidase-like                 380   2e-122   Nicotiana sylvestris
ref|XP_010262131.1|  PREDICTED: beta-galactosidase isoform X1           384   2e-122   Nelumbo nucifera [Indian lotus]
ref|XP_010262132.1|  PREDICTED: beta-galactosidase isoform X2           384   2e-122   Nelumbo nucifera [Indian lotus]
ref|XP_007138730.1|  hypothetical protein PHAVU_009G232500g             380   3e-122   Phaseolus vulgaris [French bean]
ref|XP_006357461.1|  PREDICTED: beta-galactosidase-like                 384   3e-122   
ref|XP_010062625.1|  PREDICTED: beta-galactosidase 1                    383   4e-122   
ref|XP_009599425.1|  PREDICTED: beta-galactosidase-like                 380   4e-122   Nicotiana tomentosiformis
ref|XP_003531618.1|  PREDICTED: beta-galactosidase 1-like               383   4e-122   Glycine max [soybeans]
ref|XP_009409593.1|  PREDICTED: beta-galactosidase-like                 379   5e-122   
ref|XP_011072510.1|  PREDICTED: beta-galactosidase-like                 383   5e-122   Sesamum indicum [beniseed]
gb|KHN32687.1|  Beta-galactosidase 1                                    382   6e-122   Glycine soja [wild soybean]
gb|KCW53601.1|  hypothetical protein EUGRSUZ_J02867                     379   6e-122   Eucalyptus grandis [rose gum]
gb|KDO57765.1|  hypothetical protein CISIN_1g004219mg                   379   6e-122   Citrus sinensis [apfelsine]
gb|KHN30042.1|  Beta-galactosidase 1                                    382   6e-122   Glycine soja [wild soybean]
ref|XP_012068994.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    382   7e-122   Jatropha curcas
tpg|DAA43551.1|  TPA: beta-galactosidase                                384   7e-122   
gb|EYU28411.1|  hypothetical protein MIMGU_mgv1a024117mg                379   8e-122   Erythranthe guttata [common monkey flower]
ref|XP_003546676.1|  PREDICTED: beta-galactosidase 1-like               382   8e-122   Glycine max [soybeans]
ref|XP_007024475.1|  Beta galactosidase 1                               382   1e-121   
ref|XP_011093727.1|  PREDICTED: beta-galactosidase-like                 379   1e-121   Sesamum indicum [beniseed]
ref|XP_004241849.1|  PREDICTED: beta-galactosidase-like                 382   1e-121   Solanum lycopersicum
gb|ACP18874.1|  beta-galactosidase pBG(b)                               372   1e-121   Carica papaya [mamon]
gb|KDO57764.1|  hypothetical protein CISIN_1g004219mg                   378   1e-121   Citrus sinensis [apfelsine]
gb|KCW79522.1|  hypothetical protein EUGRSUZ_C00898                     375   1e-121   Eucalyptus grandis [rose gum]
ref|XP_011659980.1|  PREDICTED: beta-galactosidase-like                 378   2e-121   Cucumis sativus [cucumbers]
ref|XP_003595163.1|  Beta-galactosidase                                 375   2e-121   
gb|KJB07253.1|  hypothetical protein B456_001G011600                    376   2e-121   Gossypium raimondii
dbj|BAE72073.1|  pear beta-galactosidase1                               378   2e-121   Pyrus communis
ref|XP_002308268.2|  hypothetical protein POPTR_0006s14680g             381   2e-121   Populus trichocarpa [western balsam poplar]
gb|KEH18344.1|  beta-galactosidase                                      381   2e-121   Medicago truncatula
gb|AAB61470.1|  beta-D-galactosidase                                    376   2e-121   Mangifera indica
ref|XP_008460995.1|  PREDICTED: beta-galactosidase 5-like               381   2e-121   Cucumis melo [Oriental melon]
ref|XP_006451459.1|  hypothetical protein CICLE_v10007531mg             377   2e-121   
ref|XP_011045966.1|  PREDICTED: beta-galactosidase-like isoform X2      381   2e-121   Populus euphratica
ref|XP_006587007.1|  PREDICTED: beta-galactosidase-like                 374   3e-121   
ref|XP_008805774.1|  PREDICTED: beta-galactosidase-like isoform X2      381   3e-121   Phoenix dactylifera
ref|XP_009408846.1|  PREDICTED: beta-galactosidase-like                 378   3e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009757670.1|  PREDICTED: beta-galactosidase-like isoform X1      380   3e-121   Nicotiana sylvestris
ref|XP_008447606.1|  PREDICTED: beta-galactosidase 1                    381   3e-121   Cucumis melo [Oriental melon]
ref|XP_009352652.1|  PREDICTED: beta-galactosidase                      378   3e-121   Pyrus x bretschneideri [bai li]
ref|XP_009757671.1|  PREDICTED: beta-galactosidase-like isoform X2      380   4e-121   Nicotiana sylvestris
ref|XP_008805772.1|  PREDICTED: beta-galactosidase-like isoform X1      381   4e-121   Phoenix dactylifera
ref|XP_002882842.1|  hypothetical protein ARALYDRAFT_897617             381   4e-121   
emb|CAH18936.1|  beta-galactosidase                                     377   4e-121   
ref|XP_002527409.1|  beta-galactosidase, putative                       380   4e-121   
ref|XP_011080179.1|  PREDICTED: beta-galactosidase-like                 380   4e-121   
dbj|BAB21492.1|  beta-D-galactosidase                                   377   4e-121   
ref|XP_004146823.1|  PREDICTED: beta-galactosidase 1                    380   4e-121   
sp|P48981.1|BGAL_MALDO  RecName: Full=Beta-galactosidase; AltName...    377   4e-121   
gb|KEH37473.1|  beta-like galactosidase                                 375   5e-121   
gb|KDO57763.1|  hypothetical protein CISIN_1g004219mg                   377   5e-121   
ref|XP_009611028.1|  PREDICTED: beta-galactosidase-like isoform X2      380   5e-121   
ref|XP_009611026.1|  PREDICTED: beta-galactosidase-like isoform X1      380   6e-121   
gb|KJB56892.1|  hypothetical protein B456_009G140800                    380   6e-121   
emb|CDY51738.1|  BnaA01g37210D                                          380   6e-121   
ref|NP_001275845.1|  beta-galactosidase                                 377   6e-121   
gb|KDO57762.1|  hypothetical protein CISIN_1g004219mg                   378   7e-121   
ref|XP_006451461.1|  hypothetical protein CICLE_v10007531mg             377   7e-121   
ref|XP_009117469.1|  PREDICTED: beta-galactosidase 1-like               380   7e-121   
gb|KJB07254.1|  hypothetical protein B456_001G011600                    376   7e-121   
dbj|BAF31233.1|  beta-D-galactosidase                                   380   8e-121   
ref|XP_009409595.1|  PREDICTED: beta-galactosidase-like                 377   8e-121   
ref|XP_002514108.1|  beta-galactosidase, putative                       379   1e-120   
ref|XP_007154660.1|  hypothetical protein PHAVU_003G137000g             379   1e-120   
ref|XP_006300095.1|  hypothetical protein CARUB_v10016323mg             379   1e-120   
ref|XP_010672619.1|  PREDICTED: beta-galactosidase 5                    379   1e-120   
ref|XP_006451460.1|  hypothetical protein CICLE_v10007531mg             377   1e-120   
gb|AES65414.2|  beta-like galactosidase                                 375   1e-120   
ref|XP_003597608.1|  Beta-galactosidase                                 379   1e-120   
ref|XP_010487145.1|  PREDICTED: beta-galactosidase 1-like               379   2e-120   
ref|XP_010545349.1|  PREDICTED: beta-galactosidase 12-like isofor...    371   2e-120   
emb|CDX88594.1|  BnaA03g10550D                                          362   2e-120   
ref|XP_012076927.1|  PREDICTED: beta-galactosidase-like                 378   3e-120   
emb|CDY37486.1|  BnaC01g37460D                                          378   3e-120   
gb|KJB07252.1|  hypothetical protein B456_001G011600                    375   3e-120   
ref|NP_001280755.1|  beta-galactosidase precursor                       375   3e-120   
ref|XP_010465236.1|  PREDICTED: beta-galactosidase 1                    378   3e-120   
gb|AAK40304.1|  beta-galactosidase                                      375   3e-120   
dbj|BAC10578.2|  beta-galactosidase                                     375   3e-120   
ref|NP_187988.1|  beta galactosidase 1                                  378   3e-120   
gb|AHG94613.1|  beta-galactosidase                                      375   3e-120   
gb|AAM13196.1|  galactosidase, putative                                 378   4e-120   
emb|CDO97918.1|  unnamed protein product                                378   4e-120   
ref|XP_010501131.1|  PREDICTED: beta-galactosidase 1-like               378   4e-120   
gb|AIU34464.1|  putative beta-galactosidase 1 precursor                 366   4e-120   
ref|XP_003595162.1|  Beta-galactosidase                                 374   5e-120   
ref|XP_010686091.1|  PREDICTED: beta-galactosidase 1                    378   5e-120   
gb|EPS62826.1|  beta-galactosidase                                      372   6e-120   
ref|XP_010033786.1|  PREDICTED: beta-galactosidase 1-like               377   6e-120   
ref|XP_008450854.1|  PREDICTED: beta-galactosidase-like                 374   7e-120   
ref|XP_010536861.1|  PREDICTED: beta-galactosidase 12                   374   8e-120   
ref|XP_009760187.1|  PREDICTED: beta-galactosidase-like isoform X4      376   8e-120   
ref|XP_004486826.1|  PREDICTED: beta-galactosidase 1-like               377   9e-120   
ref|XP_003529875.1|  PREDICTED: beta-galactosidase 1-like               377   9e-120   
ref|XP_009760186.1|  PREDICTED: beta-galactosidase-like isoform X3      376   9e-120   
dbj|BAB83260.1|  beta-D-galactosidase                                   375   9e-120   
ref|XP_010049746.1|  PREDICTED: beta-galactosidase-like                 374   1e-119   
ref|XP_010915229.1|  PREDICTED: beta-galactosidase isoform X2           377   1e-119   
ref|XP_009760185.1|  PREDICTED: beta-galactosidase-like isoform X2      377   1e-119   
ref|XP_009760184.1|  PREDICTED: beta-galactosidase-like isoform X1      376   1e-119   
gb|AHG94611.1|  beta-galactosidase                                      376   2e-119   
gb|ACF22882.1|  beta-galactosidase                                      373   2e-119   
ref|XP_010915228.1|  PREDICTED: beta-galactosidase isoform X1           376   2e-119   
gb|ACJ86256.1|  unknown                                                 358   2e-119   
gb|KGN66238.1|  hypothetical protein Csa_1G587980                       371   2e-119   
ref|NP_001266102.1|  beta-galactosidase 1-like precursor                376   2e-119   
ref|NP_001289260.1|  beta-galactosidase precursor                       373   3e-119   
dbj|BAE72074.1|  pear beta-galactosidase2                               372   3e-119   
sp|P45582.1|BGAL_ASPOF  RecName: Full=Beta-galactosidase; Short=L...    375   3e-119   
ref|XP_003546457.1|  PREDICTED: beta-galactosidase-like isoform X1      372   3e-119   
emb|CBI35944.3|  unnamed protein product                                375   3e-119   
ref|XP_006342989.1|  PREDICTED: beta-galactosidase-like                 375   4e-119   
emb|CAC44502.1|  beta-galactosidase                                     372   4e-119   
ref|XP_010654522.1|  PREDICTED: beta-galactosidase 1                    375   4e-119   
ref|XP_008451151.1|  PREDICTED: beta-galactosidase-like                 368   4e-119   
ref|XP_004135712.1|  PREDICTED: beta-galactosidase-like                 372   5e-119   
gb|KCW82506.1|  hypothetical protein EUGRSUZ_C03898                     371   5e-119   
ref|NP_001140495.1|  hypothetical protein precursor                     360   5e-119   
gb|KDO73223.1|  hypothetical protein CISIN_1g003095mg                   365   5e-119   
ref|XP_010049744.1|  PREDICTED: beta-galactosidase-like                 371   6e-119   
gb|ACC60981.1|  beta-galactosidase 1 precursor                          375   6e-119   
ref|XP_010542431.1|  PREDICTED: beta-galactosidase 1-like               375   6e-119   
ref|XP_004287559.1|  PREDICTED: beta-galactosidase isoform X5           372   7e-119   
ref|NP_001234303.1|  beta-galactosidase precursor                       374   7e-119   
gb|KHN24609.1|  Beta-galactosidase                                      371   7e-119   
ref|NP_194344.2|  beta-galactosidase 12                                 369   8e-119   
gb|ADO34788.1|  beta-galactosidase STBG3                                374   8e-119   
ref|XP_010106660.1|  Beta-galactosidase 1                               374   1e-118   
ref|XP_010545348.1|  PREDICTED: beta-galactosidase 12-like isofor...    371   1e-118   
ref|XP_011460037.1|  PREDICTED: beta-galactosidase isoform X4           371   1e-118   
gb|ACC78255.1|  beta-galactosidase                                      371   1e-118   
gb|ABV32545.1|  beta-galactosidase protein 2                            374   1e-118   
ref|XP_010047575.1|  PREDICTED: beta-galactosidase-like                 375   1e-118   
ref|XP_010534899.1|  PREDICTED: beta-galactosidase 1                    374   1e-118   
emb|CDX97513.1|  BnaA05g25660D                                          374   2e-118   
gb|KHG01120.1|  Beta-galactosidase                                      374   2e-118   
gb|KHN39301.1|  Beta-galactosidase 1                                    374   2e-118   
ref|XP_009146456.1|  PREDICTED: beta-galactosidase 1                    374   2e-118   
ref|XP_009367552.1|  PREDICTED: beta-galactosidase 1                    374   2e-118   
gb|AAN60229.1|  unknown                                                 365   2e-118   
gb|ACR35908.1|  unknown                                                 358   2e-118   
gb|ABK96254.1|  unknown                                                 374   2e-118   
gb|AFW61988.1|  hypothetical protein ZEAMMB73_453254                    357   2e-118   
gb|ABY71826.1|  beta-galactosidase                                      373   3e-118   
ref|XP_008230925.1|  PREDICTED: beta-galactosidase-like                 372   3e-118   
ref|XP_002282132.1|  PREDICTED: beta-galactosidase                      373   3e-118   
gb|AEG76892.1|  putative beta-galactosidase                             370   3e-118   
gb|KDO65278.1|  hypothetical protein CISIN_1g002867mg                   369   3e-118   
gb|EPS64494.1|  beta-galactosidase                                      370   3e-118   
ref|XP_008228300.1|  PREDICTED: beta-galactosidase 1                    373   3e-118   
ref|XP_006385360.1|  beta-galactosidase 1 family protein                373   4e-118   
emb|CBI27912.3|  unnamed protein product                                372   4e-118   
ref|XP_007217146.1|  hypothetical protein PRUPE_ppa001382mg             373   4e-118   
ref|XP_011460033.1|  PREDICTED: beta-galactosidase isoform X3           370   4e-118   
ref|NP_001265889.1|  beta-galactosidase-like precursor                  369   4e-118   
gb|KHG25378.1|  Beta-galactosidase 1 -like protein                      372   5e-118   
ref|XP_010049745.1|  PREDICTED: beta-galactosidase-like                 369   5e-118   
ref|XP_011010891.1|  PREDICTED: beta-galactosidase 1-like               372   5e-118   
ref|XP_008450855.1|  PREDICTED: beta-galactosidase-like                 369   5e-118   
ref|XP_009627536.1|  PREDICTED: beta-galactosidase                      372   5e-118   
ref|XP_008242341.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    372   5e-118   
ref|XP_006426535.1|  hypothetical protein CICLE_v10024886mg             372   6e-118   
ref|XP_006426534.1|  hypothetical protein CICLE_v10024886mg             372   6e-118   
emb|CAC44500.1|  beta-galactosidase                                     372   6e-118   
ref|XP_009769408.1|  PREDICTED: beta-galactosidase-like                 372   8e-118   
ref|XP_009789773.1|  PREDICTED: beta-galactosidase-like                 372   8e-118   
ref|XP_009606115.1|  PREDICTED: beta-galactosidase-like                 372   8e-118   
gb|KDO73222.1|  hypothetical protein CISIN_1g003095mg                   367   8e-118   
ref|XP_007204656.1|  hypothetical protein PRUPE_ppa001412mg             372   9e-118   
gb|AAC77377.1|  beta-galactosidase precursor                            369   9e-118   
ref|XP_004287560.2|  PREDICTED: beta-galactosidase isoform X1           370   9e-118   
ref|XP_003566806.1|  PREDICTED: beta-galactosidase 2                    372   9e-118   
gb|ABV32546.1|  beta-galactosidase protein 1                            372   9e-118   
ref|XP_011460028.1|  PREDICTED: beta-galactosidase isoform X2           370   9e-118   
ref|XP_007150529.1|  hypothetical protein PHAVU_005G160000g             372   1e-117   
ref|XP_011463326.1|  PREDICTED: beta-galactosidase 1                    372   1e-117   
ref|XP_003550633.1|  PREDICTED: beta-galactosidase-like                 371   1e-117   
gb|EPS72701.1|  beta-galactosidase                                      355   1e-117   
gb|ACP18875.1|  beta-galactosidase pBG(a)                               371   1e-117   
ref|XP_006407174.1|  hypothetical protein EUTSA_v10020056mg             371   1e-117   
ref|NP_849553.1|  beta-galactosidase 12                                 368   1e-117   
ref|XP_006413222.1|  hypothetical protein EUTSA_v10024511mg             369   2e-117   
emb|CAB39679.1|  putative beta-galactosidase                            368   2e-117   
ref|XP_008793242.1|  PREDICTED: beta-galactosidase                      371   2e-117   
ref|XP_009622143.1|  PREDICTED: beta-galactosidase-like                 370   4e-117   
gb|AES59331.2|  beta-like galactosidase                                 367   4e-117   
gb|KJB70253.1|  hypothetical protein B456_011G065300                    368   5e-117   
ref|XP_008391326.1|  PREDICTED: beta-galactosidase 1                    370   6e-117   
emb|CDX94367.1|  BnaC01g18170D                                          366   8e-117   
gb|KDO65277.1|  hypothetical protein CISIN_1g002867mg                   369   8e-117   
emb|CDY32919.1|  BnaC02g12030D                                          366   9e-117   
ref|XP_006366152.1|  PREDICTED: beta-galactosidase-like                 369   9e-117   
ref|XP_011000791.1|  PREDICTED: beta-galactosidase 1-like               369   1e-116   
emb|CDY23637.1|  BnaC05g39570D                                          369   1e-116   
ref|XP_010051543.1|  PREDICTED: beta-galactosidase                      367   1e-116   
sp|A2X2H7.1|BGAL4_ORYSI  RecName: Full=Beta-galactosidase 4; Shor...    365   2e-116   
gb|AFD54987.1|  beta-galactosidase                                      365   2e-116   
gb|EEC70952.1|  hypothetical protein OsI_02561                          368   2e-116   
gb|KDO65274.1|  hypothetical protein CISIN_1g002867mg                   368   2e-116   
ref|XP_006466038.1|  PREDICTED: beta-galactosidase 1-like               368   2e-116   
ref|XP_007217046.1|  hypothetical protein PRUPE_ppa001415mg             368   2e-116   
emb|CDY11899.1|  BnaC03g13250D                                          365   3e-116   
ref|XP_006401275.1|  hypothetical protein EUTSA_v10012847mg             364   3e-116   
gb|KCW82245.1|  hypothetical protein EUGRSUZ_C03662                     366   3e-116   
gb|KDP32675.1|  hypothetical protein JCGZ_13673                         367   3e-116   
sp|Q6Z6K4.1|BGAL4_ORYSJ  RecName: Full=Beta-galactosidase 4; Shor...    365   3e-116   
ref|NP_190852.2|  beta-galactosidase 2                                  365   3e-116   
gb|KFK27244.1|  hypothetical protein AALP_AA8G356800                    364   3e-116   
ref|XP_009132166.1|  PREDICTED: beta-galactosidase 4                    364   3e-116   
ref|XP_009783993.1|  PREDICTED: beta-galactosidase                      368   4e-116   
ref|XP_007135555.1|  hypothetical protein PHAVU_010G139300g             367   4e-116   
gb|KJB70252.1|  hypothetical protein B456_011G065300                    367   4e-116   
gb|AGW47883.1|  beta-galactosidase precursor                            367   4e-116   
gb|KDO65275.1|  hypothetical protein CISIN_1g002867mg                   368   4e-116   
gb|EAZ22260.1|  hypothetical protein OsJ_05915                          365   5e-116   
ref|XP_002876169.1|  AT3g52840/F8J2_10                                  364   5e-116   
ref|XP_010090040.1|  hypothetical protein L484_027271                   367   5e-116   
ref|XP_004969419.1|  PREDICTED: beta-galactosidase 2-like               367   5e-116   
gb|KJB70251.1|  hypothetical protein B456_011G065300                    367   6e-116   
tpg|DAA58690.1|  TPA: hypothetical protein ZEAMMB73_223728              352   6e-116   
ref|XP_010438797.1|  PREDICTED: beta-galactosidase 12 isoform X2        364   7e-116   
ref|XP_002867577.1|  beta-galactosidase 12                              364   7e-116   
gb|KHF98342.1|  Beta-galactosidase 1 -like protein                      367   7e-116   
ref|XP_010438795.1|  PREDICTED: beta-galactosidase 12 isoform X1        363   8e-116   
ref|XP_007017653.1|  Beta-galactosidase 5 isoform 3                     358   9e-116   
ref|XP_010448319.1|  PREDICTED: beta-galactosidase 12-like isofor...    363   9e-116   
ref|NP_001234465.1|  beta-galactosidase precursor                       366   9e-116   
ref|XP_010448320.1|  PREDICTED: beta-galactosidase 12-like isofor...    363   1e-115   
gb|EEE65914.1|  hypothetical protein OsJ_21762                          359   1e-115   
ref|XP_007012844.1|  Beta-galactosidase                                 367   1e-115   
gb|KEH39323.1|  beta-galactosidase-like protein                         362   1e-115   
ref|XP_003563718.1|  PREDICTED: beta-galactosidase 9                    363   1e-115   
emb|CDY20708.1|  BnaA02g08480D                                          363   1e-115   
ref|XP_006648459.1|  PREDICTED: beta-galactosidase 4-like               363   1e-115   
ref|XP_009126921.1|  PREDICTED: beta-galactosidase 4-like               363   1e-115   
gb|KDO73221.1|  hypothetical protein CISIN_1g003095mg                   366   2e-115   
ref|NP_200498.1|  beta-galactosidase 4                                  363   2e-115   
gb|AAK96780.1|  beta-galactosidase                                      363   2e-115   
ref|XP_006424599.1|  hypothetical protein CICLE_v10027805mg             366   2e-115   
gb|KDO73220.1|  hypothetical protein CISIN_1g003095mg                   366   2e-115   
ref|NP_001043405.1|  Os01g0580200                                       365   2e-115   
ref|XP_010443345.1|  PREDICTED: beta-galactosidase 4-like               362   2e-115   
gb|EMT13456.1|  Beta-galactosidase 9                                    362   3e-115   
ref|XP_009139949.1|  PREDICTED: beta-galactosidase 12 isoform X2        362   3e-115   
ref|XP_009139943.1|  PREDICTED: beta-galactosidase 12 isoform X1        362   3e-115   
ref|XP_006285652.1|  hypothetical protein CARUB_v10007108mg             362   3e-115   
ref|XP_010483173.1|  PREDICTED: beta-galactosidase 4                    362   4e-115   
ref|XP_009137581.1|  PREDICTED: beta-galactosidase 12-like              362   5e-115   
ref|XP_010515757.1|  PREDICTED: beta-galactosidase 2 isoform X1         362   5e-115   
ref|XP_010451557.1|  PREDICTED: beta-galactosidase 4-like               361   6e-115   
emb|CAB86888.1|  beta-galactosidase precursor-like protein              361   7e-115   
dbj|BAK05933.1|  predicted protein                                      361   7e-115   
ref|XP_006646030.1|  PREDICTED: beta-galactosidase 2-like               364   7e-115   
ref|XP_010433545.1|  PREDICTED: beta-galactosidase 12-like isofor...    361   8e-115   
ref|XP_006280080.1|  hypothetical protein CARUB_v10025963mg             361   8e-115   
ref|NP_001130532.1|  beta-galactosidase isoform 1 precursor             361   8e-115   
ref|XP_010433544.1|  PREDICTED: beta-galactosidase 12-like isofor...    361   8e-115   
ref|XP_009407297.1|  PREDICTED: beta-galactosidase 2                    364   9e-115   
ref|XP_011659982.1|  PREDICTED: beta-galactosidase-like                 360   9e-115   
gb|ACG30563.1|  beta-galactosidase precursor                            361   9e-115   
ref|XP_009133878.1|  PREDICTED: beta-galactosidase 8-like               364   1e-114   
ref|XP_009148743.1|  PREDICTED: beta-galactosidase 2 isoform X1         360   1e-114   
gb|KEH39322.1|  beta-galactosidase-like protein                         362   1e-114   



>ref|NP_001234317.1| TBG6 protein precursor [Solanum lycopersicum]
 gb|AAF70825.1|AF154424_1 putative beta-galactosidase [Solanum lycopersicum]
Length=845

 Score =   480 bits (1236),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/248 (88%), Positives = 234/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             +++KWVL+ C+V F+SSGL  C V+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI+
Sbjct  5     SLQKWVLLWCIVLFISSGLVHCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLIN  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAKEGG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EW
Sbjct  65    KAKEGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFRADNEPFK AMKG+ EKIVNLMKSHNLFESQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRADNEPFKNAMKGYAEKIVNLMKSHNLFESQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YGPQAKVLGA GHQY TWAA MAV +DTGVPWVMCKEEDAPDPVINTCNGFYCD F PNK
Sbjct  185   YGPQAKVLGAPGHQYSTWAANMAVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDNFFPNK  244

Query  1001  PYKPAIWT  1024
             PYKPAIWT
Sbjct  245   PYKPAIWT  252



>ref|XP_006340680.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=845

 Score =   480 bits (1235),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/248 (88%), Positives = 234/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             +++KWVL+ C+V F+SSGL  C V+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI+
Sbjct  5     SVQKWVLLWCIVLFISSGLVHCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLIN  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAKEGG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EW
Sbjct  65    KAKEGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFRADNEPFK AMKG+ EKIVNLMKSHNLFESQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRADNEPFKNAMKGYAEKIVNLMKSHNLFESQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YGPQAKVLGA GHQY TWAA MAV +DTGVPWVMCKEEDAPDPVINTCNGFYCD F PNK
Sbjct  185   YGPQAKVLGAPGHQYATWAANMAVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDNFFPNK  244

Query  1001  PYKPAIWT  1024
             PYKPAIWT
Sbjct  245   PYKPAIWT  252



>gb|ADO34791.1| beta-galactosidase STBG6 [Solanum lycopersicum]
Length=845

 Score =   477 bits (1228),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 217/248 (88%), Positives = 233/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             +++KWVL+ C+V F+SSGL  C V+YDR+AIVINGQRR+LFSGSIHYPRSTPEMWEDLI+
Sbjct  5     SLQKWVLLWCIVLFISSGLVHCDVTYDREAIVINGQRRLLFSGSIHYPRSTPEMWEDLIN  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAKEGG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EW
Sbjct  65    KAKEGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFRADNEPFK AMKG+ EKIVNLMKSHNLFESQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRADNEPFKNAMKGYAEKIVNLMKSHNLFESQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YGPQAKVLGA GHQY TWAA MAV +DTGVPWVMCKEEDAPDPVINTCNGFYCD F PNK
Sbjct  185   YGPQAKVLGAPGHQYSTWAANMAVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDNFFPNK  244

Query  1001  PYKPAIWT  1024
             PYKPA WT
Sbjct  245   PYKPATWT  252



>ref|XP_009628690.1| PREDICTED: beta-galactosidase 3 [Nicotiana tomentosiformis]
Length=844

 Score =   475 bits (1223),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 215/248 (87%), Positives = 233/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             +++KWV++ C+V F+S  L QC V+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI+
Sbjct  5     SVQKWVMLWCIVLFISCELIQCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLIN  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAKEGG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EW
Sbjct  65    KAKEGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFRADNEPFK AMKG+ EKIVNLMKSHNLFESQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRADNEPFKNAMKGYAEKIVNLMKSHNLFESQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YGPQAK LGA+GHQY TWAA MAV +DTGVPWVMCKEEDAPDPVINTCNGFYCD F PNK
Sbjct  185   YGPQAKALGATGHQYSTWAANMAVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDNFFPNK  244

Query  1001  PYKPAIWT  1024
             PYKPAIWT
Sbjct  245   PYKPAIWT  252



>ref|XP_009789452.1| PREDICTED: beta-galactosidase 3 [Nicotiana sylvestris]
Length=844

 Score =   473 bits (1217),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 214/248 (86%), Positives = 232/248 (94%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             +++KWV++ C+V F+S  L QC V+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI+
Sbjct  5     SVQKWVMLWCIVLFISCELIQCDVTYDRKAIVINGQRRLLFSGSIHYPRSTPEMWEDLIN  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAKEGG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EW
Sbjct  65    KAKEGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFRADNEPFK AMKG+ EKIVNLMKSHNLFESQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRADNEPFKNAMKGYAEKIVNLMKSHNLFESQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YGPQAK LGA+GHQY TWAA MAV +DTGVPWVMCKEEDAPDPVINTCNGFYCD F PNK
Sbjct  185   YGPQAKALGATGHQYSTWAANMAVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDNFFPNK  244

Query  1001  PYKPAIWT  1024
             PYKP IWT
Sbjct  245   PYKPTIWT  252



>gb|EYU24087.1| hypothetical protein MIMGU_mgv1a001258mg [Erythranthe guttata]
Length=851

 Score =   473 bits (1217),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 216/246 (88%), Positives = 229/246 (93%), Gaps = 0/246 (0%)
 Frame = +2

Query  287   RKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  466
             +KWVL  CMV ++ SG  QCSV+YDRKAI+INGQRR+LFSGSIHYPRSTPEMWEDLI+KA
Sbjct  14    KKWVLWACMVVYIGSGYVQCSVTYDRKAILINGQRRILFSGSIHYPRSTPEMWEDLINKA  73

Query  467   KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  646
             KEGGVDVIETYVFWNVHEPSPGNY+FEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNF
Sbjct  74    KEGGVDVIETYVFWNVHEPSPGNYDFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNF  133

Query  647   GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYG  826
             GGFPVWLK+VPGISFR DNEPFKMAMKGFTEKIVNLMKS  L+ESQGGPIILSQIENEYG
Sbjct  134   GGFPVWLKYVPGISFRTDNEPFKMAMKGFTEKIVNLMKSEKLYESQGGPIILSQIENEYG  193

Query  827   PQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPY  1006
             P AK LGASGHQY TWAA MAV +DTGVPWVMCKEEDAPDPVINTCNGFYCD F+PNKPY
Sbjct  194   PMAKSLGASGHQYSTWAANMAVALDTGVPWVMCKEEDAPDPVINTCNGFYCDAFSPNKPY  253

Query  1007  KPAIWT  1024
             KP IWT
Sbjct  254   KPTIWT  259



>gb|KHF97862.1| Beta-galactosidase 3 [Gossypium arboreum]
 gb|KHF97863.1| Beta-galactosidase 3 [Gossypium arboreum]
Length=515

 Score =   452 bits (1163),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             +  ++++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI 
Sbjct  5     SFSRFLIVFCFAVCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQ  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAH+RIGPY+C EW
Sbjct  65    KAKDGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHVRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKSHNL+ESQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLYESQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YG Q+K+LGA G+ YV+WAAKMA+E +TGVPWVMCKE+DAPDP+INTCNGFYCD F PNK
Sbjct  185   YGAQSKLLGAVGYNYVSWAAKMAIETETGVPWVMCKEQDAPDPIINTCNGFYCDSFQPNK  244

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  245   PYKPTMWT  252



>ref|XP_011100972.1| PREDICTED: beta-galactosidase 3-like [Sesamum indicum]
Length=848

 Score =   459 bits (1181),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/231 (90%), Positives = 219/231 (95%), Gaps = 0/231 (0%)
 Frame = +2

Query  332   GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWN  511
             GL QCSV+YD+KA+VINGQRR+L SGSIHYPRSTPEMWEDLI+KAKEGG+DVIETYVFWN
Sbjct  22    GLVQCSVTYDKKAMVINGQRRILISGSIHYPRSTPEMWEDLINKAKEGGLDVIETYVFWN  81

Query  512   VHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISF  691
             VHEPSPGNYNFEGRYDLVRF+KTIQ+AGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISF
Sbjct  82    VHEPSPGNYNFEGRYDLVRFIKTIQRAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISF  141

Query  692   RADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVT  871
             R DNEPFKMAMKGFTEKIVNLMKS NL+ESQGGPIILSQIENEYGPQAK LGA GHQY T
Sbjct  142   RTDNEPFKMAMKGFTEKIVNLMKSENLYESQGGPIILSQIENEYGPQAKALGAPGHQYAT  201

Query  872   WAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             WAA MAV MDTGVPWVMCKEEDAPDPVINTCNGFYCD F+PNKPYKP IWT
Sbjct  202   WAANMAVGMDTGVPWVMCKEEDAPDPVINTCNGFYCDAFSPNKPYKPTIWT  252



>gb|EYU31167.1| hypothetical protein MIMGU_mgv1a001956mg [Erythranthe guttata]
Length=734

 Score =   456 bits (1172),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/254 (81%), Positives = 228/254 (90%), Gaps = 2/254 (1%)
 Frame = +2

Query  269   LRGGAMRKWVLVLCM--VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEM  442
             ++  ++ KWV  +CM  V FL  G+ Q  ++YDRKA++INGQRR+L SGSIHYPRSTPEM
Sbjct  1     MKNNSVSKWVFSVCMAVVVFLECGVVQSRITYDRKALIINGQRRILISGSIHYPRSTPEM  60

Query  443   WEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGP  622
             WEDLI+KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTI+KAGLYA+LRIGP
Sbjct  61    WEDLINKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIKKAGLYANLRIGP  120

Query  623   YICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIIL  802
             YIC EWNFGGFPVWLK+VPGISFR DNEPFKMAMKGFTEKIVN+MKS NL+ESQGGPIIL
Sbjct  121   YICAEWNFGGFPVWLKYVPGISFRTDNEPFKMAMKGFTEKIVNIMKSENLYESQGGPIIL  180

Query  803   SQIENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCD  982
             SQIENEYG QAK LG  GHQY  WAA MAV +DTGVPWVMCKE+DAPDPVINTCNGFYCD
Sbjct  181   SQIENEYGQQAKQLGNPGHQYANWAANMAVGLDTGVPWVMCKEDDAPDPVINTCNGFYCD  240

Query  983   KFAPNKPYKPAIWT  1024
              F+PNKPYKP+IWT
Sbjct  241   AFSPNKPYKPSIWT  254



>ref|XP_007046795.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
 gb|EOX90952.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
Length=702

 Score =   453 bits (1166),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             +  + ++  C+   L   +TQCSV+YDRKA+VINGQRR+LFSGSIHYPRSTP+MWEDLI 
Sbjct  5     SFSRLLIAFCLALCLGCQVTQCSVTYDRKAVVINGQRRILFSGSIHYPRSTPDMWEDLIQ  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQ+AGLYAHLRIGPY+C EW
Sbjct  65    KAKDGGLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFMKTIQRAGLYAHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKSHNLFESQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLFESQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YG Q+K+LGASG+ YVTWAAKMA+E  TGVPWVMCKEEDAPDPVINTCNGFYCD F PNK
Sbjct  185   YGAQSKLLGASGYNYVTWAAKMAIETGTGVPWVMCKEEDAPDPVINTCNGFYCDTFQPNK  244

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  245   PYKPTMWT  252



>gb|KJB43420.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
 gb|KJB43421.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=608

 Score =   450 bits (1157),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 203/245 (83%), Positives = 222/245 (91%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             + ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI KAK
Sbjct  8     RLLIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EWNFG
Sbjct  68    DGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+V GISFR DNEPFK AM+GFTEKIV LMKSHNL+ESQGGPIILSQIENEYG 
Sbjct  128   GFPVWLKYVRGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLYESQGGPIILSQIENEYGA  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             Q+K+LGA G+ YV+WAAKMA+E +TGVPWVMCKE+DAPDPVINTCNGFYCD F PNKPYK
Sbjct  188   QSKLLGAVGYNYVSWAAKMAIETETGVPWVMCKEQDAPDPVINTCNGFYCDSFQPNKPYK  247

Query  1010  PAIWT  1024
             P +WT
Sbjct  248   PTMWT  252



>gb|KDO71054.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=626

 Score =   450 bits (1158),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 202/245 (82%), Positives = 223/245 (91%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             + ++V C+   L      CSV+YDRKA++INGQRR+LFSGSIHYPRSTP+MWEDLI KAK
Sbjct  8     RMLIVFCLSLCLCCHHIHCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GG+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFG
Sbjct  68    DGGLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+VPGISFR DNEPFK AM+GFTEKIVNLMKS NLFESQGGPIILSQIENEYG 
Sbjct  128   GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVNLMKSENLFESQGGPIILSQIENEYGA  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             Q+K+LGA+GH Y+TWAAKMAVEM TGVPWVMCKEEDAPDPVIN+CNGFYCD F PN+PYK
Sbjct  188   QSKLLGAAGHNYMTWAAKMAVEMGTGVPWVMCKEEDAPDPVINSCNGFYCDAFTPNQPYK  247

Query  1010  PAIWT  1024
             P IWT
Sbjct  248   PTIWT  252



>gb|EPS70273.1| beta-galactosidase, partial [Genlisea aurea]
Length=634

 Score =   449 bits (1154),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = +2

Query  305   LCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVD  484
             +C+V FL   L QCSV+YDRKAIVING+RR+L SGSIHYPRSTPEMWEDL++KAKEGG+D
Sbjct  2     VCIVVFLGGSLVQCSVTYDRKAIVINGERRILISGSIHYPRSTPEMWEDLMNKAKEGGLD  61

Query  485   VIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVW  664
             VI+TYVFWNVHEPS G+YNFEGRYDLVRFVKT QK+GLY HLRIGPYICGEWNFGGFPVW
Sbjct  62    VIDTYVFWNVHEPSQGHYNFEGRYDLVRFVKTAQKSGLYVHLRIGPYICGEWNFGGFPVW  121

Query  665   LKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVL  844
             LK+VPGISFR DNEPFKM MKGFT KIVNLMKS NL++SQGGPIILSQIENEYGPQAK L
Sbjct  122   LKYVPGISFRTDNEPFKMLMKGFTRKIVNLMKSENLYQSQGGPIILSQIENEYGPQAKAL  181

Query  845   GASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             GA GHQY TWAA MAV +DTGVPWVMCKEEDAPDPVINTCNGFYCD F+PN+PYKP +WT
Sbjct  182   GAPGHQYSTWAANMAVALDTGVPWVMCKEEDAPDPVINTCNGFYCDAFSPNQPYKPTMWT  241



>ref|XP_007046794.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
 gb|EOX90951.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
Length=854

 Score =   454 bits (1167),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             +  + ++  C+   L   +TQCSV+YDRKA+VINGQRR+LFSGSIHYPRSTP+MWEDLI 
Sbjct  5     SFSRLLIAFCLALCLGCQVTQCSVTYDRKAVVINGQRRILFSGSIHYPRSTPDMWEDLIQ  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQ+AGLYAHLRIGPY+C EW
Sbjct  65    KAKDGGLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFMKTIQRAGLYAHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKSHNLFESQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLFESQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YG Q+K+LGASG+ YVTWAAKMA+E  TGVPWVMCKEEDAPDPVINTCNGFYCD F PNK
Sbjct  185   YGAQSKLLGASGYNYVTWAAKMAIETGTGVPWVMCKEEDAPDPVINTCNGFYCDTFQPNK  244

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  245   PYKPTMWT  252



>gb|KJB43418.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=693

 Score =   449 bits (1154),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 203/245 (83%), Positives = 222/245 (91%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             + ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI KAK
Sbjct  8     RLLIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EWNFG
Sbjct  68    DGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+V GISFR DNEPFK AM+GFTEKIV LMKSHNL+ESQGGPIILSQIENEYG 
Sbjct  128   GFPVWLKYVRGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLYESQGGPIILSQIENEYGA  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             Q+K+LGA G+ YV+WAAKMA+E +TGVPWVMCKE+DAPDPVINTCNGFYCD F PNKPYK
Sbjct  188   QSKLLGAVGYNYVSWAAKMAIETETGVPWVMCKEQDAPDPVINTCNGFYCDSFQPNKPYK  247

Query  1010  PAIWT  1024
             P +WT
Sbjct  248   PTMWT  252



>gb|KDO71053.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=816

 Score =   449 bits (1156),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 202/245 (82%), Positives = 223/245 (91%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             + ++V C+   L      CSV+YDRKA++INGQRR+LFSGSIHYPRSTP+MWEDLI KAK
Sbjct  8     RMLIVFCLSLCLCCHHIHCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GG+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFG
Sbjct  68    DGGLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+VPGISFR DNEPFK AM+GFTEKIVNLMKS NLFESQGGPIILSQIENEYG 
Sbjct  128   GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVNLMKSENLFESQGGPIILSQIENEYGA  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             Q+K+LGA+GH Y+TWAAKMAVEM TGVPWVMCKEEDAPDPVIN+CNGFYCD F PN+PYK
Sbjct  188   QSKLLGAAGHNYMTWAAKMAVEMGTGVPWVMCKEEDAPDPVINSCNGFYCDAFTPNQPYK  247

Query  1010  PAIWT  1024
             P IWT
Sbjct  248   PTIWT  252



>gb|KJB43423.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=807

 Score =   449 bits (1155),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 203/245 (83%), Positives = 222/245 (91%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             + ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI KAK
Sbjct  8     RLLIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EWNFG
Sbjct  68    DGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+V GISFR DNEPFK AM+GFTEKIV LMKSHNL+ESQGGPIILSQIENEYG 
Sbjct  128   GFPVWLKYVRGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLYESQGGPIILSQIENEYGA  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             Q+K+LGA G+ YV+WAAKMA+E +TGVPWVMCKE+DAPDPVINTCNGFYCD F PNKPYK
Sbjct  188   QSKLLGAVGYNYVSWAAKMAIETETGVPWVMCKEQDAPDPVINTCNGFYCDSFQPNKPYK  247

Query  1010  PAIWT  1024
             P +WT
Sbjct  248   PTMWT  252



>gb|KDO71052.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=854

 Score =   449 bits (1155),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 202/245 (82%), Positives = 223/245 (91%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             + ++V C+   L      CSV+YDRKA++INGQRR+LFSGSIHYPRSTP+MWEDLI KAK
Sbjct  8     RMLIVFCLSLCLCCHHIHCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GG+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFG
Sbjct  68    DGGLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+VPGISFR DNEPFK AM+GFTEKIVNLMKS NLFESQGGPIILSQIENEYG 
Sbjct  128   GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVNLMKSENLFESQGGPIILSQIENEYGA  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             Q+K+LGA+GH Y+TWAAKMAVEM TGVPWVMCKEEDAPDPVIN+CNGFYCD F PN+PYK
Sbjct  188   QSKLLGAAGHNYMTWAAKMAVEMGTGVPWVMCKEEDAPDPVINSCNGFYCDAFTPNQPYK  247

Query  1010  PAIWT  1024
             P IWT
Sbjct  248   PTIWT  252



>gb|KJB43424.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=854

 Score =   449 bits (1155),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 203/245 (83%), Positives = 222/245 (91%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             + ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI KAK
Sbjct  8     RLLIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EWNFG
Sbjct  68    DGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+V GISFR DNEPFK AM+GFTEKIV LMKSHNL+ESQGGPIILSQIENEYG 
Sbjct  128   GFPVWLKYVRGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLYESQGGPIILSQIENEYGA  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             Q+K+LGA G+ YV+WAAKMA+E +TGVPWVMCKE+DAPDPVINTCNGFYCD F PNKPYK
Sbjct  188   QSKLLGAVGYNYVSWAAKMAIETETGVPWVMCKEQDAPDPVINTCNGFYCDSFQPNKPYK  247

Query  1010  PAIWT  1024
             P +WT
Sbjct  248   PTMWT  252



>gb|KJB43419.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=859

 Score =   449 bits (1155),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 203/245 (83%), Positives = 222/245 (91%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             + ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI KAK
Sbjct  8     RLLIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EWNFG
Sbjct  68    DGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+V GISFR DNEPFK AM+GFTEKIV LMKSHNL+ESQGGPIILSQIENEYG 
Sbjct  128   GFPVWLKYVRGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLYESQGGPIILSQIENEYGA  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             Q+K+LGA G+ YV+WAAKMA+E +TGVPWVMCKE+DAPDPVINTCNGFYCD F PNKPYK
Sbjct  188   QSKLLGAVGYNYVSWAAKMAIETETGVPWVMCKEQDAPDPVINTCNGFYCDSFQPNKPYK  247

Query  1010  PAIWT  1024
             P +WT
Sbjct  248   PTMWT  252



>gb|KJB43422.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=850

 Score =   449 bits (1154),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 203/245 (83%), Positives = 222/245 (91%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             + ++V C    L   L QCSV+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI KAK
Sbjct  8     RLLIVFCFALCLECQLVQCSVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQ+AGLYAHLRIGPY+C EWNFG
Sbjct  68    DGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQRAGLYAHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+V GISFR DNEPFK AM+GFTEKIV LMKSHNL+ESQGGPIILSQIENEYG 
Sbjct  128   GFPVWLKYVRGISFRTDNEPFKRAMQGFTEKIVGLMKSHNLYESQGGPIILSQIENEYGA  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             Q+K+LGA G+ YV+WAAKMA+E +TGVPWVMCKE+DAPDPVINTCNGFYCD F PNKPYK
Sbjct  188   QSKLLGAVGYNYVSWAAKMAIETETGVPWVMCKEQDAPDPVINTCNGFYCDSFQPNKPYK  247

Query  1010  PAIWT  1024
             P +WT
Sbjct  248   PTMWT  252



>ref|XP_007204246.1| hypothetical protein PRUPE_ppa002271mg [Prunus persica]
 gb|EMJ05445.1| hypothetical protein PRUPE_ppa002271mg [Prunus persica]
Length=693

 Score =   443 bits (1140),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             ++ K  L L +V FL   L QC+V+YDR+AIVINGQRR+L SGSIHYPRSTPEMWEDLI 
Sbjct  5     SVSKLCLFLGLVCFLGFQLVQCTVTYDRRAIVINGQRRILISGSIHYPRSTPEMWEDLIQ  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DV+ETYVFWNVHEPSPGNYNF+GRYDLVRF+KTIQKAGLYAHLRIGPY+C EW
Sbjct  65    KAKDGGLDVVETYVFWNVHEPSPGNYNFKGRYDLVRFLKTIQKAGLYAHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS  LFESQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSEKLFESQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YG Q+K+ GA+GH Y+TWAA MAV + TGVPWVMCKEEDAPDPVINTCNGFYCD FAPNK
Sbjct  185   YGAQSKLFGAAGHNYMTWAANMAVGLGTGVPWVMCKEEDAPDPVINTCNGFYCDSFAPNK  244

Query  1001  PYKPAIWT  1024
             PYKP IWT
Sbjct  245   PYKPTIWT  252



>ref|XP_010649088.1| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI17431.3| unnamed protein product [Vitis vinifera]
Length=845

 Score =   447 bits (1151),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 225/252 (89%), Gaps = 0/252 (0%)
 Frame = +2

Query  269   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  448
             +   ++ K  LVLCMV  L S L QCSV+YDRKAIVINGQRR+L SGSIHYPRSTP+MWE
Sbjct  1     MEANSVSKLFLVLCMVLQLGSQLIQCSVTYDRKAIVINGQRRILISGSIHYPRSTPDMWE  60

Query  449   DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  628
             D+I KAK+GG+DV+ETYVFWNVHEPSPG+YNFEGRYDLVRF++T+QKAGLYAHLRIGPY+
Sbjct  61    DIIQKAKDGGLDVVETYVFWNVHEPSPGSYNFEGRYDLVRFIRTVQKAGLYAHLRIGPYV  120

Query  629   CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  808
             C EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS  LFESQGGPIILSQ
Sbjct  121   CAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSERLFESQGGPIILSQ  180

Query  809   IENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKF  988
             IENEYG Q+K+LG +GH Y+TWAA MAV + TGVPWVMCKEEDAPDPVINTCNGFYCD F
Sbjct  181   IENEYGVQSKLLGDAGHDYMTWAANMAVGLGTGVPWVMCKEEDAPDPVINTCNGFYCDAF  240

Query  989   APNKPYKPAIWT  1024
             +PNKPYKP IWT
Sbjct  241   SPNKPYKPTIWT  252



>gb|KJB17716.1| hypothetical protein B456_003G011900 [Gossypium raimondii]
Length=854

 Score =   447 bits (1149),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 203/235 (86%), Positives = 219/235 (93%), Gaps = 0/235 (0%)
 Frame = +2

Query  320   FLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETY  499
             +LS  L Q SV+YD+KAIVINGQRR+LFSGSIHYPRSTP+MWEDLI KAK+GG+DVIETY
Sbjct  19    YLSPQLVQTSVTYDKKAIVINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGLDVIETY  78

Query  500   VFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVP  679
             VFWNVHEPSPGNYNFEGRYDLVRF+KT+QKAGLYAHLRIGPY+C EWNFGGFPVWLKFVP
Sbjct  79    VFWNVHEPSPGNYNFEGRYDLVRFIKTVQKAGLYAHLRIGPYVCAEWNFGGFPVWLKFVP  138

Query  680   GISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGH  859
             GISFR DNEPFK AM+GFTEKIV LMKSHNLFESQGGPIILSQIENEYG Q+K+LGA+G+
Sbjct  139   GISFRTDNEPFKRAMQGFTEKIVGLMKSHNLFESQGGPIILSQIENEYGAQSKLLGAAGY  198

Query  860   QYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              YVTWAAKMAVE  TGVPWVMCKE+DAPDPVINTCNGFYCD F PNKPYKP IWT
Sbjct  199   NYVTWAAKMAVETGTGVPWVMCKEDDAPDPVINTCNGFYCDAFQPNKPYKPTIWT  253



>ref|XP_010113483.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC35510.1| Beta-galactosidase 3 [Morus notabilis]
Length=847

 Score =   446 bits (1148),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             ++RK+ L +C+V  + S L QC+V+YDRKAIVINGQRR+LFSGSIHYPRSTPEMWEDLI 
Sbjct  4     SVRKFWLFICLVLVVGSELIQCNVTYDRKAIVINGQRRILFSGSIHYPRSTPEMWEDLIQ  63

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+K IQ+AGLYAHLRIGPY+C EW
Sbjct  64    KAKDGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKLIQRAGLYAHLRIGPYVCAEW  123

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV +MK  NLFESQGGPIILSQIENE
Sbjct  124   NFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGMMKKENLFESQGGPIILSQIENE  183

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YG Q+K+ GA  H Y+TWAAKMAV + TGVPWVMCKEEDAPDPVINTCNGFYCD F+PNK
Sbjct  184   YGVQSKLFGAPAHNYMTWAAKMAVGLKTGVPWVMCKEEDAPDPVINTCNGFYCDTFSPNK  243

Query  1001  PYKPAIWT  1024
             PYKP IWT
Sbjct  244   PYKPTIWT  251



>ref|XP_006425593.1| hypothetical protein CICLE_v10024881mg [Citrus clementina]
 ref|XP_006466876.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
 gb|ESR38833.1| hypothetical protein CICLE_v10024881mg [Citrus clementina]
Length=854

 Score =   446 bits (1147),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 201/245 (82%), Positives = 222/245 (91%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             + ++V C+   L      CSV+YDRKA++INGQRR+LFSGSIHYPRSTP+MWEDLI KAK
Sbjct  8     RMLIVFCLSLCLCCHHIHCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLIQKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GG+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTI+KAGLYAHLRIGPY+C EWNFG
Sbjct  68    DGGLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIKKAGLYAHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+VPGISFR DNEPFK AM+GFTEKIVNLMKS NLFESQGGPIILSQIENEYG 
Sbjct  128   GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVNLMKSENLFESQGGPIILSQIENEYGA  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             Q+K LGA+GH Y+TWAAKMAVEM TGVPWVMCKEEDAPDPVIN+CNGFYCD F PN+PYK
Sbjct  188   QSKQLGAAGHNYMTWAAKMAVEMGTGVPWVMCKEEDAPDPVINSCNGFYCDAFTPNQPYK  247

Query  1010  PAIWT  1024
             P IWT
Sbjct  248   PTIWT  252



>ref|XP_004287850.1| PREDICTED: beta-galactosidase 3 [Fragaria vesca subsp. vesca]
Length=853

 Score =   446 bits (1146),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 225/252 (89%), Gaps = 0/252 (0%)
 Frame = +2

Query  269   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  448
             + G ++ K  L L +V+FL   L QC+V+YDRKAIVINGQRR+L SGSIHYPRSTPEMWE
Sbjct  1     MEGNSVSKLCLFLGLVWFLGFQLVQCTVTYDRKAIVINGQRRILISGSIHYPRSTPEMWE  60

Query  449   DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  628
             DLI KAK+GG+DV+ETYVFWN HEPSPGNYNFEGRYDLVRF+KT+QKAGLYAHLRIGPY+
Sbjct  61    DLIQKAKDGGLDVVETYVFWNGHEPSPGNYNFEGRYDLVRFLKTVQKAGLYAHLRIGPYV  120

Query  629   CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  808
             C EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS  LFESQGGPIILSQ
Sbjct  121   CAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSEKLFESQGGPIILSQ  180

Query  809   IENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKF  988
             IENEYG Q+K+ GA+GH Y+TWAA+MAV + TGVPWVMCKEEDAPDPVINTCNGFYCD F
Sbjct  181   IENEYGVQSKLFGAAGHNYMTWAAEMAVGLGTGVPWVMCKEEDAPDPVINTCNGFYCDSF  240

Query  989   APNKPYKPAIWT  1024
             +PNKPYKP IWT
Sbjct  241   SPNKPYKPTIWT  252



>ref|XP_007158612.1| hypothetical protein PHAVU_002G1672000g, partial [Phaseolus vulgaris]
 gb|ESW30606.1| hypothetical protein PHAVU_002G1672000g, partial [Phaseolus vulgaris]
Length=365

 Score =   429 bits (1103),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 196/243 (81%), Positives = 217/243 (89%), Gaps = 2/243 (1%)
 Frame = +2

Query  302   VLCMVFFLSSGL--TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  475
             + C+  +L   L    C+V+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEG
Sbjct  13    LFCLALWLGVQLEWVHCTVTYDRKAILINGQRRLLFSGSIHYPRSTPDMWEDLIYKAKEG  72

Query  476   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  655
             G+DVIETYVFWNVHEPSPGN+NFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGF
Sbjct  73    GLDVIETYVFWNVHEPSPGNFNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGF  132

Query  656   PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQA  835
             PVWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS  L+ESQGGPIILSQIENEYG Q+
Sbjct  133   PVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGMMKSERLYESQGGPIILSQIENEYGAQS  192

Query  836   KVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPA  1015
             K+LG +G  YV WAAKMA+E  TGVPWVMCKE+DAPDPVINTCNGFYCD F PNKPYKP+
Sbjct  193   KLLGPAGQNYVNWAAKMAIETGTGVPWVMCKEDDAPDPVINTCNGFYCDYFTPNKPYKPS  252

Query  1016  IWT  1024
             IWT
Sbjct  253   IWT  255



>ref|XP_006380782.1| hypothetical protein POPTR_0007s13540g [Populus trichocarpa]
 gb|ERP58579.1| hypothetical protein POPTR_0007s13540g [Populus trichocarpa]
Length=626

 Score =   438 bits (1126),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 196/242 (81%), Positives = 221/242 (91%), Gaps = 0/242 (0%)
 Frame = +2

Query  299   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
             LV  +VF   S L QCSV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAK+GG
Sbjct  12    LVFLVVFLGCSELIQCSVTYDRKAIMINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGG  71

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DVIETYVFWNVHEP+PGNY+FEGRYD+VRF+KTIQ+AGLYAHLRIGPY+C EWNFGGFP
Sbjct  72    IDVIETYVFWNVHEPTPGNYHFEGRYDIVRFMKTIQRAGLYAHLRIGPYVCAEWNFGGFP  131

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAK  838
             VWLK+VPGISFR DNEPFK AM+GFTEKIV LMK+ +LFESQGGPIILSQIENEYG Q+K
Sbjct  132   VWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKAEHLFESQGGPIILSQIENEYGVQSK  191

Query  839   VLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAI  1018
             + GA+G+ Y+TWAA MA++  TGVPWVMCKE+DAPDPVINTCNGFYCD FAPNKPYKP I
Sbjct  192   LFGAAGYNYMTWAANMAIQTGTGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPTI  251

Query  1019  WT  1024
             WT
Sbjct  252   WT  253



>gb|AAW47739.1| beta-galactosidase [Prunus persica]
Length=853

 Score =   444 bits (1142),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 222/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             ++ K  L L +V FL   L QC+V+YDR+AIVINGQRR+L SGSIHYPRSTPEMWEDLI 
Sbjct  5     SVSKLCLFLGLVCFLGFQLVQCTVTYDRRAIVINGQRRILISGSIHYPRSTPEMWEDLIQ  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DV+ETYVFWNVHEPSPGNYNF+GRYDLVRF+KTIQKAGLYAHLRIGPY+C EW
Sbjct  65    KAKDGGLDVVETYVFWNVHEPSPGNYNFKGRYDLVRFLKTIQKAGLYAHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS  LFESQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSEKLFESQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YG Q+K+ GA+GH Y+TWAA MAV + TGVPWVMCKEEDAPDPVINTCNGFYCD FAPNK
Sbjct  185   YGAQSKLFGAAGHNYMTWAANMAVGLGTGVPWVMCKEEDAPDPVINTCNGFYCDSFAPNK  244

Query  1001  PYKPAIWT  1024
             PYKP IWT
Sbjct  245   PYKPTIWT  252



>ref|XP_008241765.1| PREDICTED: beta-galactosidase 3 [Prunus mume]
Length=853

 Score =   442 bits (1137),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 221/248 (89%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             ++ K  L L +V FL   L QC+V+YDR+AIVINGQRR+L SGSIHYPRSTPEMWEDLI 
Sbjct  5     SVSKLCLFLGLVCFLGFQLVQCTVTYDRRAIVINGQRRILISGSIHYPRSTPEMWEDLIQ  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKA LYAHLRIGPY+C EW
Sbjct  65    KAKDGGLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFLKTIQKARLYAHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS  LFESQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSEKLFESQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YG Q+K+ GA+GH Y+TWAA MAV + TGVPWVMCKEEDAPDPVINTCNGFYCD FAPNK
Sbjct  185   YGAQSKLFGAAGHNYMTWAANMAVGLGTGVPWVMCKEEDAPDPVINTCNGFYCDSFAPNK  244

Query  1001  PYKPAIWT  1024
             PYKP IWT
Sbjct  245   PYKPMIWT  252



>gb|KJB58183.1| hypothetical protein B456_009G198100 [Gossypium raimondii]
Length=590

 Score =   432 bits (1112),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 190/252 (75%), Positives = 220/252 (87%), Gaps = 0/252 (0%)
 Frame = +2

Query  269   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  448
             +   ++ K ++     F  SS L QCS++YD+KAI+INGQRR+L SGSIHYPRSTPEMWE
Sbjct  1     METSSVSKLLIFFFTAFLASSKLIQCSITYDKKAILINGQRRILISGSIHYPRSTPEMWE  60

Query  449   DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  628
             DLI KAK+GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPYI
Sbjct  61    DLIKKAKDGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKLGLYVHLRIGPYI  120

Query  629   CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  808
             C EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFT+KIV +MK+  LF SQGGPIILSQ
Sbjct  121   CAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTQKIVQMMKNEKLFASQGGPIILSQ  180

Query  809   IENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKF  988
             IENEYGP+++ LGA+GH Y+ WAAKMAVE++TGVPWVMCKE+DAPDPVIN CNGFYCD F
Sbjct  181   IENEYGPESRALGAAGHAYINWAAKMAVELNTGVPWVMCKEDDAPDPVINACNGFYCDGF  240

Query  989   APNKPYKPAIWT  1024
             +PNKPYKP +WT
Sbjct  241   SPNKPYKPTMWT  252



>ref|XP_006412010.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
 gb|ESQ53463.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
Length=626

 Score =   433 bits (1114),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 195/251 (78%), Positives = 218/251 (87%), Gaps = 1/251 (0%)
 Frame = +2

Query  275   GGAMRKWVLVLCM-VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  451
             G +  + +L  C+ +  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7     GDSASRLILWCCLGLLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  452   LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  631
             LI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVK I KAGLYAHLRIGPY+C
Sbjct  67    LIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKAIHKAGLYAHLRIGPYVC  126

Query  632   GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  811
              EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127   AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  186

Query  812   ENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFA  991
             ENEYG Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGFYCD FA
Sbjct  187   ENEYGRQGQILGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFA  246

Query  992   PNKPYKPAIWT  1024
             PNKPYKP IWT
Sbjct  247   PNKPYKPTIWT  257



>ref|XP_011025878.1| PREDICTED: beta-galactosidase 3 [Populus euphratica]
Length=847

 Score =   440 bits (1132),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 198/242 (82%), Positives = 221/242 (91%), Gaps = 0/242 (0%)
 Frame = +2

Query  299   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
              VL +VF   S L QCSV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAK+GG
Sbjct  12    FVLLVVFLGCSELIQCSVTYDRKAIMINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGG  71

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DVIETYVFWNVHEP+PGNY+FEGRYD+VRF+KTIQ+AGLYAHLRIGPY+C EWNFGGFP
Sbjct  72    IDVIETYVFWNVHEPTPGNYHFEGRYDIVRFMKTIQRAGLYAHLRIGPYVCAEWNFGGFP  131

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAK  838
             VWLK+VPGISFR DNEPFK AMKGFTEKIV LMK+ NLFESQGGPIILSQIENEYG Q+K
Sbjct  132   VWLKYVPGISFRTDNEPFKRAMKGFTEKIVGLMKAENLFESQGGPIILSQIENEYGVQSK  191

Query  839   VLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAI  1018
             + GA+G+ Y+TWAA MA++  TGVPWVMCKE+DAPDPVINTCNGFYCD FAPNKPYKP I
Sbjct  192   LFGAAGYNYMTWAANMAIQTGTGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPTI  251

Query  1019  WT  1024
             WT
Sbjct  252   WT  253



>ref|XP_008440778.1| PREDICTED: beta-galactosidase 3 [Cucumis melo]
Length=854

 Score =   440 bits (1132),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 201/243 (83%), Positives = 221/243 (91%), Gaps = 0/243 (0%)
 Frame = +2

Query  296   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  475
             +LVL + + L     QCSV+YDRKAI+INGQRRVLFSGSIHYPRSTPEMWE LI KAKEG
Sbjct  11    MLVLGLFWLLGVQFVQCSVTYDRKAILINGQRRVLFSGSIHYPRSTPEMWEGLIQKAKEG  70

Query  476   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  655
             G+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYA+LRIGPY+C EWNFGGF
Sbjct  71    GLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYANLRIGPYVCAEWNFGGF  130

Query  656   PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQA  835
             PVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS NLFESQGGPIILSQIENEYG Q+
Sbjct  131   PVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSENLFESQGGPIILSQIENEYGVQS  190

Query  836   KVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPA  1015
             K+ GA+G  Y+TWAAKMAV + TGVPWVMCKEEDAPDPVINTCNGFYCD F+PN+PYKPA
Sbjct  191   KLFGAAGQNYMTWAAKMAVGLGTGVPWVMCKEEDAPDPVINTCNGFYCDAFSPNRPYKPA  250

Query  1016  IWT  1024
             +WT
Sbjct  251   MWT  253



>ref|NP_568001.1| beta-galactosidase 3 [Arabidopsis thaliana]
 sp|Q9SCV9.1|BGAL3_ARATH RecName: Full=Beta-galactosidase 3; Short=Lactase 3; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64739.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAL07134.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAM14371.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE86646.1| beta-galactosidase 3 [Arabidopsis thaliana]
Length=856

 Score =   440 bits (1131),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 200/257 (78%), Positives = 223/257 (87%), Gaps = 1/257 (0%)
 Frame = +2

Query  257   LREKLRGGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRST  433
             +RE   G +  + +L  C+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST
Sbjct  1     MREMGTGDSASRLILWFCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRST  60

Query  434   PEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLR  613
             P+MWEDLI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLR
Sbjct  61    PDMWEDLIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLR  120

Query  614   IGPYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGP  793
             IGPY+C EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGP
Sbjct  121   IGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGP  180

Query  794   IILSQIENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGF  973
             IILSQIENEYG Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGF
Sbjct  181   IILSQIENEYGRQGQLLGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGF  240

Query  974   YCDKFAPNKPYKPAIWT  1024
             YCD FAPNKPYKP IWT
Sbjct  241   YCDSFAPNKPYKPLIWT  257



>emb|CAA18137.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=853

 Score =   439 bits (1130),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 200/257 (78%), Positives = 223/257 (87%), Gaps = 1/257 (0%)
 Frame = +2

Query  257   LREKLRGGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRST  433
             +RE   G +  + +L  C+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST
Sbjct  1     MREMGTGDSASRLILWFCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRST  60

Query  434   PEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLR  613
             P+MWEDLI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLR
Sbjct  61    PDMWEDLIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLR  120

Query  614   IGPYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGP  793
             IGPY+C EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGP
Sbjct  121   IGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGP  180

Query  794   IILSQIENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGF  973
             IILSQIENEYG Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGF
Sbjct  181   IILSQIENEYGRQGQLLGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGF  240

Query  974   YCDKFAPNKPYKPAIWT  1024
             YCD FAPNKPYKP IWT
Sbjct  241   YCDSFAPNKPYKPLIWT  257



>ref|NP_849506.1| beta-galactosidase 3 [Arabidopsis thaliana]
 gb|AEE86647.1| beta-galactosidase 3 [Arabidopsis thaliana]
Length=855

 Score =   439 bits (1130),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 200/257 (78%), Positives = 223/257 (87%), Gaps = 1/257 (0%)
 Frame = +2

Query  257   LREKLRGGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRST  433
             +RE   G +  + +L  C+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRST
Sbjct  1     MREMGTGDSASRLILWFCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRST  60

Query  434   PEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLR  613
             P+MWEDLI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLR
Sbjct  61    PDMWEDLIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLR  120

Query  614   IGPYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGP  793
             IGPY+C EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGP
Sbjct  121   IGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGP  180

Query  794   IILSQIENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGF  973
             IILSQIENEYG Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGF
Sbjct  181   IILSQIENEYGRQGQLLGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGF  240

Query  974   YCDKFAPNKPYKPAIWT  1024
             YCD FAPNKPYKP IWT
Sbjct  241   YCDSFAPNKPYKPLIWT  257



>ref|XP_004149980.1| PREDICTED: beta-galactosidase 3 [Cucumis sativus]
Length=854

 Score =   439 bits (1129),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 200/243 (82%), Positives = 220/243 (91%), Gaps = 0/243 (0%)
 Frame = +2

Query  296   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  475
             +LVL + + L     QCSV+YDRKAI+INGQRRVLFSGSIHYPRSTPEMWE LI KAKEG
Sbjct  11    MLVLGLFWLLGVQFVQCSVTYDRKAILINGQRRVLFSGSIHYPRSTPEMWEGLIQKAKEG  70

Query  476   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  655
             G+DV+ETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYA+LRIGPY+C EWNFGGF
Sbjct  71    GLDVVETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYANLRIGPYVCAEWNFGGF  130

Query  656   PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQA  835
             PVWLK+VPGISFR DNEPFK AM+GFTEKIV LMKS NLFESQGGPIILSQIENEYG Q+
Sbjct  131   PVWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKSENLFESQGGPIILSQIENEYGVQS  190

Query  836   KVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPA  1015
             K+ GA+G  Y+TWAAKMAV + TGVPWVMCKEEDAPDPVINTCNGFYCD F+PN+PYKP 
Sbjct  191   KLFGAAGQNYMTWAAKMAVGLGTGVPWVMCKEEDAPDPVINTCNGFYCDAFSPNRPYKPT  250

Query  1016  IWT  1024
             +WT
Sbjct  251   MWT  253



>ref|XP_011083163.1| PREDICTED: beta-galactosidase 3 [Sesamum indicum]
Length=845

 Score =   438 bits (1127),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
             +CSV+YDRKA++INGQRR+L SGSIHYPRSTPEMWEDLI+KAKEGG+DVI+TYVFWNVHE
Sbjct  26    ECSVTYDRKALIINGQRRILISGSIHYPRSTPEMWEDLINKAKEGGLDVIDTYVFWNVHE  85

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             PSPGNYNFEGRYDLV+FVKTIQKAGLYAHLRIGPY+C EWNFGG PVWLKFVPGISFR D
Sbjct  86    PSPGNYNFEGRYDLVKFVKTIQKAGLYAHLRIGPYVCAEWNFGGLPVWLKFVPGISFRTD  145

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             NEPFKMAMK FT+KIVN+MK+ NL+ESQGGPIILSQIENEYGPQA +LGA G QYVTWAA
Sbjct  146   NEPFKMAMKRFTKKIVNMMKTENLYESQGGPIILSQIENEYGPQANLLGAPGRQYVTWAA  205

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              MAV +DTGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKPYKP IWT
Sbjct  206   NMAVGLDTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPNKPYKPMIWT  253



>ref|XP_008337843.1| PREDICTED: beta-galactosidase 3 [Malus domestica]
 ref|XP_008363095.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
Length=853

 Score =   438 bits (1127),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 196/230 (85%), Positives = 214/230 (93%), Gaps = 0/230 (0%)
 Frame = +2

Query  335   LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  514
             L  C+V+YDRKAIVINGQRR+L SGSIHYPRSTPEMWEDLI KAKEGG+DV+ETYVFWNV
Sbjct  23    LVHCTVTYDRKAIVINGQRRILISGSIHYPRSTPEMWEDLIQKAKEGGLDVVETYVFWNV  82

Query  515   HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  694
             HEP+PGNYNFEGRYDLVRF+KTIQ AGLYAHLRIGPY+C EWN GGFPVWLK+VPGISFR
Sbjct  83    HEPTPGNYNFEGRYDLVRFLKTIQNAGLYAHLRIGPYVCAEWNNGGFPVWLKYVPGISFR  142

Query  695   ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTW  874
              DNEPFK AM+GFTEKIV LMKS NLFESQGGPIILSQIENEYG Q+K+LGA+GH Y+TW
Sbjct  143   TDNEPFKRAMQGFTEKIVRLMKSENLFESQGGPIILSQIENEYGAQSKLLGAAGHNYITW  202

Query  875   AAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AA+MAV +DTGVPWVMCKEEDAPDPVINTCNGFYCD F+PN+PYKP IWT
Sbjct  203   AAEMAVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDSFSPNQPYKPTIWT  252



>ref|XP_006283100.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
 gb|EOA15998.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
Length=813

 Score =   437 bits (1124),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 200/251 (80%), Positives = 220/251 (88%), Gaps = 1/251 (0%)
 Frame = +2

Query  275   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  451
             G +  + VL LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7     GDSSSRLVLWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWES  66

Query  452   LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  631
             LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67    LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  632   GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  811
              EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127   AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  186

Query  812   ENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFA  991
             ENEYG Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGFYCD FA
Sbjct  187   ENEYGRQGQLLGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFA  246

Query  992   PNKPYKPAIWT  1024
             PNKPYKP IWT
Sbjct  247   PNKPYKPLIWT  257



>ref|XP_010029731.1| PREDICTED: beta-galactosidase 3 [Eucalyptus grandis]
 gb|KCW56689.1| hypothetical protein EUGRSUZ_I02384 [Eucalyptus grandis]
Length=849

 Score =   438 bits (1127),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 216/230 (94%), Gaps = 0/230 (0%)
 Frame = +2

Query  335   LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  514
             L QCSVSYDRKA+VI+GQRR+LFSGSIHYPRSTP+MWEDLI KAK+GG+DV+ETYVFWNV
Sbjct  25    LIQCSVSYDRKALVIDGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGGLDVVETYVFWNV  84

Query  515   HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  694
             HEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  85    HEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  144

Query  695   ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTW  874
              DNEPFK AM+GFT+KIVNLMKS NLFESQGGPIIL+QIENEYG ++K+LGA+GH YVTW
Sbjct  145   TDNEPFKRAMEGFTKKIVNLMKSENLFESQGGPIILNQIENEYGAESKLLGAAGHNYVTW  204

Query  875   AAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AA MAV++ TGVPWVMCKEEDAPDPVINTCNGFYCD F PNK YKP IWT
Sbjct  205   AADMAVKLGTGVPWVMCKEEDAPDPVINTCNGFYCDAFTPNKDYKPTIWT  254



>emb|CAN78072.1| hypothetical protein VITISV_013292 [Vitis vinifera]
Length=854

 Score =   437 bits (1125),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 193/237 (81%), Positives = 218/237 (92%), Gaps = 0/237 (0%)
 Frame = +2

Query  314   VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIE  493
             + FL S L QCSV+YD+KAIVINGQRR+L SGSIHYPRSTP+MWEDLI KAK+GG+DVI+
Sbjct  17    LMFLHSQLIQCSVTYDKKAIVINGQRRILISGSIHYPRSTPDMWEDLIRKAKDGGLDVID  76

Query  494   TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKF  673
             TY+FWNVHEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPVWLKF
Sbjct  77    TYIFWNVHEPSPGNYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKF  136

Query  674   VPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGAS  853
             VPGISFR +NEPFKMAM+GFT+KIV++MKS NLF SQGGPIILSQIENEYGP+++ LGA+
Sbjct  137   VPGISFRTNNEPFKMAMQGFTQKIVHMMKSENLFASQGGPIILSQIENEYGPESRELGAA  196

Query  854   GHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             GH Y+ WAAKMAV +DTGVPWVMCKE+DAPDPVIN CNGFYCD F+PNKPYKP IWT
Sbjct  197   GHAYINWAAKMAVGLDTGVPWVMCKEDDAPDPVINACNGFYCDAFSPNKPYKPRIWT  253



>ref|NP_001268162.1| beta-galactosidase BG1-like precursor [Vitis vinifera]
 gb|AAK81874.1| putative beta-galactosidase BG1 [Vitis vinifera]
Length=854

 Score =   437 bits (1125),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 193/237 (81%), Positives = 218/237 (92%), Gaps = 0/237 (0%)
 Frame = +2

Query  314   VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIE  493
             + FL S L QCSV+YD+KAIVINGQRR+L SGSIHYPRSTP+MWEDLI KAK+GG+DVI+
Sbjct  17    LMFLHSQLIQCSVTYDKKAIVINGQRRILISGSIHYPRSTPDMWEDLIRKAKDGGLDVID  76

Query  494   TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKF  673
             TY+FWNVHEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPVWLKF
Sbjct  77    TYIFWNVHEPSPGNYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKF  136

Query  674   VPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGAS  853
             VPGISFR +NEPFKMAM+GFT+KIV++MKS NLF SQGGPIILSQIENEYGP+++ LGA+
Sbjct  137   VPGISFRTNNEPFKMAMQGFTQKIVHMMKSENLFASQGGPIILSQIENEYGPESRELGAA  196

Query  854   GHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             GH Y+ WAAKMAV +DTGVPWVMCKE+DAPDPVIN CNGFYCD F+PNKPYKP IWT
Sbjct  197   GHAYINWAAKMAVGLDTGVPWVMCKEDDAPDPVINACNGFYCDAFSPNKPYKPRIWT  253



>emb|CBI19767.3| unnamed protein product [Vitis vinifera]
Length=854

 Score =   437 bits (1125),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 193/237 (81%), Positives = 218/237 (92%), Gaps = 0/237 (0%)
 Frame = +2

Query  314   VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIE  493
             + FL S L QCSV+YD+KAIVINGQRR+L SGSIHYPRSTP+MWEDLI KAK+GG+DVI+
Sbjct  17    LMFLHSQLIQCSVTYDKKAIVINGQRRILISGSIHYPRSTPDMWEDLIRKAKDGGLDVID  76

Query  494   TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKF  673
             TY+FWNVHEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPVWLKF
Sbjct  77    TYIFWNVHEPSPGNYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKF  136

Query  674   VPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGAS  853
             VPGISFR +NEPFKMAM+GFT+KIV++MKS NLF SQGGPIILSQIENEYGP+++ LGA+
Sbjct  137   VPGISFRTNNEPFKMAMQGFTQKIVHMMKSENLFASQGGPIILSQIENEYGPESRELGAA  196

Query  854   GHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             GH Y+ WAAKMAV +DTGVPWVMCKE+DAPDPVIN CNGFYCD F+PNKPYKP IWT
Sbjct  197   GHAYINWAAKMAVGLDTGVPWVMCKEDDAPDPVINACNGFYCDAFSPNKPYKPRIWT  253



>emb|CDP01954.1| unnamed protein product [Coffea canephora]
Length=851

 Score =   437 bits (1124),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 209/245 (85%), Positives = 222/245 (91%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             KWVLVLCMV  L +   Q SVSYDRKA+VIN QRR+L SGSIHYPRSTPEMWEDLI+KAK
Sbjct  8     KWVLVLCMVVVLGAEFVQSSVSYDRKAVVINEQRRILISGSIHYPRSTPEMWEDLINKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GG+DVIETYVFWNVHEPSPGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFG
Sbjct  68    DGGLDVIETYVFWNVHEPSPGNYNFEGRYDLVRFIKTIQKAGLYAHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+VPGISFR DNEPFKM M+ FTEKIV LMKS NLFESQGGPIILSQIENEYGP
Sbjct  128   GFPVWLKYVPGISFRTDNEPFKMYMQRFTEKIVRLMKSENLFESQGGPIILSQIENEYGP  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             Q KVLGA  HQY+TWAA MAV ++TGVPWVMCKEEDAPDPVINTCNGFYCD F PNKPYK
Sbjct  188   QVKVLGAPAHQYMTWAANMAVGLNTGVPWVMCKEEDAPDPVINTCNGFYCDSFTPNKPYK  247

Query  1010  PAIWT  1024
             P IWT
Sbjct  248   PTIWT  252



>ref|XP_002310279.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE90729.2| beta-galactosidase family protein [Populus trichocarpa]
Length=847

 Score =   437 bits (1124),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 196/242 (81%), Positives = 221/242 (91%), Gaps = 0/242 (0%)
 Frame = +2

Query  299   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
             LV  +VF   S L QCSV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAK+GG
Sbjct  12    LVFLVVFLGCSELIQCSVTYDRKAIMINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGG  71

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DVIETYVFWNVHEP+PGNY+FEGRYD+VRF+KTIQ+AGLYAHLRIGPY+C EWNFGGFP
Sbjct  72    IDVIETYVFWNVHEPTPGNYHFEGRYDIVRFMKTIQRAGLYAHLRIGPYVCAEWNFGGFP  131

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAK  838
             VWLK+VPGISFR DNEPFK AM+GFTEKIV LMK+ +LFESQGGPIILSQIENEYG Q+K
Sbjct  132   VWLKYVPGISFRTDNEPFKRAMQGFTEKIVGLMKAEHLFESQGGPIILSQIENEYGVQSK  191

Query  839   VLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAI  1018
             + GA+G+ Y+TWAA MA++  TGVPWVMCKE+DAPDPVINTCNGFYCD FAPNKPYKP I
Sbjct  192   LFGAAGYNYMTWAANMAIQTGTGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPTI  251

Query  1019  WT  1024
             WT
Sbjct  252   WT  253



>ref|XP_010531064.1| PREDICTED: beta-galactosidase 3 [Tarenaya hassleriana]
Length=855

 Score =   437 bits (1124),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 203/256 (79%), Positives = 224/256 (88%), Gaps = 0/256 (0%)
 Frame = +2

Query  257   LREKLRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTP  436
             + E   G  +R +V  L     L S + QCSV+YDRKA+VINGQRR+LFSGSIHYPRSTP
Sbjct  1     MGEMGAGFTVRMFVWFLLGFLLLGSEIVQCSVTYDRKALVINGQRRILFSGSIHYPRSTP  60

Query  437   EMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRI  616
             +MWE LI KAK+GG+DVIETYVFWN+HEP+PG Y+FEGR DLVRFVKT+QKAGLYAHLRI
Sbjct  61    DMWEGLIQKAKDGGIDVIETYVFWNLHEPTPGKYDFEGRNDLVRFVKTVQKAGLYAHLRI  120

Query  617   GPYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPI  796
             GPY+C EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTEKIV LMKS +LFESQGGPI
Sbjct  121   GPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTEKIVELMKSESLFESQGGPI  180

Query  797   ILSQIENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFY  976
             ILSQIENEYG QA++ GA GH Y+TWAAKMAVE DTGVPWVMCKE+DAPDPVINTCNGFY
Sbjct  181   ILSQIENEYGKQAQIFGAEGHNYMTWAAKMAVETDTGVPWVMCKEDDAPDPVINTCNGFY  240

Query  977   CDKFAPNKPYKPAIWT  1024
             CD FAPNKPYKPAIWT
Sbjct  241   CDSFAPNKPYKPAIWT  256



>emb|CAB16852.1| beta-galactosidase like protein [Arabidopsis thaliana]
 emb|CAB80302.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=853

 Score =   436 bits (1122),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/251 (79%), Positives = 220/251 (88%), Gaps = 1/251 (0%)
 Frame = +2

Query  275   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  451
             G +  + +L  C+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWED
Sbjct  4     GDSASRLILWFCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWED  63

Query  452   LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  631
             LI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  64    LIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  123

Query  632   GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  811
              EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  124   AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  183

Query  812   ENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFA  991
             ENEYG Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGFYCD FA
Sbjct  184   ENEYGRQGQLLGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFA  243

Query  992   PNKPYKPAIWT  1024
             PNKPYKP IWT
Sbjct  244   PNKPYKPLIWT  254



>ref|XP_006283101.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
 gb|EOA15999.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
Length=856

 Score =   437 bits (1123),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 200/251 (80%), Positives = 220/251 (88%), Gaps = 1/251 (0%)
 Frame = +2

Query  275   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  451
             G +  + VL LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7     GDSSSRLVLWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWES  66

Query  452   LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  631
             LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67    LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  632   GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  811
              EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127   AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  186

Query  812   ENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFA  991
             ENEYG Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGFYCD FA
Sbjct  187   ENEYGRQGQLLGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFA  246

Query  992   PNKPYKPAIWT  1024
             PNKPYKP IWT
Sbjct  247   PNKPYKPLIWT  257



>ref|XP_010437358.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=856

 Score =   436 bits (1121),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 199/251 (79%), Positives = 220/251 (88%), Gaps = 1/251 (0%)
 Frame = +2

Query  275   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  451
             G +  + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7     GDSASRMILWLCLGFLILDVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  452   LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  631
             LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67    LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  632   GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  811
              EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127   AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  186

Query  812   ENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFA  991
             ENEYG Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGFYCD FA
Sbjct  187   ENEYGRQGQLLGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFA  246

Query  992   PNKPYKPAIWT  1024
             PNKPYKP IWT
Sbjct  247   PNKPYKPLIWT  257



>dbj|BAD91082.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=854

 Score =   436 bits (1121),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
              C+V+YDRKAIVINGQRR+L SGSIHYPRSTPEMWEDLI KAK+GG+DV+ETYVFWNVHE
Sbjct  25    HCAVTYDRKAIVINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDVVETYVFWNVHE  84

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             P+PGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR D
Sbjct  85    PTPGNYNFEGRYDLVRFLKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTD  144

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             NEPFK AM+GFT+KIV LMKS +LFESQGGPIILSQIENEYG Q+K+ GA+GH Y+TWAA
Sbjct  145   NEPFKRAMQGFTQKIVGLMKSESLFESQGGPIILSQIENEYGAQSKLFGAAGHNYITWAA  204

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             +MAV +DTGVPWVMCKEEDAPDPVINTCNGFYCD F+PN+PYKP IWT
Sbjct  205   EMAVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDSFSPNRPYKPTIWT  252



>ref|XP_008338023.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
 ref|XP_008367947.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
Length=853

 Score =   435 bits (1119),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 194/230 (84%), Positives = 214/230 (93%), Gaps = 0/230 (0%)
 Frame = +2

Query  335   LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  514
             L  C+V+YDRKAIVINGQRR+L SGSIHYPRSTPE WEDLI KAK+GG+DV+ETYVFWNV
Sbjct  23    LVHCAVTYDRKAIVINGQRRILISGSIHYPRSTPEXWEDLIQKAKDGGLDVVETYVFWNV  82

Query  515   HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  694
             HEP+PGNYNFEGRYDLVRF+KTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  83    HEPTPGNYNFEGRYDLVRFLKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  695   ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTW  874
              DNEPFK AM+GFT+KIV LMKS +LFESQGGPIILSQIENEYG Q+K+ GA+GH Y+TW
Sbjct  143   TDNEPFKRAMQGFTQKIVGLMKSESLFESQGGPIILSQIENEYGAQSKLFGAAGHNYITW  202

Query  875   AAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AA+MAV +DTGVPWVMCKEEDAPDPVINTCNGFYCD F+PNKPYKP IWT
Sbjct  203   AAEMAVGLDTGVPWVMCKEEDAPDPVINTCNGFYCDSFSPNKPYKPTIWT  252



>gb|KHG23756.1| Beta-galactosidase 5 -like protein [Gossypium arboreum]
Length=741

 Score =   432 bits (1110),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 219/248 (88%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             ++ K ++     F  SS L QCS++YD+KAI+INGQRR+L SGSIHYPRSTPEMWEDLI 
Sbjct  5     SVSKLLIFFFSAFLASSKLIQCSITYDKKAILINGQRRILISGSIHYPRSTPEMWEDLIK  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPYIC EW
Sbjct  65    KAKDGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKLGLYVHLRIGPYICAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFR DNEPFK AM+GFT+KIV +MK+  LF SQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTQKIVQMMKNEKLFASQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YGP+++ LGA+GH Y+ WAAKMAVE++TGVPWVMCKE+DAPDPVIN CNGFYCD F+PNK
Sbjct  185   YGPESRALGAAGHAYINWAAKMAVELNTGVPWVMCKEDDAPDPVINACNGFYCDGFSPNK  244

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  245   PYKPTMWT  252



>gb|KJB58182.1| hypothetical protein B456_009G198100 [Gossypium raimondii]
Length=733

 Score =   431 bits (1109),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 219/248 (88%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             ++ K ++     F  SS L QCS++YD+KAI+INGQRR+L SGSIHYPRSTPEMWEDLI 
Sbjct  5     SVSKLLIFFFTAFLASSKLIQCSITYDKKAILINGQRRILISGSIHYPRSTPEMWEDLIK  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPYIC EW
Sbjct  65    KAKDGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKLGLYVHLRIGPYICAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFR DNEPFK AM+GFT+KIV +MK+  LF SQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTQKIVQMMKNEKLFASQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YGP+++ LGA+GH Y+ WAAKMAVE++TGVPWVMCKE+DAPDPVIN CNGFYCD F+PNK
Sbjct  185   YGPESRALGAAGHAYINWAAKMAVELNTGVPWVMCKEDDAPDPVINACNGFYCDGFSPNK  244

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  245   PYKPTMWT  252



>ref|XP_012078404.1| PREDICTED: beta-galactosidase 3 [Jatropha curcas]
Length=848

 Score =   434 bits (1117),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 196/242 (81%), Positives = 219/242 (90%), Gaps = 0/242 (0%)
 Frame = +2

Query  299   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
             L+  +V  L   L QC+V+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAK+GG
Sbjct  12    LLAFLVLCLGCELIQCTVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIQKAKDGG  71

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DVIETYVFWNVHEP+ GNYNFEGRYDLVRF+K IQKAGLYAHLRIGPY+C EWNFGGFP
Sbjct  72    LDVIETYVFWNVHEPTQGNYNFEGRYDLVRFIKLIQKAGLYAHLRIGPYVCAEWNFGGFP  131

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAK  838
             VWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS +LFESQGGPIILSQIENEYG Q+K
Sbjct  132   VWLKYVPGISFRTDNEPFKRAMQGFTEKIVGMMKSEHLFESQGGPIILSQIENEYGSQSK  191

Query  839   VLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAI  1018
             +LGA+G+ Y+TWAA MAV+  TGVPWVMCKEEDAPDPVINTCNGFYCD F+PNKPYKP I
Sbjct  192   LLGAAGYNYMTWAANMAVQTGTGVPWVMCKEEDAPDPVINTCNGFYCDSFSPNKPYKPTI  251

Query  1019  WT  1024
             WT
Sbjct  252   WT  253



>ref|XP_010446807.1| PREDICTED: beta-galactosidase 3 [Camelina sativa]
Length=856

 Score =   434 bits (1117),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 198/251 (79%), Positives = 220/251 (88%), Gaps = 1/251 (0%)
 Frame = +2

Query  275   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  451
             G +  + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7     GDSASRMILWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  452   LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  631
             LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67    LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  632   GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  811
              EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127   AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTERIVELMKSENLFESQGGPIILSQI  186

Query  812   ENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFA  991
             ENEYG Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGFYCD FA
Sbjct  187   ENEYGRQGQLLGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFA  246

Query  992   PNKPYKPAIWT  1024
             PNKPYKP IWT
Sbjct  247   PNKPYKPLIWT  257



>ref|XP_010432182.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=856

 Score =   434 bits (1117),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 198/251 (79%), Positives = 221/251 (88%), Gaps = 1/251 (0%)
 Frame = +2

Query  275   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  451
             G ++ + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7     GDSVSRMILWLCLGFLILVVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  452   LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  631
             LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67    LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  632   GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  811
              EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127   AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTERIVELMKSENLFESQGGPIILSQI  186

Query  812   ENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFA  991
             ENEYG Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGFYCD FA
Sbjct  187   ENEYGRQGQLLGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFA  246

Query  992   PNKPYKPAIWT  1024
             PNKPYKP IWT
Sbjct  247   PNKPYKPLIWT  257



>gb|KJB63588.1| hypothetical protein B456_010G007300 [Gossypium raimondii]
Length=586

 Score =   426 bits (1095),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 187/245 (76%), Positives = 213/245 (87%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             K++       F+S  L  C+++YD+K+IVINGQRR+L SGSIHYPRSTP+MWE LI KAK
Sbjct  8     KFIFFFITAMFMSFNLIHCTITYDKKSIVINGQRRILISGSIHYPRSTPDMWESLIKKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
              GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFG
Sbjct  68    NGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKMGLYVHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+VPGISFR DNEPFK AM+GFTEKIV +MK+  LF S GGPIILSQIENEYGP
Sbjct  128   GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVQMMKNEKLFASHGGPIILSQIENEYGP  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             ++K LGA+GH YV WAAKMAV +DTGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKPYK
Sbjct  188   ESKALGAAGHGYVNWAAKMAVGLDTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPNKPYK  247

Query  1010  PAIWT  1024
             P +WT
Sbjct  248   PMLWT  252



>ref|XP_002510455.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF52642.1| beta-galactosidase, putative [Ricinus communis]
Length=846

 Score =   433 bits (1114),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 220/248 (89%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             ++ K +    MV  + S L QC+V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWEDLI 
Sbjct  5     SVSKLLTFFLMVLLMGSKLVQCTVTYDKKAIIINGQRRILISGSIHYPRSTPEMWEDLIQ  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DVI+TYVFW+VHE SPGNYNF+GRYDLVRF+KT+QK GLYAHLRIGPY+C EW
Sbjct  65    KAKDGGLDVIDTYVFWDVHETSPGNYNFDGRYDLVRFIKTVQKVGLYAHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFR DNEPFK AM+GFT+KIV +MK+ NLF SQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRTDNEPFKAAMQGFTQKIVQMMKNENLFASQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YGP+++ LGA+G  Y+ WAAKMAV +DTGVPWVMCKE+DAPDP+INTCNGFYCD FAPNK
Sbjct  185   YGPESRALGAAGRSYINWAAKMAVGLDTGVPWVMCKEDDAPDPMINTCNGFYCDAFAPNK  244

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  245   PYKPTLWT  252



>ref|XP_003520277.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score =   433 bits (1113),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/232 (84%), Positives = 214/232 (92%), Gaps = 0/232 (0%)
 Frame = +2

Query  329   SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFW  508
             S + + SV+YDRKA++INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG+DV+ETYVFW
Sbjct  20    SHVARASVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGIDVVETYVFW  79

Query  509   NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGIS  688
             NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGIS
Sbjct  80    NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGIS  139

Query  689   FRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYV  868
             FR DNEPFK AM+GFTEKIV +MKS  LFESQGGPIILSQIENEYG Q+K+ GA+G  YV
Sbjct  140   FRTDNEPFKRAMQGFTEKIVGMMKSERLFESQGGPIILSQIENEYGAQSKLQGAAGQNYV  199

Query  869   TWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              WAAKMAVEM TGVPWVMCKE+DAPDPVINTCNGFYCDKF PN+PYKP IWT
Sbjct  200   NWAAKMAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCDKFTPNRPYKPMIWT  251



>ref|XP_009145073.1| PREDICTED: beta-galactosidase 3 [Brassica rapa]
Length=856

 Score =   433 bits (1114),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 197/251 (78%), Positives = 219/251 (87%), Gaps = 1/251 (0%)
 Frame = +2

Query  275   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  451
             G    + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7     GDTAPRLILWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  452   LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  631
             LI KAK+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  67    LIQKAKDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  126

Query  632   GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  811
              EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTE+IV LMKS NL+ESQGGPIILSQI
Sbjct  127   AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMQGFTERIVQLMKSENLYESQGGPIILSQI  186

Query  812   ENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFA  991
             ENEYG Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGFYCD FA
Sbjct  187   ENEYGRQGQLLGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFA  246

Query  992   PNKPYKPAIWT  1024
             PNKPYKP IWT
Sbjct  247   PNKPYKPLIWT  257



>emb|CDX75569.1| BnaA01g01330D [Brassica napus]
Length=827

 Score =   432 bits (1111),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/246 (80%), Positives = 218/246 (89%), Gaps = 1/246 (0%)
 Frame = +2

Query  290   KWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  466
             + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE LI KA
Sbjct  12    RLILWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKA  71

Query  467   KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  646
             K+GGVDVIETYVFWN+HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C EWNF
Sbjct  72    KDGGVDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNF  131

Query  647   GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYG  826
             GGFPVWLK+VPGISFR DNEPFK AM+GFTE+IV LMKS NL+ESQGGPIILSQIENEYG
Sbjct  132   GGFPVWLKYVPGISFRTDNEPFKRAMQGFTERIVQLMKSENLYESQGGPIILSQIENEYG  191

Query  827   PQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPY  1006
              Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGFYCD FAPNKPY
Sbjct  192   RQGQLLGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPY  251

Query  1007  KPAIWT  1024
             KP IWT
Sbjct  252   KPLIWT  257



>ref|XP_002867020.1| hypothetical protein ARALYDRAFT_491000 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43279.1| hypothetical protein ARALYDRAFT_491000 [Arabidopsis lyrata subsp. 
lyrata]
Length=853

 Score =   432 bits (1112),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 195/251 (78%), Positives = 219/251 (87%), Gaps = 1/251 (0%)
 Frame = +2

Query  275   GGAMRKWVLVLCM-VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  451
             G +  + +L  C+ +  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  4     GDSASRLILWFCLGLLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  63

Query  452   LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  631
             LI KAK+GG+DVIETYVFWN+HEP+PG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  64    LIQKAKDGGIDVIETYVFWNLHEPTPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  123

Query  632   GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  811
              EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  124   AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  183

Query  812   ENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFA  991
             ENEYG Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGFYCD FA
Sbjct  184   ENEYGRQGQLLGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFA  243

Query  992   PNKPYKPAIWT  1024
             PNKPYKP IWT
Sbjct  244   PNKPYKPLIWT  254



>gb|KDO84692.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=637

 Score =   426 bits (1094),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 219/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLI  457
             ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI
Sbjct  5     SVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLI  64

Query  458   SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  637
              KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY+C E
Sbjct  65    RKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAE  124

Query  638   WNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIEN  817
             WNFGGFPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILSQIEN
Sbjct  125   WNFGGFPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQIEN  184

Query  818   EYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPN  997
             EYGP++K LGA+GH YV WAAKMAV +DTGVPWVMCKE+DAPDPVIN+CNGFYCD F+PN
Sbjct  185   EYGPESKSLGAAGHAYVNWAAKMAVGLDTGVPWVMCKEDDAPDPVINSCNGFYCDAFSPN  244

Query  998   KPYKPAIWT  1024
             KPYKP +WT
Sbjct  245   KPYKPTLWT  253



>ref|XP_006412011.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
 gb|ESQ53464.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
Length=856

 Score =   432 bits (1111),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 195/251 (78%), Positives = 218/251 (87%), Gaps = 1/251 (0%)
 Frame = +2

Query  275   GGAMRKWVLVLCM-VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  451
             G +  + +L  C+ +  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7     GDSASRLILWCCLGLLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  452   LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  631
             LI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVK I KAGLYAHLRIGPY+C
Sbjct  67    LIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKAIHKAGLYAHLRIGPYVC  126

Query  632   GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  811
              EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127   AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  186

Query  812   ENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFA  991
             ENEYG Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGFYCD FA
Sbjct  187   ENEYGRQGQILGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFA  246

Query  992   PNKPYKPAIWT  1024
             PNKPYKP IWT
Sbjct  247   PNKPYKPTIWT  257



>ref|XP_010254673.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =   432 bits (1110),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
             +CSV+YDRKAI+INGQRR+LFSGSIHYPRSTPEMW DLI KAKEGG+DVI+TYVFWNVHE
Sbjct  24    ECSVTYDRKAIIINGQRRILFSGSIHYPRSTPEMWGDLIQKAKEGGLDVIQTYVFWNVHE  83

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             PSPGNYNFEGRYDLVRF+KT+QKAGLY HLRIGPYICGEWNFGGFPVWLK+VPGISFR D
Sbjct  84    PSPGNYNFEGRYDLVRFIKTVQKAGLYVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTD  143

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             NEPFKMAM+GFT+KIV +MKS  LFESQGGPIILSQIENEYGP++K  G++G+ Y+TWAA
Sbjct  144   NEPFKMAMQGFTQKIVQMMKSERLFESQGGPIILSQIENEYGPESKAFGSAGYSYMTWAA  203

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              MAV++ TGVPWVMCK++DAPDPVIN CNGFYCD F+PNKPYKPA+WT
Sbjct  204   NMAVKLGTGVPWVMCKQDDAPDPVINACNGFYCDAFSPNKPYKPAMWT  251



>gb|KJB63586.1| hypothetical protein B456_010G007300 [Gossypium raimondii]
Length=538

 Score =   422 bits (1084),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 187/245 (76%), Positives = 213/245 (87%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             K++       F+S  L  C+++YD+K+IVINGQRR+L SGSIHYPRSTP+MWE LI KAK
Sbjct  8     KFIFFFITAMFMSFNLIHCTITYDKKSIVINGQRRILISGSIHYPRSTPDMWESLIKKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
              GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFG
Sbjct  68    NGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKMGLYVHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+VPGISFR DNEPFK AM+GFTEKIV +MK+  LF S GGPIILSQIENEYGP
Sbjct  128   GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVQMMKNEKLFASHGGPIILSQIENEYGP  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             ++K LGA+GH YV WAAKMAV +DTGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKPYK
Sbjct  188   ESKALGAAGHGYVNWAAKMAVGLDTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPNKPYK  247

Query  1010  PAIWT  1024
             P +WT
Sbjct  248   PMLWT  252



>ref|XP_003538867.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=853

 Score =   431 bits (1108),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 198/242 (82%), Positives = 216/242 (89%), Gaps = 2/242 (1%)
 Frame = +2

Query  305   LCMVFFLSSGLTQ--CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
              C+  +L   L Q  CSV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG
Sbjct  15    FCLALWLGFQLEQVHCSVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGG  74

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DVIETY+FWNVHEPS GNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFP
Sbjct  75    LDVIETYIFWNVHEPSRGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFP  134

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAK  838
             VWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS  L+ESQGGPIILSQIENEYG Q+K
Sbjct  135   VWLKYVPGISFRTDNEPFKKAMQGFTEKIVGMMKSERLYESQGGPIILSQIENEYGAQSK  194

Query  839   VLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAI  1018
             +LG +G  YV WAAKMAVE  TGVPWVMCKE+DAPDPVINTCNGFYCD F PNKPYKP+I
Sbjct  195   LLGPAGQNYVNWAAKMAVETGTGVPWVMCKEDDAPDPVINTCNGFYCDYFTPNKPYKPSI  254

Query  1019  WT  1024
             WT
Sbjct  255   WT  256



>ref|XP_007156097.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
 gb|ESW28091.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
Length=847

 Score =   431 bits (1107),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/228 (86%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
               +V+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG+DV+ETYVFWNVHE
Sbjct  23    HAAVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIFKAKEGGLDVVETYVFWNVHE  82

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR D
Sbjct  83    PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTD  142

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             NEPFK AM+GFTEKIV +MKS  LFESQGGPIILSQIENEYG Q+K+ GA+G  YV WAA
Sbjct  143   NEPFKRAMQGFTEKIVGMMKSEQLFESQGGPIILSQIENEYGAQSKLQGAAGQNYVNWAA  202

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             KMAVEM TGVPWVMCKE+DAPDPVINTCNGFYCDKF PN+PYKP IWT
Sbjct  203   KMAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCDKFTPNRPYKPLIWT  250



>gb|KHN36067.1| Beta-galactosidase 3 [Glycine soja]
Length=849

 Score =   431 bits (1107),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 198/242 (82%), Positives = 217/242 (90%), Gaps = 2/242 (1%)
 Frame = +2

Query  305   LCMVFFLSSGLTQ--CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
              C+  +L   L Q  CSV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG
Sbjct  15    FCLALWLGFQLEQVHCSVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGG  74

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DVIETYVFWNVHEPS GNYNFEGRYDLVRFVKTIQKAGLYA+LRIGPY+C EWNFGGFP
Sbjct  75    LDVIETYVFWNVHEPSRGNYNFEGRYDLVRFVKTIQKAGLYANLRIGPYVCAEWNFGGFP  134

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAK  838
             VWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS  L+ESQGGPIILSQIENEYG Q+K
Sbjct  135   VWLKYVPGISFRTDNEPFKKAMQGFTEKIVGMMKSERLYESQGGPIILSQIENEYGAQSK  194

Query  839   VLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAI  1018
             +LG++G  YV WAAKMAVE  TGVPWVMCKE+DAPDPVINTCNGFYCD F PNKPYKP+I
Sbjct  195   LLGSAGQNYVNWAAKMAVETGTGVPWVMCKEDDAPDPVINTCNGFYCDYFTPNKPYKPSI  254

Query  1019  WT  1024
             WT
Sbjct  255   WT  256



>gb|KFK30264.1| hypothetical protein AALP_AA7G238600 [Arabis alpina]
Length=849

 Score =   431 bits (1107),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 194/231 (84%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = +2

Query  332   GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWN  511
             G  QCSV+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE LI KAK+GGVDVIETYVFWN
Sbjct  20    GFVQCSVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGVDVIETYVFWN  79

Query  512   VHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISF  691
             +HEPSPG Y+FEGR DLVRFVKTI KAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISF
Sbjct  80    LHEPSPGKYDFEGRNDLVRFVKTIHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISF  139

Query  692   RADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVT  871
             R DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQIENEYG Q ++LGA GH Y+T
Sbjct  140   RTDNEPFKRAMKGFTERIVELMKSDNLFESQGGPIILSQIENEYGRQGQLLGAEGHNYMT  199

Query  872   WAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             WAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGFYCD FAPNKPYKP IWT
Sbjct  200   WAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPTIWT  250



>ref|XP_003517202.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=849

 Score =   430 bits (1106),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 198/242 (82%), Positives = 217/242 (90%), Gaps = 2/242 (1%)
 Frame = +2

Query  305   LCMVFFLSSGLTQ--CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
              C+  +L   L Q  CSV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG
Sbjct  15    FCLALWLGFQLEQVHCSVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGG  74

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DVIETYVFWNVHEPS GNYNFEGRYDLVRFVKTIQKAGLYA+LRIGPY+C EWNFGGFP
Sbjct  75    LDVIETYVFWNVHEPSRGNYNFEGRYDLVRFVKTIQKAGLYANLRIGPYVCAEWNFGGFP  134

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAK  838
             VWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS  L+ESQGGPIILSQIENEYG Q+K
Sbjct  135   VWLKYVPGISFRTDNEPFKKAMQGFTEKIVGMMKSERLYESQGGPIILSQIENEYGAQSK  194

Query  839   VLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAI  1018
             +LG++G  YV WAAKMAVE  TGVPWVMCKE+DAPDPVINTCNGFYCD F PNKPYKP+I
Sbjct  195   LLGSAGQNYVNWAAKMAVETGTGVPWVMCKEDDAPDPVINTCNGFYCDYFTPNKPYKPSI  254

Query  1019  WT  1024
             WT
Sbjct  255   WT  256



>ref|XP_004509327.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=851

 Score =   430 bits (1106),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 193/234 (82%), Positives = 215/234 (92%), Gaps = 0/234 (0%)
 Frame = +2

Query  323   LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYV  502
             L S +   +V+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG+DVIETYV
Sbjct  19    LVSHIIHSTVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIQKAKEGGLDVIETYV  78

Query  503   FWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPG  682
             FWNVHEPSPGN+NFEGRYDLV+F+KTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPG
Sbjct  79    FWNVHEPSPGNFNFEGRYDLVKFIKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPG  138

Query  683   ISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQ  862
             ISFR DNEPFK AM+GFTEKIV +MKS +LFESQGGPIILSQIENEYG Q+K+ GA+G  
Sbjct  139   ISFRTDNEPFKRAMQGFTEKIVGMMKSEHLFESQGGPIILSQIENEYGAQSKLQGAAGQN  198

Query  863   YVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             Y+ WAAKMAVEM TGVPWVMCKE+DAPDPVINTCNGFYCDKF PN+PYKP +WT
Sbjct  199   YMNWAAKMAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCDKFTPNRPYKPTMWT  252



>ref|XP_003548865.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score =   430 bits (1106),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 195/229 (85%), Positives = 211/229 (92%), Gaps = 0/229 (0%)
 Frame = +2

Query  338   TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  517
             +  SV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG+DV+ETYVFWNVH
Sbjct  23    SHASVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGLDVVETYVFWNVH  82

Query  518   EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  697
             EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR 
Sbjct  83    EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRT  142

Query  698   DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWA  877
             DNEPFK AM+GFTEKIV +MKS  LFESQGGPIILSQIENEYG Q+K+ G +G  YV WA
Sbjct  143   DNEPFKTAMQGFTEKIVGMMKSERLFESQGGPIILSQIENEYGAQSKLQGDAGQNYVNWA  202

Query  878   AKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AKMAVEM TGVPWVMCKE+DAPDPVINTCNGFYCDKF PN+PYKP IWT
Sbjct  203   AKMAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCDKFTPNRPYKPMIWT  251



>dbj|BAJ34544.1| unnamed protein product [Thellungiella halophila]
Length=856

 Score =   431 bits (1107),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 194/251 (77%), Positives = 218/251 (87%), Gaps = 1/251 (0%)
 Frame = +2

Query  275   GGAMRKWVLVLCM-VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  451
             G +  + +L  C+ +  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  7     GDSASRLILWCCLGLLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  66

Query  452   LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  631
             LI KAK+GG+DVIETYVFWN+HEPSPG Y+FEGR DLVRFVK I KAGLYAHLRIGPY+C
Sbjct  67    LIQKAKDGGIDVIETYVFWNLHEPSPGKYDFEGRNDLVRFVKAIHKAGLYAHLRIGPYVC  126

Query  632   GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  811
              EWNFGGFPVWLK+VPGISFR DNEPFK AMKGFTE+IV LMKS NLFESQGGPIILSQI
Sbjct  127   AEWNFGGFPVWLKYVPGISFRTDNEPFKRAMKGFTERIVELMKSENLFESQGGPIILSQI  186

Query  812   ENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFA  991
             ENEYG Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVI+TCNGFYCD FA
Sbjct  187   ENEYGRQGQILGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVISTCNGFYCDSFA  246

Query  992   PNKPYKPAIWT  1024
             PNKPYKP IWT
Sbjct  247   PNKPYKPTIWT  257



>gb|KHN27041.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score =   430 bits (1106),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 195/229 (85%), Positives = 211/229 (92%), Gaps = 0/229 (0%)
 Frame = +2

Query  338   TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  517
             +  SV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG+DV+ETYVFWNVH
Sbjct  23    SHASVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGLDVVETYVFWNVH  82

Query  518   EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  697
             EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR 
Sbjct  83    EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRT  142

Query  698   DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWA  877
             DNEPFK AM+GFTEKIV +MKS  LFESQGGPIILSQIENEYG Q+K+ G +G  YV WA
Sbjct  143   DNEPFKTAMQGFTEKIVGMMKSERLFESQGGPIILSQIENEYGAQSKLQGDAGQNYVNWA  202

Query  878   AKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AKMAVEM TGVPWVMCKE+DAPDPVINTCNGFYCDKF PN+PYKP IWT
Sbjct  203   AKMAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCDKFTPNRPYKPMIWT  251



>ref|XP_002263382.2| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI38026.3| unnamed protein product [Vitis vinifera]
Length=846

 Score =   429 bits (1104),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 193/245 (79%), Positives = 217/245 (89%), Gaps = 1/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             KW L LCM  FL   LTQCSV+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE LI KAK
Sbjct  8     KWFL-LCMWVFLCIQLTQCSVTYDRKALIINGQRRILFSGSIHYPRSTPQMWEGLIQKAK  66

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GG+D I+TYVFWN+HEPSPG YNFEGRYDLVRF+K IQKAGLY HLRIGPYIC EWNFG
Sbjct  67    DGGLDAIDTYVFWNLHEPSPGKYNFEGRYDLVRFIKLIQKAGLYVHLRIGPYICAEWNFG  126

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLKFVPG+SFR DNEPFKMAM+ FT+KIV +MK+  LFESQGGPII+SQIENEYG 
Sbjct  127   GFPVWLKFVPGVSFRTDNEPFKMAMQRFTQKIVQMMKNEKLFESQGGPIIISQIENEYGH  186

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             +++  GA G+ Y+TWAAKMAV MDTGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKP K
Sbjct  187   ESRAFGAPGYAYLTWAAKMAVAMDTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPNKPNK  246

Query  1010  PAIWT  1024
             P +WT
Sbjct  247   PTLWT  251



>dbj|BAF31234.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =   429 bits (1103),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/230 (83%), Positives = 212/230 (92%), Gaps = 0/230 (0%)
 Frame = +2

Query  335   LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  514
             L QCSV+YDRKAI+INGQR++L SGSIHYPRSTP+MWE L+ KAK+GG+DVI+TYVFWNV
Sbjct  25    LIQCSVTYDRKAIIINGQRKILISGSIHYPRSTPDMWEGLMQKAKDGGLDVIQTYVFWNV  84

Query  515   HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  694
             HEPSPGNYNFEGRYDLVRFVKT+QKAGLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  85    HEPSPGNYNFEGRYDLVRFVKTVQKAGLYMHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  144

Query  695   ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTW  874
              DNEPFKMAM+GFTEKIV +MKS +LFESQGGPIILSQIENEYG ++K LGA GH Y+TW
Sbjct  145   TDNEPFKMAMQGFTEKIVQMMKSESLFESQGGPIILSQIENEYGSESKALGAPGHAYMTW  204

Query  875   AAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AAKMAV + TGVPWVMCKE+DAPDPVINTCNGFYCD F PNKPYKP +WT
Sbjct  205   AAKMAVGLRTGVPWVMCKEDDAPDPVINTCNGFYCDAFTPNKPYKPTMWT  254



>gb|KHG11061.1| Beta-galactosidase 5 -like protein [Gossypium arboreum]
Length=734

 Score =   426 bits (1094),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 186/245 (76%), Positives = 214/245 (87%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             K++       F+S  L  C+++YD+K+IVINGQRR+L SGSIHYPRSTP+MWE LI KAK
Sbjct  8     KFIFFFITAMFMSFNLIHCTITYDKKSIVINGQRRILISGSIHYPRSTPDMWESLIKKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
              GG+DVI+TY+FWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFG
Sbjct  68    NGGLDVIDTYIFWNGHEPSPGNYNFEGRYDLVRFIKTVQKLGLYVHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+VPGISFR DNEPFK AM+GFTEKIV +MK+  LF S GGPIILSQIENEYGP
Sbjct  128   GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVQMMKNEKLFASHGGPIILSQIENEYGP  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             ++K LGA+GH+YV WAAKMAV +DTGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKPYK
Sbjct  188   ESKALGAAGHRYVNWAAKMAVGLDTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPNKPYK  247

Query  1010  PAIWT  1024
             P +WT
Sbjct  248   PMLWT  252



>ref|XP_004512085.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=847

 Score =   429 bits (1102),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 196/242 (81%), Positives = 215/242 (89%), Gaps = 3/242 (1%)
 Frame = +2

Query  299   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
             L +    FL   +    V+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG
Sbjct  12    LFISFALFL---VVYSDVTYDRKAIIINGQRRILFSGSIHYPRSTPDMWEDLIQKAKEGG  68

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DVIETYVFWNVHEPSPGNYNFEGR DLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFP
Sbjct  69    LDVIETYVFWNVHEPSPGNYNFEGRNDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFP  128

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAK  838
             VWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS +L+ESQGGPIILSQIENEYG Q+K
Sbjct  129   VWLKYVPGISFRTDNEPFKKAMQGFTEKIVGMMKSEHLYESQGGPIILSQIENEYGAQSK  188

Query  839   VLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAI  1018
             + GA G+ Y+ WAAKMAVEM TGVPWVMCKE+DAPDPVINTCNGFYCDKF PNKPYKP +
Sbjct  189   LFGAVGYNYMNWAAKMAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCDKFTPNKPYKPTM  248

Query  1019  WT  1024
             WT
Sbjct  249   WT  250



>gb|KJB63587.1| hypothetical protein B456_010G007300 [Gossypium raimondii]
Length=732

 Score =   425 bits (1093),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 187/245 (76%), Positives = 213/245 (87%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             K++       F+S  L  C+++YD+K+IVINGQRR+L SGSIHYPRSTP+MWE LI KAK
Sbjct  8     KFIFFFITAMFMSFNLIHCTITYDKKSIVINGQRRILISGSIHYPRSTPDMWESLIKKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
              GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFG
Sbjct  68    NGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKMGLYVHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+VPGISFR DNEPFK AM+GFTEKIV +MK+  LF S GGPIILSQIENEYGP
Sbjct  128   GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVQMMKNEKLFASHGGPIILSQIENEYGP  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             ++K LGA+GH YV WAAKMAV +DTGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKPYK
Sbjct  188   ESKALGAAGHGYVNWAAKMAVGLDTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPNKPYK  247

Query  1010  PAIWT  1024
             P +WT
Sbjct  248   PMLWT  252



>gb|KJB63585.1| hypothetical protein B456_010G007300 [Gossypium raimondii]
Length=734

 Score =   425 bits (1093),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 187/245 (76%), Positives = 213/245 (87%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             K++       F+S  L  C+++YD+K+IVINGQRR+L SGSIHYPRSTP+MWE LI KAK
Sbjct  8     KFIFFFITAMFMSFNLIHCTITYDKKSIVINGQRRILISGSIHYPRSTPDMWESLIKKAK  67

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
              GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFG
Sbjct  68    NGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQKMGLYVHLRIGPYVCAEWNFG  127

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+VPGISFR DNEPFK AM+GFTEKIV +MK+  LF S GGPIILSQIENEYGP
Sbjct  128   GFPVWLKYVPGISFRTDNEPFKRAMQGFTEKIVQMMKNEKLFASHGGPIILSQIENEYGP  187

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             ++K LGA+GH YV WAAKMAV +DTGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKPYK
Sbjct  188   ESKALGAAGHGYVNWAAKMAVGLDTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPNKPYK  247

Query  1010  PAIWT  1024
             P +WT
Sbjct  248   PMLWT  252



>ref|XP_010275526.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =   428 bits (1101),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 193/243 (79%), Positives = 215/243 (88%), Gaps = 0/243 (0%)
 Frame = +2

Query  296   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  475
             + V  +V  +S     C+V+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI KAKEG
Sbjct  9     LFVFFLVLSVSFQWILCTVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKEG  68

Query  476   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  655
             G+DVI+TYVFWNVHEPSPGNYNFEGRYDLVRF+KT+QKAGLY HLRIGPYICGEWNFGGF
Sbjct  69    GLDVIQTYVFWNVHEPSPGNYNFEGRYDLVRFIKTVQKAGLYVHLRIGPYICGEWNFGGF  128

Query  656   PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQA  835
             PVWLK+VPGISFR DNEPFKMAM+GFT+KIV +MKS  LFESQGGPIILSQIENEYG ++
Sbjct  129   PVWLKYVPGISFRTDNEPFKMAMQGFTQKIVEMMKSEMLFESQGGPIILSQIENEYGTES  188

Query  836   KVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPA  1015
             K  GA+GH Y+TWAA MA+ + TGVPWVMCKE DAPDPVIN CNGFYCD F PNKPYKPA
Sbjct  189   KAFGAAGHAYMTWAANMAIGLGTGVPWVMCKEGDAPDPVINACNGFYCDAFHPNKPYKPA  248

Query  1016  IWT  1024
             +WT
Sbjct  249   MWT  251



>ref|XP_002305449.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE85960.1| beta-galactosidase family protein [Populus trichocarpa]
Length=731

 Score =   424 bits (1091),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 187/252 (74%), Positives = 216/252 (86%), Gaps = 0/252 (0%)
 Frame = +2

Query  269   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  448
             +   +  KW+  L +V   S  L QC+V+YD+KA++INGQR+VLFSGSIHYPRSTPEMWE
Sbjct  1     MAANSTTKWLFSLSVVLLTSLQLIQCNVTYDKKALIINGQRKVLFSGSIHYPRSTPEMWE  60

Query  449   DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  628
              LI KAK+GG+DVI+TYVFWN+HEPSPGNYNF+GRYDLVRF+K + +AGLY HLRIGPYI
Sbjct  61    GLIQKAKDGGLDVIDTYVFWNLHEPSPGNYNFDGRYDLVRFIKLVHEAGLYVHLRIGPYI  120

Query  629   CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  808
             C EWNFGGFPVWLK+VPGISFR DNEPFK AM+ FT+KIV +MK  NLFESQGGPIILSQ
Sbjct  121   CAEWNFGGFPVWLKYVPGISFRTDNEPFKSAMQKFTQKIVQMMKDENLFESQGGPIILSQ  180

Query  809   IENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKF  988
             IENEY P++K  G+ GH Y+TWAA MA+ MDTGVPWVMCKE DAPDPVINTCNGFYCD F
Sbjct  181   IENEYEPESKAFGSPGHAYMTWAAHMAISMDTGVPWVMCKEFDAPDPVINTCNGFYCDYF  240

Query  989   APNKPYKPAIWT  1024
             +PNKPYKP +WT
Sbjct  241   SPNKPYKPTMWT  252



>ref|XP_007160714.1| hypothetical protein PHAVU_001G010900g [Phaseolus vulgaris]
 gb|ESW32708.1| hypothetical protein PHAVU_001G010900g [Phaseolus vulgaris]
Length=739

 Score =   424 bits (1090),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 185/248 (75%), Positives = 218/248 (88%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             ++ K +L++  +FF+ S L  CSV+YDRKAI+INGQRR+L SGSIHYPRS PEMWEDLI 
Sbjct  5     SVSKLLLLVFTIFFVGSELIHCSVTYDRKAIIINGQRRILISGSIHYPRSAPEMWEDLIR  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+D I+TYVFWNVHEPSPGNYNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EW
Sbjct  65    KAKDGGLDAIDTYVFWNVHEPSPGNYNFEGRYDLVRFIKTVQRVGLYVHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFR DN PFK AM+GFT+KIV +MK+  LF+SQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRTDNGPFKAAMQGFTQKIVQMMKNEKLFQSQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YGP++K LG +G+ Y  WAAKMAV ++TGVPWVMCK++DAPDPVIN CNGFYCD F+PNK
Sbjct  185   YGPESKQLGGAGYAYTNWAAKMAVGLNTGVPWVMCKQDDAPDPVINACNGFYCDYFSPNK  244

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  245   PYKPNLWT  252



>gb|KDO84691.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=731

 Score =   424 bits (1089),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 219/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLI  457
             ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI
Sbjct  5     SVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLI  64

Query  458   SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  637
              KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY+C E
Sbjct  65    RKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAE  124

Query  638   WNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIEN  817
             WNFGGFPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILSQIEN
Sbjct  125   WNFGGFPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQIEN  184

Query  818   EYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPN  997
             EYGP++K LGA+GH YV WAAKMAV +DTGVPWVMCKE+DAPDPVIN+CNGFYCD F+PN
Sbjct  185   EYGPESKSLGAAGHAYVNWAAKMAVGLDTGVPWVMCKEDDAPDPVINSCNGFYCDAFSPN  244

Query  998   KPYKPAIWT  1024
             KPYKP +WT
Sbjct  245   KPYKPTLWT  253



>ref|XP_012071945.1| PREDICTED: beta-galactosidase 5 [Jatropha curcas]
 gb|KDP38567.1| hypothetical protein JCGZ_04492 [Jatropha curcas]
Length=853

 Score =   427 bits (1097),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 189/243 (78%), Positives = 214/243 (88%), Gaps = 0/243 (0%)
 Frame = +2

Query  296   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  475
             + +  MV  + S L Q SV+YD+KAI+INGQRR+L SGSIHYPRSTPEMWEDLI KAK+G
Sbjct  10    LTIYLMVLLMGSELIQGSVTYDKKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKDG  69

Query  476   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  655
             G+D I+TYVFW+VHEPSPGNYNFEGRYDLVRF+KTIQK GLYAHLRIGPY+C EWNFGG+
Sbjct  70    GLDAIDTYVFWDVHEPSPGNYNFEGRYDLVRFIKTIQKVGLYAHLRIGPYVCAEWNFGGY  129

Query  656   PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQA  835
             PVWLK+VPGISFR DNEPFK AM+GFTEKIV +MK+  LF SQGGPIILSQIENEYGP  
Sbjct  130   PVWLKYVPGISFRTDNEPFKAAMQGFTEKIVQMMKNEKLFASQGGPIILSQIENEYGPVG  189

Query  836   KVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPA  1015
             K L  +GH Y+ WAAKMAV ++TGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKPYKPA
Sbjct  190   KALREAGHSYINWAAKMAVGLNTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPNKPYKPA  249

Query  1016  IWT  1024
             +WT
Sbjct  250   MWT  252



>ref|XP_006473573.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
Length=850

 Score =   427 bits (1097),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 191/249 (77%), Positives = 219/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLI  457
             ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI
Sbjct  5     SVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLI  64

Query  458   SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  637
              KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY+C E
Sbjct  65    RKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAE  124

Query  638   WNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIEN  817
             WNFGGFPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILSQIEN
Sbjct  125   WNFGGFPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQIEN  184

Query  818   EYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPN  997
             EYGP++K LGA+GH YV WAAKMAV +DTGVPWVMCKE+DAPDPVINTCNGFYCD F+PN
Sbjct  185   EYGPESKALGAAGHAYVNWAAKMAVGLDTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPN  244

Query  998   KPYKPAIWT  1024
             KPYKP +WT
Sbjct  245   KPYKPTLWT  253



>gb|KDO84689.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=805

 Score =   425 bits (1092),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 219/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLI  457
             ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI
Sbjct  5     SVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLI  64

Query  458   SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  637
              KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY+C E
Sbjct  65    RKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAE  124

Query  638   WNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIEN  817
             WNFGGFPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILSQIEN
Sbjct  125   WNFGGFPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQIEN  184

Query  818   EYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPN  997
             EYGP++K LGA+GH YV WAAKMAV +DTGVPWVMCKE+DAPDPVIN+CNGFYCD F+PN
Sbjct  185   EYGPESKSLGAAGHAYVNWAAKMAVGLDTGVPWVMCKEDDAPDPVINSCNGFYCDAFSPN  244

Query  998   KPYKPAIWT  1024
             KPYKP +WT
Sbjct  245   KPYKPTLWT  253



>gb|KDO84690.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=809

 Score =   425 bits (1092),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 219/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLI  457
             ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI
Sbjct  5     SVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLI  64

Query  458   SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  637
              KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY+C E
Sbjct  65    RKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAE  124

Query  638   WNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIEN  817
             WNFGGFPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILSQIEN
Sbjct  125   WNFGGFPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQIEN  184

Query  818   EYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPN  997
             EYGP++K LGA+GH YV WAAKMAV +DTGVPWVMCKE+DAPDPVIN+CNGFYCD F+PN
Sbjct  185   EYGPESKSLGAAGHAYVNWAAKMAVGLDTGVPWVMCKEDDAPDPVINSCNGFYCDAFSPN  244

Query  998   KPYKPAIWT  1024
             KPYKP +WT
Sbjct  245   KPYKPTLWT  253



>emb|CDY59693.1| BnaC07g51120D [Brassica napus]
Length=856

 Score =   426 bits (1094),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 189/231 (82%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = +2

Query  332   GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWN  511
             G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE LI KAK+GGVDVIETYVFWN
Sbjct  27    GFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGVDVIETYVFWN  86

Query  512   VHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISF  691
             +HEPSPG Y+F+GR DLVRFVKT+ KAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGISF
Sbjct  87    LHEPSPGKYDFDGRNDLVRFVKTVHKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISF  146

Query  692   RADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVT  871
             R DNEPFK AM+GFTE+IV LMKS NL+ESQGGPIILSQIENEYG Q ++LGA GH Y+T
Sbjct  147   RTDNEPFKKAMQGFTERIVELMKSENLYESQGGPIILSQIENEYGRQGQLLGAEGHNYMT  206

Query  872   WAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             WAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGFYCD FAPNKPYKP IWT
Sbjct  207   WAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCDSFAPNKPYKPTIWT  257



>gb|KHN00504.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score =   425 bits (1093),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 193/231 (84%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = +2

Query  329   SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFW  508
             S + +  V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG+DV+ETYVFW
Sbjct  20    SHVARAFVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEDLILKAKEGGIDVVETYVFW  79

Query  509   NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGIS  688
             NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFPVWLK+VPGIS
Sbjct  80    NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGIS  139

Query  689   FRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYV  868
             FR DNEPFK AM+GFTEKIV +MKS  LFESQGGPIILSQIENEYG Q+K+ GA+G  YV
Sbjct  140   FRTDNEPFKRAMQGFTEKIVGMMKSERLFESQGGPIILSQIENEYGAQSKLQGAAGQNYV  199

Query  869   TWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIW  1021
              WAAKMAVEM TGVPWVMCKE+DAPDPVINTCNGFYC KF PN+PYKP IW
Sbjct  200   NWAAKMAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCHKFTPNRPYKPMIW  250



>emb|CDX69219.1| BnaC01g02340D [Brassica napus]
Length=824

 Score =   425 bits (1092),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 194/251 (77%), Positives = 216/251 (86%), Gaps = 1/251 (0%)
 Frame = +2

Query  275   GGAMRKWVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  451
             G    + +L LC+ F  L  G  QC V+YDRKA++INGQRR+LFSGSIHYPRSTP+MWE 
Sbjct  4     GDTAPRLILWLCLGFLILGVGFVQCGVTYDRKALLINGQRRILFSGSIHYPRSTPDMWEG  63

Query  452   LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  631
             LI KAK+GGVDVIETYVFWN+HEPSPG Y+ EGR DLVRFVKTI KAGLYAHLRIGPY+C
Sbjct  64    LIQKAKDGGVDVIETYVFWNLHEPSPGKYDLEGRNDLVRFVKTIHKAGLYAHLRIGPYVC  123

Query  632   GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  811
              EWNFGGFPVWLK+VP ISFR DNEPFK AM+GFTE+IV LMKS NL+ESQGGPIILSQI
Sbjct  124   AEWNFGGFPVWLKYVPRISFRTDNEPFKRAMQGFTERIVELMKSENLYESQGGPIILSQI  183

Query  812   ENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFA  991
             ENEYG Q ++LGA GH Y+TWAAKMA+  +TGVPWVMCKE+DAPDPVINTCNGFYC  FA
Sbjct  184   ENEYGRQGQLLGAEGHNYMTWAAKMAIATETGVPWVMCKEDDAPDPVINTCNGFYCHSFA  243

Query  992   PNKPYKPAIWT  1024
             PNKPYKP IWT
Sbjct  244   PNKPYKPLIWT  254



>gb|KHN12675.1| Beta-galactosidase 5 [Glycine soja]
Length=732

 Score =   422 bits (1084),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 185/232 (80%), Positives = 210/232 (91%), Gaps = 0/232 (0%)
 Frame = +2

Query  329   SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFW  508
             S L  CSV+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI KAK+GG+DVI+TYVFW
Sbjct  21    SELIHCSVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIGKAKDGGLDVIDTYVFW  80

Query  509   NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGIS  688
             NVHEPSPGNYNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EWNFGGFPVWLK+VPGIS
Sbjct  81    NVHEPSPGNYNFEGRYDLVRFIKTVQRVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIS  140

Query  689   FRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYV  868
             FR DN PFK AM+GFT+KIV +MK+  LF+SQGGPIILSQIENEYGP+++ LGA+GH Y 
Sbjct  141   FRTDNGPFKAAMQGFTQKIVEMMKNEKLFQSQGGPIILSQIENEYGPESRQLGAAGHAYT  200

Query  869   TWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              WAAKMAV + TGVPWVMCK++DAPDPVINTCNGFYCD F+PNKPYKP +WT
Sbjct  201   NWAAKMAVGLATGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKPYKPNLWT  252



>ref|XP_011037170.1| PREDICTED: beta-galactosidase 5-like [Populus euphratica]
Length=789

 Score =   423 bits (1088),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 216/255 (85%), Gaps = 0/255 (0%)
 Frame = +2

Query  260   REKLRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPE  439
              EK+   +  KW+  L +V      L QC+V+YD+KA++INGQR+VLFSGSIHYPRSTPE
Sbjct  56    EEKMVANSTTKWLFSLSVVLLTGLQLIQCNVTYDKKALIINGQRKVLFSGSIHYPRSTPE  115

Query  440   MWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIG  619
             MWE LI KAK+GG+DVI+TYVFWN+HEPSPGNYNF+GRYDLVRF+K + +AGLY HLRIG
Sbjct  116   MWEGLIQKAKDGGLDVIDTYVFWNLHEPSPGNYNFDGRYDLVRFIKLVHEAGLYVHLRIG  175

Query  620   PYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPII  799
             PYIC EWNFGGFPVWLK+VPGISFR DN PFK AM+ FT+KIV +MK  NLFESQGGPII
Sbjct  176   PYICAEWNFGGFPVWLKYVPGISFRTDNGPFKSAMQKFTQKIVQMMKDENLFESQGGPII  235

Query  800   LSQIENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYC  979
             LSQIENEY P++K  G+ GH Y+TWAA MAV MDTGVPWVMCKE DAPDPVINTCNGFYC
Sbjct  236   LSQIENEYEPESKAFGSPGHAYMTWAAHMAVSMDTGVPWVMCKEFDAPDPVINTCNGFYC  295

Query  980   DKFAPNKPYKPAIWT  1024
             D F+PNKPYKP +WT
Sbjct  296   DYFSPNKPYKPTMWT  310



>gb|KDO84688.1| hypothetical protein CISIN_1g003076mg [Citrus sinensis]
Length=850

 Score =   425 bits (1092),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 219/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLI  457
             ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI
Sbjct  5     SVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLI  64

Query  458   SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  637
              KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY+C E
Sbjct  65    RKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAE  124

Query  638   WNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIEN  817
             WNFGGFPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILSQIEN
Sbjct  125   WNFGGFPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQIEN  184

Query  818   EYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPN  997
             EYGP++K LGA+GH YV WAAKMAV +DTGVPWVMCKE+DAPDPVIN+CNGFYCD F+PN
Sbjct  185   EYGPESKSLGAAGHAYVNWAAKMAVGLDTGVPWVMCKEDDAPDPVINSCNGFYCDAFSPN  244

Query  998   KPYKPAIWT  1024
             KPYKP +WT
Sbjct  245   KPYKPTLWT  253



>ref|XP_006435076.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
 gb|ESR48316.1| hypothetical protein CICLE_v10000260mg [Citrus clementina]
Length=850

 Score =   425 bits (1092),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 219/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLI  457
             ++ K +  L M   L + L QCS V+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI
Sbjct  5     SVSKLLTWLWMALLLGTELIQCSTVTYDRKAILINGQRRILISGSIHYPRSTPEMWEDLI  64

Query  458   SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  637
              KAK+GG+DVI+TYVFWN HEPSPG+YNFEG YDLVRF+KT+Q+ GLYAHLRIGPY+C E
Sbjct  65    RKAKDGGLDVIDTYVFWNGHEPSPGHYNFEGSYDLVRFIKTVQRVGLYAHLRIGPYVCAE  124

Query  638   WNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIEN  817
             WNFGGFPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILSQIEN
Sbjct  125   WNFGGFPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQIEN  184

Query  818   EYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPN  997
             EYGP++K LGA+GH YV WAAKMAV +DTGVPWVMCKE+DAPDPVIN+CNGFYCD F+PN
Sbjct  185   EYGPESKSLGAAGHAYVNWAAKMAVGLDTGVPWVMCKEDDAPDPVINSCNGFYCDAFSPN  244

Query  998   KPYKPAIWT  1024
             KPYKP +WT
Sbjct  245   KPYKPTLWT  253



>ref|XP_009603021.1| PREDICTED: beta-galactosidase 5 [Nicotiana tomentosiformis]
Length=729

 Score =   421 bits (1082),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 186/252 (74%), Positives = 215/252 (85%), Gaps = 0/252 (0%)
 Frame = +2

Query  269   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  448
             +   ++ K+ +V      + + L  C V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE
Sbjct  1     METSSISKFFIVYAFSLLMVAQLICCKVTYDKKAIIINGQRRILLSGSIHYPRSTPEMWE  60

Query  449   DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  628
             DLI KAK+  +DVIETYVFWN+HEPSPGNY+FEGRYDLVRF+KT+QKAGLYAHLRIGPY+
Sbjct  61    DLIKKAKDANLDVIETYVFWNIHEPSPGNYDFEGRYDLVRFIKTVQKAGLYAHLRIGPYV  120

Query  629   CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  808
             C EWNFGGFPVWLK+VPGISFR DNEPFK AM+ FT+KIV +MKS  LFESQGGPIILSQ
Sbjct  121   CAEWNFGGFPVWLKYVPGISFRTDNEPFKAAMQKFTQKIVEMMKSEKLFESQGGPIILSQ  180

Query  809   IENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKF  988
             IENEY P  K LG +G  YV WAAKMAV +DTGVPWVMCKE+DAPDP+INTCNGFYCD+F
Sbjct  181   IENEYEPARKALGTAGEAYVQWAAKMAVGLDTGVPWVMCKEDDAPDPIINTCNGFYCDEF  240

Query  989   APNKPYKPAIWT  1024
             +PNKPYKP +WT
Sbjct  241   SPNKPYKPTMWT  252



>emb|CDO97013.1| unnamed protein product [Coffea canephora]
Length=730

 Score =   421 bits (1082),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 187/248 (75%), Positives = 215/248 (87%), Gaps = 1/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             A  KW L  CM+  L++ +  CSV+YDRKA++I+GQRR+LFSGSIHYPRSTP+MWE LI 
Sbjct  6     ASSKWFL-HCMLLILAAQVAHCSVTYDRKALIIDGQRRILFSGSIHYPRSTPDMWEGLIQ  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+D I+TYVFWN+HEPSPGN+NFEGRYDLVRF+K +QKAGLY HLRIGPY+C EW
Sbjct  65    KAKDGGLDAIDTYVFWNIHEPSPGNFNFEGRYDLVRFIKLVQKAGLYVHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFR DNEPFKMAM+ FTEKIV +MK   LF+SQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRTDNEPFKMAMQRFTEKIVRMMKYEKLFQSQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YG ++K  GA G  Y+ WAA MAVE +TGVPWVMCKE+DAPDPVINTCNGFYCD F+PNK
Sbjct  185   YGIESKAYGAGGRAYMNWAANMAVETNTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPNK  244

Query  1001  PYKPAIWT  1024
             PYKP IWT
Sbjct  245   PYKPTIWT  252



>ref|XP_009761050.1| PREDICTED: beta-galactosidase 5 [Nicotiana sylvestris]
Length=729

 Score =   421 bits (1081),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 185/252 (73%), Positives = 217/252 (86%), Gaps = 0/252 (0%)
 Frame = +2

Query  269   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  448
             +   ++ K+ +V  +   + + L  C V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE
Sbjct  1     METSSVSKFFIVYTISLLMVAQLIWCKVTYDKKAIIINGQRRILLSGSIHYPRSTPEMWE  60

Query  449   DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  628
             DLI+KAK+  +DVIETYVFWN+HEPSPGNY+FEGRYDLVRF+KT+QKAGLYAHLRIGPY+
Sbjct  61    DLINKAKDANLDVIETYVFWNIHEPSPGNYDFEGRYDLVRFIKTVQKAGLYAHLRIGPYV  120

Query  629   CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  808
             C EWNFGGFPVWLK+VPGISFR DNEPFK AM+ FT+KIV +MKS  LFESQGGPIILSQ
Sbjct  121   CAEWNFGGFPVWLKYVPGISFRTDNEPFKAAMQKFTQKIVEMMKSERLFESQGGPIILSQ  180

Query  809   IENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKF  988
             IENEY P  K LG +G  YV WAA+MAV +DTGVPWVMCKE+DAPDP+INTCNGFYCD+F
Sbjct  181   IENEYEPARKALGTAGEAYVQWAAQMAVGLDTGVPWVMCKEDDAPDPIINTCNGFYCDEF  240

Query  989   APNKPYKPAIWT  1024
             +PNKPYKP +WT
Sbjct  241   SPNKPYKPTMWT  252



>ref|XP_003589339.1| Beta-galactosidase [Medicago truncatula]
 gb|AES59590.1| beta-like galactosidase [Medicago truncatula]
Length=745

 Score =   421 bits (1081),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 185/232 (80%), Positives = 208/232 (90%), Gaps = 0/232 (0%)
 Frame = +2

Query  329   SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFW  508
             S +  C+V+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI KAK+GG+DVI+TYVFW
Sbjct  22    SEVIHCTVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDVIDTYVFW  81

Query  509   NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGIS  688
             NVHEPSPGNYNFEGRYDLV+F+KT+QK GLY HLRIGPY+C EWNFGGFPVWLK+VPGIS
Sbjct  82    NVHEPSPGNYNFEGRYDLVQFIKTVQKKGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIS  141

Query  689   FRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYV  868
             FR DN PFK AM+GFT+KIV +MK+  LF+SQGGPIILSQIENEYGPQ + LGASGH Y 
Sbjct  142   FRTDNGPFKAAMQGFTQKIVQMMKNEKLFQSQGGPIILSQIENEYGPQGRALGASGHAYS  201

Query  869   TWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              WAAKMAV + TGVPWVMCKE+DAPDPVIN CNGFYCD F+PNKPYKP +WT
Sbjct  202   NWAAKMAVGLGTGVPWVMCKEDDAPDPVINACNGFYCDDFSPNKPYKPKLWT  253



>ref|XP_007042084.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
 gb|EOX97915.1| Beta-galactosidase 3 isoform 2 [Theobroma cacao]
Length=627

 Score =   416 bits (1069),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 188/250 (75%), Positives = 214/250 (86%), Gaps = 1/250 (0%)
 Frame = +2

Query  278   GAMRKWVLVLCMVF-FLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDL  454
             GA       LC+   FLS  +TQCSVSYDRKA++I+GQRR+L SGSIHYPRSTP+MWE L
Sbjct  2     GATSASQFFLCIAMVFLSVKVTQCSVSYDRKALIIDGQRRILLSGSIHYPRSTPQMWEGL  61

Query  455   ISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICG  634
             I KAK+GG+D I+TYVFWN+HEPSPGNYNFEGRYDLVRF+K ++KAGLY +LRIGPYICG
Sbjct  62    IQKAKDGGLDAIDTYVFWNLHEPSPGNYNFEGRYDLVRFIKLVKKAGLYVNLRIGPYICG  121

Query  635   EWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIE  814
             EWNFGGFPVWLK+VPGISFR DNEPFK AM+ FT+KIV +MK   LFESQGGPIILSQIE
Sbjct  122   EWNFGGFPVWLKYVPGISFRTDNEPFKQAMQKFTQKIVQMMKDEYLFESQGGPIILSQIE  181

Query  815   NEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAP  994
             NEY P++K  G++G  YV WAA MAV +DTGVPWVMCKE DAPDPVINTCNGFYCD F+P
Sbjct  182   NEYEPESKSFGSAGQAYVKWAANMAVGLDTGVPWVMCKEYDAPDPVINTCNGFYCDYFSP  241

Query  995   NKPYKPAIWT  1024
             NKPYKP +WT
Sbjct  242   NKPYKPTLWT  251



>gb|KHN41933.1| Beta-galactosidase 3 [Glycine soja]
Length=862

 Score =   423 bits (1087),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 198/251 (79%), Positives = 216/251 (86%), Gaps = 11/251 (4%)
 Frame = +2

Query  305   LCMVFFLSSGLTQ--CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
              C+  +L   L Q  CSV+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG
Sbjct  15    FCLALWLGFQLEQVHCSVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGG  74

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DVIETY+FWNVHEPS GNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPY+C EWNFGGFP
Sbjct  75    LDVIETYIFWNVHEPSRGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYVCAEWNFGGFP  134

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILS---------QI  811
             VWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS  L+ESQGGPIILS         QI
Sbjct  135   VWLKYVPGISFRTDNEPFKKAMQGFTEKIVGMMKSERLYESQGGPIILSQGDMHIMLFQI  194

Query  812   ENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFA  991
             ENEYG Q+K+LG +G  YV WAAKMAVE  TGVPWVMCKE+DAPDPVINTCNGFYCD F 
Sbjct  195   ENEYGAQSKLLGPAGQNYVNWAAKMAVETGTGVPWVMCKEDDAPDPVINTCNGFYCDYFT  254

Query  992   PNKPYKPAIWT  1024
             PNKPYKP+IWT
Sbjct  255   PNKPYKPSIWT  265



>ref|XP_004238611.1| PREDICTED: beta-galactosidase 5 [Solanum lycopersicum]
Length=729

 Score =   419 bits (1077),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 186/247 (75%), Positives = 216/247 (87%), Gaps = 0/247 (0%)
 Frame = +2

Query  284   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  463
             + K++ V      +   L  C V+YD+KAI+INGQRR+L SGSIHYPRSTPEMW+DLI+K
Sbjct  6     VSKFLKVYIFSLLMVVQLVFCIVTYDKKAIIINGQRRILLSGSIHYPRSTPEMWQDLINK  65

Query  464   AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  643
             AK+  +DVIETYVFWNVHEPSPGNYNF+GRYDLVRF+KT+QKAGLYAHLRIGPY+C EWN
Sbjct  66    AKDANLDVIETYVFWNVHEPSPGNYNFDGRYDLVRFIKTVQKAGLYAHLRIGPYVCAEWN  125

Query  644   FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEY  823
             FGGFPVWLK+VPGISFR DNEPFK AM+ FT KIV +MKS NLFESQGGPIILSQIENEY
Sbjct  126   FGGFPVWLKYVPGISFRTDNEPFKAAMQKFTNKIVEMMKSENLFESQGGPIILSQIENEY  185

Query  824   GPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKP  1003
              P+ +VLGA+G  YV WAA+MAV ++TGVPWVMCKE+DAPDP+INTCNGFYCD+F+PNKP
Sbjct  186   QPEKEVLGAAGEAYVQWAAQMAVGLNTGVPWVMCKEDDAPDPIINTCNGFYCDEFSPNKP  245

Query  1004  YKPAIWT  1024
             YKP +WT
Sbjct  246   YKPTMWT  252



>ref|NP_001265904.1| beta-galactosidase 5-like precursor [Cicer arietinum]
 emb|CAA10128.1| beta-galactosidase [Cicer arietinum]
Length=745

 Score =   419 bits (1077),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 186/234 (79%), Positives = 207/234 (88%), Gaps = 0/234 (0%)
 Frame = +2

Query  323   LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYV  502
             + S L  CSV+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI KAK GG+DVI+TYV
Sbjct  19    VCSQLIHCSVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIQKAKVGGLDVIDTYV  78

Query  503   FWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPG  682
             FWNVHEPSP NYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPVWLK+VPG
Sbjct  79    FWNVHEPSPSNYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPG  138

Query  683   ISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQ  862
             ISFR DN PFK AM+GFT+KIV +MK+  LF+SQGGPIILSQIENEYGPQ + LGA GH 
Sbjct  139   ISFRTDNGPFKAAMQGFTQKIVQMMKNEKLFQSQGGPIILSQIENEYGPQGRALGAVGHA  198

Query  863   YVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             Y  WAAKMAV + TGVPWVMCKE+DAPDPVIN+CNGFYCD F+PNKPYKP +WT
Sbjct  199   YSNWAAKMAVGLGTGVPWVMCKEDDAPDPVINSCNGFYCDDFSPNKPYKPKLWT  252



>ref|XP_002306893.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE93889.1| beta-galactosidase family protein [Populus trichocarpa]
Length=853

 Score =   422 bits (1085),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 217/248 (88%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             ++ K++ +  MV  + S L  C+V+YD+KAI+I+GQRR+L SGSIHYPRSTP+MWEDL+ 
Sbjct  5     SVSKFLTLFLMVLIVGSKLIHCTVTYDKKAIIIDGQRRILISGSIHYPRSTPDMWEDLVQ  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DVI+TYVFWNVHEPSPGNYNFEGR+DLVRF+KT+QK GLY HLRIGPY+C EW
Sbjct  65    KAKDGGLDVIDTYVFWNVHEPSPGNYNFEGRFDLVRFIKTVQKGGLYVHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFR DN PFK AM+GFT+KIV +MK   LF+SQGGPII SQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRTDNGPFKAAMQGFTQKIVQMMKDERLFQSQGGPIIFSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YGP+++  GA+GH Y+ WAA+MAV + TGVPWVMCKE+DAPDPVINTCNGFYCD F+PNK
Sbjct  185   YGPESRAFGAAGHSYINWAAQMAVGLKTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPNK  244

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  245   PYKPTMWT  252



>ref|XP_003612092.1| Beta-galactosidase [Medicago truncatula]
 gb|AES95050.1| beta-galactosidase [Medicago truncatula]
Length=843

 Score =   422 bits (1084),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 191/242 (79%), Positives = 215/242 (89%), Gaps = 3/242 (1%)
 Frame = +2

Query  299   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
             L + +  FL+       V+YDRKAI+INGQRR+LFSGSIHYPRSTP+MWEDLI KAKEGG
Sbjct  12    LFVSLTLFLA---VYSDVTYDRKAIIINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGG  68

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DVIETYVFWNVHEPSPGNYNFEGR DLVRF++T+ KAGLYAHLRIGPY+C EWNFGGFP
Sbjct  69    LDVIETYVFWNVHEPSPGNYNFEGRNDLVRFIQTVHKAGLYAHLRIGPYVCAEWNFGGFP  128

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAK  838
             VWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS  L+ESQGGPIILSQIENEYG Q+K
Sbjct  129   VWLKYVPGISFRQDNEPFKKAMQGFTEKIVGMMKSERLYESQGGPIILSQIENEYGAQSK  188

Query  839   VLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAI  1018
             +LG  G+ Y++WAAKMAVEM TGVPW+MCKE+DAPDPVINTCNGFYCDKF PNKPYKP +
Sbjct  189   MLGPVGYNYMSWAAKMAVEMGTGVPWIMCKEDDAPDPVINTCNGFYCDKFTPNKPYKPTM  248

Query  1019  WT  1024
             WT
Sbjct  249   WT  250



>ref|XP_006342225.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=729

 Score =   417 bits (1073),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 185/247 (75%), Positives = 216/247 (87%), Gaps = 0/247 (0%)
 Frame = +2

Query  284   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  463
             + K++ V      +   L  C V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWEDLI+K
Sbjct  6     VSKFLKVYTFYLLMVVQLVFCIVTYDKKAIIINGQRRILLSGSIHYPRSTPEMWEDLINK  65

Query  464   AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  643
             AK+  +DVIETYVFWNVHEPSPGNYNF+GRYDLVRF+KT+QKAGLYAHLRIGPY+C EWN
Sbjct  66    AKDANLDVIETYVFWNVHEPSPGNYNFDGRYDLVRFIKTVQKAGLYAHLRIGPYVCAEWN  125

Query  644   FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEY  823
             FGGFPVWLK+VPGISFR DNEPFK++M+ FT KIV +MKS NLFESQGGPIILSQIENEY
Sbjct  126   FGGFPVWLKYVPGISFRTDNEPFKVSMQKFTNKIVEMMKSENLFESQGGPIILSQIENEY  185

Query  824   GPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKP  1003
              P+ + LGA+G  YV WAA+MAV ++TGVPWVMCKE+DAPDP+INTCNGFYCD+F+PNKP
Sbjct  186   QPEREALGAAGEAYVQWAAQMAVGLNTGVPWVMCKEDDAPDPIINTCNGFYCDEFSPNKP  245

Query  1004  YKPAIWT  1024
             YKP +WT
Sbjct  246   YKPTMWT  252



>gb|KHN20946.1| Beta-galactosidase 5 [Glycine soja]
Length=732

 Score =   417 bits (1073),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = +2

Query  329   SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFW  508
             S L  CSV+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI KAK+GG+DVI+TYVFW
Sbjct  21    SELIHCSVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIRKAKDGGLDVIDTYVFW  80

Query  509   NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGIS  688
             NVHEPSPGNYNFEGR DLVRF+KT+Q+ GLY HLRIGPY+C EWNFGGFPVWLK+VPGIS
Sbjct  81    NVHEPSPGNYNFEGRNDLVRFIKTVQRVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIS  140

Query  689   FRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYV  868
             FR DN PFK AM+GFT+KIV +MK+  LF+SQGGPIILSQIENEYGP++  LGA+GH Y 
Sbjct  141   FRTDNGPFKAAMQGFTQKIVQMMKNEKLFQSQGGPIILSQIENEYGPESGQLGAAGHAYT  200

Query  869   TWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              WAAKMAV + TGVPWVMCK++DAPDPVINTCNGFYCD F+PNKPYKP++WT
Sbjct  201   NWAAKMAVGLATGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKPYKPSLWT  252



>ref|XP_009129554.1| PREDICTED: beta-galactosidase 5 [Brassica rapa]
Length=730

 Score =   417 bits (1071),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 182/247 (74%), Positives = 211/247 (85%), Gaps = 0/247 (0%)
 Frame = +2

Query  284   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  463
             + K +  L +   + S + QCS++YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI K
Sbjct  7     LTKILCFLLITMVIGSAMIQCSITYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIKK  66

Query  464   AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  643
             AK+GG+DVI+TYVFWN HEPSPG YNF+GRYDLVRF+KT+Q+ GLY HLRIGPY+C EWN
Sbjct  67    AKDGGLDVIDTYVFWNGHEPSPGTYNFKGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWN  126

Query  644   FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEY  823
             FGGFPVWLK+VPGISFR+DN PFK AM+GFT+KIV +MK H  F SQGGPIILSQIENE+
Sbjct  127   FGGFPVWLKYVPGISFRSDNGPFKAAMQGFTQKIVQMMKEHRFFASQGGPIILSQIENEF  186

Query  824   GPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKP  1003
             GP+ K LG +GH YV WAAKMAV +DTGVPWVMCKE+DAPDP+IN CNGFYCD F PNKP
Sbjct  187   GPELKALGPAGHSYVNWAAKMAVGLDTGVPWVMCKEDDAPDPIINACNGFYCDYFTPNKP  246

Query  1004  YKPAIWT  1024
             YKP +WT
Sbjct  247   YKPKMWT  253



>ref|XP_007225291.1| hypothetical protein PRUPE_ppa001334mg [Prunus persica]
 gb|EMJ26490.1| hypothetical protein PRUPE_ppa001334mg [Prunus persica]
Length=851

 Score =   420 bits (1080),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 187/234 (80%), Positives = 212/234 (91%), Gaps = 1/234 (0%)
 Frame = +2

Query  326   SSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYV  502
             SS L QC+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+GG+DVI+TYV
Sbjct  20    SSELIQCTTVTYDKKAIIINGQRRLLISGSIHYPRSTPEMWEGLIQKAKDGGLDVIDTYV  79

Query  503   FWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPG  682
             FWN HEPSPGNYNFEGRYDLVRF+KT+QKAGLY HLRIGPY+C EWNFGGFPVWLK+VPG
Sbjct  80    FWNGHEPSPGNYNFEGRYDLVRFIKTVQKAGLYLHLRIGPYVCAEWNFGGFPVWLKYVPG  139

Query  683   ISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQ  862
             ISFR DN PFKMAM+GFT+KIV +MK+  LF SQGGPIILSQIENEYGP++K LGA+GH 
Sbjct  140   ISFRTDNGPFKMAMQGFTQKIVQMMKNEMLFASQGGPIILSQIENEYGPESKALGAAGHA  199

Query  863   YVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             Y+ WAAKMAV +DTGVPWVMCKE+DAPDP+IN CNGFYCD F+PNKPYKP +WT
Sbjct  200   YINWAAKMAVALDTGVPWVMCKEDDAPDPMINACNGFYCDGFSPNKPYKPTMWT  253



>ref|XP_010552493.1| PREDICTED: beta-galactosidase 5 [Tarenaya hassleriana]
Length=731

 Score =   417 bits (1071),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 183/247 (74%), Positives = 212/247 (86%), Gaps = 0/247 (0%)
 Frame = +2

Query  284   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  463
             + K +  L     +SS + QC V+YD+K+IVING+RR+L SGSIHYPRSTPEMWEDLI+K
Sbjct  6     VSKILTFLLTTILVSSAVIQCGVTYDKKSIVINGRRRILLSGSIHYPRSTPEMWEDLITK  65

Query  464   AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  643
             AK+GG+DVI+TYVFWN HEPSPGNYNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EWN
Sbjct  66    AKDGGLDVIDTYVFWNGHEPSPGNYNFEGRYDLVRFIKTVQRVGLYVHLRIGPYVCAEWN  125

Query  644   FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEY  823
             FGGFPVWLK+VPGISFR DN PFK AM+GFT+KIV +MK+  LF SQGGPIILSQIENEY
Sbjct  126   FGGFPVWLKYVPGISFRTDNGPFKAAMQGFTQKIVQMMKNEGLFASQGGPIILSQIENEY  185

Query  824   GPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKP  1003
             GP+ K LG++G  YV WAAKMAV + TGVPWVMCKE+DAPDP+IN CNGFYCD F PNKP
Sbjct  186   GPERKALGSAGQSYVNWAAKMAVGLQTGVPWVMCKEDDAPDPIINACNGFYCDYFTPNKP  245

Query  1004  YKPAIWT  1024
             YKP +WT
Sbjct  246   YKPLLWT  252



>dbj|BAD91085.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=848

 Score =   420 bits (1079),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 190/246 (77%), Positives = 216/246 (88%), Gaps = 2/246 (1%)
 Frame = +2

Query  293   WVLVLCMVFFLSS--GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  466
             WVL+ C + + S    +T+C+V YDRKA+VI+GQRR+LFSGSIHYPRSTPEMWE LI KA
Sbjct  10    WVLLCCCIVWSSVYVEVTKCNVVYDRKALVIDGQRRLLFSGSIHYPRSTPEMWEGLIQKA  69

Query  467   KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  646
             K+GG+D I+TYVFWN+HEPSPGNYNFEGR DLVRF+KT+ KAGLY HLRIGPYIC EWNF
Sbjct  70    KDGGLDAIDTYVFWNLHEPSPGNYNFEGRNDLVRFIKTVHKAGLYVHLRIGPYICSEWNF  129

Query  647   GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYG  826
             GGFPVWLKFVPGISFR DNEPFK AM+ FT+K+V LMK+  LFESQGGPIILSQIENEY 
Sbjct  130   GGFPVWLKFVPGISFRTDNEPFKSAMQKFTQKVVQLMKNEKLFESQGGPIILSQIENEYE  189

Query  827   PQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPY  1006
             P++K  GASG+ Y+TWAAKMAV M TGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKPY
Sbjct  190   PESKAFGASGYAYMTWAAKMAVGMGTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPNKPY  249

Query  1007  KPAIWT  1024
             KP +WT
Sbjct  250   KPTMWT  255



>ref|XP_011048837.1| PREDICTED: beta-galactosidase 5 [Populus euphratica]
Length=853

 Score =   420 bits (1079),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 216/248 (87%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             ++ K++ +  MV  + S L  C+V+YD+KAI+I+G RR+L SGSIHYPRSTP+MWEDL+ 
Sbjct  5     SVSKFLTLFLMVLIVGSKLIHCTVTYDKKAIIIDGHRRILISGSIHYPRSTPDMWEDLVR  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK GG+DVI+TYVFWNVHEPSPGNYNFEGR+DLVRF+KT+QK GLY HLRIGPY+C EW
Sbjct  65    KAKHGGLDVIDTYVFWNVHEPSPGNYNFEGRFDLVRFIKTVQKEGLYVHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFR DN PFK AM+GFT+KIV +MK   LF+SQGGPII SQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRTDNGPFKAAMQGFTQKIVQMMKDERLFQSQGGPIIFSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YGP+++  GA+GH Y+ WAA+MAV ++TGVPWVMCKE+DAPDPVINTCNGFYCD F+PNK
Sbjct  185   YGPESRAFGAAGHSYINWAAQMAVGLNTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPNK  244

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  245   PYKPTMWT  252



>gb|AAF67342.1| beta galactosidase [Vigna radiata]
Length=739

 Score =   416 bits (1070),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 183/248 (74%), Positives = 215/248 (87%), Gaps = 0/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             ++ K ++++  + FL S L  CSV+YDRKAI+INGQRR+L SGSIHYPRSTPEMWEDLI 
Sbjct  5     SVSKLLVLVFTILFLGSELIHCSVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEDLIR  64

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK GG+D I+TYVFWNVHEPSPG YNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EW
Sbjct  65    KAKGGGLDAIDTYVFWNVHEPSPGIYNFEGRYDLVRFIKTVQRVGLYVHLRIGPYVCAEW  124

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGISFR DN PFK AM+GFT+KIV +MK+  LF+SQGGPIILSQIENE
Sbjct  125   NFGGFPVWLKYVPGISFRTDNGPFKAAMQGFTQKIVQMMKNEKLFQSQGGPIILSQIENE  184

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YG ++K LG +G+ Y  WAAKMAV ++TGVPWVMCK++DAPDPVIN CNGFYCD F+PNK
Sbjct  185   YGSESKQLGGAGYAYTNWAAKMAVGLNTGVPWVMCKQDDAPDPVINACNGFYCDYFSPNK  244

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  245   PYKPTLWT  252



>ref|XP_004291830.1| PREDICTED: beta-galactosidase 5 [Fragaria vesca subsp. vesca]
Length=730

 Score =   416 bits (1070),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 212/244 (87%), Gaps = 1/244 (0%)
 Frame = +2

Query  296   VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  472
              L L    F+ S L QC+ VSYD+KAI+ING+R++L SGSIHYPRSTPEMWE LI KAK+
Sbjct  11    ALYLVAFLFVGSELIQCTTVSYDKKAILINGRRKLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  473   GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  652
             GG+DVI+TYVFWN HEPSPGNY FEGRYDLVRFV+T+QKAGLY HLRIGPY+C EWNFGG
Sbjct  71    GGLDVIDTYVFWNGHEPSPGNYYFEGRYDLVRFVRTVQKAGLYLHLRIGPYVCAEWNFGG  130

Query  653   FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQ  832
             FPVWLK+VPGISFR DN PFKMAM+GFT+KIV +MK+  LF SQGGPIILSQIENEYGP+
Sbjct  131   FPVWLKYVPGISFRTDNGPFKMAMQGFTQKIVQMMKNERLFASQGGPIILSQIENEYGPE  190

Query  833   AKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKP  1012
              K LGA+GH Y+ WAAKMAV M+TGVPWVMCKE+DAPDP+IN CNGFYCD F PNKPYKP
Sbjct  191   VKALGAAGHNYINWAAKMAVGMNTGVPWVMCKEDDAPDPMINACNGFYCDGFTPNKPYKP  250

Query  1013  AIWT  1024
              +WT
Sbjct  251   TLWT  254



>gb|KCW64027.1| hypothetical protein EUGRSUZ_G01704 [Eucalyptus grandis]
Length=558

 Score =   410 bits (1055),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 185/246 (75%), Positives = 213/246 (87%), Gaps = 2/246 (1%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  466
             KW L  C++   +  LT CS V+YD KA++INGQRR+LFSGSIHYPRSTP+MWE L+ KA
Sbjct  9     KWFLP-CVLLCATLSLTHCSSVTYDGKALIINGQRRILFSGSIHYPRSTPQMWEGLVHKA  67

Query  467   KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  646
             KEGG+DV++TYVFWNVHEPSPGNYNFEG+YDLV+FVKT+QKAGLY HLRIGPY+C EWNF
Sbjct  68    KEGGLDVVDTYVFWNVHEPSPGNYNFEGQYDLVQFVKTVQKAGLYVHLRIGPYVCAEWNF  127

Query  647   GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYG  826
             GG PVWLKFV G+SFR DNEPFK+AM+ FT+KIV +MKS +LF SQGGPIILSQIENEY 
Sbjct  128   GGLPVWLKFVRGVSFRTDNEPFKLAMQKFTQKIVQMMKSEHLFHSQGGPIILSQIENEYE  187

Query  827   PQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPY  1006
             P+ K  GA+G  Y+ WAAKMAV M TGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKPY
Sbjct  188   PERKAFGAAGKAYMNWAAKMAVGMGTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPNKPY  247

Query  1007  KPAIWT  1024
             KP +WT
Sbjct  248   KPTLWT  253



>ref|XP_008221339.1| PREDICTED: beta-galactosidase 5 [Prunus mume]
Length=851

 Score =   419 bits (1078),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 186/235 (79%), Positives = 213/235 (91%), Gaps = 1/235 (0%)
 Frame = +2

Query  323   LSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETY  499
             +SS L QC+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+GG+DVI+TY
Sbjct  19    ISSELIQCTTVTYDKKAIIINGQRRLLISGSIHYPRSTPEMWEGLIQKAKDGGLDVIDTY  78

Query  500   VFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVP  679
             VFWN HEPSPGNYNFEGRYDLVRF+KT+QKAGLY HLRIGPY+C EWNFGGFPVWLK+VP
Sbjct  79    VFWNGHEPSPGNYNFEGRYDLVRFIKTVQKAGLYLHLRIGPYVCAEWNFGGFPVWLKYVP  138

Query  680   GISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGH  859
             GISFR +N PFKMAM+GFT+KIV +MK+  LF SQGGPIILSQIENEYGP++K LGA+GH
Sbjct  139   GISFRTNNGPFKMAMQGFTQKIVQMMKNEKLFASQGGPIILSQIENEYGPESKALGAAGH  198

Query  860   QYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              Y+ WAAKMAV +DTGVPWVMCKE+DAPDP+IN CNGFYCD F+PNKPYKP +WT
Sbjct  199   AYINWAAKMAVALDTGVPWVMCKEDDAPDPMINACNGFYCDGFSPNKPYKPTMWT  253



>gb|KJB32548.1| hypothetical protein B456_005G246600 [Gossypium raimondii]
 gb|KJB32550.1| hypothetical protein B456_005G246600 [Gossypium raimondii]
Length=579

 Score =   411 bits (1057),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 184/237 (78%), Positives = 208/237 (88%), Gaps = 0/237 (0%)
 Frame = +2

Query  314   VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIE  493
             + FL   L  C+V+YDRKAI I+GQ+R+LFSGSIHYPRSTPEMWE LI KAK GG+DVI+
Sbjct  16    ILFLYLLLVHCNVTYDRKAIAIDGQKRILFSGSIHYPRSTPEMWEGLIQKAKNGGLDVID  75

Query  494   TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKF  673
             TYVFWN+HEPSPGNYNFEGRYDLV+F+K ++KAGLY HLRIGPYICGEWNFGGFPVWLK+
Sbjct  76    TYVFWNLHEPSPGNYNFEGRYDLVQFIKLVKKAGLYVHLRIGPYICGEWNFGGFPVWLKY  135

Query  674   VPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGAS  853
             VPGISFR DNEPFK AM  FT+KIV +MK  NLFESQGGPIILSQIENEY P++K+ G +
Sbjct  136   VPGISFRTDNEPFKKAMAKFTQKIVQMMKDENLFESQGGPIILSQIENEYEPESKLYGPA  195

Query  854   GHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             G  YV WAAKMAV ++TGVPWVMCKE DAPDPVINTCNGFYCD F+PNKPYKP +WT
Sbjct  196   GKAYVKWAAKMAVGLNTGVPWVMCKEYDAPDPVINTCNGFYCDYFSPNKPYKPTLWT  252



>ref|XP_007042083.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
 gb|EOX97914.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
Length=730

 Score =   416 bits (1068),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 188/250 (75%), Positives = 214/250 (86%), Gaps = 1/250 (0%)
 Frame = +2

Query  278   GAMRKWVLVLCMVF-FLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDL  454
             GA       LC+   FLS  +TQCSVSYDRKA++I+GQRR+L SGSIHYPRSTP+MWE L
Sbjct  2     GATSASQFFLCIAMVFLSVKVTQCSVSYDRKALIIDGQRRILLSGSIHYPRSTPQMWEGL  61

Query  455   ISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICG  634
             I KAK+GG+D I+TYVFWN+HEPSPGNYNFEGRYDLVRF+K ++KAGLY +LRIGPYICG
Sbjct  62    IQKAKDGGLDAIDTYVFWNLHEPSPGNYNFEGRYDLVRFIKLVKKAGLYVNLRIGPYICG  121

Query  635   EWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIE  814
             EWNFGGFPVWLK+VPGISFR DNEPFK AM+ FT+KIV +MK   LFESQGGPIILSQIE
Sbjct  122   EWNFGGFPVWLKYVPGISFRTDNEPFKQAMQKFTQKIVQMMKDEYLFESQGGPIILSQIE  181

Query  815   NEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAP  994
             NEY P++K  G++G  YV WAA MAV +DTGVPWVMCKE DAPDPVINTCNGFYCD F+P
Sbjct  182   NEYEPESKSFGSAGQAYVKWAANMAVGLDTGVPWVMCKEYDAPDPVINTCNGFYCDYFSP  241

Query  995   NKPYKPAIWT  1024
             NKPYKP +WT
Sbjct  242   NKPYKPTLWT  251



>ref|XP_008377189.1| PREDICTED: beta-galactosidase 5-like [Malus domestica]
Length=852

 Score =   419 bits (1077),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 213/244 (87%), Gaps = 1/244 (0%)
 Frame = +2

Query  296   VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  472
             VL L M  F++S L  C+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+
Sbjct  11    VLFLTMTLFIASELIHCTTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  473   GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  652
             GG+DVI+TYVFWN HEPSPGNY FEGRYDLVRF+KT+QKAGL+ HLRIGPY+C EWNFGG
Sbjct  71    GGLDVIDTYVFWNGHEPSPGNYYFEGRYDLVRFIKTVQKAGLFLHLRIGPYVCAEWNFGG  130

Query  653   FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQ  832
             FPVWLK+VPGISFR DNEPFKMAM+GFT+KIV +MK+  LF SQGGPIILSQIENEYGP+
Sbjct  131   FPVWLKYVPGISFRTDNEPFKMAMQGFTQKIVQMMKNEKLFASQGGPIILSQIENEYGPE  190

Query  833   AKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKP  1012
              K LG +G  Y+ WAAKMAV +DTGVPWVMCKE+DAPDP+IN CNGFYCD F PNKPYKP
Sbjct  191   RKALGXAGQNYINWAAKMAVGLDTGVPWVMCKEDDAPDPMINACNGFYCDGFTPNKPYKP  250

Query  1013  AIWT  1024
              +WT
Sbjct  251   TMWT  254



>ref|XP_006393673.1| hypothetical protein EUTSA_v10011265mg [Eutrema salsugineum]
 gb|ESQ30959.1| hypothetical protein EUTSA_v10011265mg [Eutrema salsugineum]
Length=726

 Score =   415 bits (1067),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 182/247 (74%), Positives = 209/247 (85%), Gaps = 0/247 (0%)
 Frame = +2

Query  284   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  463
             + K +  L     + S + QCSV+YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI K
Sbjct  3     LSKILSFLLTTMLIGSAMIQCSVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIKK  62

Query  464   AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  643
             AK+GG+DVI+TYVFWN HEPSPG YNF+GRYDLVRF+KT+Q+ GLY HLRIGPY+C EWN
Sbjct  63    AKDGGLDVIDTYVFWNGHEPSPGTYNFKGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWN  122

Query  644   FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEY  823
             FGGFPVWLK+VPGISFR DN PFK AM+GFT+KIV +MK H  F SQGGPIILSQIENE+
Sbjct  123   FGGFPVWLKYVPGISFRTDNGPFKAAMQGFTQKIVQMMKDHRFFASQGGPIILSQIENEF  182

Query  824   GPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKP  1003
             GP+ K LG +GH YV WAAKMAV ++TGVPWVMCKE+DAPDP+IN CNGFYCD F PNKP
Sbjct  183   GPELKALGPAGHSYVNWAAKMAVGLNTGVPWVMCKEDDAPDPIINACNGFYCDYFTPNKP  242

Query  1004  YKPAIWT  1024
             YKP +WT
Sbjct  243   YKPTMWT  249



>emb|CDY47949.1| BnaA10g28210D [Brassica napus]
Length=730

 Score =   415 bits (1067),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 181/247 (73%), Positives = 211/247 (85%), Gaps = 0/247 (0%)
 Frame = +2

Query  284   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  463
             + K +  L +   + S + QCS++YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI K
Sbjct  7     LTKILCFLLITMVIGSAMIQCSITYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIKK  66

Query  464   AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  643
             AK+GG+DVI+TYVFWN HEPSPG Y+F+GRYDLVRF+KT+Q+ GLY HLRIGPY+C EWN
Sbjct  67    AKDGGLDVIDTYVFWNGHEPSPGTYDFKGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWN  126

Query  644   FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEY  823
             FGGFPVWLK+VPGISFR+DN PFK AM+GFT+KIV +MK H  F SQGGPIILSQIENE+
Sbjct  127   FGGFPVWLKYVPGISFRSDNGPFKAAMQGFTQKIVQMMKEHRFFASQGGPIILSQIENEF  186

Query  824   GPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKP  1003
             GP+ K LG +GH YV WAAKMAV +DTGVPWVMCKE+DAPDP+IN CNGFYCD F PNKP
Sbjct  187   GPELKALGPAGHSYVNWAAKMAVGLDTGVPWVMCKEDDAPDPIINACNGFYCDYFTPNKP  246

Query  1004  YKPAIWT  1024
             YKP +WT
Sbjct  247   YKPKMWT  253



>emb|CDY53959.1| BnaCnng25850D [Brassica napus]
Length=730

 Score =   415 bits (1066),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 180/247 (73%), Positives = 211/247 (85%), Gaps = 0/247 (0%)
 Frame = +2

Query  284   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  463
             + K +  L +   + S + QCS++YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI K
Sbjct  7     LTKILCFLLITMVIGSAMIQCSITYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIKK  66

Query  464   AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  643
             AK+GG+DVI+TYVFWN HEPSPG Y+F+GRYDLVRF+KT+Q+ GLY HLRIGPY+C EWN
Sbjct  67    AKDGGLDVIDTYVFWNGHEPSPGTYDFKGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWN  126

Query  644   FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEY  823
             FGGFPVWLK+VPGISFR+DN PFK AM+GFT+KIV +MK H  F SQGGPIILSQIENE+
Sbjct  127   FGGFPVWLKYVPGISFRSDNGPFKAAMQGFTQKIVQMMKEHRFFASQGGPIILSQIENEF  186

Query  824   GPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKP  1003
             GP+ K LG +GH Y+ WAAKMAV +DTGVPWVMCKE+DAPDP+IN CNGFYCD F PNKP
Sbjct  187   GPELKALGPAGHSYINWAAKMAVGLDTGVPWVMCKEDDAPDPIINACNGFYCDYFTPNKP  246

Query  1004  YKPAIWT  1024
             YKP +WT
Sbjct  247   YKPKMWT  253



>ref|XP_010061261.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 5 [Eucalyptus 
grandis]
Length=730

 Score =   415 bits (1066),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 182/229 (79%), Positives = 207/229 (90%), Gaps = 0/229 (0%)
 Frame = +2

Query  338   TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  517
             T+CSVSYDRK++ INGQRR+L SGSIHYPRSTP+MWEDLI KAK+GG+DVIETYVFWN H
Sbjct  25    TRCSVSYDRKSLNINGQRRILISGSIHYPRSTPDMWEDLIQKAKDGGLDVIETYVFWNGH  84

Query  518   EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  697
             EPSPG YNF+ RYDLVRF+KT+QK GLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR 
Sbjct  85    EPSPGKYNFDERYDLVRFIKTVQKVGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRT  144

Query  698   DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWA  877
             DNEPFK AM+GFT+KIV +MK   LF SQGGPIILSQIENEYGP++K L A+GH Y+ WA
Sbjct  145   DNEPFKAAMQGFTQKIVQMMKDEQLFASQGGPIILSQIENEYGPESKALRAAGHAYINWA  204

Query  878   AKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             A+MAV +DTGVPWVMCKE+DAPDPVINTCNGFYCD F+PN+PYKP +WT
Sbjct  205   AEMAVGLDTGVPWVMCKEDDAPDPVINTCNGFYCDAFSPNRPYKPTMWT  253



>ref|XP_011083609.1| PREDICTED: beta-galactosidase 3-like [Sesamum indicum]
Length=845

 Score =   418 bits (1074),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 184/243 (76%), Positives = 209/243 (86%), Gaps = 0/243 (0%)
 Frame = +2

Query  296   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  475
             +L  C+   + S L   SV+YD KA++INGQRR+L SGSIHYPRSTP+MWEDLI KAK  
Sbjct  10    ILFFCIFLVMGSQLISGSVTYDNKAVIINGQRRILLSGSIHYPRSTPDMWEDLILKAKNA  69

Query  476   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  655
             G+DVI+TYVFWNVHEPSPGNYNFEGRYDLVRFVKT+QK GLY HLRIGPY+C EWNFGGF
Sbjct  70    GLDVIDTYVFWNVHEPSPGNYNFEGRYDLVRFVKTVQKLGLYVHLRIGPYVCAEWNFGGF  129

Query  656   PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQA  835
             PVWLK+VPGISFR DNEPFK AM+ FT+KIV +MKS NLFESQGGPIILSQIENEYG Q 
Sbjct  130   PVWLKYVPGISFRTDNEPFKAAMQQFTQKIVGVMKSENLFESQGGPIILSQIENEYGAQR  189

Query  836   KVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPA  1015
             + LG +G  Y+ WAAKMAV +DTGVPWVMCK+++APDPVIN CNGFYCD F+PNKPYKP 
Sbjct  190   RALGPAGEAYMNWAAKMAVALDTGVPWVMCKDDEAPDPVINACNGFYCDSFSPNKPYKPT  249

Query  1016  IWT  1024
             +WT
Sbjct  250   MWT  252



>ref|XP_004147848.1| PREDICTED: beta-galactosidase 5-like [Cucumis sativus]
 ref|XP_011652436.1| PREDICTED: beta-galactosidase 5-like [Cucumis sativus]
 ref|XP_011652437.1| PREDICTED: beta-galactosidase 5-like [Cucumis sativus]
Length=844

 Score =   417 bits (1073),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 183/230 (80%), Positives = 211/230 (92%), Gaps = 1/230 (0%)
 Frame = +2

Query  338   TQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  514
             TQC+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMW+DL+ KAK+GG+DV++TYVFWNV
Sbjct  24    TQCTTVTYDKKAILINGQRRILISGSIHYPRSTPEMWDDLMQKAKDGGLDVVDTYVFWNV  83

Query  515   HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  694
             HEPSPGNY+FEGRYDLVRF+KT Q+ GLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  84    HEPSPGNYDFEGRYDLVRFIKTAQRVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  143

Query  695   ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTW  874
              DN PFKMAM+GFT+KIV +MKS  LF SQGGPIILSQIENEYGPQ+K LGA+GH Y+ W
Sbjct  144   TDNGPFKMAMQGFTQKIVQMMKSEKLFASQGGPIILSQIENEYGPQSKALGAAGHAYMNW  203

Query  875   AAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AAKMAV ++TGVPWVMCKE+DAPDPVIN+CNGFYCD F+PNKPYKP +WT
Sbjct  204   AAKMAVGLNTGVPWVMCKEDDAPDPVINSCNGFYCDYFSPNKPYKPTLWT  253



>ref|XP_012067207.1| PREDICTED: beta-galactosidase 3-like [Jatropha curcas]
Length=735

 Score =   414 bits (1064),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 183/256 (71%), Positives = 216/256 (84%), Gaps = 3/256 (1%)
 Frame = +2

Query  266   KLRGGAMRKWVLVLCMVFFLSS---GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTP  436
             K+   +  KW   LCM+  LS     L QC+V+YD+KA++INGQR++LFSGSIHYPRSTP
Sbjct  2     KMEANSTTKWFSSLCMMVLLSLCSLHLIQCNVTYDKKALIINGQRKILFSGSIHYPRSTP  61

Query  437   EMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRI  616
             +MWE LI KAK+G +DVI+TYVFWN+HEPSPGNYNFEGRYDLV+F+K +QKAGLY HLRI
Sbjct  62    QMWEGLIQKAKDGALDVIDTYVFWNLHEPSPGNYNFEGRYDLVQFIKLVQKAGLYVHLRI  121

Query  617   GPYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPI  796
             GPY+C EWNFGGFPVWLKFVPGISFR DNEPFK+AM+ FT+KIV +MK   LFESQGGPI
Sbjct  122   GPYVCAEWNFGGFPVWLKFVPGISFRTDNEPFKLAMQKFTQKIVQMMKDEKLFESQGGPI  181

Query  797   ILSQIENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFY  976
             ILSQIENEY P+ K  G +G+ Y+TWAA MA+ ++TGVPWVMCK+ DAP+PVINTCNGFY
Sbjct  182   ILSQIENEYEPEEKAFGDAGYAYMTWAAHMALSLNTGVPWVMCKQSDAPEPVINTCNGFY  241

Query  977   CDKFAPNKPYKPAIWT  1024
             CD F PNKPYKP +WT
Sbjct  242   CDYFTPNKPYKPTMWT  257



>ref|XP_007199661.1| hypothetical protein PRUPE_ppa001363mg [Prunus persica]
 gb|EMJ00860.1| hypothetical protein PRUPE_ppa001363mg [Prunus persica]
Length=844

 Score =   417 bits (1072),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 190/245 (78%), Positives = 216/245 (88%), Gaps = 2/245 (1%)
 Frame = +2

Query  293   WVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             WVL LC+V++ LS  L QC+V YDRKA++I+GQRR+LFSGSIHYPRSTPEMWE LI KAK
Sbjct  10    WVL-LCIVWWSLSLELAQCNVVYDRKALIIDGQRRILFSGSIHYPRSTPEMWEGLIQKAK  68

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GG+D I+TYVFWN+HEPSPGNYNFEGRYDL RF+KT+ KAGLY HLRIGPYIC EWNFG
Sbjct  69    DGGLDAIDTYVFWNLHEPSPGNYNFEGRYDLARFIKTVHKAGLYVHLRIGPYICSEWNFG  128

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+VPGISFR DNEPFK AM+ FT+KIV LMK   LFESQGGPIILSQIENEY P
Sbjct  129   GFPVWLKYVPGISFRTDNEPFKSAMQKFTQKIVQLMKDEKLFESQGGPIILSQIENEYEP  188

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             ++K  GASG+ Y++WAAKMAV M TGVPWVMCKE+DAPDPVINTCNGFYCD F+PN+ YK
Sbjct  189   ESKAFGASGYAYMSWAAKMAVGMGTGVPWVMCKEQDAPDPVINTCNGFYCDYFSPNRVYK  248

Query  1010  PAIWT  1024
             P +WT
Sbjct  249   PTLWT  253



>gb|ABF94150.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
Length=819

 Score =   416 bits (1069),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
              C+V+YD+KA++++GQRR+LFSGSIHYPRSTPEMW+ LI KAK+GG+DVI+TYVFWN HE
Sbjct  24    HCAVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHE  83

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             P+PGNYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPVWLK+VPGISFR D
Sbjct  84    PTPGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTD  143

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             NEPFK AM+GFTEKIV +MKS NLF SQGGPIILSQIENEYGP+ K  GA+G  Y+ WAA
Sbjct  144   NEPFKNAMQGFTEKIVGMMKSENLFASQGGPIILSQIENEYGPEGKEFGAAGKAYINWAA  203

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             KMAV +DTGVPWVMCKE+DAPDPVIN CNGFYCD F+PNKPYKP +WT
Sbjct  204   KMAVGLDTGVPWVMCKEDDAPDPVINACNGFYCDTFSPNKPYKPTMWT  251



>ref|XP_008466519.1| PREDICTED: beta-galactosidase 5-like [Cucumis melo]
Length=844

 Score =   417 bits (1071),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 184/249 (74%), Positives = 218/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLI  457
             ++  ++  + M   L    TQC+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWEDL+
Sbjct  5     SVSSFLFFVFMAALLGFRSTQCTTVTYDKKAILINGQRRILISGSIHYPRSTPEMWEDLM  64

Query  458   SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  637
              KAK+GG+DV++TYVFWNVHEPSPGNY+FEGRYDLVRF+KT Q+ GLY HLRIGPY+C E
Sbjct  65    QKAKDGGLDVVDTYVFWNVHEPSPGNYDFEGRYDLVRFIKTAQRVGLYIHLRIGPYVCAE  124

Query  638   WNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIEN  817
             WNFGGFPVWLK+VPGISFR DN PFKMAM+GFT+KIV +MK+  LF SQGGPIILSQIEN
Sbjct  125   WNFGGFPVWLKYVPGISFRTDNGPFKMAMQGFTQKIVQMMKNEKLFASQGGPIILSQIEN  184

Query  818   EYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPN  997
             EYGPQ++ LGA+GH Y+ WAAKMAV ++TGVPWVMCKE+DAPDPVIN+CNGFYCD F+PN
Sbjct  185   EYGPQSRALGAAGHAYMNWAAKMAVGLNTGVPWVMCKEDDAPDPVINSCNGFYCDYFSPN  244

Query  998   KPYKPAIWT  1024
             KPYKP +WT
Sbjct  245   KPYKPTLWT  253



>ref|XP_008236954.1| PREDICTED: beta-galactosidase 3-like [Prunus mume]
Length=844

 Score =   417 bits (1071),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 190/245 (78%), Positives = 216/245 (88%), Gaps = 2/245 (1%)
 Frame = +2

Query  293   WVLVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             WVL LC+V++ LS  L QC+V YDRKA++I+GQRR+LFSGSIHYPRSTPEMWE LI KAK
Sbjct  10    WVL-LCIVWWSLSLELAQCNVVYDRKALIIDGQRRILFSGSIHYPRSTPEMWEGLIQKAK  68

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GG+D I+TYVFWN+HEPSPGNYNFEGRYDL RF+KT+ KAGLY HLRIGPYIC EWNFG
Sbjct  69    DGGLDAIDTYVFWNLHEPSPGNYNFEGRYDLARFIKTVHKAGLYVHLRIGPYICSEWNFG  128

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+VPGISFR DNEPFK AM+ FT+KIV LMK   LFESQGGPIILSQIENEY P
Sbjct  129   GFPVWLKYVPGISFRTDNEPFKSAMQKFTQKIVQLMKDEKLFESQGGPIILSQIENEYEP  188

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             ++K  GASG+ Y+TWAAKMAV M TGVPWVMCKE+DAPDPVINTCNGFYCD F+PN+ +K
Sbjct  189   ESKAFGASGYAYMTWAAKMAVGMGTGVPWVMCKEQDAPDPVINTCNGFYCDYFSPNRVHK  248

Query  1010  PAIWT  1024
             P +WT
Sbjct  249   PTLWT  253



>ref|XP_010110010.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC25028.1| Beta-galactosidase 3 [Morus notabilis]
Length=821

 Score =   416 bits (1068),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 185/230 (80%), Positives = 203/230 (88%), Gaps = 0/230 (0%)
 Frame = +2

Query  335   LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  514
             L  C+VSYDRKA++INGQRR+L SGSIHYPRSTPEMWEDLI KAK+GG+DVI+TYVFWNV
Sbjct  23    LMNCTVSYDRKALLINGQRRILISGSIHYPRSTPEMWEDLIQKAKDGGLDVIDTYVFWNV  82

Query  515   HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  694
             HEPSPG YNF+GRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  83    HEPSPGKYNFDGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  695   ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTW  874
              DN PFK AM+GFT+KIV LMK   LFE QGGPIILSQIENEYG Q++  GA GH YV W
Sbjct  143   TDNGPFKAAMQGFTQKIVQLMKDEKLFEPQGGPIILSQIENEYGYQSRQTGAIGHNYVEW  202

Query  875   AAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AAKMAV +DT VPWVMCKE+DAPDPVINTCNGFYCD F PNKPYKP IWT
Sbjct  203   AAKMAVGLDTDVPWVMCKEDDAPDPVINTCNGFYCDAFTPNKPYKPKIWT  252



>gb|AGR44466.1| beta-D-galactosidase 7 [Pyrus x bretschneideri]
Length=852

 Score =   416 bits (1070),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 213/244 (87%), Gaps = 1/244 (0%)
 Frame = +2

Query  296   VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  472
             VL L M  F++S L  C+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+
Sbjct  11    VLFLTMTLFMASELIHCTTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  473   GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  652
             GG+DVI+TYVFWN HEPSPGNY FEGRYDLVRF+KT+QKAGL+ HLRIGPY+C EWNFGG
Sbjct  71    GGLDVIDTYVFWNGHEPSPGNYYFEGRYDLVRFIKTVQKAGLFLHLRIGPYVCAEWNFGG  130

Query  653   FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQ  832
             FPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILSQIENEYGP+
Sbjct  131   FPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQIENEYGPE  190

Query  833   AKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKP  1012
              K LGA+G  Y+ WAAKMAV +DTGVPWVMCKE+DAPDP+IN CNGFYCD F PNKPYKP
Sbjct  191   RKALGAAGQNYINWAAKMAVGLDTGVPWVMCKEDDAPDPMINACNGFYCDGFTPNKPYKP  250

Query  1013  AIWT  1024
              +WT
Sbjct  251   TMWT  254



>ref|XP_008388000.1| PREDICTED: beta-galactosidase 5 [Malus domestica]
Length=852

 Score =   416 bits (1070),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 212/244 (87%), Gaps = 1/244 (0%)
 Frame = +2

Query  296   VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  472
             V  + M  FL S L  C+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+
Sbjct  11    VFFMSMALFLGSELIHCTTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  473   GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  652
             GG+DVI+TYVFWN HEPSPGNY FEGRYDLV F+KT+QKAGL+ HLRIGPYIC EWNFGG
Sbjct  71    GGLDVIDTYVFWNGHEPSPGNYYFEGRYDLVGFIKTVQKAGLFLHLRIGPYICAEWNFGG  130

Query  653   FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQ  832
             FPVWLK+VPGISFR DN PFKMAM+GFT+KIV +MK   LF SQGGPIILSQIENEYGP+
Sbjct  131   FPVWLKYVPGISFRTDNGPFKMAMQGFTQKIVQMMKDEKLFASQGGPIILSQIENEYGPE  190

Query  833   AKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKP  1012
             +K LGA+GH Y+ WAA+MAV +DTGVPWVMCKE+DAPDP+IN CNGFYCD F PNKPYKP
Sbjct  191   SKALGAAGHNYINWAAQMAVGLDTGVPWVMCKEDDAPDPMINACNGFYCDGFTPNKPYKP  250

Query  1013  AIWT  1024
             A+WT
Sbjct  251   AMWT  254



>gb|AAM22973.1|AF499737_1 beta-galactosidase [Oryza sativa Japonica Group]
 gb|AAM34271.1|AF508799_1 beta-galactosidase [Oryza sativa Japonica Group]
Length=843

 Score =   416 bits (1069),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
              C+V+YD+KA++++GQRR+LFSGSIHYPRSTPEMW+ LI KAK+GG+DVI+TYVFWN HE
Sbjct  24    HCAVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHE  83

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             P+PGNYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPVWLK+VPGISFR D
Sbjct  84    PTPGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTD  143

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             NEPFK AM+GFTEKIV +MKS NLF SQGGPIILSQIENEYGP+ K  GA+G  Y+ WAA
Sbjct  144   NEPFKNAMQGFTEKIVGMMKSENLFASQGGPIILSQIENEYGPEGKEFGAAGKAYINWAA  203

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             KMAV +DTGVPWVMCKE+DAPDPVIN CNGFYCD F+PNKPYKP +WT
Sbjct  204   KMAVGLDTGVPWVMCKEDDAPDPVINACNGFYCDTFSPNKPYKPTMWT  251



>ref|NP_001049068.1| Os03g0165400 [Oryza sativa Japonica Group]
 sp|Q10RB4.1|BGAL5_ORYSJ RecName: Full=Beta-galactosidase 5; Short=Lactase 5; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABF94149.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10982.1| Os03g0165400 [Oryza sativa Japonica Group]
 dbj|BAG95436.1| unnamed protein product [Oryza sativa Japonica Group]
Length=841

 Score =   416 bits (1069),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
              C+V+YD+KA++++GQRR+LFSGSIHYPRSTPEMW+ LI KAK+GG+DVI+TYVFWN HE
Sbjct  24    HCAVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHE  83

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             P+PGNYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPVWLK+VPGISFR D
Sbjct  84    PTPGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTD  143

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             NEPFK AM+GFTEKIV +MKS NLF SQGGPIILSQIENEYGP+ K  GA+G  Y+ WAA
Sbjct  144   NEPFKNAMQGFTEKIVGMMKSENLFASQGGPIILSQIENEYGPEGKEFGAAGKAYINWAA  203

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             KMAV +DTGVPWVMCKE+DAPDPVIN CNGFYCD F+PNKPYKP +WT
Sbjct  204   KMAVGLDTGVPWVMCKEDDAPDPVINACNGFYCDTFSPNKPYKPTMWT  251



>ref|XP_011092826.1| PREDICTED: beta-galactosidase 3 [Sesamum indicum]
Length=732

 Score =   412 bits (1060),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 209/229 (91%), Gaps = 0/229 (0%)
 Frame = +2

Query  338   TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  517
             + CSVSYDRKA++INGQRR+LFSGSIHYPRSTP+MWE LI KAK+GG+D I+TYVFW++H
Sbjct  25    SHCSVSYDRKALIINGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGLDAIDTYVFWDLH  84

Query  518   EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  697
             EPSPG YNFEGRYDLVRFVK +QKAGLY HLRIGPYIC EWNFGGFPVWLK+VPGISFR 
Sbjct  85    EPSPGTYNFEGRYDLVRFVKLVQKAGLYLHLRIGPYICAEWNFGGFPVWLKYVPGISFRT  144

Query  698   DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWA  877
             DN+PFKMAM+ FTEKIV +MK+  LF+SQGGPIILSQIENEYG +++  GA+GH Y++WA
Sbjct  145   DNQPFKMAMQRFTEKIVQMMKTERLFQSQGGPIILSQIENEYGLESRNFGAAGHAYMSWA  204

Query  878   AKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AKMAV++ TGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKPYKP +WT
Sbjct  205   AKMAVDLGTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPNKPYKPTMWT  253



>ref|XP_008382310.1| PREDICTED: beta-galactosidase 5-like [Malus domestica]
Length=848

 Score =   416 bits (1068),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 188/246 (76%), Positives = 215/246 (87%), Gaps = 2/246 (1%)
 Frame = +2

Query  293   WVLVLCMVFFLSSGL--TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  466
             WVL+ C + + S  +  T+C+V +DRKA+VI+GQRR+LFSGSIHYPRSTPEMWE LI  A
Sbjct  10    WVLLCCCIVWSSVYVEQTECNVVFDRKALVIDGQRRLLFSGSIHYPRSTPEMWEGLIQXA  69

Query  467   KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  646
             K+GG+D I+TYVFWN+HEPSPGNYNFEGR DLVRF+KT+ KAGLY HLRIGPYIC EWNF
Sbjct  70    KDGGLDAIDTYVFWNLHEPSPGNYNFEGRNDLVRFIKTVHKAGLYVHLRIGPYICSEWNF  129

Query  647   GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYG  826
             GGFPVWLKFVPGISFR DNEPFK AM+ FT+K+V LMK+  LFESQGGPIILSQIENEY 
Sbjct  130   GGFPVWLKFVPGISFRTDNEPFKSAMQKFTQKVVQLMKNEKLFESQGGPIILSQIENEYE  189

Query  827   PQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPY  1006
             P++K  GASG+ Y+TWAAKMAV M TGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKPY
Sbjct  190   PESKAFGASGYAYMTWAAKMAVGMGTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPNKPY  249

Query  1007  KPAIWT  1024
             KP +WT
Sbjct  250   KPTMWT  255



>ref|XP_008799994.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=845

 Score =   416 bits (1068),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 183/228 (80%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
             QC VSYDRKAI+INGQRR+L SGSIHYPRSTP+MWE L+ KAK+GG+DVI+TY FWN HE
Sbjct  21    QCGVSYDRKAIIINGQRRILISGSIHYPRSTPDMWEGLLQKAKDGGLDVIQTYAFWNGHE  80

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             PSPGNYNFEGRYDLVRF+KT+ K GLY HLRIGPYICGEWNFGGFPVWLK+ PGISFR D
Sbjct  81    PSPGNYNFEGRYDLVRFIKTVHKVGLYVHLRIGPYICGEWNFGGFPVWLKYAPGISFRTD  140

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             NEPFKMAM+GFT+KIV +MKS +LF SQGGPIILSQIENEYGP++K  GA+G+ YV WAA
Sbjct  141   NEPFKMAMQGFTQKIVQMMKSESLFASQGGPIILSQIENEYGPESKAFGAAGNAYVNWAA  200

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             KMAV + TGVPWVMCKE+DAPDPVIN CNGFYCD F PNKPYKP +WT
Sbjct  201   KMAVGLGTGVPWVMCKEDDAPDPVINACNGFYCDAFTPNKPYKPTMWT  248



>ref|XP_009396354.1| PREDICTED: beta-galactosidase 5-like [Musa acuminata subsp. malaccensis]
Length=848

 Score =   416 bits (1068),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 182/230 (79%), Positives = 206/230 (90%), Gaps = 0/230 (0%)
 Frame = +2

Query  335   LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  514
             + QC V+YDRKAI+INGQR++L SGSIHYPRSTP+MWE LI KAK+GG+DVI+TYVFWN 
Sbjct  23    VAQCGVTYDRKAIIINGQRKILISGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNG  82

Query  515   HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  694
             HEPSPG YNFEGRYDLVRF+KT+QK GLY HLR+GPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  83    HEPSPGTYNFEGRYDLVRFIKTVQKVGLYVHLRVGPYVCAEWNFGGFPVWLKYVPGISFR  142

Query  695   ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTW  874
              DNEPFKMAM+GFT+KIV +MKS +LF SQGGPIILSQIENEYGP++K LG++G  YV W
Sbjct  143   TDNEPFKMAMQGFTQKIVEMMKSESLFASQGGPIILSQIENEYGPESKALGSAGRSYVNW  202

Query  875   AAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AA MAV + TGVPWVMCKEEDAPDPVINTCNGFYCD F PNKPYKP +WT
Sbjct  203   AADMAVGLGTGVPWVMCKEEDAPDPVINTCNGFYCDSFTPNKPYKPMMWT  252



>gb|EYU42595.1| hypothetical protein MIMGU_mgv1a001990mg [Erythranthe guttata]
Length=729

 Score =   411 bits (1057),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 210/229 (92%), Gaps = 0/229 (0%)
 Frame = +2

Query  338   TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  517
             + CSV+YDRKA+VINGQR++LFSGSIHYPRS+P+MWE LI KAK+GG+D I+TYVFW++H
Sbjct  22    SHCSVTYDRKALVINGQRKILFSGSIHYPRSSPDMWEGLIQKAKDGGLDAIDTYVFWDLH  81

Query  518   EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  697
             EPSPGNYNFEGR DL+RF+K + +AGLY HLRIGPYIC EWNFGGFPVWLK+VPGISFR 
Sbjct  82    EPSPGNYNFEGRCDLIRFIKLVHEAGLYLHLRIGPYICAEWNFGGFPVWLKYVPGISFRT  141

Query  698   DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWA  877
             DNEPFKMAM+ FTEKIV +MK+  LF+SQGGPIILSQIENEYG ++K  G++GH Y++WA
Sbjct  142   DNEPFKMAMQRFTEKIVGMMKNERLFQSQGGPIILSQIENEYGLESKSFGSAGHSYMSWA  201

Query  878   AKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AKMAVE+DTGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKPYKPAIWT
Sbjct  202   AKMAVELDTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPNKPYKPAIWT  250



>ref|XP_006306871.1| hypothetical protein CARUB_v10008424mg [Capsella rubella]
 gb|EOA39769.1| hypothetical protein CARUB_v10008424mg [Capsella rubella]
Length=733

 Score =   412 bits (1058),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 183/248 (74%), Positives = 209/248 (84%), Gaps = 1/248 (0%)
 Frame = +2

Query  284   MRKWVLVLCMVFFLSSGLTQC-SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             + K +  L     L S L QC SV+YD+KAI++NG RR+L SGSIHYPRSTPEMWEDLI 
Sbjct  9     LTKILSFLLTTMLLGSSLIQCTSVTYDKKAIIVNGHRRILLSGSIHYPRSTPEMWEDLIK  68

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DVI+TYVFWN HEPSPG YNF+GRYDLVRF+KTIQ+ GLY HLRIGPY+C EW
Sbjct  69    KAKDGGLDVIDTYVFWNGHEPSPGTYNFKGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEW  128

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+V GISFR DN PFK AM+GFTEKIV +MK H  F SQGGPIILSQIENE
Sbjct  129   NFGGFPVWLKYVDGISFRTDNGPFKAAMQGFTEKIVQMMKEHRFFASQGGPIILSQIENE  188

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             +GP+ K LG +GH YV WAAKMAV ++TG+PWVMCKE+DAPDP+IN CNGFYCD FAPNK
Sbjct  189   FGPELKALGPAGHSYVNWAAKMAVGLNTGIPWVMCKEDDAPDPIINACNGFYCDYFAPNK  248

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  249   PYKPTMWT  256



>dbj|BAD91084.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=852

 Score =   415 bits (1066),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 212/244 (87%), Gaps = 1/244 (0%)
 Frame = +2

Query  296   VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  472
             VL L M  F++S L  C+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+
Sbjct  11    VLFLTMTLFMASELIHCTTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  473   GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  652
             GG+DVI+TYVFWN HEPSPGNY FEGRYDLVRF+KT+QKAGL+ HLRIGPY+C EWNFGG
Sbjct  71    GGLDVIDTYVFWNGHEPSPGNYYFEGRYDLVRFIKTVQKAGLFLHLRIGPYVCAEWNFGG  130

Query  653   FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQ  832
             FPVWLK+VPGISFR DN PFK+AM+GFT+KIV +MK+  LF SQGGPIILSQIENEYGP+
Sbjct  131   FPVWLKYVPGISFRTDNGPFKVAMQGFTQKIVQMMKNEKLFASQGGPIILSQIENEYGPE  190

Query  833   AKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKP  1012
              K LGA G  Y+ WAAKMAV +DTGVPWVMCKE+DAPDP+IN CNGFYCD F PNKPYKP
Sbjct  191   RKALGAPGQNYINWAAKMAVGLDTGVPWVMCKEDDAPDPMINACNGFYCDGFTPNKPYKP  250

Query  1013  AIWT  1024
              +WT
Sbjct  251   TMWT  254



>ref|XP_006649450.1| PREDICTED: beta-galactosidase 5-like [Oryza brachyantha]
Length=841

 Score =   414 bits (1065),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 182/224 (81%), Positives = 207/224 (92%), Gaps = 0/224 (0%)
 Frame = +2

Query  353   SYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSPG  532
             +YD+K++VI+GQRR+LFSGSIHYPRSTPEMWE LI KAK+GG+DVI+TYVFWN HEP+PG
Sbjct  28    TYDKKSVVIDGQRRILFSGSIHYPRSTPEMWEGLIEKAKDGGLDVIQTYVFWNGHEPTPG  87

Query  533   NYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEPF  712
             NYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPVWLK+VPGISFR DNEPF
Sbjct  88    NYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPF  147

Query  713   KMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAKMAV  892
             KMAM+GFTEKIV+LMKS  LF SQGGPIILSQIENEYGP+ K  GA+G  Y+ WAAKMAV
Sbjct  148   KMAMQGFTEKIVDLMKSEELFASQGGPIILSQIENEYGPEGKEFGAAGKAYINWAAKMAV  207

Query  893   EMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              +DTGVPWVMCKE+DAPDP+INTCNGFYCD F+PNKPYKP +WT
Sbjct  208   GLDTGVPWVMCKEDDAPDPLINTCNGFYCDAFSPNKPYKPMMWT  251



>ref|XP_009614464.1| PREDICTED: beta-galactosidase 3-like [Nicotiana tomentosiformis]
Length=727

 Score =   411 bits (1056),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 182/245 (74%), Positives = 212/245 (87%), Gaps = 0/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             KW L+  ++    +    CSV+YD+K+++INGQR++LFSGSIHYPRSTP+MWE +I KAK
Sbjct  4     KWFLLCSLLLIFVTEFGYCSVTYDKKSLIINGQRKILFSGSIHYPRSTPDMWEGIIQKAK  63

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GG+DVIETYVFWN+HEPSPGNYNFEGR DLVRF+K +QKAGLY HLRIGPYICGEWNFG
Sbjct  64    DGGLDVIETYVFWNLHEPSPGNYNFEGRNDLVRFIKLVQKAGLYMHLRIGPYICGEWNFG  123

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+VPGISFR DNEPFK  M+ FT+KIV +MK+  LF++QGGPIILSQIENEYG 
Sbjct  124   GFPVWLKYVPGISFRTDNEPFKREMQRFTQKIVQMMKNEKLFQTQGGPIILSQIENEYGL  183

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             + K  GA GH Y+TWAAKMAVEM TGVPW+MCKE+DAPDPVINTCNGFYCD F+PNKP K
Sbjct  184   EIKKYGAPGHAYMTWAAKMAVEMGTGVPWIMCKEDDAPDPVINTCNGFYCDYFSPNKPNK  243

Query  1010  PAIWT  1024
             P IWT
Sbjct  244   PTIWT  248



>ref|XP_010066194.1| PREDICTED: beta-galactosidase 5-like isoform X3 [Eucalyptus grandis]
Length=699

 Score =   410 bits (1054),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 185/246 (75%), Positives = 213/246 (87%), Gaps = 2/246 (1%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  466
             KW L  C++   +  LT CS V+YD KA++INGQRR+LFSGSIHYPRSTP+MWE L+ KA
Sbjct  9     KWFLP-CVLLCATLSLTHCSSVTYDGKALIINGQRRILFSGSIHYPRSTPQMWEGLVHKA  67

Query  467   KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  646
             KEGG+DV++TYVFWNVHEPSPGNYNFEG+YDLV+FVKT+QKAGLY HLRIGPY+C EWNF
Sbjct  68    KEGGLDVVDTYVFWNVHEPSPGNYNFEGQYDLVQFVKTVQKAGLYVHLRIGPYVCAEWNF  127

Query  647   GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYG  826
             GG PVWLKFV G+SFR DNEPFK+AM+ FT+KIV +MKS +LF SQGGPIILSQIENEY 
Sbjct  128   GGLPVWLKFVRGVSFRTDNEPFKLAMQKFTQKIVQMMKSEHLFHSQGGPIILSQIENEYE  187

Query  827   PQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPY  1006
             P+ K  GA+G  Y+ WAAKMAV M TGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKPY
Sbjct  188   PERKAFGAAGKAYMNWAAKMAVGMGTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPNKPY  247

Query  1007  KPAIWT  1024
             KP +WT
Sbjct  248   KPTLWT  253



>gb|KJB32549.1| hypothetical protein B456_005G246600 [Gossypium raimondii]
Length=693

 Score =   410 bits (1053),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 184/237 (78%), Positives = 208/237 (88%), Gaps = 0/237 (0%)
 Frame = +2

Query  314   VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIE  493
             + FL   L  C+V+YDRKAI I+GQ+R+LFSGSIHYPRSTPEMWE LI KAK GG+DVI+
Sbjct  16    ILFLYLLLVHCNVTYDRKAIAIDGQKRILFSGSIHYPRSTPEMWEGLIQKAKNGGLDVID  75

Query  494   TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKF  673
             TYVFWN+HEPSPGNYNFEGRYDLV+F+K ++KAGLY HLRIGPYICGEWNFGGFPVWLK+
Sbjct  76    TYVFWNLHEPSPGNYNFEGRYDLVQFIKLVKKAGLYVHLRIGPYICGEWNFGGFPVWLKY  135

Query  674   VPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGAS  853
             VPGISFR DNEPFK AM  FT+KIV +MK  NLFESQGGPIILSQIENEY P++K+ G +
Sbjct  136   VPGISFRTDNEPFKKAMAKFTQKIVQMMKDENLFESQGGPIILSQIENEYEPESKLYGPA  195

Query  854   GHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             G  YV WAAKMAV ++TGVPWVMCKE DAPDPVINTCNGFYCD F+PNKPYKP +WT
Sbjct  196   GKAYVKWAAKMAVGLNTGVPWVMCKEYDAPDPVINTCNGFYCDYFSPNKPYKPTLWT  252



>ref|XP_008452119.1| PREDICTED: beta-galactosidase 3-like [Cucumis melo]
Length=846

 Score =   414 bits (1064),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 187/242 (77%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = +2

Query  299   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
             L L      +S     +V+YDRKAI+INGQRR+LFSGSIHYPRSTPEMWEDLI KAK GG
Sbjct  10    LFLIAFLLANSHFIHSTVTYDRKAILINGQRRILFSGSIHYPRSTPEMWEDLILKAKNGG  69

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DV+ETYVFWNVHEP PG YNFEGR+DLVRF+KTIQ+AGLYA+LRIGPY+C EWNFGGFP
Sbjct  70    LDVVETYVFWNVHEPYPGIYNFEGRFDLVRFIKTIQRAGLYANLRIGPYVCAEWNFGGFP  129

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAK  838
             VWLK+VPGISFR DNE FK AM+GFTEKIV +MKS NLFESQGGPIIL+QIENEYG ++K
Sbjct  130   VWLKYVPGISFRTDNEAFKKAMQGFTEKIVAMMKSENLFESQGGPIILAQIENEYGTESK  189

Query  839   VLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAI  1018
             + G +GH Y+TWAA MAV + TGVPWVMCKEEDAPDPVINTCNGFYCD F+PNKPYKP +
Sbjct  190   LFGEAGHNYMTWAANMAVGLQTGVPWVMCKEEDAPDPVINTCNGFYCDTFSPNKPYKPTM  249

Query  1019  WT  1024
             WT
Sbjct  250   WT  251



>ref|XP_010315322.1| PREDICTED: beta-galactosidase 3-like [Solanum lycopersicum]
Length=727

 Score =   410 bits (1054),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 186/249 (75%), Positives = 214/249 (86%), Gaps = 1/249 (0%)
 Frame = +2

Query  278   GAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLI  457
             G   KW L+  ++ F  S +  CSVSYD+K+++INGQR++LFSGS+HYPRSTP+MWE +I
Sbjct  2     GINTKWFLIFFVLIF-GSKICYCSVSYDKKSLIINGQRKILFSGSVHYPRSTPDMWEGII  60

Query  458   SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  637
              KAK+GG+DVIETYVFWN+HEPSPGNYNFEGR DLVRF+K IQKAGLY HLRIGPYICGE
Sbjct  61    QKAKDGGLDVIETYVFWNLHEPSPGNYNFEGRNDLVRFIKLIQKAGLYMHLRIGPYICGE  120

Query  638   WNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIEN  817
             WNFGGFPVWLK+VPGISFR +NEPFK  M+ FT KIV +MK+  LF++QGGPIILSQIEN
Sbjct  121   WNFGGFPVWLKYVPGISFRTNNEPFKREMQRFTTKIVQMMKNEKLFQTQGGPIILSQIEN  180

Query  818   EYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPN  997
             EYG + K  GA GH Y+TWAAKMAVEM TGVPWVMCKE+DAPDPVINTCNGFYCD F+PN
Sbjct  181   EYGLEIKQYGAPGHAYMTWAAKMAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPN  240

Query  998   KPYKPAIWT  1024
             KP KP IWT
Sbjct  241   KPNKPTIWT  249



>gb|KFK36177.1| hypothetical protein AALP_AA4G088200 [Arabis alpina]
Length=713

 Score =   410 bits (1053),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 177/236 (75%), Positives = 206/236 (87%), Gaps = 0/236 (0%)
 Frame = +2

Query  317   FFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIET  496
               + SG+ QCSV+YD++AI++NG RR+L SGSIHYPRSTPEMWEDLI KAK+GG+DVI+T
Sbjct  1     MLIGSGVIQCSVTYDKRAIIVNGHRRILLSGSIHYPRSTPEMWEDLIKKAKDGGLDVIDT  60

Query  497   YVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFV  676
             YVFWN HEP+PG Y+FEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EWNFGGFPVWLK+V
Sbjct  61    YVFWNGHEPTPGTYDFEGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWNFGGFPVWLKYV  120

Query  677   PGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASG  856
             PGISFR DN PFK AM+GFT+KIV +MK   LF SQGGPIILSQIENE+GP+ K  G++G
Sbjct  121   PGISFRTDNGPFKAAMQGFTQKIVQMMKDEKLFASQGGPIILSQIENEFGPELKEFGSAG  180

Query  857   HQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             H YV WAAKMAV +DTGVPWVMCKE+DAPDP+IN CNGFYCD F PNKPYKP +WT
Sbjct  181   HSYVNWAAKMAVGLDTGVPWVMCKEDDAPDPIINACNGFYCDYFTPNKPYKPTMWT  236



>ref|XP_009777047.1| PREDICTED: beta-galactosidase 3-like [Nicotiana sylvestris]
Length=726

 Score =   410 bits (1053),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 184/245 (75%), Positives = 214/245 (87%), Gaps = 1/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             KW+L+  ++ F S     CSV+YD+K+++INGQR++LFSGSIHYPRSTP+MWE +I KAK
Sbjct  4     KWLLLFFVLIFASE-FGYCSVTYDKKSLIINGQRKILFSGSIHYPRSTPDMWEGIIQKAK  62

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GG+DVIETYVFWN+HEPSPGNYNFEGR DLVRF+K +QKAGLY HLRIGPYICGEWNFG
Sbjct  63    DGGLDVIETYVFWNLHEPSPGNYNFEGRNDLVRFIKLVQKAGLYMHLRIGPYICGEWNFG  122

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+VPGISFR DNEPFK  M+ FT+KIV +MK+  LF++QGGPIILSQIENEYG 
Sbjct  123   GFPVWLKYVPGISFRTDNEPFKREMQRFTQKIVQMMKNEKLFQTQGGPIILSQIENEYGL  182

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             + K  GA GH Y+TWAAKMAVEM TGVPW+MCKE+DAPDPVINTCNGFYCD F+PNKP K
Sbjct  183   EIKKYGAPGHAYMTWAAKMAVEMGTGVPWIMCKEDDAPDPVINTCNGFYCDYFSPNKPNK  242

Query  1010  PAIWT  1024
             P IWT
Sbjct  243   PTIWT  247



>gb|KJB32547.1| hypothetical protein B456_005G246600 [Gossypium raimondii]
Length=732

 Score =   410 bits (1054),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 184/237 (78%), Positives = 208/237 (88%), Gaps = 0/237 (0%)
 Frame = +2

Query  314   VFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIE  493
             + FL   L  C+V+YDRKAI I+GQ+R+LFSGSIHYPRSTPEMWE LI KAK GG+DVI+
Sbjct  16    ILFLYLLLVHCNVTYDRKAIAIDGQKRILFSGSIHYPRSTPEMWEGLIQKAKNGGLDVID  75

Query  494   TYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKF  673
             TYVFWN+HEPSPGNYNFEGRYDLV+F+K ++KAGLY HLRIGPYICGEWNFGGFPVWLK+
Sbjct  76    TYVFWNLHEPSPGNYNFEGRYDLVQFIKLVKKAGLYVHLRIGPYICGEWNFGGFPVWLKY  135

Query  674   VPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGAS  853
             VPGISFR DNEPFK AM  FT+KIV +MK  NLFESQGGPIILSQIENEY P++K+ G +
Sbjct  136   VPGISFRTDNEPFKKAMAKFTQKIVQMMKDENLFESQGGPIILSQIENEYEPESKLYGPA  195

Query  854   GHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             G  YV WAAKMAV ++TGVPWVMCKE DAPDPVINTCNGFYCD F+PNKPYKP +WT
Sbjct  196   GKAYVKWAAKMAVGLNTGVPWVMCKEYDAPDPVINTCNGFYCDYFSPNKPYKPTLWT  252



>ref|XP_004146490.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus]
Length=846

 Score =   413 bits (1061),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 188/242 (78%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = +2

Query  299   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
             L L      +S L   +V+YDRKAI+INGQRR+LFSGSIHYPRSTPEMWEDLI KAK GG
Sbjct  10    LFLIAFLLANSHLIHSTVTYDRKAILINGQRRILFSGSIHYPRSTPEMWEDLILKAKNGG  69

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DV+ETYVFWNVHEP PG YNFEGR+DLVRF+KTIQKAGLYA+LRIGPY+C EWNFGGFP
Sbjct  70    LDVVETYVFWNVHEPYPGIYNFEGRFDLVRFIKTIQKAGLYANLRIGPYVCAEWNFGGFP  129

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAK  838
             VWLK+VPGISFR DNE FK AM+GFTEKIV LMKS NLFESQGGPIIL+QIENEYG ++K
Sbjct  130   VWLKYVPGISFRTDNEAFKNAMQGFTEKIVALMKSENLFESQGGPIILAQIENEYGTESK  189

Query  839   VLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAI  1018
             + G +G+ Y+TWAA MAV + TGVPWVMCKE DAPDPVINTCNGFYCD F+PNKPYKP +
Sbjct  190   LFGEAGYNYMTWAANMAVGLQTGVPWVMCKEADAPDPVINTCNGFYCDTFSPNKPYKPTM  249

Query  1019  WT  1024
             WT
Sbjct  250   WT  251



>ref|XP_009335672.1| PREDICTED: beta-galactosidase 5 [Pyrus x bretschneideri]
Length=852

 Score =   413 bits (1061),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 185/244 (76%), Positives = 211/244 (86%), Gaps = 1/244 (0%)
 Frame = +2

Query  296   VLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  472
             VL + M  FL S L  C+ V+YD+KAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+
Sbjct  11    VLFMSMALFLGSELIHCTTVTYDKKAILINGQRRLLISGSIHYPRSTPEMWEGLIQKAKD  70

Query  473   GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  652
             GG+DVI+TYVFWN HEPSPGNY FE RYDLV F+KT++KAGL  HLRIGPY+C EWNFGG
Sbjct  71    GGLDVIDTYVFWNGHEPSPGNYYFEERYDLVGFIKTVEKAGLLLHLRIGPYVCAEWNFGG  130

Query  653   FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQ  832
             FPVWLK+VPGISFR DN PFKMAM+GFT+KIV +MK   LF SQGGPIILSQIENEYGP+
Sbjct  131   FPVWLKYVPGISFRTDNGPFKMAMQGFTQKIVQMMKDEKLFASQGGPIILSQIENEYGPE  190

Query  833   AKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKP  1012
             +K LGA+GH Y+ WAA+MAV +DTGVPWVMCKE+DAPDP+IN CNGFYCD F PNKPYKP
Sbjct  191   SKALGAAGHNYINWAAQMAVGLDTGVPWVMCKEDDAPDPIINACNGFYCDGFTPNKPYKP  250

Query  1013  AIWT  1024
             A+WT
Sbjct  251   AMWT  254



>ref|XP_010066191.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Eucalyptus grandis]
 ref|XP_010066192.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Eucalyptus grandis]
Length=737

 Score =   409 bits (1051),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 185/246 (75%), Positives = 213/246 (87%), Gaps = 2/246 (1%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  466
             KW L  C++   +  LT CS V+YD KA++INGQRR+LFSGSIHYPRSTP+MWE L+ KA
Sbjct  9     KWFLP-CVLLCATLSLTHCSSVTYDGKALIINGQRRILFSGSIHYPRSTPQMWEGLVHKA  67

Query  467   KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  646
             KEGG+DV++TYVFWNVHEPSPGNYNFEG+YDLV+FVKT+QKAGLY HLRIGPY+C EWNF
Sbjct  68    KEGGLDVVDTYVFWNVHEPSPGNYNFEGQYDLVQFVKTVQKAGLYVHLRIGPYVCAEWNF  127

Query  647   GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYG  826
             GG PVWLKFV G+SFR DNEPFK+AM+ FT+KIV +MKS +LF SQGGPIILSQIENEY 
Sbjct  128   GGLPVWLKFVRGVSFRTDNEPFKLAMQKFTQKIVQMMKSEHLFHSQGGPIILSQIENEYE  187

Query  827   PQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPY  1006
             P+ K  GA+G  Y+ WAAKMAV M TGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKPY
Sbjct  188   PERKAFGAAGKAYMNWAAKMAVGMGTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPNKPY  247

Query  1007  KPAIWT  1024
             KP +WT
Sbjct  248   KPTLWT  253



>ref|XP_010066193.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Eucalyptus grandis]
 gb|KCW64026.1| hypothetical protein EUGRSUZ_G01704 [Eucalyptus grandis]
Length=733

 Score =   409 bits (1051),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 185/246 (75%), Positives = 213/246 (87%), Gaps = 2/246 (1%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  466
             KW L  C++   +  LT CS V+YD KA++INGQRR+LFSGSIHYPRSTP+MWE L+ KA
Sbjct  9     KWFLP-CVLLCATLSLTHCSSVTYDGKALIINGQRRILFSGSIHYPRSTPQMWEGLVHKA  67

Query  467   KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  646
             KEGG+DV++TYVFWNVHEPSPGNYNFEG+YDLV+FVKT+QKAGLY HLRIGPY+C EWNF
Sbjct  68    KEGGLDVVDTYVFWNVHEPSPGNYNFEGQYDLVQFVKTVQKAGLYVHLRIGPYVCAEWNF  127

Query  647   GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYG  826
             GG PVWLKFV G+SFR DNEPFK+AM+ FT+KIV +MKS +LF SQGGPIILSQIENEY 
Sbjct  128   GGLPVWLKFVRGVSFRTDNEPFKLAMQKFTQKIVQMMKSEHLFHSQGGPIILSQIENEYE  187

Query  827   PQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPY  1006
             P+ K  GA+G  Y+ WAAKMAV M TGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKPY
Sbjct  188   PERKAFGAAGKAYMNWAAKMAVGMGTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPNKPY  247

Query  1007  KPAIWT  1024
             KP +WT
Sbjct  248   KPTLWT  253



>ref|XP_010917686.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=849

 Score =   412 bits (1059),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 182/228 (80%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
             QC V+YD KA++INGQRR+L SGSIHYPRSTP+MWE LI KAK+GG+DVI+TYVFWN HE
Sbjct  25    QCGVTYDSKAVIINGQRRILISGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNGHE  84

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             PSPG+YNFEGRYDLVRF+KT+QK GLY HLRIGPYICGEWNFGGFPVWLK+V GISFR D
Sbjct  85    PSPGSYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYICGEWNFGGFPVWLKYVSGISFRTD  144

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             NEPFK AM+GFT+KIV +MKS +LF SQGGPIILSQIENEYGP++  LGA+GH YV WAA
Sbjct  145   NEPFKNAMQGFTQKIVQMMKSESLFASQGGPIILSQIENEYGPESNALGAAGHAYVNWAA  204

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             KMAV M TGVPWVMCKE+DAPDP+IN CNGFYCD F PNKPYKP +WT
Sbjct  205   KMAVGMGTGVPWVMCKEDDAPDPMINACNGFYCDAFTPNKPYKPTMWT  252



>ref|XP_006838689.1| PREDICTED: beta-galactosidase 5 [Amborella trichopoda]
 gb|ERN01258.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
Length=843

 Score =   412 bits (1058),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 182/230 (79%), Positives = 203/230 (88%), Gaps = 0/230 (0%)
 Frame = +2

Query  335   LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  514
             L  C+V+YD +++VING RR+L SGSIHYPRSTPEMW DLI KAK+GG+DVI+TYVFWNV
Sbjct  19    LAHCAVTYDHRSLVINGNRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNV  78

Query  515   HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  694
             HEPSPGNY+F GRYDLVRFVKT QK GLY HLRIGPY C EWNFGGFPVWLK+VPGISFR
Sbjct  79    HEPSPGNYDFSGRYDLVRFVKTAQKVGLYVHLRIGPYACAEWNFGGFPVWLKYVPGISFR  138

Query  695   ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTW  874
              DNEPFK+AM+GFT+KIV LMKS NL+ESQGGPIILSQIENEYGP++K  G  GH Y+TW
Sbjct  139   TDNEPFKIAMQGFTQKIVELMKSENLYESQGGPIILSQIENEYGPESKAFGPPGHAYMTW  198

Query  875   AAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AA MAV+  TGVPWVMCKE+DAPDPVINTCNGFYCD F PNKPYKP +WT
Sbjct  199   AANMAVQTGTGVPWVMCKEDDAPDPVINTCNGFYCDSFVPNKPYKPTMWT  248



>gb|KEH36209.1| beta-galactosidase-like protein [Medicago truncatula]
Length=733

 Score =   409 bits (1050),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 214/252 (85%), Gaps = 0/252 (0%)
 Frame = +2

Query  269   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  448
             +   ++ K +LV+    F+        V+YDRK+++INGQRR+L SGSIHYPRSTPEMWE
Sbjct  1     MNATSVSKLLLVVVTTLFVLFLGCHSKVTYDRKSLLINGQRRILISGSIHYPRSTPEMWE  60

Query  449   DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  628
             DLI KAK GG+DVI+TYVFW+VHEPSP NYNFEGRYDLVRF+KT+QKAGLYA+LRIGPY+
Sbjct  61    DLIRKAKHGGLDVIDTYVFWDVHEPSPSNYNFEGRYDLVRFIKTVQKAGLYANLRIGPYV  120

Query  629   CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  808
             C EWNFGG PVWLK+VPGISFR DN PFK AM+GFT+KIV +MKS  LF+SQGGPIILSQ
Sbjct  121   CAEWNFGGIPVWLKYVPGISFRTDNGPFKAAMQGFTQKIVQMMKSEKLFQSQGGPIILSQ  180

Query  809   IENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKF  988
             IENEYGP+++  GA+GH Y+ WAA MAV + TGVPWVMCKE DAPDPVIN+CNGFYCD F
Sbjct  181   IENEYGPESRATGAAGHAYLNWAANMAVGLGTGVPWVMCKENDAPDPVINSCNGFYCDDF  240

Query  989   APNKPYKPAIWT  1024
             +PNKPYKP++WT
Sbjct  241   SPNKPYKPSMWT  252



>ref|XP_011457728.1| PREDICTED: beta-galactosidase 3-like [Fragaria vesca subsp. vesca]
Length=843

 Score =   412 bits (1058),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 185/230 (80%), Positives = 208/230 (90%), Gaps = 0/230 (0%)
 Frame = +2

Query  335   LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  514
             L Q +VSYDRKA+VINGQR++LFSGSIHYPRSTPEMWE LI KAK+GG+DVI+TYVFWN+
Sbjct  23    LIQSNVSYDRKALVINGQRKILFSGSIHYPRSTPEMWEGLIEKAKDGGLDVIDTYVFWNL  82

Query  515   HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  694
             HEPSPGNYNFEGR DLVRF+K +Q+A LY HLRIGPYIC EWNFGGFPVWLK+VPGISFR
Sbjct  83    HEPSPGNYNFEGRNDLVRFIKMVQEARLYVHLRIGPYICSEWNFGGFPVWLKYVPGISFR  142

Query  695   ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTW  874
              DNEPFK AM+ FT+KIV LMK   LFESQGGPIILSQIENEY P++K+ GA+GH Y+TW
Sbjct  143   TDNEPFKSAMQKFTKKIVQLMKHEKLFESQGGPIILSQIENEYEPESKLFGAAGHAYMTW  202

Query  875   AAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AA+MAV M TGVPWVMCKEEDAPDPVINTCNGFYCD F+PNKPYKP++WT
Sbjct  203   AAEMAVGMGTGVPWVMCKEEDAPDPVINTCNGFYCDYFSPNKPYKPSLWT  252



>ref|XP_003558743.1| PREDICTED: beta-galactosidase 5 [Brachypodium distachyon]
Length=839

 Score =   411 bits (1057),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
             +C+V+YD+KA++I+GQRR+LFSGSIHYPRSTPEMWE L  KAK+GG+DVI+TYVFWN HE
Sbjct  24    ECAVTYDKKAVLIDGQRRILFSGSIHYPRSTPEMWEGLFQKAKDGGLDVIQTYVFWNGHE  83

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             P+PGNYNFEGRYDLV+F+KT QKAGL+ HLRIGPYICGEWNFGGFPVWLK+VPGISFR D
Sbjct  84    PTPGNYNFEGRYDLVKFIKTAQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTD  143

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             NEPFK AM+GFTEKIV +MKS  LF SQGGPIILSQIENEYGP+ K  GA+G  Y  WAA
Sbjct  144   NEPFKTAMQGFTEKIVGMMKSEELFASQGGPIILSQIENEYGPEGKSFGAAGKSYSNWAA  203

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             KMAV +DTGVPWVMCK++DAPDPVIN CNGFYCD F+PNKPYKP +WT
Sbjct  204   KMAVGLDTGVPWVMCKQDDAPDPVINACNGFYCDAFSPNKPYKPTMWT  251



>ref|XP_006362025.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=727

 Score =   408 bits (1048),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 184/245 (75%), Positives = 212/245 (87%), Gaps = 1/245 (0%)
 Frame = +2

Query  290   KWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAK  469
             KW L+  ++ F  S +  CSV+YD+K+++INGQR++LFSGS+HYPRSTP+MWE +I KAK
Sbjct  6     KWFLIFFVLIF-GSKICYCSVTYDKKSLIINGQRKILFSGSVHYPRSTPDMWEGIIQKAK  64

Query  470   EGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFG  649
             +GG+DVIETYVFWN+HEPSPGNYNFEGR DLVRF+K IQKAGLY HLRIGPYICGEWNFG
Sbjct  65    DGGLDVIETYVFWNLHEPSPGNYNFEGRNDLVRFIKLIQKAGLYMHLRIGPYICGEWNFG  124

Query  650   GFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGP  829
             GFPVWLK+VPGISFR DNEPFK  M+ FT KIV +MK+  LF++QGG IILSQIENEYG 
Sbjct  125   GFPVWLKYVPGISFRTDNEPFKREMQRFTTKIVQMMKNEKLFQTQGGHIILSQIENEYGL  184

Query  830   QAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYK  1009
             + K  GA GH Y+TWAAKMAVEM TGVPWVMCKE+DAPDPVINTCNGFYCD F+PNKP K
Sbjct  185   EIKQYGAPGHAYMTWAAKMAVEMGTGVPWVMCKEDDAPDPVINTCNGFYCDYFSPNKPNK  244

Query  1010  PAIWT  1024
             P IWT
Sbjct  245   PTIWT  249



>ref|XP_007136038.1| hypothetical protein PHAVU_009G012700g [Phaseolus vulgaris]
 gb|ESW08032.1| hypothetical protein PHAVU_009G012700g [Phaseolus vulgaris]
Length=738

 Score =   408 bits (1048),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 208/234 (89%), Gaps = 0/234 (0%)
 Frame = +2

Query  323   LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYV  502
             + S L  C+V+YDRK+++I GQRR+L SGSIHYPRSTP+MWEDLI KAK GG+DVI+TYV
Sbjct  21    VGSQLIHCNVTYDRKSLLIKGQRRILISGSIHYPRSTPDMWEDLIRKAKHGGLDVIDTYV  80

Query  503   FWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPG  682
             FW+VHEPSPGNYNFEGRYDLVRF+KT+QK GLYA+LRIGPY+C EWNFGG PVWLK+VPG
Sbjct  81    FWDVHEPSPGNYNFEGRYDLVRFIKTVQKVGLYANLRIGPYVCAEWNFGGIPVWLKYVPG  140

Query  683   ISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQ  862
             ISFR DNEPFK AM+GFT+KIV +MKS  LF+SQGGPIILSQIENEYGP+++ +GA+G  
Sbjct  141   ISFRTDNEPFKAAMQGFTQKIVQMMKSEKLFQSQGGPIILSQIENEYGPESRAMGAAGRA  200

Query  863   YVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             Y+ WAA MAV + TGVPWVMCK+ DAPDPVIN+CNGFYCD F PNKPYKP++WT
Sbjct  201   YLNWAASMAVGLGTGVPWVMCKQNDAPDPVINSCNGFYCDDFTPNKPYKPSMWT  254



>ref|XP_008660537.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 5-like [Zea 
mays]
Length=842

 Score =   411 bits (1056),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 214/251 (85%), Gaps = 4/251 (2%)
 Frame = +2

Query  284   MRKW---VLVLCMVFFLSSGLT-QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWED  451
             MR+W    L+ C V         +C+V+YD+KA++I+GQRR+LFSGSIHYPRSTP+MWE 
Sbjct  1     MRRWWPAALLGCAVAVSVLVAAVECAVTYDKKAVLIDGQRRILFSGSIHYPRSTPDMWEG  60

Query  452   LISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYIC  631
             LI KAK+GG+DVI+TYVFWN HEP+PGNY FE RYDLVRF+KT+QKAGL+ HLRIGPYIC
Sbjct  61    LIQKAKDGGLDVIQTYVFWNGHEPTPGNYYFEERYDLVRFIKTVQKAGLFVHLRIGPYIC  120

Query  632   GEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQI  811
             GEWNFGGFPVWLK+VPGISFR DNEPFK AM+GFTEKIV +MKS NLF SQGGPIILSQI
Sbjct  121   GEWNFGGFPVWLKYVPGISFRTDNEPFKTAMQGFTEKIVGMMKSENLFASQGGPIILSQI  180

Query  812   ENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFA  991
             ENEYGP+ +  GA+G  Y+ WAAKMAV + TGVPWVMCKEEDAPDPVIN CNGFYCD F+
Sbjct  181   ENEYGPEGREFGAAGQAYINWAAKMAVGLGTGVPWVMCKEEDAPDPVINACNGFYCDAFS  240

Query  992   PNKPYKPAIWT  1024
             PNKPYKP +WT
Sbjct  241   PNKPYKPTMWT  251



>ref|XP_009107461.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Brassica rapa]
 ref|XP_009107462.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Brassica rapa]
Length=729

 Score =   407 bits (1047),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 185/249 (74%), Positives = 209/249 (84%), Gaps = 7/249 (3%)
 Frame = +2

Query  293   WVLVLCMVFFLS-----SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLI  457
             WVL   + FFL+     S + QCSV+YD+KAIV+NG RR+L SGSIHYPRSTPEMWEDLI
Sbjct  5     WVLSKIVTFFLTAMLIGSSIIQCSVTYDKKAIVVNGHRRILLSGSIHYPRSTPEMWEDLI  64

Query  458   SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  637
              KAK+GG+DVI+TYVFWN HEPSPG YNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C E
Sbjct  65    KKAKDGGLDVIDTYVFWNGHEPSPGIYNFEGRYDLVRFIKTVQEVGLYVHLRIGPYVCAE  124

Query  638   WNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIEN  817
             WNFGGFPVWLK+VPGISFR DN PFK AM+GFT KIV +MK H  F SQGGPIILSQIEN
Sbjct  125   WNFGGFPVWLKYVPGISFRTDNGPFKDAMQGFTYKIVQMMKDHQFFASQGGPIILSQIEN  184

Query  818   EYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPN  997
             E+GP  K  G+S H YV WA KMAV ++TGVPWVMCKE+DAPDP+INTCNGFYCD F PN
Sbjct  185   EFGPILK--GSSDHSYVNWAVKMAVGLNTGVPWVMCKEDDAPDPIINTCNGFYCDHFTPN  242

Query  998   KPYKPAIWT  1024
             KPYKP +WT
Sbjct  243   KPYKPTMWT  251



>ref|XP_010932916.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=845

 Score =   411 bits (1056),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = +2

Query  338   TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  517
              QC V+YDRKAI+ING+RR+L SGSIHYPRSTP+MWE L+ KA++GG+DVI+TYVFWN H
Sbjct  20    AQCGVTYDRKAIIINGRRRILISGSIHYPRSTPDMWEGLVQKARDGGLDVIQTYVFWNGH  79

Query  518   EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  697
             EPSPGNYNFEGRYDLVRF+KT  K G+Y HLRIGPY+CGEWNFGGFPVWLK+VPGISFR 
Sbjct  80    EPSPGNYNFEGRYDLVRFIKTAHKVGMYVHLRIGPYVCGEWNFGGFPVWLKYVPGISFRT  139

Query  698   DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWA  877
             DNEPFK+AM+GFT+KIV +MKS +LF SQGGPIILSQIENEYGP++K   A+GH YV WA
Sbjct  140   DNEPFKIAMQGFTQKIVQMMKSESLFASQGGPIILSQIENEYGPESKAFDAAGHAYVNWA  199

Query  878   AKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AKMAV + TGVPWVMCKE+DAPDPVIN CNGFYCD F PNKPYKP +WT
Sbjct  200   AKMAVGLGTGVPWVMCKEDDAPDPVINACNGFYCDAFTPNKPYKPTMWT  248



>ref|XP_002891311.1| hypothetical protein ARALYDRAFT_473836 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67570.1| hypothetical protein ARALYDRAFT_473836 [Arabidopsis lyrata subsp. 
lyrata]
Length=732

 Score =   407 bits (1047),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/248 (74%), Positives = 208/248 (84%), Gaps = 1/248 (0%)
 Frame = +2

Query  284   MRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             + K +  L     + S + QCS V+YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI 
Sbjct  8     LSKILTFLLTTMLIGSSMIQCSSVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIK  67

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DVI+TYVFWN HEPSPG YNFEGRYDLVRF+KTIQ+ GLY HLRIGPY+C EW
Sbjct  68    KAKDGGLDVIDTYVFWNGHEPSPGTYNFEGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEW  127

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+V GISFR DN PFK AM+GFTEKIV +MK H  F SQGGPIILSQIENE
Sbjct  128   NFGGFPVWLKYVDGISFRTDNGPFKAAMQGFTEKIVQMMKEHRFFASQGGPIILSQIENE  187

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             + P+ K LG +GH YV WAAKMAV ++TGVPWVMCKE+DAPDP+IN+CNGFYCD F PNK
Sbjct  188   FEPELKGLGPAGHSYVNWAAKMAVGLNTGVPWVMCKEDDAPDPIINSCNGFYCDYFTPNK  247

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  248   PYKPTMWT  255



>gb|AAL24206.1| At1g45130/F27F5_20 [Arabidopsis thaliana]
Length=732

 Score =   407 bits (1047),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/248 (74%), Positives = 207/248 (83%), Gaps = 1/248 (0%)
 Frame = +2

Query  284   MRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             + K +  L     + S + QCS V+YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI 
Sbjct  8     LSKILTFLLTTMLIGSSVIQCSSVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIK  67

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DVI+TYVFWN HEPSPG YNFEGRYDLVRF+KTIQ+ GLY HLRIGPY+C EW
Sbjct  68    KAKDGGLDVIDTYVFWNGHEPSPGTYNFEGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEW  127

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+V GISFR DN PFK AM+GFTEKIV +MK H  F SQGGPIILSQIENE
Sbjct  128   NFGGFPVWLKYVDGISFRTDNGPFKSAMQGFTEKIVQMMKEHRFFASQGGPIILSQIENE  187

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             + P  K LG +GH YV WAAKMAV ++TGVPWVMCKE+DAPDP+INTCNGFYCD F PNK
Sbjct  188   FEPDLKGLGPAGHSYVNWAAKMAVGLNTGVPWVMCKEDDAPDPIINTCNGFYCDYFTPNK  247

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  248   PYKPTMWT  255



>ref|NP_175127.1| beta-galactosidase 5 [Arabidopsis thaliana]
 sp|Q9MAJ7.1|BGAL5_ARATH RecName: Full=Beta-galactosidase 5; Short=Lactase 5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF69162.1|AC007915_14 F27F5.20 [Arabidopsis thaliana]
 gb|AAL47461.1| At1g45130/F27F5_20 [Arabidopsis thaliana]
 gb|AAM16238.1| At1g45130/F27F5_20 [Arabidopsis thaliana]
 gb|AEE32082.1| beta-galactosidase 5 [Arabidopsis thaliana]
Length=732

 Score =   407 bits (1047),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/248 (74%), Positives = 207/248 (83%), Gaps = 1/248 (0%)
 Frame = +2

Query  284   MRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             + K +  L     + S + QCS V+YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI 
Sbjct  8     LSKILTFLLTTMLIGSSVIQCSSVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIK  67

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DVI+TYVFWN HEPSPG YNFEGRYDLVRF+KTIQ+ GLY HLRIGPY+C EW
Sbjct  68    KAKDGGLDVIDTYVFWNGHEPSPGTYNFEGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEW  127

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+V GISFR DN PFK AM+GFTEKIV +MK H  F SQGGPIILSQIENE
Sbjct  128   NFGGFPVWLKYVDGISFRTDNGPFKSAMQGFTEKIVQMMKEHRFFASQGGPIILSQIENE  187

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             + P  K LG +GH YV WAAKMAV ++TGVPWVMCKE+DAPDP+INTCNGFYCD F PNK
Sbjct  188   FEPDLKGLGPAGHSYVNWAAKMAVGLNTGVPWVMCKEDDAPDPIINTCNGFYCDYFTPNK  247

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  248   PYKPTMWT  255



>emb|CAB64741.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=732

 Score =   407 bits (1046),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/248 (74%), Positives = 207/248 (83%), Gaps = 1/248 (0%)
 Frame = +2

Query  284   MRKWVLVLCMVFFLSSGLTQCS-VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             + K +  L     + S + QCS V+YD+KAIVING RR+L SGSIHYPRSTPEMWEDLI 
Sbjct  8     LSKILTFLLTTMLIGSSVIQCSSVTYDKKAIVINGHRRILLSGSIHYPRSTPEMWEDLIK  67

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DVI+TYVFWN HEPSPG YNFEGRYDLVRF+KTIQ+ GLY HLRIGPY+C EW
Sbjct  68    KAKDGGLDVIDTYVFWNGHEPSPGTYNFEGRYDLVRFIKTIQEVGLYVHLRIGPYVCAEW  127

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+V GISFR DN PFK AM+GFTEKIV +MK H  F SQGGPIILSQIENE
Sbjct  128   NFGGFPVWLKYVDGISFRTDNGPFKSAMQGFTEKIVQMMKEHRFFASQGGPIILSQIENE  187

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             + P  K LG +GH YV WAAKMAV ++TGVPWVMCKE+DAPDP+INTCNGFYCD F PNK
Sbjct  188   FEPDLKGLGPAGHSYVNWAAKMAVGLNTGVPWVMCKEDDAPDPIINTCNGFYCDYFTPNK  247

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  248   PYKPTMWT  255



>gb|EYU32887.1| hypothetical protein MIMGU_mgv1a001295mg [Erythranthe guttata]
Length=845

 Score =   410 bits (1054),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
              C+V+YD KAI+INGQRR+L SGS+HYPRSTP+MWEDLI KAK GG+DVI+TYVFWN HE
Sbjct  26    NCTVTYDNKAILINGQRRILLSGSVHYPRSTPDMWEDLILKAKNGGLDVIDTYVFWNGHE  85

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             PSPGNYNFEGRYDLVRFVKT+QK GL+ +LRIGPY+C EWN+GGFPVWLK+VPGISFR D
Sbjct  86    PSPGNYNFEGRYDLVRFVKTVQKVGLFVNLRIGPYVCAEWNYGGFPVWLKYVPGISFRTD  145

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             NEPFK AM+GFT+KIV +MKS NLFESQGGPIILSQIENEYG Q + LGA+G  Y+ WAA
Sbjct  146   NEPFKAAMQGFTQKIVGMMKSENLFESQGGPIILSQIENEYGSQRRALGAAGDAYMNWAA  205

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             KMAV +DTGVPW+MCK+++APDP+INTCNGFYCD F PNKPYKP +WT
Sbjct  206   KMAVGLDTGVPWIMCKDDNAPDPLINTCNGFYCDAFTPNKPYKPTMWT  253



>ref|XP_008809207.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=852

 Score =   410 bits (1054),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
             QC V+YDRKA+VING RR+L SGSIHYPRSTP+MWE LI KAK+GG+DV++TYVFWN HE
Sbjct  28    QCGVTYDRKAVVINGHRRILISGSIHYPRSTPDMWEGLIQKAKDGGLDVVQTYVFWNGHE  87

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             PSPG+YNF+G YDLVRF+KT+QKAGLY HLRIGPYICGEWNFGGFPVWLK+V GISFR D
Sbjct  88    PSPGSYNFKGSYDLVRFIKTVQKAGLYVHLRIGPYICGEWNFGGFPVWLKYVSGISFRTD  147

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             NEPFK AM+GFT+KIV +MKS +LF SQGGPIILSQIENEYGP++   GA+GH YV WAA
Sbjct  148   NEPFKTAMQGFTQKIVQMMKSESLFASQGGPIILSQIENEYGPESNAFGAAGHAYVNWAA  207

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             KMAV M TGVPWVMCKEEDAPDP+IN CNGFYCD F PNKPYKP +WT
Sbjct  208   KMAVGMGTGVPWVMCKEEDAPDPMINACNGFYCDAFTPNKPYKPTMWT  255



>ref|XP_007017651.1| Beta-galactosidase 5 isoform 1 [Theobroma cacao]
 gb|EOY14876.1| Beta-galactosidase 5 isoform 1 [Theobroma cacao]
Length=760

 Score =   407 bits (1047),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/236 (77%), Positives = 205/236 (87%), Gaps = 5/236 (2%)
 Frame = +2

Query  317   FFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIET  496
               + S L QCS++YD+KAIV     R+L SGSIHYPRSTPEMWEDLI KAK+GG+DVI+T
Sbjct  54    LLVCSKLIQCSITYDKKAIV-----RILISGSIHYPRSTPEMWEDLIKKAKDGGLDVIDT  108

Query  497   YVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFV  676
             YVFWN HE SPGNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPVWLK+V
Sbjct  109   YVFWNGHELSPGNYNFEGRYDLVRFIKTVQKLGLYVHLRIGPYVCAEWNFGGFPVWLKYV  168

Query  677   PGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASG  856
             PGISFR DNEPFK AM+GFT+KIV +MK+  LF SQGGPIILSQIENEYGP+ K LGA+G
Sbjct  169   PGISFRTDNEPFKRAMQGFTQKIVQMMKNEKLFASQGGPIILSQIENEYGPEGKALGAAG  228

Query  857   HQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             H Y+ WAAKMAV +DTGVPWVMCKE+DAPDPVIN CNGFYCD F+PNKPYKP +WT
Sbjct  229   HAYINWAAKMAVGLDTGVPWVMCKEDDAPDPVINACNGFYCDAFSPNKPYKPKMWT  284



>ref|XP_009395554.1| PREDICTED: beta-galactosidase 5 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   410 bits (1053),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  350   VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSP  529
             V+YDRKAI+I+GQRR+L SGSIHYPRSTPEMWE LI KAK+GG+DVI+TYVFWN HEPSP
Sbjct  21    VTYDRKAIIIDGQRRILISGSIHYPRSTPEMWEGLIQKAKDGGLDVIQTYVFWNGHEPSP  80

Query  530   GNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEP  709
             G YNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR DNEP
Sbjct  81    GTYNFEGRYDLVRFIKTVQKVGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEP  140

Query  710   FKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAKMA  889
             FKMAM+GFT+KIV +MKS +LF SQGGPIILSQIENEYGP++K  G++GH YV WAA+MA
Sbjct  141   FKMAMQGFTQKIVQMMKSESLFGSQGGPIILSQIENEYGPESKAFGSAGHSYVNWAAEMA  200

Query  890   VEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             V + TGVPWVMCKE+DAPDPVIN CNGFYCD F PNKPYKP +WT
Sbjct  201   VGLKTGVPWVMCKEDDAPDPVINACNGFYCDSFTPNKPYKPTMWT  245



>ref|XP_004500970.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Cicer arietinum]
Length=627

 Score =   403 bits (1036),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 205/231 (89%), Gaps = 0/231 (0%)
 Frame = +2

Query  332   GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWN  511
             G    +VSYDRK+++ING RR+L SGSIHYPRSTP+MWEDLI KAK GG+DVI+TYVFW+
Sbjct  20    GCNCSNVSYDRKSLLINGHRRILISGSIHYPRSTPQMWEDLIWKAKHGGLDVIDTYVFWD  79

Query  512   VHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISF  691
             VHEPSPGNYNFEGRYDLVRF+KT+QK GLYA+LRIGPY+C EWNFGG PVWLK+VPGISF
Sbjct  80    VHEPSPGNYNFEGRYDLVRFIKTVQKVGLYANLRIGPYVCAEWNFGGIPVWLKYVPGISF  139

Query  692   RADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVT  871
             R DN PFK AM+GFT+KIV +MKS  LF+SQGGPIILSQIENEYGP+ + +GA+GH Y+ 
Sbjct  140   RTDNGPFKAAMQGFTQKIVQMMKSEKLFQSQGGPIILSQIENEYGPERRAMGAAGHAYLN  199

Query  872   WAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             WAA MAV + TGVPWVMCKE DAPDPVIN+CNGFYCD F+PNKP+KP++WT
Sbjct  200   WAANMAVGLGTGVPWVMCKENDAPDPVINSCNGFYCDNFSPNKPFKPSLWT  250



>ref|XP_003523710.1| PREDICTED: beta-galactosidase 3-like isoform 1 [Glycine max]
Length=736

 Score =   406 bits (1043),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 209/232 (90%), Gaps = 2/232 (1%)
 Frame = +2

Query  329   SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFW  508
             S LT C+V+YDRK+++INGQRR+L SGSIHYPRSTPEMWEDLI KAK GG+DVI+TYVFW
Sbjct  23    SELTHCNVTYDRKSLLINGQRRILISGSIHYPRSTPEMWEDLIWKAKHGGLDVIDTYVFW  82

Query  509   NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGIS  688
             +VHEPSPGNY+FEGRYDLVRF+KT+QK GLYA+LRIGPY+C EWNFGG PVWLK+VPG+S
Sbjct  83    DVHEPSPGNYDFEGRYDLVRFIKTVQKVGLYANLRIGPYVCAEWNFGGIPVWLKYVPGVS  142

Query  689   FRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYV  868
             FR DNEPFK AM+GFT+KIV +MKS  LF+SQGGPIILSQIENEYGP+++  GA+G  YV
Sbjct  143   FRTDNEPFKAAMQGFTQKIVQMMKSEKLFQSQGGPIILSQIENEYGPESR--GAAGRAYV  200

Query  869   TWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              WAA MAV + TGVPWVMCKE DAPDPVIN+CNGFYCD F+PNKPYKP++WT
Sbjct  201   NWAASMAVGLGTGVPWVMCKENDAPDPVINSCNGFYCDDFSPNKPYKPSMWT  252



>gb|KHN45883.1| Beta-galactosidase 5 [Glycine soja]
Length=727

 Score =   405 bits (1042),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 209/232 (90%), Gaps = 2/232 (1%)
 Frame = +2

Query  329   SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFW  508
             S LT C+V+YDRK+++INGQRR+L SGSIHYPRSTPEMWEDLI KAK GG+DVI+TYVFW
Sbjct  23    SELTHCNVTYDRKSLLINGQRRILISGSIHYPRSTPEMWEDLIWKAKHGGLDVIDTYVFW  82

Query  509   NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGIS  688
             +VHEPSPGNY+FEGRYDLVRF+KT+QK GLYA+LRIGPY+C EWNFGG PVWLK+VPG+S
Sbjct  83    DVHEPSPGNYDFEGRYDLVRFIKTVQKVGLYANLRIGPYVCAEWNFGGIPVWLKYVPGVS  142

Query  689   FRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYV  868
             FR DNEPFK AM+GFT+KIV +MKS  LF+SQGGPIILSQIENEYGP+++  GA+G  YV
Sbjct  143   FRTDNEPFKAAMQGFTQKIVQMMKSEKLFQSQGGPIILSQIENEYGPESR--GAAGRAYV  200

Query  869   TWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              WAA MAV + TGVPWVMCKE DAPDPVIN+CNGFYCD F+PNKPYKP++WT
Sbjct  201   NWAASMAVGLGTGVPWVMCKENDAPDPVINSCNGFYCDDFSPNKPYKPSMWT  252



>ref|XP_010679814.1| PREDICTED: beta-galactosidase 3 [Beta vulgaris subsp. vulgaris]
Length=853

 Score =   409 bits (1050),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 181/247 (73%), Positives = 208/247 (84%), Gaps = 0/247 (0%)
 Frame = +2

Query  284   MRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISK  463
             M+  +L   ++ FL+    QCSVSYDRKA++I+GQRR+L SGSIHYPRSTP+MWEDLI K
Sbjct  1     MKSLMLFWVLMLFLNCKFMQCSVSYDRKALLIDGQRRILMSGSIHYPRSTPDMWEDLIMK  60

Query  464   AKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWN  643
             AK GG+D I+TYVFWNVHEPSPGNYNFEGRYD+V+F+K IQKAGLYAHLRIGPY+C EWN
Sbjct  61    AKNGGLDAIDTYVFWNVHEPSPGNYNFEGRYDIVKFLKIIQKAGLYAHLRIGPYVCAEWN  120

Query  644   FGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEY  823
             FGGFPVWLK+VPGISFR DNEPFK  M+ FTEKIVNL+KSHNLFESQGGPIIL+Q+ENEY
Sbjct  121   FGGFPVWLKYVPGISFRTDNEPFKREMQRFTEKIVNLLKSHNLFESQGGPIILAQVENEY  180

Query  824   GPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKP  1003
             G     LG  G+ Y+TWAAKM   + TGVPW MCK+ D PDP+INTCNGFYCD F PNK 
Sbjct  181   GRLRMRLGREGNNYMTWAAKMVTSLQTGVPWTMCKDGDTPDPLINTCNGFYCDNFTPNKG  240

Query  1004  YKPAIWT  1024
             YKP +WT
Sbjct  241   YKPKLWT  247



>ref|XP_008643999.1| PREDICTED: uncharacterized protein LOC100382452 isoform X1 [Zea 
mays]
 tpg|DAA43552.1| TPA: hypothetical protein ZEAMMB73_935084 [Zea mays]
Length=845

 Score =   408 bits (1048),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 203/224 (91%), Gaps = 0/224 (0%)
 Frame = +2

Query  353   SYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSPG  532
             +YD+KA++I+GQRR+LFSGSIHYPRSTP+MWE LI KAK+GG+DVI+TYVFWN HEP+PG
Sbjct  30    TYDKKAVLIDGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNGHEPTPG  89

Query  533   NYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEPF  712
             NY FE RYDLVRFVKT+QKAGL+ HLRIGPYICGEWNFGGFPVWLK+VPGISFR DNEPF
Sbjct  90    NYYFEERYDLVRFVKTVQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPF  149

Query  713   KMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAKMAV  892
             K AM+GFTEKIV +MKS NLF SQGGPIILSQIENEYGP+ K  GA+G  Y+ WAAKMAV
Sbjct  150   KTAMQGFTEKIVGMMKSENLFASQGGPIILSQIENEYGPEGKEFGAAGQAYINWAAKMAV  209

Query  893   EMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              +DTGVPWVMCKEEDAPDPVIN CNGFYCD F+PNKPYKP +WT
Sbjct  210   GLDTGVPWVMCKEEDAPDPVINACNGFYCDAFSPNKPYKPTMWT  253



>emb|CDY36028.1| BnaA08g04330D [Brassica napus]
Length=712

 Score =   404 bits (1038),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 180/236 (76%), Positives = 203/236 (86%), Gaps = 2/236 (1%)
 Frame = +2

Query  317   FFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIET  496
               + S + QCSV+YD+KAIV+NG RR+L SGSIHYPRSTPEMWEDLI KAK+GG+DVI+T
Sbjct  1     MLIGSSIIQCSVTYDKKAIVVNGHRRILLSGSIHYPRSTPEMWEDLIKKAKDGGLDVIDT  60

Query  497   YVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFV  676
             YVFWN HEPSPG YNFEGRYDLVRF+KT+Q+ GLY HLRIGPY+C EWNFGGFPVWLK+V
Sbjct  61    YVFWNGHEPSPGIYNFEGRYDLVRFIKTVQEVGLYVHLRIGPYVCAEWNFGGFPVWLKYV  120

Query  677   PGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASG  856
             PGISFR DN PFK AM+GFT KIV +MK H  F SQGGPIILSQIENE+GP  K  G+S 
Sbjct  121   PGISFRTDNGPFKDAMQGFTHKIVQMMKDHQFFASQGGPIILSQIENEFGPILK--GSSD  178

Query  857   HQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             H YV WAAKMAV ++TGVPWVMCKE+DAPDP+INTCNGFYCD F PNKPYKP +WT
Sbjct  179   HSYVNWAAKMAVGLNTGVPWVMCKEDDAPDPIINTCNGFYCDYFTPNKPYKPTMWT  234



>gb|EEE58382.1| hypothetical protein OsJ_09539 [Oryza sativa Japonica Group]
Length=851

 Score =   408 bits (1048),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 208/238 (87%), Gaps = 10/238 (4%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
              C+V+YD+KA++++GQRR+LFSGSIHYPRSTPEMW+ LI KAK+GG+DVI+TYVFWN HE
Sbjct  24    HCAVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHE  83

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             P+PGNYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPVWLK+VPGISFR D
Sbjct  84    PTPGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTD  143

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ----------IENEYGPQAKVLGA  850
             NEPFK AM+GFTEKIV +MKS NLF SQGGPIILSQ          IENEYGP+ K  GA
Sbjct  144   NEPFKNAMQGFTEKIVGMMKSENLFASQGGPIILSQASAKLCFPCHIENEYGPEGKEFGA  203

Query  851   SGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             +G  Y+ WAAKMAV +DTGVPWVMCKE+DAPDPVIN CNGFYCD F+PNKPYKP +WT
Sbjct  204   AGKAYINWAAKMAVGLDTGVPWVMCKEDDAPDPVINACNGFYCDTFSPNKPYKPTMWT  261



>gb|EEC74580.1| hypothetical protein OsI_10152 [Oryza sativa Indica Group]
Length=851

 Score =   408 bits (1048),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 208/238 (87%), Gaps = 10/238 (4%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
              C+V+YD+KA++++GQRR+LFSGSIHYPRSTPEMW+ LI KAK+GG+DVI+TYVFWN HE
Sbjct  24    HCAVTYDKKAVLVDGQRRILFSGSIHYPRSTPEMWDGLIEKAKDGGLDVIQTYVFWNGHE  83

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             P+PGNYNFEGRYDLVRF+KT+QKAG++ HLRIGPYICGEWNFGGFPVWLK+VPGISFR D
Sbjct  84    PTPGNYNFEGRYDLVRFIKTVQKAGMFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTD  143

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ----------IENEYGPQAKVLGA  850
             NEPFK AM+GFTEKIV +MKS NLF SQGGPIILSQ          IENEYGP+ K  GA
Sbjct  144   NEPFKNAMQGFTEKIVGMMKSENLFASQGGPIILSQASAKLCFPCHIENEYGPEGKEFGA  203

Query  851   SGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             +G  Y+ WAAKMAV +DTGVPWVMCKE+DAPDPVIN CNGFYCD F+PNKPYKP +WT
Sbjct  204   AGKAYINWAAKMAVGLDTGVPWVMCKEDDAPDPVINACNGFYCDTFSPNKPYKPTMWT  261



>dbj|BAJ96054.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score =   405 bits (1041),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 201/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  347   SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPS  526
             +V+YDRKA++INGQRR+LFSGSIHYPRSTPEMWE LI KAK+GG+DVI+TYVFWN HEP+
Sbjct  31    AVTYDRKAVLINGQRRILFSGSIHYPRSTPEMWEGLIQKAKDGGLDVIQTYVFWNGHEPT  90

Query  527   PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNE  706
             PG+YNFEGRYDLV+F+KT QKAGL+ HLRIGPYICGEWNFGGFPVWLK+VPGISFR DNE
Sbjct  91    PGSYNFEGRYDLVKFIKTAQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  150

Query  707   PFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAKM  886
             PFK AM+GFTEKIV +MKS  LF SQGGPIILSQIENEYGP+ K  GA+G  Y  WAAKM
Sbjct  151   PFKAAMQGFTEKIVGMMKSEELFASQGGPIILSQIENEYGPEEKEFGAAGKSYSDWAAKM  210

Query  887   AVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AV +DTGVPWVMCK+EDAPDPVIN CNGFYCD F PN P KP +WT
Sbjct  211   AVGLDTGVPWVMCKQEDAPDPVINACNGFYCDAFTPNTPSKPTMWT  256



>ref|XP_004500969.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Cicer arietinum]
Length=732

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 205/231 (89%), Gaps = 0/231 (0%)
 Frame = +2

Query  332   GLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWN  511
             G    +VSYDRK+++ING RR+L SGSIHYPRSTP+MWEDLI KAK GG+DVI+TYVFW+
Sbjct  20    GCNCSNVSYDRKSLLINGHRRILISGSIHYPRSTPQMWEDLIWKAKHGGLDVIDTYVFWD  79

Query  512   VHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISF  691
             VHEPSPGNYNFEGRYDLVRF+KT+QK GLYA+LRIGPY+C EWNFGG PVWLK+VPGISF
Sbjct  80    VHEPSPGNYNFEGRYDLVRFIKTVQKVGLYANLRIGPYVCAEWNFGGIPVWLKYVPGISF  139

Query  692   RADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVT  871
             R DN PFK AM+GFT+KIV +MKS  LF+SQGGPIILSQIENEYGP+ + +GA+GH Y+ 
Sbjct  140   RTDNGPFKAAMQGFTQKIVQMMKSEKLFQSQGGPIILSQIENEYGPERRAMGAAGHAYLN  199

Query  872   WAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             WAA MAV + TGVPWVMCKE DAPDPVIN+CNGFYCD F+PNKP+KP++WT
Sbjct  200   WAANMAVGLGTGVPWVMCKENDAPDPVINSCNGFYCDNFSPNKPFKPSLWT  250



>dbj|BAK07157.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score =   405 bits (1040),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 201/226 (89%), Gaps = 0/226 (0%)
 Frame = +2

Query  347   SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPS  526
             +V+YDRKA++INGQRR+LFSGSIHYPRSTPEMWE LI KAK+GG+DVI+TYVFWN HEP+
Sbjct  31    AVTYDRKAVLINGQRRILFSGSIHYPRSTPEMWEGLIQKAKDGGLDVIQTYVFWNGHEPT  90

Query  527   PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNE  706
             PG+YNFEGRYDLV+F+KT QKAGL+ HLRIGPYICGEWNFGGFPVWLK+VPGISFR DNE
Sbjct  91    PGSYNFEGRYDLVKFIKTAQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  150

Query  707   PFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAKM  886
             PFK AM+GFTEKIV +MKS  LF SQGGPIILSQIENEYGP+ K  GA+G  Y  WAAKM
Sbjct  151   PFKAAMQGFTEKIVGMMKSEELFASQGGPIILSQIENEYGPEEKEFGAAGKSYSDWAAKM  210

Query  887   AVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AV +DTGVPWVMCK+EDAPDPVIN CNGFYCD F PN P KP +WT
Sbjct  211   AVGLDTGVPWVMCKQEDAPDPVINACNGFYCDAFTPNTPSKPTMWT  256



>emb|CDP07463.1| unnamed protein product [Coffea canephora]
Length=850

 Score =   405 bits (1040),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 175/243 (72%), Positives = 205/243 (84%), Gaps = 0/243 (0%)
 Frame = +2

Query  296   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  475
             +    +   + + L QCSV+YD++AI+ING RR+L SGSIHYPRSTPEMWEDL+ KAK  
Sbjct  11    IFFFSIALLMGAQLIQCSVTYDKRAIIINGHRRILLSGSIHYPRSTPEMWEDLVIKAKNA  70

Query  476   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  655
             G+DVI+TYVFWN+HEP+ GNYNFEGRYDLVRF+KT+QK GLY HLRIGPY+C EWNFGGF
Sbjct  71    GLDVIDTYVFWNIHEPTQGNYNFEGRYDLVRFLKTVQKVGLYVHLRIGPYVCAEWNFGGF  130

Query  656   PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQA  835
             PVWLK+VPGISFR DNEPFK+AM+ F++KIV  MKS  LFESQGGPIILSQIENEYG   
Sbjct  131   PVWLKYVPGISFRTDNEPFKVAMQKFSQKIVGTMKSEGLFESQGGPIILSQIENEYGTTE  190

Query  836   KVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPA  1015
             K LGA+G  Y+ WAA MA+ +DTGVPWVMCK++DAPDP+IN CNGFYCD F PNKPYKP 
Sbjct  191   KRLGAAGSAYLKWAAGMAIGLDTGVPWVMCKQDDAPDPIINACNGFYCDTFLPNKPYKPT  250

Query  1016  IWT  1024
             +WT
Sbjct  251   MWT  253



>ref|XP_002465807.1| hypothetical protein SORBIDRAFT_01g046160 [Sorghum bicolor]
 gb|EER92805.1| hypothetical protein SORBIDRAFT_01g046160 [Sorghum bicolor]
Length=842

 Score =   404 bits (1038),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 202/224 (90%), Gaps = 0/224 (0%)
 Frame = +2

Query  353   SYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSPG  532
             +YD+KA++I+GQRR+LFSGSIHYPRSTP+MWE LI KAK+GG+DVI+TYVFWN HEP+PG
Sbjct  28    TYDKKAVLIDGQRRILFSGSIHYPRSTPDMWEGLIQKAKDGGLDVIQTYVFWNGHEPTPG  87

Query  533   NYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEPF  712
             NY FE RYDLVRF+KT+QKAGL+ HLRIGPYICGEWNFGGFPVWLK+VPGISFR DNEPF
Sbjct  88    NYYFEERYDLVRFIKTVQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPF  147

Query  713   KMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAKMAV  892
             K AM+GFTEKIV +MKS  LF SQGGPIILSQIENEYGP+ K LGA+G  Y+ WAAKMA+
Sbjct  148   KTAMQGFTEKIVGMMKSEKLFASQGGPIILSQIENEYGPEGKELGAAGQAYINWAAKMAI  207

Query  893   EMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              + TGVPWVMCKEEDAPDPVIN CNGFYCD F+PNKPYKP +WT
Sbjct  208   GLGTGVPWVMCKEEDAPDPVINACNGFYCDAFSPNKPYKPTMWT  251



>ref|XP_004985588.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Setaria italica]
Length=841

 Score =   403 bits (1035),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 202/224 (90%), Gaps = 0/224 (0%)
 Frame = +2

Query  353   SYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSPG  532
             +YD+KA++I+GQRR+LFSGSIHYPRSTP+MWE+LI KAK+GG+DVI+TYVFWN HEP+PG
Sbjct  28    TYDKKAVLIDGQRRILFSGSIHYPRSTPDMWEELIQKAKDGGLDVIQTYVFWNGHEPTPG  87

Query  533   NYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEPF  712
             NY FE RYDLVRFVKT+QKAGL+ HLRIGPYICGEWNFGGFPVWLK+VPGISFR DNEPF
Sbjct  88    NYYFEERYDLVRFVKTVQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNEPF  147

Query  713   KMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAKMAV  892
             K AM+GFTEKIV +MKS  LF SQGGPIILSQIENEYGP+ K  GA+G  Y+ WAAKMAV
Sbjct  148   KTAMQGFTEKIVGMMKSEKLFASQGGPIILSQIENEYGPEGKEFGAAGQSYINWAAKMAV  207

Query  893   EMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              + TGVPWVMCKE+DAPDPVIN CNGFYCD F+PNKPYKP +WT
Sbjct  208   GLGTGVPWVMCKEDDAPDPVINACNGFYCDAFSPNKPYKPMMWT  251



>ref|XP_010107841.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC17241.1| Beta-galactosidase 3 [Morus notabilis]
Length=860

 Score =   403 bits (1036),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = +2

Query  338   TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVH  517
             TQC+V YDRKA+VIN QR++ FSGSIHYPRSTP+MW  L+ KAK+GG+DVI+TYVFWN+H
Sbjct  25    TQCNVGYDRKALVINAQRKLFFSGSIHYPRSTPQMWAGLVQKAKDGGLDVIDTYVFWNLH  84

Query  518   EPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRA  697
             EPSPGNYNFEGR DLV F+KT+Q+AGLY HLRIGPYIC EWNFGGFPVWLK+VPGISFR 
Sbjct  85    EPSPGNYNFEGRNDLVGFIKTVQRAGLYVHLRIGPYICSEWNFGGFPVWLKYVPGISFRT  144

Query  698   DNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWA  877
             DN PFK AM+ FT+KIV +MK   LF+SQGGPIILSQIENEY P++K  GA+G+ Y+TWA
Sbjct  145   DNGPFKSAMQKFTQKIVQMMKDEKLFQSQGGPIILSQIENEYEPESKAFGAAGYAYMTWA  204

Query  878   AKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AKMAVEM TGVPWVMCKE DAPDPVIN+CNGFYCD F+PNKPYKP IWT
Sbjct  205   AKMAVEMGTGVPWVMCKENDAPDPVINSCNGFYCDYFSPNKPYKPTIWT  253



>ref|XP_002512959.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF49462.1| beta-galactosidase, putative [Ricinus communis]
Length=732

 Score =   399 bits (1025),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 177/252 (70%), Positives = 216/252 (86%), Gaps = 0/252 (0%)
 Frame = +2

Query  269   LRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWE  448
             + G +  KW+ +  ++  LSS + +C+V+YD+KA++INGQ+R+LFSGSIHYPRSTP+MWE
Sbjct  1     MEGNSATKWLSLCVVLLSLSSQIIECNVTYDKKALIINGQKRILFSGSIHYPRSTPQMWE  60

Query  449   DLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYI  628
              LI KAK+GG+DVI+TYVFWN+HEPSPGNYNFEGR DLV+F+K + KAGLY HLRIGPYI
Sbjct  61    GLIQKAKDGGLDVIDTYVFWNLHEPSPGNYNFEGRNDLVQFIKLVHKAGLYVHLRIGPYI  120

Query  629   CGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQ  808
             CGEWNFGGFPVWLK++PG+ FR DNEPFK+ M+ FT+KIV +MK   L+ESQGGPIILSQ
Sbjct  121   CGEWNFGGFPVWLKYIPGMIFRTDNEPFKLQMQKFTQKIVQMMKDEQLYESQGGPIILSQ  180

Query  809   IENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKF  988
             IENEY P+ K  GA+GH Y+TWAA MAV ++TGVPWVMCKE DAPDPV+NTCNGFYCD F
Sbjct  181   IENEYEPEDKAFGAAGHAYMTWAAHMAVSLNTGVPWVMCKEFDAPDPVVNTCNGFYCDYF  240

Query  989   APNKPYKPAIWT  1024
             +PNK YKP +WT
Sbjct  241   SPNKAYKPTMWT  252



>gb|ABR16628.1| unknown [Picea sitchensis]
Length=836

 Score =   402 bits (1032),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 178/244 (73%), Positives = 207/244 (85%), Gaps = 0/244 (0%)
 Frame = +2

Query  293   WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  472
             W   L +   L+ G  +C V+YD KA+VING+RR+L SGSIHYPRST EMW DL  KAK+
Sbjct  6     WFAFLVLSVMLAVGGVECGVTYDHKALVINGERRILISGSIHYPRSTAEMWPDLFRKAKD  65

Query  473   GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  652
             GG+DVI+TYVFWN+HEPSPGNYNFEGR+DLV+FVK  Q+AGLY HLRIGPY+C EWNFGG
Sbjct  66    GGLDVIQTYVFWNMHEPSPGNYNFEGRFDLVKFVKLAQEAGLYVHLRIGPYVCAEWNFGG  125

Query  653   FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQ  832
             FPVWLK+VPGISFR DNEPFK AM+GFT+K+V+LMKS  LFESQGGPIIL+Q+ENEY P+
Sbjct  126   FPVWLKYVPGISFRTDNEPFKNAMEGFTKKVVDLMKSEGLFESQGGPIILAQVENEYKPE  185

Query  833   AKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKP  1012
                 G +G QY+ WAA+MAV MDTGVPWVMCK++DAPDPVINTCNGFYCD F PNKPYKP
Sbjct  186   EMEYGLAGAQYMNWAAQMAVGMDTGVPWVMCKQDDAPDPVINTCNGFYCDNFVPNKPYKP  245

Query  1013  AIWT  1024
              +WT
Sbjct  246   TMWT  249



>gb|EMT10014.1| Beta-galactosidase 5 [Aegilops tauschii]
Length=851

 Score =   397 bits (1021),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 200/229 (87%), Gaps = 3/229 (1%)
 Frame = +2

Query  347   SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPS  526
             +V+YDRKA++I+G+RR+LFSGSIHYPRST EMWE LI KAK+GG+DVI+TYVFWN HEP+
Sbjct  32    AVTYDRKAVLISGERRILFSGSIHYPRSTQEMWEGLIQKAKDGGLDVIQTYVFWNGHEPT  91

Query  527   PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNE  706
             PGNYNFEGRYDLVRF+KT QKAGL+ HLRIGPYICGEWNFGGFPVWLK+VPGISFR DNE
Sbjct  92    PGNYNFEGRYDLVRFIKTAQKAGLFVHLRIGPYICGEWNFGGFPVWLKYVPGISFRTDNE  151

Query  707   PFKMAMKGFTEKIVNLMKSHNLFESQGGPIILS---QIENEYGPQAKVLGASGHQYVTWA  877
             PFK AM+GFTEKIV +MKS  LF SQGGPIILS   QIENEYGP+ K  GA+G  Y  WA
Sbjct  152   PFKAAMQGFTEKIVGMMKSEELFASQGGPIILSQAMQIENEYGPEEKEFGAAGKSYSDWA  211

Query  878   AKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AKMAV +DTGVPWVMCK+EDAPDPVIN CNGFYCD F PN P KP +WT
Sbjct  212   AKMAVGLDTGVPWVMCKQEDAPDPVINACNGFYCDAFTPNSPSKPTMWT  260



>gb|AHL69742.1| beta-galactosidase [Hylocereus undatus]
Length=835

 Score =   396 bits (1018),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 174/243 (72%), Positives = 207/243 (85%), Gaps = 3/243 (1%)
 Frame = +2

Query  296   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  475
             ++++C+ F L       SV YD+K IV+NGQR++L SGSIHYPRSTP+MWEDLI+KAK G
Sbjct  11    IILVCVSFVLG---VHSSVIYDKKGIVVNGQRKILISGSIHYPRSTPDMWEDLITKAKHG  67

Query  476   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  655
             G+DVI+TYVFWN HEPSPG Y FEGRYDLVRF+KT+Q+ GLY +LRIGPY+C EWNFGGF
Sbjct  68    GLDVIDTYVFWNGHEPSPGKYYFEGRYDLVRFIKTVQRVGLYVNLRIGPYVCAEWNFGGF  127

Query  656   PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQA  835
             PVWLK+VPGISFR DNEPFK AM+GFT+KIV +MK+  LF SQGGPIILSQIENEYG + 
Sbjct  128   PVWLKYVPGISFRTDNEPFKRAMQGFTQKIVQMMKNERLFASQGGPIILSQIENEYGSEE  187

Query  836   KVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPA  1015
             +  GA+G+ Y+ WAAKMAV +D GVPW+MCK++DAPDPVINTCNGFYCD F PNKPYKP 
Sbjct  188   RAYGAAGYSYMNWAAKMAVGLDIGVPWLMCKQDDAPDPVINTCNGFYCDAFRPNKPYKPM  247

Query  1016  IWT  1024
             +WT
Sbjct  248   MWT  250



>ref|XP_009418405.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   396 bits (1018),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 174/230 (76%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = +2

Query  335   LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  514
             + QC V+YDRKAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+  +DVI+TYVFWN 
Sbjct  21    VAQCGVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEGLIQKAKDAHLDVIQTYVFWNG  80

Query  515   HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  694
             HEPSPG Y+FEGRYDLV+F+KT+Q  GLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  81    HEPSPGTYDFEGRYDLVKFIKTVQNLGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  140

Query  695   ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTW  874
              DNEPFKMAM+GFT+KIV ++KS +LF SQGGPIILSQIENEYGP ++  G  G  Y+ W
Sbjct  141   TDNEPFKMAMQGFTQKIVQMLKSESLFASQGGPIILSQIENEYGPVSRASGPPGRSYLNW  200

Query  875   AAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AA+MAV ++TGVPWVMCKE+DAPDPVINTCNGFYCD F PN PYKP +WT
Sbjct  201   AAEMAVGLETGVPWVMCKEDDAPDPVINTCNGFYCDTFTPNMPYKPIMWT  250



>ref|XP_009418404.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=860

 Score =   396 bits (1018),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 174/230 (76%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = +2

Query  335   LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  514
             + QC V+YDRKAI+INGQRR+L SGSIHYPRSTPEMWE LI KAK+  +DVI+TYVFWN 
Sbjct  21    VAQCGVTYDRKAIIINGQRRILISGSIHYPRSTPEMWEGLIQKAKDAHLDVIQTYVFWNG  80

Query  515   HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  694
             HEPSPG Y+FEGRYDLV+F+KT+Q  GLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR
Sbjct  81    HEPSPGTYDFEGRYDLVKFIKTVQNLGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFR  140

Query  695   ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTW  874
              DNEPFKMAM+GFT+KIV ++KS +LF SQGGPIILSQIENEYGP ++  G  G  Y+ W
Sbjct  141   TDNEPFKMAMQGFTQKIVQMLKSESLFASQGGPIILSQIENEYGPVSRASGPPGRSYLNW  200

Query  875   AAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AA+MAV ++TGVPWVMCKE+DAPDPVINTCNGFYCD F PN PYKP +WT
Sbjct  201   AAEMAVGLETGVPWVMCKEDDAPDPVINTCNGFYCDTFTPNMPYKPIMWT  250



>gb|KCW69753.1| hypothetical protein EUGRSUZ_F031302, partial [Eucalyptus grandis]
Length=518

 Score =   384 bits (987),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/246 (72%), Positives = 200/246 (81%), Gaps = 4/246 (2%)
 Frame = +2

Query  299   LVLCMVFFLSSGL----TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  466
             LVL  V  LS G+       SVSYD KAIVINGQRR+L SGSIHYPRSTPEMW DLI KA
Sbjct  5     LVLWNVLGLSLGVCVFSVLASVSYDSKAIVINGQRRILISGSIHYPRSTPEMWPDLIEKA  64

Query  467   KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  646
             KEGG+DVI+TYVFWN HEPSPG Y FEG YDLV+F+K  ++AGLY HLRIGPY+C EWNF
Sbjct  65    KEGGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLAKQAGLYVHLRIGPYVCAEWNF  124

Query  647   GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYG  826
             GGFPVWLK++PGI+FR DNEPFK  M+ F  KIVN+MK+  LFESQGGPIILSQIENEYG
Sbjct  125   GGFPVWLKYIPGINFRTDNEPFKYQMQKFATKIVNMMKAERLFESQGGPIILSQIENEYG  184

Query  827   PQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPY  1006
             P    +GA G  Y  WAAKMA+ +D GVPWVMCK++DAPDP+INTCNGFYCD F+PNK Y
Sbjct  185   PMEYEIGAPGQVYTQWAAKMALNLDIGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAY  244

Query  1007  KPAIWT  1024
             KP +WT
Sbjct  245   KPTMWT  250



>gb|KDP40776.1| hypothetical protein JCGZ_24775 [Jatropha curcas]
Length=530

 Score =   384 bits (986),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 194/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  344   CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEP  523
              SVSYD +AI INGQRR+L SGSIHYPRS+PEMW DLI KAKEGG+DVI+TYVFWN HEP
Sbjct  32    ASVSYDSRAITINGQRRILISGSIHYPRSSPEMWPDLIQKAKEGGLDVIQTYVFWNGHEP  91

Query  524   SPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADN  703
             SPG Y FEG YDLV+F+K +++AGLYAHLRIGPY+C EWNFGGFPVWLK++PGI+FR DN
Sbjct  92    SPGKYYFEGNYDLVKFIKLVKQAGLYAHLRIGPYVCAEWNFGGFPVWLKYIPGINFRTDN  151

Query  704   EPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAK  883
              PFK  M+ FT KIVN+MK+  LFESQGGPIILSQIENEYGP    LGA G  Y  WAAK
Sbjct  152   GPFKAEMQKFTTKIVNMMKAEGLFESQGGPIILSQIENEYGPMEYELGAPGKAYSNWAAK  211

Query  884   MAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             MAV + TGVPWVMCK++DAPDPVINTCNGFYCD F+PNKPYKP +WT
Sbjct  212   MAVGLGTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKPYKPKMWT  258



>gb|KCW69752.1| hypothetical protein EUGRSUZ_F031302 [Eucalyptus grandis]
Length=546

 Score =   384 bits (986),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 177/246 (72%), Positives = 200/246 (81%), Gaps = 4/246 (2%)
 Frame = +2

Query  299   LVLCMVFFLSSGL----TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  466
             LVL  V  LS G+       SVSYD KAIVINGQRR+L SGSIHYPRSTPEMW DLI KA
Sbjct  5     LVLWNVLGLSLGVCVFSVLASVSYDSKAIVINGQRRILISGSIHYPRSTPEMWPDLIEKA  64

Query  467   KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  646
             KEGG+DVI+TYVFWN HEPSPG Y FEG YDLV+F+K  ++AGLY HLRIGPY+C EWNF
Sbjct  65    KEGGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLAKQAGLYVHLRIGPYVCAEWNF  124

Query  647   GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYG  826
             GGFPVWLK++PGI+FR DNEPFK  M+ F  KIVN+MK+  LFESQGGPIILSQIENEYG
Sbjct  125   GGFPVWLKYIPGINFRTDNEPFKYQMQKFATKIVNMMKAERLFESQGGPIILSQIENEYG  184

Query  827   PQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPY  1006
             P    +GA G  Y  WAAKMA+ +D GVPWVMCK++DAPDP+INTCNGFYCD F+PNK Y
Sbjct  185   PMEYEIGAPGQVYTQWAAKMALNLDIGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAY  244

Query  1007  KPAIWT  1024
             KP +WT
Sbjct  245   KPTMWT  250



>gb|KCW68186.1| hypothetical protein EUGRSUZ_F01855 [Eucalyptus grandis]
Length=692

 Score =   389 bits (998),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 192/213 (90%), Gaps = 0/213 (0%)
 Frame = +2

Query  386   QRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLV  565
             QRR+L SGSIHYPRSTP+MWEDLI KAK+GG+DVIETYVFWN HEPSPG YNF+ RYDLV
Sbjct  3     QRRILISGSIHYPRSTPDMWEDLIQKAKDGGLDVIETYVFWNGHEPSPGKYNFDERYDLV  62

Query  566   RFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKI  745
             RF+KT+QK GLYAHLRIGPY+C EWNFGGFPVWLK+VPGISFR DNEPFK AM+GFT+KI
Sbjct  63    RFIKTVQKVGLYAHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNEPFKAAMQGFTQKI  122

Query  746   VNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMC  925
             V +MK   LF SQGGPIILSQIENEYGP++K L A+GH Y+ WAA+MAV +DTGVPWVMC
Sbjct  123   VQMMKDEQLFASQGGPIILSQIENEYGPESKALRAAGHAYINWAAEMAVGLDTGVPWVMC  182

Query  926   KEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             KE+DAPDPVINTCNGFYCD F+PN+PYKP +WT
Sbjct  183   KEDDAPDPVINTCNGFYCDAFSPNRPYKPTMWT  215



>gb|KJB65165.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
 gb|KJB65168.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=634

 Score =   387 bits (993),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 174/244 (71%), Positives = 204/244 (84%), Gaps = 4/244 (2%)
 Frame = +2

Query  293   WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  472
             W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRSTP+MW DLI+KAKE
Sbjct  18    WLLFSSWVFSLVS----ATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKE  73

Query  473   GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  652
             GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGG
Sbjct  74    GGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGG  133

Query  653   FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQ  832
             FPVWLK+VPGI+FR DNEPFK AM+ FTEKIV++MK+  LFE+QGGPII+SQIENE+GP 
Sbjct  134   FPVWLKYVPGIAFRTDNEPFKAAMQKFTEKIVSMMKAEKLFETQGGPIIMSQIENEFGPV  193

Query  833   AKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKP  1012
                +G  G  Y+ WAA+MAV +DTGVPW+MCK++DAPDPVINTCNGFYC+ F PN  YKP
Sbjct  194   EWEIGDPGKAYIKWAAQMAVGLDTGVPWIMCKQDDAPDPVINTCNGFYCENFTPNAKYKP  253

Query  1013  AIWT  1024
              +WT
Sbjct  254   KMWT  257



>gb|KDO49473.1| hypothetical protein CISIN_1g0051602mg, partial [Citrus sinensis]
Length=416

 Score =   379 bits (973),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 178/242 (74%), Positives = 206/242 (85%), Gaps = 0/242 (0%)
 Frame = +2

Query  299   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
             + + +V  L   LT  SV+YD KA++INGQRR+LFSGSIHYPRS+ EMWE LI KAK+GG
Sbjct  10    IFMSIVLSLCLHLTLSSVTYDSKALIINGQRRILFSGSIHYPRSSHEMWEGLIQKAKDGG  69

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DVI+TYVFWNVHEPSPGNYNFEGRYDLVRF+K +QKAGLY HLRIGPYIC EWNFGGFP
Sbjct  70    LDVIDTYVFWNVHEPSPGNYNFEGRYDLVRFIKLVQKAGLYVHLRIGPYICAEWNFGGFP  129

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAK  838
             VWLKFV GISFR DN+PFK AM+ FT+KIV +MK   LF+SQGGPIILSQIENEY P+ +
Sbjct  130   VWLKFVQGISFRTDNKPFKHAMQNFTQKIVLMMKDEKLFKSQGGPIILSQIENEYEPERE  189

Query  839   VLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAI  1018
               G++G  Y+ WAA+MAVE++T VPWVMCKEEDAPDPVINTCNGFYC  F+PNKP KP +
Sbjct  190   EFGSAGEAYMKWAAEMAVELNTEVPWVMCKEEDAPDPVINTCNGFYCHSFSPNKPSKPKM  249

Query  1019  WT  1024
             WT
Sbjct  250   WT  251



>ref|XP_011077976.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=729

 Score =   389 bits (999),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/243 (71%), Positives = 205/243 (84%), Gaps = 0/243 (0%)
 Frame = +2

Query  296   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  475
              LVL ++F L+    + +VSYD KA +ING+RR+L SGSIHYPRSTPEMW DLI KAK+G
Sbjct  12    TLVLVVLFSLACSSVRATVSYDDKAFIINGKRRILISGSIHYPRSTPEMWPDLIQKAKDG  71

Query  476   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  655
             G+DVI+TYVFWN HE SPG YNFEGR+DLV+F+K +Q+AGLY HLRIGPY+C EWNFGGF
Sbjct  72    GLDVIQTYVFWNGHEASPGKYNFEGRFDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGF  131

Query  656   PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQA  835
             PVWLK+VPGI FR DN+PFK+AM+GF EKIVN+MKS  LFESQGGPII+SQIENEYGP  
Sbjct  132   PVWLKYVPGIEFRTDNQPFKVAMQGFVEKIVNMMKSEKLFESQGGPIIMSQIENEYGPVE  191

Query  836   KVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPA  1015
               +GA G  Y  WAAKMAV ++TGVPW+MCK+E APDP+I+TCNGFYC+ F PNKP+KP 
Sbjct  192   WEIGAPGKAYTAWAAKMAVGLNTGVPWIMCKQETAPDPIIDTCNGFYCEGFRPNKPWKPK  251

Query  1016  IWT  1024
             +WT
Sbjct  252   MWT  254



>gb|EYU45189.1| hypothetical protein MIMGU_mgv1a003101mg [Erythranthe guttata]
Length=608

 Score =   385 bits (988),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/242 (70%), Positives = 203/242 (84%), Gaps = 0/242 (0%)
 Frame = +2

Query  299   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
             LV+ ++  ++    + +VSYD KA +INGQR++L SGSIHYPRSTPEMW DLI KAK+GG
Sbjct  7     LVVTVLLAIACSSVRATVSYDDKAFIINGQRKILISGSIHYPRSTPEMWPDLIQKAKDGG  66

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DVI+TYVFWN HEPSPGNYNFEGR+DLV+F+K   +AGLY HLRIGPY+CGEWNFGGFP
Sbjct  67    LDVIQTYVFWNGHEPSPGNYNFEGRFDLVKFIKLAHQAGLYVHLRIGPYVCGEWNFGGFP  126

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAK  838
             VWLK+VPGI FR DN+PFK+AM+ F EKIVNLMKS NLFE +GGPII+SQIENEYGP   
Sbjct  127   VWLKYVPGIEFRTDNQPFKVAMQRFVEKIVNLMKSENLFEPRGGPIIMSQIENEYGPIEW  186

Query  839   VLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAI  1018
              +GA G  Y  WAAKMAV +DTGVPW+MCK+E APDP+I+TCNGFYC+ F PN+P KP +
Sbjct  187   EIGAPGKAYSAWAAKMAVGLDTGVPWIMCKQETAPDPMIDTCNGFYCEGFTPNRPNKPKM  246

Query  1019  WT  1024
             WT
Sbjct  247   WT  248



>ref|XP_010242207.1| PREDICTED: beta-galactosidase [Nelumbo nucifera]
Length=846

 Score =   391 bits (1005),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 201/228 (88%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
             + SVSYD+KAI+INGQRR+LFSGSIHYPRSTPEMW DLI KAK+GG+D I+TYVFWN HE
Sbjct  38    KASVSYDQKAIIINGQRRILFSGSIHYPRSTPEMWPDLIQKAKDGGLDAIQTYVFWNGHE  97

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             PSPG Y FEGRYDLVRF+K +Q+AGLY HLRIGPY+C EWNFGGFPVWLK+VPGI FR D
Sbjct  98    PSPGQYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIEFRTD  157

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             NEPFK+ M+GFT+KIV++MK+ NLFE QGGPII+SQIENEYGP    +GA G  Y  WAA
Sbjct  158   NEPFKVTMQGFTKKIVDMMKAENLFEPQGGPIIMSQIENEYGPVEWEIGAPGQAYTKWAA  217

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             +MAV++ TGVPWVMCK++DAPDP+IN+CNGFYCD F+PNKPYKP +WT
Sbjct  218   QMAVDLGTGVPWVMCKQDDAPDPMINSCNGFYCDWFSPNKPYKPKMWT  265



>ref|XP_006353531.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=726

 Score =   387 bits (994),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 204/240 (85%), Gaps = 2/240 (1%)
 Frame = +2

Query  305   LCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVD  484
             +C + F SS   + SVSYD +AI+ING+R++L SGSIHYPRSTP+MW DLI KAK+GG+D
Sbjct  14    ICSLDFFSS--VKASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLD  71

Query  485   VIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVW  664
             VIETYVFWN HEPSPG YNFEGRYDLVRF+K  Q+AGLY +LRIGPYIC EWNFGGFPVW
Sbjct  72    VIETYVFWNAHEPSPGKYNFEGRYDLVRFIKLAQRAGLYVNLRIGPYICAEWNFGGFPVW  131

Query  665   LKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVL  844
             LK+VPG+ FR DN+PFK+AM+GF +KIVN+MKS NLFE QGGPII++QIENEYGP    +
Sbjct  132   LKYVPGMEFRTDNQPFKVAMQGFVQKIVNMMKSENLFEPQGGPIIMAQIENEYGPVEWEI  191

Query  845   GASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             GA G  +  WAA+MAV + TGVPW+MCK+EDAPDPVI+TCNGFYC+ F PNKPYKP +WT
Sbjct  192   GAPGKAFTKWAAQMAVGLKTGVPWIMCKQEDAPDPVIDTCNGFYCEGFRPNKPYKPKMWT  251



>ref|XP_004150073.1| PREDICTED: beta-galactosidase 5 [Cucumis sativus]
 gb|KGN61834.1| hypothetical protein Csa_2G249880 [Cucumis sativus]
Length=848

 Score =   390 bits (1001),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/254 (70%), Positives = 208/254 (82%), Gaps = 7/254 (3%)
 Frame = +2

Query  284   MRKWVLVLCMVFF------LSSGLTQC-SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEM  442
             MR     +C V F      L   LT C +V+YD KA++INGQR++LFSGSIHYPRS P+M
Sbjct  1     MRNLRNSVCFVVFFFLCWSLHFQLTNCENVTYDGKALIINGQRKILFSGSIHYPRSVPDM  60

Query  443   WEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGP  622
             WE LI KAK GG+DV++TYVFWN+HEPSPG Y+FEGR DLV+F+K ++KAGLY HLRIGP
Sbjct  61    WESLIEKAKMGGLDVVDTYVFWNLHEPSPGIYDFEGRNDLVKFIKLVEKAGLYVHLRIGP  120

Query  623   YICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIIL  802
             YICGEWNFGGFP WLKFVPGISFR DNEPFK+AM  FT+KIV +MK   LF+SQGGPIIL
Sbjct  121   YICGEWNFGGFPAWLKFVPGISFRTDNEPFKLAMAKFTKKIVQMMKDERLFQSQGGPIIL  180

Query  803   SQIENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCD  982
             SQIENEY  + KV G +G  Y+ WAAKMAV+MDTGVPWVMCK++DAPDP+INTCNGFYCD
Sbjct  181   SQIENEYETEDKVFGEAGFAYMNWAAKMAVQMDTGVPWVMCKQDDAPDPMINTCNGFYCD  240

Query  983   KFAPNKPYKPAIWT  1024
              F+PNKPYKP  WT
Sbjct  241   YFSPNKPYKPNFWT  254



>gb|KJB65166.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=697

 Score =   385 bits (990),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/244 (71%), Positives = 204/244 (84%), Gaps = 4/244 (2%)
 Frame = +2

Query  293   WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  472
             W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRSTP+MW DLI+KAKE
Sbjct  18    WLLFSSWVFSLVS----ATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKE  73

Query  473   GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  652
             GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGG
Sbjct  74    GGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGG  133

Query  653   FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQ  832
             FPVWLK+VPGI+FR DNEPFK AM+ FTEKIV++MK+  LFE+QGGPII+SQIENE+GP 
Sbjct  134   FPVWLKYVPGIAFRTDNEPFKAAMQKFTEKIVSMMKAEKLFETQGGPIIMSQIENEFGPV  193

Query  833   AKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKP  1012
                +G  G  Y+ WAA+MAV +DTGVPW+MCK++DAPDPVINTCNGFYC+ F PN  YKP
Sbjct  194   EWEIGDPGKAYIKWAAQMAVGLDTGVPWIMCKQDDAPDPVINTCNGFYCENFTPNAKYKP  253

Query  1013  AIWT  1024
              +WT
Sbjct  254   KMWT  257



>ref|XP_009409594.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=735

 Score =   387 bits (993),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 195/228 (86%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
               SVSYD KAI++NGQRR+L SGSIHYPRSTPEMW DLI KAK+GG+DVI+TYVFWN HE
Sbjct  37    DASVSYDHKAIIVNGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  96

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             PSPG Y F G YDLVRF+K ++ AGLY HLRIGPY+C EWNFGGFPVWLK+VPGI+FR D
Sbjct  97    PSPGQYYFGGNYDLVRFIKLVKHAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGINFRTD  156

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             NEPFK AM  FTEKIV +MKS  LFESQGGPIILSQIENEYGP  K  GA+   YVTWAA
Sbjct  157   NEPFKAAMAKFTEKIVAMMKSERLFESQGGPIILSQIENEYGPMEKFGGAAAKNYVTWAA  216

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             +MAV ++TGVPWVMCK++DAPDPVIN CNGFYCD F+PNKPYKP +WT
Sbjct  217   QMAVGLNTGVPWVMCKQDDAPDPVINACNGFYCDYFSPNKPYKPTMWT  264



>gb|AAC25984.1| beta-galactosidase [Solanum lycopersicum]
Length=724

 Score =   385 bits (989),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 171/235 (73%), Positives = 203/235 (86%), Gaps = 2/235 (1%)
 Frame = +2

Query  320   FLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETY  499
             F SS   + SVSYD +AI+ING+R++L SGSIHYPRSTP+MW DLI KAK+GG+DVIETY
Sbjct  17    FFSS--VKASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETY  74

Query  500   VFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVP  679
             VFWN HEPSPG YNFEGRYDLVRF+K +Q+AGLY +LRIGPY+C EWNFGGFPVWLK+VP
Sbjct  75    VFWNGHEPSPGKYNFEGRYDLVRFIKMVQRAGLYVNLRIGPYVCAEWNFGGFPVWLKYVP  134

Query  680   GISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGH  859
             G+ FR +N+PFK+AM+GF +KIVN+MKS NLFESQGGPII++QIENEYGP    +GA G 
Sbjct  135   GMEFRTNNQPFKVAMQGFVQKIVNMMKSENLFESQGGPIIMAQIENEYGPVEWEIGAPGK  194

Query  860   QYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              Y  WAA+MAV + TGVPW+MCK+EDAPDPVI+TCNGFYC+ F PNKPYKP +WT
Sbjct  195   AYTKWAAQMAVGLKTGVPWIMCKQEDAPDPVIDTCNGFYCEGFRPNKPYKPKMWT  249



>gb|EPS69033.1| beta-galactosidase, partial [Genlisea aurea]
Length=723

 Score =   385 bits (989),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 201/230 (87%), Gaps = 2/230 (1%)
 Frame = +2

Query  335   LTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNV  514
              +QC+VSYDRK+++I+GQRR+L SGSIHYPRS P+MWE LI KAK GG+D I+TYVFWN+
Sbjct  13    FSQCNVSYDRKSLIIDGQRRILISGSIHYPRSDPQMWEGLIQKAKNGGLDAIDTYVFWNL  72

Query  515   HEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFR  694
             HEPSPG YNFEGR DLV F+K +QKAGLY +LRIGPYIC EWNFGGFPVWLK+VPGISFR
Sbjct  73    HEPSPGTYNFEGRNDLVGFIKLVQKAGLYLNLRIGPYICAEWNFGGFPVWLKYVPGISFR  132

Query  695   ADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTW  874
              +NEPFK+AM+ FT+KIV ++K+  LFESQGGPIILSQIENEYG +    G  GH+Y++W
Sbjct  133   TNNEPFKLAMQSFTQKIVQMLKNERLFESQGGPIILSQIENEYGFEVNDHG--GHEYISW  190

Query  875   AAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AAKMAV ++TGVPW MCKE+DAPDPVINTCNGFYCD F+PNKPYKP IWT
Sbjct  191   AAKMAVGLNTGVPWSMCKEDDAPDPVINTCNGFYCDYFSPNKPYKPKIWT  240



>pdb|3W5F|A Chain A, Crystal Structure Of Tomato Beta-galactosidase 4
 pdb|3W5F|B Chain B, Crystal Structure Of Tomato Beta-galactosidase 4
 pdb|3W5G|A Chain A, Crystal Structure Of Tomato Beta-galactosidase 4 In 
Complex With Galactose
 pdb|3W5G|B Chain B, Crystal Structure Of Tomato Beta-galactosidase 4 In 
Complex With Galactose
Length=718

 Score =   385 bits (988),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 199/226 (88%), Gaps = 0/226 (0%)
 Frame = +2

Query  347   SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPS  526
             SVSYD +AI+ING+R++L SGSIHYPRSTP+MW DLI KAK+GG+DVIETYVFWN HEPS
Sbjct  7     SVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETYVFWNGHEPS  66

Query  527   PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNE  706
             PG YNFEGRYDLVRF+K +Q+AGLY +LRIGPY+C EWNFGGFPVWLK+VPG+ FR +N+
Sbjct  67    PGKYNFEGRYDLVRFIKMVQRAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGMEFRTNNQ  126

Query  707   PFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAKM  886
             PFK+AM+GF +KIVN+MKS NLFESQGGPII++QIENEYGP    +GA G  Y  WAA+M
Sbjct  127   PFKVAMQGFVQKIVNMMKSENLFESQGGPIIMAQIENEYGPVEWEIGAPGKAYTKWAAQM  186

Query  887   AVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AV + TGVPW+MCK+EDAPDPVI+TCNGFYC+ F PNKPYKP +WT
Sbjct  187   AVGLKTGVPWIMCKQEDAPDPVIDTCNGFYCEGFRPNKPYKPKMWT  232



>gb|ADO34789.1| beta-galactosidase STBG4 [Solanum lycopersicum]
Length=724

 Score =   385 bits (988),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 171/235 (73%), Positives = 202/235 (86%), Gaps = 2/235 (1%)
 Frame = +2

Query  320   FLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETY  499
             F SS   + SVSYD +AI+ING+R++L SGSIHYPRSTP+MW DLI KAK+GG+DVIETY
Sbjct  17    FFSS--VKASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETY  74

Query  500   VFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVP  679
             VFWN HEPSPG YNFEGRYDLVRF+K +Q+AGLY +LRIGPY+C EWNFGGFPVWLK+VP
Sbjct  75    VFWNGHEPSPGKYNFEGRYDLVRFIKMVQRAGLYVNLRIGPYVCAEWNFGGFPVWLKYVP  134

Query  680   GISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGH  859
             G+ FR +N+PFK+AM+GF +KIVN+MKS NLFESQGGPII++QIENEYGP    +GA G 
Sbjct  135   GMEFRTNNQPFKVAMQGFVQKIVNMMKSENLFESQGGPIIMAQIENEYGPVEWEIGAPGK  194

Query  860   QYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              Y  WAA+MAV + TGVPW+MCK EDAPDPVI+TCNGFYC+ F PNKPYKP +WT
Sbjct  195   AYTKWAAQMAVGLKTGVPWIMCKREDAPDPVIDTCNGFYCEGFRPNKPYKPKMWT  249



>gb|KEH39519.1| beta-galactosidase [Medicago truncatula]
Length=590

 Score =   380 bits (976),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  344   CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEP  523
              SVSYD KAI INGQ R+L SGSIHYPRSTPEMW DLI KAKEGG+DVI+TYVFWN HEP
Sbjct  26    ASVSYDSKAITINGQSRILISGSIHYPRSTPEMWPDLIQKAKEGGLDVIQTYVFWNGHEP  85

Query  524   SPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADN  703
             SPG Y FEG YDLV+F+K +Q+AGLY HLRIGPY+C EWNFGGFPVWLK++PGISFR DN
Sbjct  86    SPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYIPGISFRTDN  145

Query  704   EPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAK  883
             EPFK  M+ FTEKIV++MK+  LFESQGGPII+SQIENEYGP    +GA G  Y  WAA 
Sbjct  146   EPFKFQMQKFTEKIVDMMKADRLFESQGGPIIMSQIENEYGPMEYEIGAPGKSYTKWAAD  205

Query  884   MAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             MAV + TGVPW+MCK++DAPDPVINTCNGFYCD F+PNK YKP +WT
Sbjct  206   MAVGLGTGVPWIMCKQDDAPDPVINTCNGFYCDYFSPNKDYKPKMWT  252



>ref|XP_009768469.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=837

 Score =   387 bits (995),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 175/243 (72%), Positives = 207/243 (85%), Gaps = 1/243 (0%)
 Frame = +2

Query  299   LVLCMVFF-LSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  475
             L+L +VFF       + SV+YD +AIVING+RR+L SGSIHYPRSTPEMW DLI KAK+G
Sbjct  8     LLLFIVFFSFIYSSVRASVTYDDRAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDG  67

Query  476   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  655
             G+DVIETYVFWN HEPSPG +NFEGRYDLV+F+K +Q+AGLY +LRIGPY+C EWNFGGF
Sbjct  68    GLDVIETYVFWNGHEPSPGKFNFEGRYDLVKFIKLVQQAGLYVNLRIGPYVCAEWNFGGF  127

Query  656   PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQA  835
             PVWLK+VPG+ FRADN+PFK+AM+GF EKIVN+MKS NLFE QGGPII++QIENEYGP  
Sbjct  128   PVWLKYVPGMEFRADNQPFKVAMQGFVEKIVNMMKSGNLFEPQGGPIIMAQIENEYGPIE  187

Query  836   KVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPA  1015
               +G  G  Y  WAA+MAV +DTGVPW+MCK+EDAPDPVI+TCNGFYC+ F PNKPYKP 
Sbjct  188   WGVGDPGKPYAKWAAEMAVGLDTGVPWIMCKQEDAPDPVIDTCNGFYCENFKPNKPYKPK  247

Query  1016  IWT  1024
             +WT
Sbjct  248   MWT  250



>gb|ADV41669.1| beta-D-galactosidase [Actinidia deliciosa var. deliciosa]
Length=728

 Score =   384 bits (986),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/249 (72%), Positives = 202/249 (81%), Gaps = 2/249 (1%)
 Frame = +2

Query  284   MRKWVLVLC--MVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLI  457
             +R  VL +C  + F L       SV+YD KAI INGQRR+LFSGSIHYPRSTPEMW  LI
Sbjct  5     LRIKVLFVCVGLFFLLCCCSVTASVTYDGKAIKINGQRRILFSGSIHYPRSTPEMWPGLI  64

Query  458   SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  637
              KAKEGG+DVI+TYVFWN HEPSPG Y FEGRYDLVRF+K  Q+AGLY HLRIG Y+C E
Sbjct  65    QKAKEGGLDVIQTYVFWNGHEPSPGQYYFEGRYDLVRFIKLAQQAGLYVHLRIGLYVCAE  124

Query  638   WNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIEN  817
             WNFGGFPVWLK+VPGI+FR DN PFK AM+ FTEKIVNLMKS  LFESQGGPII+SQIEN
Sbjct  125   WNFGGFPVWLKYVPGIAFRTDNGPFKAAMQKFTEKIVNLMKSEKLFESQGGPIIMSQIEN  184

Query  818   EYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPN  997
             EYGP    +GA G  Y  WAA+MAV +DTGVPW+MCK+EDAPDP+I+TCNGFYC+ F PN
Sbjct  185   EYGPVEWEIGAPGKAYTKWAAEMAVGLDTGVPWIMCKQEDAPDPIIDTCNGFYCEGFTPN  244

Query  998   KPYKPAIWT  1024
             K YKP +WT
Sbjct  245   KNYKPKMWT  253



>ref|NP_001234842.1| ss-galactosidase precursor [Solanum lycopersicum]
 emb|CAA10175.1| ss-galactosidase [Solanum lycopersicum]
Length=724

 Score =   383 bits (983),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 202/235 (86%), Gaps = 2/235 (1%)
 Frame = +2

Query  320   FLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETY  499
             F SS   + SVSYD +AI+ING+R++L SGSIHYPRSTP+MW DLI KAK+GG+DVIETY
Sbjct  17    FFSS--VKASVSYDDRAIIINGKRKILISGSIHYPRSTPQMWPDLIQKAKDGGLDVIETY  74

Query  500   VFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVP  679
             VFWN H PSPG YNFEGRYDLVRF+K +Q+AGLY +LRIGPY+C EWNFGGFPVWLK+VP
Sbjct  75    VFWNGHGPSPGKYNFEGRYDLVRFIKMVQRAGLYVNLRIGPYVCAEWNFGGFPVWLKYVP  134

Query  680   GISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGH  859
             G+ FR +N+PFK+AM+GF +KIVN+MKS NLFESQGGPII++QIENEYGP    +GA G 
Sbjct  135   GMEFRTNNQPFKVAMRGFVQKIVNMMKSENLFESQGGPIIMAQIENEYGPVEWEIGAPGK  194

Query  860   QYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              Y  WAA+MAV + TGVPW+MCK+EDAPDPVI+TCNGFYC+ F PNKPYKP +WT
Sbjct  195   AYTKWAAQMAVGLKTGVPWIMCKQEDAPDPVIDTCNGFYCEGFRPNKPYKPKMWT  249



>emb|CAA09467.1| exo galactanase [Lupinus angustifolius]
Length=730

 Score =   383 bits (984),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 175/248 (71%), Positives = 207/248 (83%), Gaps = 1/248 (0%)
 Frame = +2

Query  281   AMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             + R + +VL ++FF    +T  SV+YD KAI+INGQRR+L SGSIHYPRSTP+MW DLI 
Sbjct  13    SRRNFHMVLLLLFFWVCYVT-ASVTYDHKAIMINGQRRILISGSIHYPRSTPQMWPDLIQ  71

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DVIETYVFWN HEPSPG Y FE R+DLV F+K +Q+AGL+ HLRIGP+IC EW
Sbjct  72    KAKDGGLDVIETYVFWNGHEPSPGKYYFEDRFDLVGFIKLVQQAGLFVHLRIGPFICAEW  131

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPGI+FR DNEPFK AM+ FTEKIVN+MK+  LF+SQGGPIILSQIENE
Sbjct  132   NFGGFPVWLKYVPGIAFRTDNEPFKEAMQKFTEKIVNIMKAEKLFQSQGGPIILSQIENE  191

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YGP    +GA G  Y  WAA+MAV +DTGVPWVMCK+EDAPDP+I+TCNGFYC+ F PNK
Sbjct  192   YGPVEWEIGAPGKAYTKWAAQMAVGLDTGVPWVMCKQEDAPDPIIDTCNGFYCENFTPNK  251

Query  1001  PYKPAIWT  1024
              YKP +WT
Sbjct  252   NYKPKLWT  259



>ref|XP_010911412.1| PREDICTED: beta-galactosidase-like, partial [Elaeis guineensis]
Length=585

 Score =   378 bits (971),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 193/228 (85%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
               +VSYD KA++INGQRR+L SGSIHYPRSTPEMW DLI KAK+GG+DVI+TYVFWN HE
Sbjct  37    DATVSYDHKALIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  96

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             PSPG Y F GRYDLVRF+K +++AGLY HLRIGPY+C EWNFGGFP+WLK+VPGISFR D
Sbjct  97    PSPGQYYFGGRYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPIWLKYVPGISFRTD  156

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             N PFK AM+ FTEKIV++MK+  LFE QGGPIILSQIENE+GP     GA    Y  WAA
Sbjct  157   NGPFKAAMEKFTEKIVSMMKAEGLFEWQGGPIILSQIENEFGPLEYYGGAPAKSYTNWAA  216

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             +MAV + TGVPWVMCK++DAPDPVINTCNGFYCD F+PNKPYKP IWT
Sbjct  217   QMAVGLKTGVPWVMCKQDDAPDPVINTCNGFYCDDFSPNKPYKPMIWT  264



>gb|KJB65169.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=811

 Score =   385 bits (988),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 174/244 (71%), Positives = 204/244 (84%), Gaps = 4/244 (2%)
 Frame = +2

Query  293   WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  472
             W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRSTP+MW DLI+KAKE
Sbjct  18    WLLFSSWVFSLVS----ATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKE  73

Query  473   GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  652
             GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGG
Sbjct  74    GGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGG  133

Query  653   FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQ  832
             FPVWLK+VPGI+FR DNEPFK AM+ FTEKIV++MK+  LFE+QGGPII+SQIENE+GP 
Sbjct  134   FPVWLKYVPGIAFRTDNEPFKAAMQKFTEKIVSMMKAEKLFETQGGPIIMSQIENEFGPV  193

Query  833   AKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKP  1012
                +G  G  Y+ WAA+MAV +DTGVPW+MCK++DAPDPVINTCNGFYC+ F PN  YKP
Sbjct  194   EWEIGDPGKAYIKWAAQMAVGLDTGVPWIMCKQDDAPDPVINTCNGFYCENFTPNAKYKP  253

Query  1013  AIWT  1024
              +WT
Sbjct  254   KMWT  257



>gb|KDO57768.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
 gb|KDO57769.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=605

 Score =   379 bits (972),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 209/260 (80%), Gaps = 0/260 (0%)
 Frame = +2

Query  245   QELALREKLRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYP  424
             +++ ++ K+ G  ++  +LVL           + SVSYD KA++INGQ+R+L SGSIHYP
Sbjct  4     KQVLVKWKMLGANVKVLMLVLLSFCSWEISFVKASVSYDHKAVIINGQKRILISGSIHYP  63

Query  425   RSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYA  604
             RSTPEMW DLI KAK+GG+DVI+TYVFWN HEP+ GNY F+ RYDLVRF+K +Q+AGLY 
Sbjct  64    RSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYV  123

Query  605   HLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQ  784
             HLRIGPY+C EWN+GGFPVWLK+VPGI FR DN PFK AM  FTEKIV++MK+  LF++Q
Sbjct  124   HLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTDNGPFKAAMHKFTEKIVSMMKAEKLFQTQ  183

Query  785   GGPIILSQIENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTC  964
             GGPIILSQIENE+GP    +GA G  Y  WAA+MAV ++TGVPWVMCK++DAPDPVINTC
Sbjct  184   GGPIILSQIENEFGPVEWDIGAPGKAYAKWAAQMAVGLNTGVPWVMCKQDDAPDPVINTC  243

Query  965   NGFYCDKFAPNKPYKPAIWT  1024
             NGFYC+KF PN+ YKP +WT
Sbjct  244   NGFYCEKFVPNQNYKPKMWT  263



>ref|XP_009402923.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=733

 Score =   382 bits (982),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 196/229 (86%), Gaps = 1/229 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
               SVSYDRKA++ING RR+LFSGSIHYPRSTPEMW DLI KAK+GG+DVI+TYVFWN HE
Sbjct  34    DASVSYDRKAVIINGHRRILFSGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  93

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             PSPG Y F G YDLVRFVK +++AGLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR D
Sbjct  94    PSPGQYYFGGNYDLVRFVKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTD  153

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVL-GASGHQYVTWA  877
             N PFK AM  FTEKIV++MKS  LFESQGGPIILSQIENEYGP  +   GA+   Y +WA
Sbjct  154   NGPFKAAMAKFTEKIVSMMKSQGLFESQGGPIILSQIENEYGPLEEYYGGAAAKNYASWA  213

Query  878   AKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             A+MAV + TGVPWVMCK++DAPDP+INTCNGFYCD F+PNKPYKP +WT
Sbjct  214   AQMAVGLKTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKPYKPTMWT  262



>gb|KDO57767.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=635

 Score =   379 bits (974),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 209/260 (80%), Gaps = 0/260 (0%)
 Frame = +2

Query  245   QELALREKLRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYP  424
             +++ ++ K+ G  ++  +LVL           + SVSYD KA++INGQ+R+L SGSIHYP
Sbjct  4     KQVLVKWKMLGANVKVLMLVLLSFCSWEISFVKASVSYDHKAVIINGQKRILISGSIHYP  63

Query  425   RSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYA  604
             RSTPEMW DLI KAK+GG+DVI+TYVFWN HEP+ GNY F+ RYDLVRF+K +Q+AGLY 
Sbjct  64    RSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYV  123

Query  605   HLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQ  784
             HLRIGPY+C EWN+GGFPVWLK+VPGI FR DN PFK AM  FTEKIV++MK+  LF++Q
Sbjct  124   HLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTDNGPFKAAMHKFTEKIVSMMKAEKLFQTQ  183

Query  785   GGPIILSQIENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTC  964
             GGPIILSQIENE+GP    +GA G  Y  WAA+MAV ++TGVPWVMCK++DAPDPVINTC
Sbjct  184   GGPIILSQIENEFGPVEWDIGAPGKAYAKWAAQMAVGLNTGVPWVMCKQDDAPDPVINTC  243

Query  965   NGFYCDKFAPNKPYKPAIWT  1024
             NGFYC+KF PN+ YKP +WT
Sbjct  244   NGFYCEKFVPNQNYKPKMWT  263



>gb|KDO57766.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=649

 Score =   380 bits (975),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 209/260 (80%), Gaps = 0/260 (0%)
 Frame = +2

Query  245   QELALREKLRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYP  424
             +++ ++ K+ G  ++  +LVL           + SVSYD KA++INGQ+R+L SGSIHYP
Sbjct  4     KQVLVKWKMLGANVKVLMLVLLSFCSWEISFVKASVSYDHKAVIINGQKRILISGSIHYP  63

Query  425   RSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYA  604
             RSTPEMW DLI KAK+GG+DVI+TYVFWN HEP+ GNY F+ RYDLVRF+K +Q+AGLY 
Sbjct  64    RSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYV  123

Query  605   HLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQ  784
             HLRIGPY+C EWN+GGFPVWLK+VPGI FR DN PFK AM  FTEKIV++MK+  LF++Q
Sbjct  124   HLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTDNGPFKAAMHKFTEKIVSMMKAEKLFQTQ  183

Query  785   GGPIILSQIENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTC  964
             GGPIILSQIENE+GP    +GA G  Y  WAA+MAV ++TGVPWVMCK++DAPDPVINTC
Sbjct  184   GGPIILSQIENEFGPVEWDIGAPGKAYAKWAAQMAVGLNTGVPWVMCKQDDAPDPVINTC  243

Query  965   NGFYCDKFAPNKPYKPAIWT  1024
             NGFYC+KF PN+ YKP +WT
Sbjct  244   NGFYCEKFVPNQNYKPKMWT  263



>ref|XP_006423393.1| hypothetical protein CICLE_v10030257mg, partial [Citrus clementina]
 gb|ESR36633.1| hypothetical protein CICLE_v10030257mg, partial [Citrus clementina]
Length=728

 Score =   382 bits (980),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 178/242 (74%), Positives = 206/242 (85%), Gaps = 0/242 (0%)
 Frame = +2

Query  299   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
             + + +V  L   LT  SV+YD KA++INGQRR+LFSGSIHYPRS+ EMWE LI KAK+GG
Sbjct  10    IFMSIVLSLCLHLTLSSVTYDSKALIINGQRRILFSGSIHYPRSSHEMWEGLIQKAKDGG  69

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DVI+TYVFWNVHEPSPGNYNFEGRYDLVRF+K +QKAGLY HLRIGPYIC EWNFGGFP
Sbjct  70    LDVIDTYVFWNVHEPSPGNYNFEGRYDLVRFIKLVQKAGLYVHLRIGPYICAEWNFGGFP  129

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAK  838
             VWLKFV GISFR DN+PFK AM+ FT+KIV +MK   LF+SQGGPIILSQIENEY P+ +
Sbjct  130   VWLKFVQGISFRTDNKPFKHAMQNFTQKIVQMMKDEKLFKSQGGPIILSQIENEYEPERE  189

Query  839   VLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAI  1018
               G++G  Y+ WAA+MAVE++T VPWVMCKEEDAPDPVINTCNGFYC  F+PNKP KP +
Sbjct  190   EFGSAGEAYMKWAAEMAVELNTEVPWVMCKEEDAPDPVINTCNGFYCHSFSPNKPSKPKM  249

Query  1019  WT  1024
             WT
Sbjct  250   WT  251



>gb|KJB65167.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=843

 Score =   385 bits (988),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 174/244 (71%), Positives = 204/244 (84%), Gaps = 4/244 (2%)
 Frame = +2

Query  293   WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  472
             W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRSTP+MW DLI+KAKE
Sbjct  18    WLLFSSWVFSLVS----ATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKE  73

Query  473   GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  652
             GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGG
Sbjct  74    GGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGG  133

Query  653   FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQ  832
             FPVWLK+VPGI+FR DNEPFK AM+ FTEKIV++MK+  LFE+QGGPII+SQIENE+GP 
Sbjct  134   FPVWLKYVPGIAFRTDNEPFKAAMQKFTEKIVSMMKAEKLFETQGGPIIMSQIENEFGPV  193

Query  833   AKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKP  1012
                +G  G  Y+ WAA+MAV +DTGVPW+MCK++DAPDPVINTCNGFYC+ F PN  YKP
Sbjct  194   EWEIGDPGKAYIKWAAQMAVGLDTGVPWIMCKQDDAPDPVINTCNGFYCENFTPNAKYKP  253

Query  1013  AIWT  1024
              +WT
Sbjct  254   KMWT  257



>gb|AAF67341.1| beta galactosidase [Vigna radiata]
Length=721

 Score =   381 bits (979),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 201/241 (83%), Gaps = 1/241 (0%)
 Frame = +2

Query  302   VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGV  481
             VL ++FF   G+T  SV+YD KAIVI+G+RR+L SGSIHYPRSTP+MW DLI KAK+GG+
Sbjct  10    VLMLLFFWVCGVT-ASVTYDHKAIVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGL  68

Query  482   DVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  661
             DVI+TYVFWN HEPSPG Y FE RYDLVRFVK  Q+AGLY HLRIGPYIC EWNFGGFPV
Sbjct  69    DVIQTYVFWNGHEPSPGKYYFEDRYDLVRFVKLAQQAGLYVHLRIGPYICAEWNFGGFPV  128

Query  662   WLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKV  841
             WLK+VPGI+FR DNEPFK AM+ FT KIV+LMK   LF+SQGGPIILSQIENEYGP    
Sbjct  129   WLKYVPGIAFRTDNEPFKAAMQKFTAKIVSLMKEERLFQSQGGPIILSQIENEYGPVEWE  188

Query  842   LGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIW  1021
             +GA G  Y  WAA+MAV +DTGVPWVMCK+EDAPDPVI+TCNGFYC+ F PNK  KP +W
Sbjct  189   IGAPGKSYTKWAAQMAVGLDTGVPWVMCKQEDAPDPVIDTCNGFYCENFKPNKNTKPKMW  248

Query  1022  T  1024
             T
Sbjct  249   T  249



>ref|XP_006487343.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
Length=719

 Score =   381 bits (979),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/242 (74%), Positives = 206/242 (85%), Gaps = 0/242 (0%)
 Frame = +2

Query  299   LVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGG  478
             + + +V  L   LT  SV+YD KA++INGQRR+LFSGSIHYPRS+ EMWE LI KAK+GG
Sbjct  10    IFMSIVLSLCLHLTLSSVTYDNKALIINGQRRILFSGSIHYPRSSHEMWEGLIQKAKDGG  69

Query  479   VDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFP  658
             +DVI+TYVFWNVHEPSPGNYNFEGRYDLVRF+K +QKAGLY HLRIGPYIC EWNFGGFP
Sbjct  70    LDVIDTYVFWNVHEPSPGNYNFEGRYDLVRFIKLVQKAGLYVHLRIGPYICAEWNFGGFP  129

Query  659   VWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAK  838
             VWLKFV GISFR DN+PFK AM+ FT+KIV +MK   LF+SQGGPIILSQIENEY P+ +
Sbjct  130   VWLKFVQGISFRTDNKPFKHAMQNFTQKIVLMMKDEKLFKSQGGPIILSQIENEYEPERE  189

Query  839   VLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAI  1018
               G++G  Y+ WAA+MAVE++T VPWVMCKEEDAPDPVINTCNGFYC  F+PNKP KP +
Sbjct  190   EFGSAGEAYIKWAAEMAVELNTEVPWVMCKEEDAPDPVINTCNGFYCHSFSPNKPSKPKM  249

Query  1019  WT  1024
             WT
Sbjct  250   WT  251



>ref|XP_010479073.1| PREDICTED: beta-galactosidase 5 [Camelina sativa]
Length=733

 Score =   382 bits (980),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/248 (70%), Positives = 199/248 (80%), Gaps = 1/248 (0%)
 Frame = +2

Query  284   MRKWVLVLCMVFFLSSGLTQC-SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             + K +  L     + SGL QC SV+YD+KAI++NG RR+L SGSIHYPRSTPEMWEDLI 
Sbjct  9     LSKILSFLLTTMLVGSGLIQCTSVTYDKKAIIVNGHRRILLSGSIHYPRSTPEMWEDLIK  68

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GG+DVI+TYVFWN HEPSPG YNF+GRYDLVRF+KTIQ+ GLY HLRI        
Sbjct  69    KAKDGGLDVIDTYVFWNGHEPSPGTYNFKGRYDLVRFIKTIQEVGLYVHLRIXXXXXXXX  128

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
                GFPVWLK+V GISFR DN PFK AM+GFTEKIV +MK H  F SQGGPIILSQIENE
Sbjct  129   XXXGFPVWLKYVDGISFRTDNGPFKAAMQGFTEKIVEMMKEHRFFASQGGPIILSQIENE  188

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             +GP+ K LG +GH YV WAAKMAV ++TGVPWVMCKE+DAPDP+IN CNGFYCD F PNK
Sbjct  189   FGPELKALGPAGHSYVNWAAKMAVGLNTGVPWVMCKEDDAPDPIINACNGFYCDYFTPNK  248

Query  1001  PYKPAIWT  1024
             PYKP +WT
Sbjct  249   PYKPTMWT  256



>gb|KJB65170.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
 gb|KJB65171.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=842

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/244 (71%), Positives = 204/244 (84%), Gaps = 4/244 (2%)
 Frame = +2

Query  293   WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  472
             W+L    VF L S     +VSYD KAI+ING+RR+L SGSIHYPRSTP+MW DLI+KAKE
Sbjct  18    WLLFSSWVFSLVS----ATVSYDSKAIIINGRRRILLSGSIHYPRSTPQMWPDLIAKAKE  73

Query  473   GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  652
             GG+DVI+TYVFWN HEPSPGNY FE RYDLVRF+K +Q+AGLY HLRIGPYIC EWNFGG
Sbjct  74    GGLDVIQTYVFWNGHEPSPGNYYFEDRYDLVRFIKLVQQAGLYVHLRIGPYICAEWNFGG  133

Query  653   FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQ  832
             FPVWLK+VPGI+FR DNEPFK AM+ FTEKIV++MK+  LFE+QGGPII+SQIENE+GP 
Sbjct  134   FPVWLKYVPGIAFRTDNEPFKAAMQKFTEKIVSMMKAEKLFETQGGPIIMSQIENEFGPV  193

Query  833   AKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKP  1012
                +G  G  Y+ WAA+MAV +DTGVPW+MCK++DAPDPVINTCNGFYC+ F PN  YKP
Sbjct  194   EWEIGDPGKAYIKWAAQMAVGLDTGVPWIMCKQDDAPDPVINTCNGFYCENFTPNAKYKP  253

Query  1013  AIWT  1024
              +WT
Sbjct  254   KMWT  257



>ref|XP_003543598.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=841

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/244 (70%), Positives = 203/244 (83%), Gaps = 1/244 (0%)
 Frame = +2

Query  293   WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  472
             W + L + F L  G  + SVSYD KAI INGQRR+L SGSIHYPRSTPEMW DLI KAK+
Sbjct  12    WNVALLLAFSLI-GSAKASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKD  70

Query  473   GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  652
             GG+DVI+TYVFWN HEPSPG Y FEG YDLV+F+K +Q+AGLY HLRIGPY+C EWNFGG
Sbjct  71    GGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGG  130

Query  653   FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQ  832
             FPVWLK++PGISFR DNEPFK+ M+ FT KIV+LMK+  L+ESQGGPII+SQIENEYGP 
Sbjct  131   FPVWLKYIPGISFRTDNEPFKVQMQKFTTKIVDLMKAERLYESQGGPIIMSQIENEYGPM  190

Query  833   AKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKP  1012
                +GA+G  Y  WAA+MA+E+ TGVPW+MCK++D PDP+INTCNGFYCD F+PNK YKP
Sbjct  191   EYEIGAAGKAYTKWAAEMAMELGTGVPWIMCKQDDTPDPLINTCNGFYCDYFSPNKAYKP  250

Query  1013  AIWT  1024
              +WT
Sbjct  251   KMWT  254



>ref|XP_008450853.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=721

 Score =   381 bits (978),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/240 (71%), Positives = 200/240 (83%), Gaps = 0/240 (0%)
 Frame = +2

Query  305   LCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVD  484
             + +VF         SV+YD KAI+ING+RR+L SGSIHYPRSTP+MW DLI KAK+GG+D
Sbjct  7     IMVVFLWVCSSVMASVTYDHKAIIINGRRRILISGSIHYPRSTPQMWPDLIQKAKDGGLD  66

Query  485   VIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVW  664
             VI+TYVFWN HEPSPG+YNFE RYDLVRFVK +Q+AGLY HLRIGPY+C EWNFGGFPVW
Sbjct  67    VIDTYVFWNGHEPSPGHYNFEDRYDLVRFVKLVQQAGLYVHLRIGPYVCAEWNFGGFPVW  126

Query  665   LKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVL  844
             LK+VPGI+FR DN PFK AM+ FTEKIV +MK   L+ESQGGPIILSQIENEYGP    +
Sbjct  127   LKYVPGIAFRTDNGPFKAAMQKFTEKIVGVMKGEKLYESQGGPIILSQIENEYGPVEWEI  186

Query  845   GASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             GA G  Y  WAA+MA+++DTGVPWVMCK++DAPDPVI+TCNGFYC+ F PN+ YKP +WT
Sbjct  187   GAPGKSYSKWAAQMALDLDTGVPWVMCKQDDAPDPVIDTCNGFYCENFKPNQVYKPKMWT  246



>ref|NP_001266133.1| beta-galactosidase-like [Cicer arietinum]
 emb|CAA06309.1| beta-galactosidase [Cicer arietinum]
Length=730

 Score =   381 bits (979),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/248 (69%), Positives = 207/248 (83%), Gaps = 2/248 (1%)
 Frame = +2

Query  287   RKWVLVLCMVFFLSSGL--TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLIS  460
             RK+ +V+ +V FL   +     SV+YD KAIVINGQRR+L SGSIHYPRSTP+MW DLI 
Sbjct  8     RKFYMVIGLVLFLCLFVFSVTASVTYDHKAIVINGQRRILISGSIHYPRSTPQMWPDLIQ  67

Query  461   KAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEW  640
             KAK+GGVDVI+TYVFWN HEPSPGNY FE R+DLV+FVK +Q+AGLY +LRIGPY+C EW
Sbjct  68    KAKDGGVDVIQTYVFWNGHEPSPGNYYFEDRFDLVKFVKVVQQAGLYVNLRIGPYVCAEW  127

Query  641   NFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENE  820
             NFGGFPVWLK+VPG++FR DNEPFK AM+ FT KIV++MK+ NLFESQGGPII+SQIENE
Sbjct  128   NFGGFPVWLKYVPGVAFRTDNEPFKAAMQKFTAKIVSMMKAENLFESQGGPIIMSQIENE  187

Query  821   YGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNK  1000
             YGP    +GA G  Y  W ++MA+ +DTGVPW+MCK+EDAPDP+I+TCNG+YC+ F PNK
Sbjct  188   YGPVEWEIGAPGKAYTKWFSQMAIGLDTGVPWIMCKQEDAPDPIIDTCNGYYCENFTPNK  247

Query  1001  PYKPAIWT  1024
              YKP +WT
Sbjct  248   NYKPKMWT  255



>gb|KCW53602.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=673

 Score =   379 bits (974),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  344   CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEP  523
              SVSYD KAI INGQRR+L SGSIHYPRSTPEMW DLI KAKEGG+DVI+TYVFWN HEP
Sbjct  29    ASVSYDAKAITINGQRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEP  88

Query  524   SPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADN  703
             SPG YNFEG YD+V+FVK  Q+AGLY HLR+GPY+C EWNFGGFPVWLK+V GISFR DN
Sbjct  89    SPGKYNFEGNYDIVKFVKLAQQAGLYVHLRVGPYVCAEWNFGGFPVWLKYVRGISFRTDN  148

Query  704   EPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAK  883
              PFK  M+ FT KIVN+MK+  LFESQGGPIILSQIENEYGP    +GASG  Y  WAA+
Sbjct  149   GPFKYYMQKFTTKIVNMMKAEWLFESQGGPIILSQIENEYGPMEYEIGASGRAYTKWAAE  208

Query  884   MAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             MAV + TGVPWVMCK++DAPDP+INTCNGFYCD F+PNK YKP +WT
Sbjct  209   MAVGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWT  255



>ref|XP_009388558.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=738

 Score =   381 bits (979),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 194/229 (85%), Gaps = 1/229 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
               SVSYDRKA++ING+RR+L SGSIHYPRSTPEMW DLI KAK+GG+DVI+TYVFWN HE
Sbjct  39    DASVSYDRKALIINGRRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHE  98

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             PSPG Y F G YDLVRFVK +++AGLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR D
Sbjct  99    PSPGQYYFGGNYDLVRFVKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTD  158

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGAS-GHQYVTWA  877
             NEPFK AM  FTEKIV++MKS  LFESQGGPIILSQIENEYGP     G      Y +WA
Sbjct  159   NEPFKAAMSKFTEKIVSVMKSEGLFESQGGPIILSQIENEYGPLEDYYGGGVAKNYASWA  218

Query  878   AKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             A MAV ++TGVPWVMCK++DAPDPVINTCNGFYCD F+PNKPYKP +WT
Sbjct  219   AHMAVGLNTGVPWVMCKQDDAPDPVINTCNGFYCDDFSPNKPYKPTMWT  267



>ref|XP_009762312.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=725

 Score =   380 bits (977),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 168/239 (70%), Positives = 201/239 (84%), Gaps = 3/239 (1%)
 Frame = +2

Query  308   CMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDV  487
             C + F S    + +VSYD +AI+ING+R++L SGSIHYPRSTPEMW DLI KAK+GG+DV
Sbjct  15    CSLVFSS---VKATVSYDDRAIIINGRRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDV  71

Query  488   IETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWL  667
             IETYVFWN HEPSPG YNFEGRYDLV+FVK +QKAGLY +LRIGPY+C EWNFGGFP+WL
Sbjct  72    IETYVFWNGHEPSPGKYNFEGRYDLVKFVKLVQKAGLYVNLRIGPYVCAEWNFGGFPIWL  131

Query  668   KFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLG  847
             K++PG+ FR DN+PFK+AM+GF +KIVN+MKS  LFE QGGPII++QIENEYGP    +G
Sbjct  132   KYIPGMEFRTDNQPFKVAMQGFVQKIVNMMKSEKLFEPQGGPIIIAQIENEYGPVEWEIG  191

Query  848   ASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             A G  Y  W A+MAV + TGVPW+MCK+EDAPDPVI+TCNGFYC+ F PNKPYKP +WT
Sbjct  192   APGKAYTKWTAQMAVGLKTGVPWIMCKQEDAPDPVIDTCNGFYCEGFRPNKPYKPKMWT  250



>ref|XP_010262131.1| PREDICTED: beta-galactosidase isoform X1 [Nelumbo nucifera]
Length=847

 Score =   384 bits (986),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 197/226 (87%), Gaps = 0/226 (0%)
 Frame = +2

Query  347   SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPS  526
             SV+YD+KAIVING+RR+L SGSIHYPRSTPEMW DLI KAK+GG+DVI+TYVFWN HEPS
Sbjct  31    SVTYDQKAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  90

Query  527   PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNE  706
             PG Y FEGRYDLVRF+K +Q+AGLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR DN+
Sbjct  91    PGKYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNQ  150

Query  707   PFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAKM  886
             PFK AM+GFT+KIV++MK+  LF+SQGGPIILSQIENEYGP    +GA G  Y  WAA+M
Sbjct  151   PFKAAMQGFTKKIVDMMKAERLFQSQGGPIILSQIENEYGPVEWEIGAPGRAYTKWAAQM  210

Query  887   AVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AV + TGVPWVMCK++DAPDPVIN CNGFYCD F PNK YKP +WT
Sbjct  211   AVGLGTGVPWVMCKQDDAPDPVINACNGFYCDWFTPNKAYKPKMWT  256



>ref|XP_010262132.1| PREDICTED: beta-galactosidase isoform X2 [Nelumbo nucifera]
Length=842

 Score =   384 bits (986),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 197/226 (87%), Gaps = 0/226 (0%)
 Frame = +2

Query  347   SVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPS  526
             SV+YD+KAIVING+RR+L SGSIHYPRSTPEMW DLI KAK+GG+DVI+TYVFWN HEPS
Sbjct  31    SVTYDQKAIVINGKRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPS  90

Query  527   PGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADNE  706
             PG Y FEGRYDLVRF+K +Q+AGLY HLRIGPY+C EWNFGGFPVWLK+VPGISFR DN+
Sbjct  91    PGKYYFEGRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGISFRTDNQ  150

Query  707   PFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAKM  886
             PFK AM+GFT+KIV++MK+  LF+SQGGPIILSQIENEYGP    +GA G  Y  WAA+M
Sbjct  151   PFKAAMQGFTKKIVDMMKAERLFQSQGGPIILSQIENEYGPVEWEIGAPGRAYTKWAAQM  210

Query  887   AVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             AV + TGVPWVMCK++DAPDPVIN CNGFYCD F PNK YKP +WT
Sbjct  211   AVGLGTGVPWVMCKQDDAPDPVINACNGFYCDWFTPNKAYKPKMWT  256



>ref|XP_007138730.1| hypothetical protein PHAVU_009G232500g [Phaseolus vulgaris]
 gb|ESW10724.1| hypothetical protein PHAVU_009G232500g [Phaseolus vulgaris]
Length=722

 Score =   380 bits (977),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/241 (73%), Positives = 201/241 (83%), Gaps = 1/241 (0%)
 Frame = +2

Query  302   VLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGV  481
             VL ++F    G+T  SV+YD KAIVI+G+RR+L SGSIHYPRSTP+MW DLI KAK+GGV
Sbjct  10    VLMLLFLWVCGVT-ASVTYDHKAIVIDGKRRILISGSIHYPRSTPQMWPDLIQKAKDGGV  68

Query  482   DVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPV  661
             DVI+TYVFWN HEPSPG Y FE RYDLVRFVK +Q+AGLY HLRIGPYIC EWNFGGFPV
Sbjct  69    DVIQTYVFWNGHEPSPGKYYFEDRYDLVRFVKVVQQAGLYVHLRIGPYICAEWNFGGFPV  128

Query  662   WLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKV  841
             WLK+VPG++FR DNEPFK AM+ FT KIV+LMK   LF+SQGGPII+SQIENEYGP    
Sbjct  129   WLKYVPGMAFRTDNEPFKAAMQKFTAKIVSLMKEERLFQSQGGPIIMSQIENEYGPVEWE  188

Query  842   LGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIW  1021
             +GA G  Y  WAA+MAV +DTGVPWVMCK+EDAPDPVI+TCNGFYC+ F PNK  KP +W
Sbjct  189   IGAPGKAYTKWAAQMAVGLDTGVPWVMCKQEDAPDPVIDTCNGFYCENFKPNKNTKPKMW  248

Query  1022  T  1024
             T
Sbjct  249   T  249



>ref|XP_006357461.1| PREDICTED: beta-galactosidase-like, partial [Solanum tuberosum]
Length=866

 Score =   384 bits (986),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 193/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  344   CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEP  523
             CSVSYDR AI++NGQRR+L SGSIHYPRSTPEMW DLI KAKEGGVDVI+TYVFWN HEP
Sbjct  53    CSVSYDRNAIIVNGQRRILVSGSIHYPRSTPEMWPDLIQKAKEGGVDVIQTYVFWNGHEP  112

Query  524   SPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADN  703
               G Y FE RYDLV+F+K + +AGLY HLR+GPY C EWNFGGFPVWLK+VPGISFR DN
Sbjct  113   EQGKYYFEERYDLVKFIKIVHQAGLYVHLRVGPYACAEWNFGGFPVWLKYVPGISFRTDN  172

Query  704   EPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAK  883
             EPFK AM+ FT KIVN+MK+  L+ESQGGPIILSQIENEYGP  K LG  G  Y  WAAK
Sbjct  173   EPFKSAMQKFTTKIVNMMKAERLYESQGGPIILSQIENEYGPIEKRLGEPGKSYSDWAAK  232

Query  884   MAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             MA+++ TGVPWVMCK++DAPDPVINTCNGFYCD F+PNK YKP IWT
Sbjct  233   MALDLGTGVPWVMCKQDDAPDPVINTCNGFYCDYFSPNKAYKPKIWT  279



>ref|XP_010062625.1| PREDICTED: beta-galactosidase 1 [Eucalyptus grandis]
Length=825

 Score =   383 bits (983),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 177/246 (72%), Positives = 200/246 (81%), Gaps = 4/246 (2%)
 Frame = +2

Query  299   LVLCMVFFLSSGL----TQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKA  466
             LVL  V  LS G+       SVSYD KAIVINGQRR+L SGSIHYPRSTPEMW DLI KA
Sbjct  5     LVLWNVLGLSLGVCVFSVLASVSYDSKAIVINGQRRILISGSIHYPRSTPEMWPDLIEKA  64

Query  467   KEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNF  646
             KEGG+DVI+TYVFWN HEPSPG Y FEG YDLV+F+K  ++AGLY HLRIGPY+C EWNF
Sbjct  65    KEGGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLAKQAGLYVHLRIGPYVCAEWNF  124

Query  647   GGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYG  826
             GGFPVWLK++PGI+FR DNEPFK  M+ F  KIVN+MK+  LFESQGGPIILSQIENEYG
Sbjct  125   GGFPVWLKYIPGINFRTDNEPFKYQMQKFATKIVNMMKAERLFESQGGPIILSQIENEYG  184

Query  827   PQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPY  1006
             P    +GA G  Y  WAAKMA+ +D GVPWVMCK++DAPDP+INTCNGFYCD F+PNK Y
Sbjct  185   PMEYEIGAPGQVYTQWAAKMALNLDIGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAY  244

Query  1007  KPAIWT  1024
             KP +WT
Sbjct  245   KPTMWT  250



>ref|XP_009599425.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=725

 Score =   380 bits (975),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 197/228 (86%), Gaps = 0/228 (0%)
 Frame = +2

Query  341   QCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHE  520
             + +VSYD +AI+ING+R++L SGSIHYPRSTPEMW DLI KAK+GG+DVIETYVFWN HE
Sbjct  23    KATVSYDDRAILINGKRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIETYVFWNGHE  82

Query  521   PSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRAD  700
             PSPG YNFEGRYDL++FVK +QKAGLY +LRIGPY+C EWNFGGFPVWLK+VPG+ FR D
Sbjct  83    PSPGKYNFEGRYDLIKFVKLVQKAGLYVNLRIGPYVCAEWNFGGFPVWLKYVPGMEFRTD  142

Query  701   NEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAA  880
             N+PFK+AM+GF ++IVN+MKS  LFE QGGPII++QIENEYGP    +GA G  Y  W A
Sbjct  143   NQPFKVAMQGFVQRIVNMMKSEKLFEPQGGPIIIAQIENEYGPVEWEIGAPGKAYTKWTA  202

Query  881   KMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             +MAV + TGVPW+MCK+EDAPDPVI+TCNGFYC+ F PNKPYKP +WT
Sbjct  203   QMAVSLKTGVPWIMCKQEDAPDPVIDTCNGFYCEGFRPNKPYKPKMWT  250



>ref|XP_003531618.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
 gb|KHN11289.1| Beta-galactosidase 1 [Glycine soja]
Length=843

 Score =   383 bits (984),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 203/249 (82%), Gaps = 2/249 (1%)
 Frame = +2

Query  284   MRKWVLVLCMVFFLSSGLTQCS--VSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLI  457
             ++ W + L +V F  S L Q S  VSYD KAI+INGQRR+L SGSIHYPRSTPEMW DLI
Sbjct  6     LKVWNVPLLLVVFACSLLGQASASVSYDHKAIIINGQRRILLSGSIHYPRSTPEMWPDLI  65

Query  458   SKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGE  637
              KAKEGG+DVI+TYVFWN HEPSPG Y F G YDLVRF+K +Q+AGLY +LRIGPY+C E
Sbjct  66    QKAKEGGLDVIQTYVFWNGHEPSPGKYYFGGNYDLVRFIKLVQQAGLYVNLRIGPYVCAE  125

Query  638   WNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIEN  817
             WNFGGFPVWLK++PGISFR DN PFK  M+ FT+KIV++MK+  LFESQGGPIILSQIEN
Sbjct  126   WNFGGFPVWLKYIPGISFRTDNGPFKFQMEKFTKKIVDMMKAERLFESQGGPIILSQIEN  185

Query  818   EYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPN  997
             EYGP    +GA G  Y  WAA MAV + TGVPW+MCK++DAPDP+INTCNGFYCD F+PN
Sbjct  186   EYGPMEYEIGAPGRSYTQWAAHMAVGLGTGVPWIMCKQDDAPDPIINTCNGFYCDYFSPN  245

Query  998   KPYKPAIWT  1024
             K YKP +WT
Sbjct  246   KAYKPKMWT  254



>ref|XP_009409593.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=712

 Score =   379 bits (974),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 192/232 (83%), Gaps = 0/232 (0%)
 Frame = +2

Query  329   SGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFW  508
             S     SVSYD KAI++NGQRR+L SGSIHYPRSTPEMW DLI KAK+GG+DVI+TYVFW
Sbjct  9     SSPVDASVSYDHKAIIVNGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFW  68

Query  509   NVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGIS  688
             N HEPSPG Y F G YDLVRF+K +++AGLY HLRIGPY+C EWNFGGFPVWLK+VPGI+
Sbjct  69    NGHEPSPGQYYFGGNYDLVRFIKLVKQAGLYVHLRIGPYVCAEWNFGGFPVWLKYVPGIT  128

Query  689   FRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYV  868
             FR DNEPFK AM  FTEKIV +MKS  LFESQGGPIILSQIENEYGP     G     YV
Sbjct  129   FRTDNEPFKAAMAKFTEKIVAMMKSEGLFESQGGPIILSQIENEYGPMENFGGDGAKNYV  188

Query  869   TWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
              WAA+MAV ++T VPWVMCK++DAPDPVIN CNGFYCD F+PNKPYKP +WT
Sbjct  189   NWAAQMAVGLNTSVPWVMCKQDDAPDPVINACNGFYCDYFSPNKPYKPTMWT  240



>ref|XP_011072510.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=842

 Score =   383 bits (983),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 176/243 (72%), Positives = 200/243 (82%), Gaps = 0/243 (0%)
 Frame = +2

Query  296   VLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEG  475
             +LVL +VF       + SVSYD K+I ING+R++L SGSIHYPRSTPEMW DLI KAKEG
Sbjct  13    LLVLLVVFSSWISCGEGSVSYDSKSISINGRRKILISGSIHYPRSTPEMWPDLIQKAKEG  72

Query  476   GVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGF  655
             GVDVI+TYVFWN HEP PG Y FEGRYDLV+F+K +Q+AGLY HLRIGPY C EWNFGGF
Sbjct  73    GVDVIQTYVFWNGHEPEPGKYYFEGRYDLVKFIKLVQEAGLYVHLRIGPYACAEWNFGGF  132

Query  656   PVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQA  835
             PVWLK+VPGISFR DN PFK AM+ FT KIVN+MKS  L+E+QGGPIILSQIENEYGP  
Sbjct  133   PVWLKYVPGISFRTDNGPFKAAMQKFTTKIVNMMKSEKLYETQGGPIILSQIENEYGPME  192

Query  836   KVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPA  1015
               LG  G  Y  WAAKMAV++ TGVPWVMCK++DAPDP+INTCNGFYCD F+PNK YKP 
Sbjct  193   YELGEPGRAYTEWAAKMAVDLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPK  252

Query  1016  IWT  1024
             +WT
Sbjct  253   MWT  255



>gb|KHN32687.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score =   382 bits (982),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 173/244 (71%), Positives = 202/244 (83%), Gaps = 1/244 (0%)
 Frame = +2

Query  293   WVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKE  472
             W + L +VF L  G  + SVSYD KAI INGQRR+L SGSIHYPRSTPEMW DLI KAK+
Sbjct  2     WNVALLLVFSLI-GSAKASVSYDSKAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKD  60

Query  473   GGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGG  652
             GG+DVI+TYVFWN HEPSPG Y FEG YDLV+F+K +Q+AGLY HLRIGPY+C EWNFGG
Sbjct  61    GGLDVIQTYVFWNGHEPSPGKYYFEGNYDLVKFIKLVQQAGLYVHLRIGPYVCAEWNFGG  120

Query  653   FPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQ  832
             FPVWLK++PGISFR DNEPFK  M+ FT KIV+LMK+  L+ESQGGPII+SQIENEYGP 
Sbjct  121   FPVWLKYIPGISFRTDNEPFKHQMQKFTTKIVDLMKAERLYESQGGPIIMSQIENEYGPM  180

Query  833   AKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKP  1012
                +GA+G  Y  WAA+MA+ + TGVPWVMCK++D PDP+INTCNGFYCD F+PNK YKP
Sbjct  181   EYEIGAAGKAYTKWAAEMAMGLGTGVPWVMCKQDDTPDPLINTCNGFYCDYFSPNKAYKP  240

Query  1013  AIWT  1024
              +WT
Sbjct  241   KMWT  244



>gb|KCW53601.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=696

 Score =   379 bits (972),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  344   CSVSYDRKAIVINGQRRVLFSGSIHYPRSTPEMWEDLISKAKEGGVDVIETYVFWNVHEP  523
              SVSYD KAI INGQRR+L SGSIHYPRSTPEMW DLI KAKEGG+DVI+TYVFWN HEP
Sbjct  29    ASVSYDAKAITINGQRRILISGSIHYPRSTPEMWPDLIRKAKEGGLDVIQTYVFWNGHEP  88

Query  524   SPGNYNFEGRYDLVRFVKTIQKAGLYAHLRIGPYICGEWNFGGFPVWLKFVPGISFRADN  703
             SPG YNFEG YD+V+FVK  Q+AGLY HLR+GPY+C EWNFGGFPVWLK+V GISFR DN
Sbjct  89    SPGKYNFEGNYDIVKFVKLAQQAGLYVHLRVGPYVCAEWNFGGFPVWLKYVRGISFRTDN  148

Query  704   EPFKMAMKGFTEKIVNLMKSHNLFESQGGPIILSQIENEYGPQAKVLGASGHQYVTWAAK  883
              PFK  M+ FT KIVN+MK+  LFESQGGPIILSQIENEYGP    +GASG  Y  WAA+
Sbjct  149   GPFKYYMQKFTTKIVNMMKAEWLFESQGGPIILSQIENEYGPMEYEIGASGRAYTKWAAE  208

Query  884   MAVEMDTGVPWVMCKEEDAPDPVINTCNGFYCDKFAPNKPYKPAIWT  1024
             MAV + TGVPWVMCK++DAPDP+INTCNGFYCD F+PNK YKP +WT
Sbjct  209   MAVGLGTGVPWVMCKQDDAPDPIINTCNGFYCDYFSPNKAYKPKMWT  255



>gb|KDO57765.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=710

 Score =   379 bits (973),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 209/260 (80%), Gaps = 0/260 (0%)
 Frame = +2

Query  245   QELALREKLRGGAMRKWVLVLCMVFFLSSGLTQCSVSYDRKAIVINGQRRVLFSGSIHYP  424
             +++ ++ K+ G  ++  +LVL           + SVSYD KA++INGQ+R+L SGSIHYP
Sbjct  4     KQVLVKWKMLGANVKVLMLVLLSFCSWEISFVKASVSYDHKAVIINGQKRILISGSIHYP  63

Query  425   RSTPEMWEDLISKAKEGGVDVIETYVFWNVHEPSPGNYNFEGRYDLVRFVKTIQKAGLYA  604
             RSTPEMW DLI KAK+GG+DVI+TYVFWN HEP+ GNY F+ RYDLVRF+K +Q+AGLY 
Sbjct  64    RSTPEMWPDLIQKAKDGGLDVIQTYVFWNGHEPTQGNYYFQDRYDLVRFIKLVQQAGLYV  123

Query  605   HLRIGPYICGEWNFGGFPVWLKFVPGISFRADNEPFKMAMKGFTEKIVNLMKSHNLFESQ  784
             HLRIGPY+C EWN+GGFPVWLK+VPGI FR DN PFK AM  FTEKIV++MK+  LF++Q
Sbjct  124   HLRIGPYVCAEWNYGGFPVWLKYVPGIEFRTDNGPFKAAMHKFTEKIVSMMKAEKLFQTQ  183

Query  785   GGPIILSQIENEYGPQAKVLGASGHQYVTWAAKMAVEMDTGVPWVMCKEEDAPDPVINTC  964
             GGPIILSQIENE+GP    +GA G  Y  WAA+MAV ++TGVPWVMCK++DAPDPVINTC
Sbjct  184   GGPIILSQIENEFGPVEWDIGAPGKAYAKWAAQMAVGLNTGVPWVMCKQDDAPDPVINTC  243

Query  965   NGFYCDKFAPNKPYKPAIWT  1024
             NGFYC+KF PN+ YKP +WT
Sbjct  244   NGFYCEKFVPNQNYKPKMWT  263



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2597779137181