BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9025

Length=832
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008337091.1|  PREDICTED: uncharacterized aarF domain-conta...    320   6e-106   
ref|XP_006355214.1|  PREDICTED: uncharacterized protein LOC102585966    339   2e-105   Solanum tuberosum [potatoes]
ref|XP_004246076.1|  PREDICTED: uncharacterized protein LOC101247741    337   2e-104   Solanum lycopersicum
ref|XP_009622901.1|  PREDICTED: uncharacterized protein LOC104114...    331   2e-102   Nicotiana tomentosiformis
ref|XP_009403302.1|  PREDICTED: uncharacterized aarF domain-conta...    331   2e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008391427.1|  PREDICTED: uncharacterized protein LOC103453649    330   7e-102   
ref|XP_006483623.1|  PREDICTED: uncharacterized aarF domain-conta...    318   1e-101   
ref|XP_002527984.1|  Ubiquinone biosynthesis protein coq-8, putative    329   2e-101   Ricinus communis
ref|XP_007225353.1|  hypothetical protein PRUPE_ppa000948mg             329   2e-101   Prunus persica
ref|XP_008219987.1|  PREDICTED: uncharacterized protein LOC103320...    329   2e-101   Prunus mume [ume]
ref|XP_009367941.1|  PREDICTED: uncharacterized protein LOC103957500    328   3e-101   Pyrus x bretschneideri [bai li]
ref|XP_011082268.1|  PREDICTED: uncharacterized protein LOC105165093    328   5e-101   Sesamum indicum [beniseed]
emb|CBI20791.3|  unnamed protein product                                322   5e-101   Vitis vinifera
gb|EYU22093.1|  hypothetical protein MIMGU_mgv1a000993mg                327   6e-101   Erythranthe guttata [common monkey flower]
ref|XP_009798287.1|  PREDICTED: uncharacterized protein LOC104244540    327   6e-101   Nicotiana sylvestris
ref|XP_011003019.1|  PREDICTED: uncharacterized aarF domain-conta...    306   1e-100   Populus euphratica
ref|XP_009375716.1|  PREDICTED: uncharacterized protein LOC103964508    327   1e-100   Pyrus x bretschneideri [bai li]
ref|XP_006850925.1|  PREDICTED: uncharacterized protein LOC18440724     326   1e-100   Amborella trichopoda
ref|XP_011003016.1|  PREDICTED: uncharacterized aarF domain-conta...    306   2e-100   Populus euphratica
ref|XP_011003015.1|  PREDICTED: uncharacterized aarF domain-conta...    307   2e-100   Populus euphratica
ref|XP_008798142.1|  PREDICTED: uncharacterized protein LOC103713...    325   4e-100   Phoenix dactylifera
ref|XP_008798143.1|  PREDICTED: uncharacterized protein LOC103713...    325   4e-100   
ref|XP_011003022.1|  PREDICTED: probable serine/threonine-protein...    303   1e-99    Populus euphratica
ref|XP_010927205.1|  PREDICTED: uncharacterized protein LOC105049295    324   1e-99    Elaeis guineensis
ref|XP_004291221.1|  PREDICTED: uncharacterized protein LOC101315016    324   1e-99    Fragaria vesca subsp. vesca
gb|KDO67203.1|  hypothetical protein CISIN_1g002031mg                   316   3e-99    Citrus sinensis [apfelsine]
ref|XP_006286769.1|  hypothetical protein CARUB_v10003319mg             323   4e-99    Capsella rubella
gb|KDO67201.1|  hypothetical protein CISIN_1g002031mg                   316   4e-99    Citrus sinensis [apfelsine]
ref|XP_002283043.1|  PREDICTED: uncharacterized protein LOC100242...    323   6e-99    Vitis vinifera
ref|XP_010541528.1|  PREDICTED: uncharacterized protein LOC104814...    322   7e-99    Tarenaya hassleriana [spider flower]
gb|KDO67202.1|  hypothetical protein CISIN_1g002031mg                   316   8e-99    Citrus sinensis [apfelsine]
ref|XP_007011534.1|  ABC1 family protein                                321   1e-98    
gb|KJB55249.1|  hypothetical protein B456_009G069300                    321   2e-98    Gossypium raimondii
ref|XP_010541526.1|  PREDICTED: uncharacterized protein LOC104814...    322   2e-98    Tarenaya hassleriana [spider flower]
gb|KHG17463.1|  putative aarF domain-containing protein kinase 1        322   2e-98    Gossypium arboreum [tree cotton]
ref|XP_010421323.1|  PREDICTED: uncharacterized protein LOC104706794    321   3e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010470869.1|  PREDICTED: uncharacterized protein LOC104750728    321   3e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010541525.1|  PREDICTED: uncharacterized protein LOC104814...    321   3e-98    Tarenaya hassleriana [spider flower]
ref|XP_007161530.1|  hypothetical protein PHAVU_001G077100g             320   3e-98    Phaseolus vulgaris [French bean]
ref|XP_012076305.1|  PREDICTED: uncharacterized protein LOC105637451    320   3e-98    Jatropha curcas
emb|CDX88133.1|  BnaA06g27240D                                          320   4e-98    
ref|XP_010263230.1|  PREDICTED: uncharacterized protein LOC104601555    320   5e-98    Nelumbo nucifera [Indian lotus]
ref|XP_003544660.1|  PREDICTED: uncharacterized protein LOC100802...    320   5e-98    Glycine max [soybeans]
emb|CDX80470.1|  BnaC07g29740D                                          320   6e-98    
ref|XP_009151006.1|  PREDICTED: uncharacterized protein LOC103874346    320   6e-98    Brassica rapa
ref|XP_006394732.1|  hypothetical protein EUTSA_v10003586mg             320   8e-98    Eutrema salsugineum [saltwater cress]
ref|XP_008360489.1|  PREDICTED: uncharacterized protein LOC103424180    319   8e-98    
ref|XP_003550103.1|  PREDICTED: uncharacterized protein LOC100775...    319   1e-97    Glycine max [soybeans]
ref|NP_568458.1|  ABC1 family protein                                   320   1e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011045052.1|  PREDICTED: uncharacterized protein LOC105140...    318   1e-97    Populus euphratica
ref|NP_001058483.1|  Os06g0701300                                       311   1e-97    
ref|XP_010049790.1|  PREDICTED: uncharacterized protein LOC104438365    318   1e-97    Eucalyptus grandis [rose gum]
ref|XP_011045051.1|  PREDICTED: uncharacterized protein LOC105140...    318   2e-97    Populus euphratica
ref|XP_011003023.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    316   2e-97    Populus euphratica
gb|EPS66438.1|  hypothetical protein M569_08337                         317   3e-97    Genlisea aurea
gb|KDO67191.1|  hypothetical protein CISIN_1g002031mg                   317   6e-97    Citrus sinensis [apfelsine]
gb|KDO67192.1|  hypothetical protein CISIN_1g002031mg                   317   7e-97    Citrus sinensis [apfelsine]
ref|XP_006483617.1|  PREDICTED: uncharacterized aarF domain-conta...    317   9e-97    Citrus sinensis [apfelsine]
ref|XP_006450111.1|  hypothetical protein CICLE_v10007354mg             317   1e-96    Citrus clementina [clementine]
ref|XP_002874225.1|  ABC1 family protein                                317   1e-96    Arabidopsis lyrata subsp. lyrata
ref|XP_002438956.1|  hypothetical protein SORBIDRAFT_10g028960          304   1e-96    
gb|KGN60194.1|  hypothetical protein Csa_3G888530                       316   1e-96    Cucumis sativus [cucumbers]
ref|XP_004136301.1|  PREDICTED: uncharacterized protein LOC101216220    316   1e-96    Cucumis sativus [cucumbers]
ref|XP_006371822.1|  hypothetical protein POPTR_0018s03950g             315   2e-96    
gb|EMT12092.1|  hypothetical protein F775_11904                         303   3e-96    
ref|XP_006371820.1|  hypothetical protein POPTR_0018s03950g             315   3e-96    
ref|XP_006371821.1|  hypothetical protein POPTR_0018s03950g             315   3e-96    Populus trichocarpa [western balsam poplar]
ref|XP_008466267.1|  PREDICTED: uncharacterized protein LOC103503727    315   3e-96    Cucumis melo [Oriental melon]
ref|XP_004498548.1|  PREDICTED: uncharacterized protein LOC101504060    313   9e-96    Cicer arietinum [garbanzo]
ref|XP_010112151.1|  hypothetical protein L484_019890                   313   2e-95    
ref|XP_006371818.1|  hypothetical protein POPTR_0018s03930g             312   2e-95    
dbj|BAJ86975.1|  predicted protein                                      312   3e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009129999.1|  PREDICTED: uncharacterized protein LOC103854785    311   1e-94    Brassica rapa
ref|XP_010432830.1|  PREDICTED: uncharacterized protein LOC104717024    310   2e-94    Camelina sativa [gold-of-pleasure]
emb|CDY05396.1|  BnaC02g41040D                                          311   2e-94    
ref|XP_003563512.1|  PREDICTED: uncharacterized protein LOC100845...    310   2e-94    Brachypodium distachyon [annual false brome]
emb|CDY05459.1|  BnaA02g32320D                                          311   2e-94    
gb|AES58845.2|  ABC1 family protein                                     306   5e-94    Medicago truncatula
ref|XP_003588594.1|  aarF domain-containing protein kinase, putative    307   2e-93    
ref|XP_006656445.1|  PREDICTED: uncharacterized protein LOC102706948    306   3e-93    Oryza brachyantha
ref|XP_008648079.1|  PREDICTED: uncharacterized protein LOC100382...    306   7e-93    
gb|AGT16406.1|  hypothetical protein SHCRBa_024_H17_F_120               306   8e-93    Saccharum hybrid cultivar R570
ref|XP_006371847.1|  hypothetical protein POPTR_0018s04280g             286   1e-92    
ref|XP_004966108.1|  PREDICTED: uncharacterized protein LOC101759876    305   2e-92    Setaria italica
ref|XP_011008661.1|  PREDICTED: uncharacterized protein LOC105113984    302   2e-91    Populus euphratica
ref|NP_001190388.1|  ABC1 family protein                                303   2e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010669479.1|  PREDICTED: uncharacterized protein LOC104886...    298   5e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010669478.1|  PREDICTED: uncharacterized protein LOC104886...    298   6e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006382184.1|  ABC1 family protein                                296   3e-89    
ref|XP_009403305.1|  PREDICTED: uncharacterized protein LOC103986888    290   2e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003588582.1|  aarF domain-containing protein kinase, putative    288   9e-87    
gb|EEC81263.1|  hypothetical protein OsI_24357                          283   2e-84    Oryza sativa Indica Group [Indian rice]
gb|EEE66303.1|  hypothetical protein OsJ_22534                          283   2e-84    Oryza sativa Japonica Group [Japonica rice]
gb|KFK27753.1|  hypothetical protein AALP_AA8G424500                    279   6e-83    Arabis alpina [alpine rockcress]
gb|EPS65049.1|  hypothetical protein M569_09728                         266   2e-79    Genlisea aurea
ref|XP_010227425.1|  PREDICTED: uncharacterized protein LOC100845...    259   7e-76    
ref|XP_011016557.1|  PREDICTED: uncharacterized aarF domain-conta...    238   7e-75    Populus euphratica
ref|XP_002965001.1|  hypothetical protein SELMODRAFT_266894             245   1e-70    
ref|XP_001766095.1|  predicted protein                                  242   1e-69    
ref|XP_002977076.1|  hypothetical protein SELMODRAFT_106221             239   2e-68    
ref|XP_001767436.1|  predicted protein                                  234   9e-67    
ref|XP_010454806.1|  PREDICTED: uncharacterized protein LOC104736503    214   1e-59    Camelina sativa [gold-of-pleasure]
ref|XP_002965004.1|  hypothetical protein SELMODRAFT_439199             208   5e-57    
ref|XP_007011535.1|  ABC1 family protein, putative                      192   2e-52    
ref|XP_004365160.1|  ABC1 family protein                                174   5e-45    Capsaspora owczarzaki ATCC 30864
ref|XP_009033315.1|  hypothetical protein AURANDRAFT_20383              161   2e-43    Aureococcus anophagefferens
ref|XP_001743916.1|  hypothetical protein                               155   2e-41    Monosiga brevicollis MX1
emb|CBJ30466.1|  conserved unknown protein                              160   2e-40    Ectocarpus siliculosus
ref|XP_002977079.1|  hypothetical protein SELMODRAFT_443434             157   1e-39    
ref|XP_004997282.1|  serine/threonine protein kinase                    159   1e-39    Salpingoeca rosetta
emb|CDJ60647.1|  hypothetical protein EMWEY_00033290                    139   1e-35    Eimeria maxima
emb|CDI87049.1|  ABC1 family beta-lactamase, putative                   144   8e-35    Eimeria praecox
emb|CDI84207.1|  hypothetical protein EAH_00014140                      144   9e-35    Eimeria acervulina
emb|CDJ47204.1|  ABC1 family beta-lactamase, putative                   144   1e-34    Eimeria brunetti
ref|XP_008370903.1|  PREDICTED: uncharacterized protein LOC103434348    131   4e-34    
emb|CDJ37043.1|  hypothetical protein ETH_00005180                      142   5e-34    Eimeria tenella
ref|XP_002367048.1|  ABC1 family beta-lactamase, putative               142   7e-34    Toxoplasma gondii ME49
gb|KFH16184.1|  ABC1 family protein                                     142   1e-33    Toxoplasma gondii MAS
gb|KFH12447.1|  ABC1 family protein                                     142   1e-33    Toxoplasma gondii VAND
gb|KFG47948.1|  ABC1 family protein                                     142   1e-33    Toxoplasma gondii p89
gb|ESS34195.1|  ABC1 family protein                                     142   1e-33    Toxoplasma gondii VEG
gb|KFG64585.1|  ABC1 family protein                                     142   1e-33    Toxoplasma gondii RUB
emb|CDJ68611.1|  ABC1 family beta-lactamase, putative                   141   1e-33    Eimeria necatrix
gb|KFG53925.1|  ABC1 family protein                                     141   2e-33    Toxoplasma gondii FOU
gb|EPR63601.1|  ABC1 family protein                                     141   2e-33    Toxoplasma gondii GT1
ref|XP_008219989.1|  PREDICTED: uncharacterized protein LOC103320...    140   2e-33    Prunus mume [ume]
emb|CDJ31169.1|  Beta-lactamase family protein, related                 140   2e-33    Eimeria mitis
ref|XP_002139221.1|  ABC1 family protein                                133   6e-33    Cryptosporidium muris RN66
ref|XP_008883720.1|  ABC1 family protein                                138   1e-32    
gb|KJB55250.1|  hypothetical protein B456_009G069300                    137   2e-32    Gossypium raimondii
ref|XP_003885939.1|  putative ABC1 family beta-lactamase                135   1e-31    Neospora caninum Liverpool
ref|WP_013767326.1|  ABC transporter                                    131   3e-31    Haliscomenobacter hydrossis
ref|XP_674400.1|  hypothetical protein                                  129   7e-31    
gb|KDO67199.1|  hypothetical protein CISIN_1g002031mg                   132   1e-30    Citrus sinensis [apfelsine]
ref|WP_038682564.1|  hypothetical protein                               129   2e-30    Rubrobacter radiotolerans
gb|EUD73740.1|  Atypical/ABC1 protein kinase                            129   3e-30    Plasmodium vinckei petteri
gb|EWM21892.1|  abc1 family protein                                     130   4e-30    Nannochloropsis gaditana
ref|XP_008890245.1|  hypothetical protein PPTG_00585                    127   9e-30    Phytophthora parasitica INRA-310
gb|ETK96708.1|  hypothetical protein L915_00641                         127   1e-29    Phytophthora parasitica
emb|CDU21766.1|  atypical protein kinase, ABC-1 family, putative        129   2e-29    
ref|WP_022984014.1|  hypothetical protein                               125   2e-29    Alcanivorax sp. P2S70
ref|WP_035248985.1|  ABC transporter                                    125   3e-29    Alcanivorax jadensis
emb|CDU21353.1|  atypical protein kinase, ABC-1 family, putative        128   4e-29    
ref|XP_002902200.1|  glycoside hydrolase, putative                      125   4e-29    Phytophthora infestans T30-4
gb|ETB59539.1|  hypothetical protein, variant 1                         127   7e-29    Plasmodium yoelii 17X
gb|ETB59538.1|  hypothetical protein YYC_02994                          127   8e-29    Plasmodium yoelii 17X
emb|CDU85136.1|  atypical protein kinase, ABC-1 family, putative        127   8e-29    Plasmodium yoelii
ref|XP_005535054.1|  unknown kinase with aarF domain, fused with ...    127   9e-29    Cyanidioschyzon merolae strain 10D
ref|WP_045120201.1|  hypothetical protein                               124   9e-29    
emb|CDZ16902.1|  atypical protein kinase, ABC-1 family, putative        127   9e-29    
ref|XP_008624003.1|  Atypical/ABC1 protein kinase                       127   1e-28    Plasmodium vinckei vinckei
ref|WP_027420298.1|  hypothetical protein                               124   1e-28    Crocinitomix catalasitica
gb|ACY14511.1|  ABC-1 domain protein                                    124   1e-28    Haliangium ochraceum DSM 14365
ref|XP_004828896.1|  hypothetical protein BEWA_020770                   125   4e-28    Theileria equi strain WA
gb|EKD51091.1|  hypothetical protein ACD_62C00350G0019                  122   8e-28    uncultured bacterium
ref|WP_015738287.1|  ABC-1 domain-containing protein                    121   1e-27    Ammonifex degensii
ref|XP_011128574.1|  putative of plant or bacterial origin              121   7e-27    Gregarina niphandrodes
ref|XP_010696179.1|  PREDICTED: uncharacterized aarF domain-conta...    117   9e-27    
gb|AHK78811.1|  ABC transporter                                         118   9e-27    Ectothiorhodospira haloalkaliphila
ref|WP_027356835.1|  ABC transporter                                    119   1e-26    Desulfofundulus thermocisternus
ref|XP_005772328.1|  hypothetical protein EMIHUDRAFT_444785             119   1e-26    Emiliania huxleyi CCMP1516
gb|AHG92313.1|  ABC-1 domain-containing protein                         117   2e-26    Gemmatirosa kalamazoonesis
ref|XP_005709275.1|  aarF domain-containing kinase                      117   2e-26    Galdieria sulphuraria
ref|XP_005783551.1|  ABC family protein                                 118   2e-26    Emiliania huxleyi CCMP1516
ref|XP_008817520.1|  Atypical/ABC1 protein kinase                       120   3e-26    Plasmodium inui San Antonio 1
ref|XP_010696177.1|  PREDICTED: uncharacterized aarF domain-conta...    116   3e-26    Beta vulgaris subsp. vulgaris [field beet]
gb|EDX89446.1|  ABC1 family protein                                     117   3e-26    Alcanivorax sp. DG881
emb|CCF74655.1|  unnamed protein product                                119   3e-26    
ref|WP_041581201.1|  hypothetical protein                               117   4e-26    
ref|WP_027725713.1|  hypothetical protein                               115   4e-26    Tuberibacillus calidus
gb|AGK55351.1|  hypothetical protein B1NLA3E_18035                      117   4e-26    Bacillus sp. 1NLA3E
ref|XP_007472793.1|  PREDICTED: uncharacterized aarF domain-conta...    116   4e-26    Monodelphis domestica
ref|WP_012594648.1|  MULTISPECIES: hypothetical protein                 117   4e-26    Cyanothece
emb|CDR96921.1|  beta-lactamase family protein, putative                119   6e-26    Babesia bigemina
ref|WP_003352824.1|  ABC transporter                                    116   6e-26    Bacillus smithii
ref|WP_039927528.1|  ABC transporter                                    113   7e-26    
emb|CDR36674.1|  CYFA0S01e03488g1_1                                     116   8e-26    Cyberlindnera fabianii
gb|KHN34388.1|  Putative serine/threonine-protein kinase abkB           115   8e-26    Glycine soja [wild soybean]
ref|XP_001616808.1|  hypothetical protein                               118   9e-26    Plasmodium vivax
ref|XP_001418611.1|  predicted protein                                  113   1e-25    Ostreococcus lucimarinus CCE9901
ref|WP_035463079.1|  hypothetical protein                               114   1e-25    
ref|XP_764917.1|  ABC1 protein                                          118   1e-25    Theileria parva strain Muguga
ref|XP_007472792.1|  PREDICTED: uncharacterized aarF domain-conta...    116   1e-25    Monodelphis domestica
ref|WP_035231376.1|  ABC transporter                                    115   1e-25    Alcanivorax nanhaiticus
ref|XP_003525637.1|  PREDICTED: uncharacterized aarF domain-conta...    114   2e-25    Glycine max [soybeans]
ref|XP_002260847.1|  protein kinase                                     117   2e-25    Plasmodium knowlesi strain H
ref|XP_008865582.1|  hypothetical protein H310_03486                    115   2e-25    Aphanomyces invadans
gb|AIF06367.1|  ABC-1 domain-containing protein                         110   2e-25    uncultured marine thaumarchaeote KM3_191_E02
gb|KHN14080.1|  Hypothetical protein glysoja_033307                     114   2e-25    Glycine soja [wild soybean]
ref|WP_007551557.1|  protein kinase                                     114   2e-25    Nitrosarchaeum koreense
ref|XP_009522474.1|  hypothetical protein PHYSODRAFT_497640             114   2e-25    Phytophthora sojae
ref|WP_014965975.1|  MULTISPECIES: protein kinase                       114   3e-25    Nitrosopumilus
ref|XP_006476976.1|  PREDICTED: uncharacterized aarF domain-conta...    113   4e-25    
gb|AIF01855.1|  ABC-1 domain-containing protein                         113   4e-25    uncultured marine thaumarchaeote KM3_150_B03
ref|XP_002305258.2|  hypothetical protein POPTR_0004s07340g             113   4e-25    
gb|AIF06811.1|  putative protein kinase                                 113   4e-25    uncultured marine thaumarchaeote KM3_196_E01
ref|WP_020536755.1|  hypothetical protein                               114   5e-25    Lewinella cohaerens
gb|AIF01655.1|  putative protein kinase                                 109   5e-25    uncultured marine thaumarchaeote KM3_14_C04
ref|WP_008929554.1|  ABC transporter                                    113   5e-25    Alcanivorax hongdengensis
ref|XP_011015766.1|  PREDICTED: uncharacterized aarF domain-conta...    114   5e-25    Populus euphratica
ref|XP_952368.1|  ABC1-related protein                                  115   5e-25    Theileria annulata
ref|XP_011005926.1|  PREDICTED: uncharacterized aarF domain-conta...    114   6e-25    Populus euphratica
ref|XP_003550862.1|  PREDICTED: uncharacterized aarF domain-conta...    112   6e-25    Glycine max [soybeans]
ref|XP_006413380.1|  hypothetical protein EUTSA_v10027088mg             110   6e-25    
ref|XP_320250.2|  AGAP012287-PA                                         113   6e-25    Anopheles gambiae str. PEST
ref|XP_006476975.1|  PREDICTED: uncharacterized aarF domain-conta...    112   6e-25    Citrus sinensis [apfelsine]
ref|WP_045052988.1|  ABC transporter                                    113   6e-25    Aliterella atlantica
emb|CBJ48471.1|  conserved unknown protein                              113   7e-25    Ectocarpus siliculosus
ref|WP_013822906.1|  ABC transporter                                    113   8e-25    
gb|ETW45822.1|  hypothetical protein PFMALIP_06148                      115   9e-25    Plasmodium falciparum MaliPS096_E11
ref|WP_044107482.1|  hypothetical protein                               113   9e-25    cyanobacterium endosymbiont of Epithemia turgida
gb|KFB49811.1|  AGAP012287-PA-like protein                              112   1e-24    Anopheles sinensis
ref|XP_001348316.2|  Atypical protein kinase, ABC-1 family, putative    115   1e-24    
gb|AIF08841.1|  putative protein kinase                                 112   1e-24    uncultured marine thaumarchaeote KM3_33_B12
ref|XP_009690377.1|  uncharacterized protein TOT_020000340              114   1e-24    Theileria orientalis strain Shintoku
gb|EUT78640.1|  hypothetical protein PFAG_05215                         115   1e-24    Plasmodium falciparum Santa Lucia
gb|ETW58928.1|  hypothetical protein PFMC_05113                         115   2e-24    Plasmodium falciparum CAMP/Malaysia
gb|EWC74049.1|  hypothetical protein C923_05245                         114   2e-24    Plasmodium falciparum UGT5.1
ref|XP_004624946.1|  PREDICTED: uncharacterized aarF domain-conta...    112   2e-24    Octodon degus
gb|ETW40302.1|  hypothetical protein PFNF135_05344                      114   2e-24    Plasmodium falciparum NF135/5.C10
gb|ETW29210.1|  hypothetical protein PFFCH_03335                        114   2e-24    Plasmodium falciparum FCH/4
gb|ETW16230.1|  hypothetical protein PFFVO_04764                        114   2e-24    Plasmodium falciparum Vietnam Oak-Knoll (FVO)
ref|WP_009633994.1|  putative unusual protein kinase                    112   2e-24    Synechocystis sp. PCC 7509
ref|XP_004610349.1|  PREDICTED: uncharacterized aarF domain-conta...    112   2e-24    Sorex araneus [Eurasian shrew]
ref|XP_006440042.1|  hypothetical protein CICLE_v10020267mg             111   2e-24    
gb|KFK29020.1|  hypothetical protein AALP_AA7G078300                    111   2e-24    Arabis alpina [alpine rockcress]
gb|KHO45261.1|  ubiquinone biosynthesis protein                         112   2e-24    archaeon GW2011_AR4
ref|XP_003575213.1|  PREDICTED: uncharacterized aarF domain-conta...    113   2e-24    
ref|XP_009109235.1|  PREDICTED: uncharacterized aarF domain-conta...    111   2e-24    Brassica rapa
ref|WP_027724350.1|  ABC transporter                                    112   3e-24    Tuberibacillus calidus
gb|EYU23157.1|  hypothetical protein MIMGU_mgv1a005533mg                111   3e-24    Erythranthe guttata [common monkey flower]
ref|NP_001031709.1|  protein kinase family protein                      111   3e-24    Arabidopsis thaliana [mouse-ear cress]
ref|WP_044240828.1|  hypothetical protein                               112   3e-24    
ref|WP_027349433.1|  ubiquinone biosynthesis protein UbiB               111   3e-24    Halotalea alkalilenta
ref|WP_007223959.1|  ubiquinone biosynthesis protein UbiB               111   3e-24    marine gamma proteobacterium HTCC2143
gb|KDO69332.1|  hypothetical protein CISIN_1g045839mg                   110   3e-24    Citrus sinensis [apfelsine]
emb|CDY24848.1|  BnaA08g14620D                                          110   3e-24    Brassica napus [oilseed rape]
ref|XP_002670533.1|  predicted protein                                  112   3e-24    Naegleria gruberi strain NEG-M
ref|WP_037611223.1|  transporter                                        111   3e-24    Streptococcus sp. SR4
ref|XP_008838028.1|  PREDICTED: uncharacterized aarF domain-conta...    111   3e-24    
ref|WP_004182566.1|  transporter                                        111   3e-24    Streptococcus salivarius
ref|WP_024545946.1|  hypothetical protein                               112   4e-24    Synechococcus sp. NKBG15041c
gb|ABZ07050.1|  putative ABC1 family protein                            110   4e-24    uncultured marine crenarchaeote HF4000_ANIW97J3
ref|WP_038675975.1|  transporter                                        111   4e-24    Streptococcus salivarius
ref|XP_007155516.1|  hypothetical protein PHAVU_003G208300g             110   4e-24    Phaseolus vulgaris [French bean]
gb|ETN61401.1|  ABC1 family protein                                     111   4e-24    Anopheles darlingi [American malaria mosquito]
ref|WP_002885037.1|  transporter                                        111   4e-24    Streptococcus salivarius
ref|XP_005716547.1|  unnamed protein product                            112   5e-24    Chondrus crispus [carageen]
ref|XP_009416860.1|  PREDICTED: uncharacterized aarF domain-conta...    112   5e-24    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002867643.1|  ATP binding protein                                110   5e-24    
gb|AJA91871.1|  ABC1 family protein                                     110   5e-24    Candidatus Nitrosopelagicus brevis
ref|XP_005788568.1|  ubiquinone biosynthesis protein                    111   5e-24    Emiliania huxleyi CCMP1516
gb|ABZ07833.1|  putative ABC1 family protein                            110   5e-24    uncultured marine crenarchaeote HF4000_ANIW141J13
ref|WP_027158256.1|  ubiquinone biosynthesis protein UbiB               111   5e-24    Methylobacter luteus
gb|EYF06059.1|  Ubiquinone biosynthesis monooxygenase UbiB              111   5e-24    Chondromyces apiculatus DSM 436
gb|KHO53628.1|  ABC-1 protein                                           111   5e-24    archaeon GW2011_AR11
ref|WP_034935360.1|  hypothetical protein                               111   6e-24    
gb|ELR99465.1|  putative unusual protein kinase                         111   6e-24    Gloeocapsa sp. PCC 73106
ref|XP_003472379.1|  PREDICTED: uncharacterized aarF domain-conta...    110   6e-24    Cavia porcellus [guinea pig]
ref|WP_003870539.1|  2-octaprenylphenol hydroxylase                     110   7e-24    
ref|WP_040950706.1|  ABC transporter                                    110   7e-24    Gorillibacterium massiliense
ref|XP_001855172.1|  ABC1 family protein                                110   7e-24    Culex quinquefasciatus
gb|KCW52220.1|  hypothetical protein EUGRSUZ_J01643                     110   8e-24    Eucalyptus grandis [rose gum]
ref|XP_009588221.1|  PREDICTED: uncharacterized aarF domain-conta...    108   8e-24    Nicotiana tomentosiformis
ref|WP_012021240.1|  glycosyl transferase family 1                      109   8e-24    
ref|WP_019179672.1|  hypothetical protein                               110   9e-24    Microbacterium yannicii
ref|WP_015050607.1|  ABC-1-like protein kinase                          110   9e-24    Thermacetogenium phaeum
gb|EMS66269.1|  hypothetical protein TRIUR3_01462                       111   9e-24    Triticum urartu
ref|XP_002993143.1|  hypothetical protein SELMODRAFT_136638             109   1e-23    
gb|ABW66219.1|  ABC-1 domain protein                                    109   1e-23    Desulfococcus oleovorans Hxd3
ref|XP_004224495.1|  protein kinase                                     112   1e-23    Plasmodium cynomolgi strain B
ref|XP_011535289.1|  PREDICTED: uncharacterized aarF domain-conta...    107   1e-23    Homo sapiens [man]
ref|WP_030007073.1|  hypothetical protein                               110   1e-23    
ref|WP_045771760.1|  transporter                                        109   1e-23    Streptococcus salivarius
ref|XP_010032755.1|  PREDICTED: uncharacterized aarF domain-conta...    110   1e-23    Eucalyptus grandis [rose gum]
ref|XP_002964518.1|  ABC1 protein kinase                                109   1e-23    
ref|WP_003097138.1|  transporter                                        109   1e-23    Streptococcus vestibularis
ref|WP_043391448.1|  ABC transporter                                    110   1e-23    Archangium violaceum
ref|XP_010032757.1|  PREDICTED: uncharacterized aarF domain-conta...    110   1e-23    Eucalyptus grandis [rose gum]
ref|XP_010876926.1|  PREDICTED: uncharacterized aarF domain-conta...    109   1e-23    
ref|XP_010648446.1|  PREDICTED: uncharacterized protein LOC100242...    111   1e-23    
ref|WP_003868723.1|  2-octaprenylphenol hydroxylase                     109   2e-23    
gb|EWM26591.1|  abc1 protein kinase                                     110   2e-23    
ref|WP_012306086.1|  hypothetical protein                               110   2e-23    
ref|XP_010433721.1|  PREDICTED: uncharacterized aarF domain-conta...    108   2e-23    
ref|WP_027107873.1|  2-octaprenylphenol hydroxylase                     109   2e-23    
ref|WP_023493499.1|  ABC-1 domain-containing protein                    109   2e-23    
emb|CDY08949.1|  BnaC08g11790D                                          108   2e-23    
ref|XP_009588220.1|  PREDICTED: uncharacterized aarF domain-conta...    107   2e-23    
emb|CCA30171.1|  ABC1 family protein, related                           111   2e-23    
ref|WP_041427900.1|  hypothetical protein                               109   2e-23    
ref|WP_042724073.1|  hypothetical protein                               107   2e-23    
ref|WP_009546809.1|  MULTISPECIES: hypothetical protein                 109   2e-23    
ref|XP_010932299.1|  PREDICTED: uncharacterized aarF domain-conta...    108   2e-23    
ref|WP_006569398.1|  2-octaprenylphenol hydroxylase                     109   2e-23    
gb|AFW71972.1|  ABC1 protein                                            110   2e-23    
ref|WP_029249889.1|  ubiquinone biosynthesis protein UbiB               109   2e-23    
gb|ADB13188.1|  ABC1 protein                                            110   2e-23    
ref|NP_001147886.1|  LOC100281496                                       110   2e-23    
ref|XP_003608888.1|  aarF domain-containing protein kinase, putative    108   2e-23    
ref|XP_007102051.1|  PREDICTED: uncharacterized aarF domain-conta...    108   2e-23    
gb|AES91085.2|  ubiquinone biosynthesis protein coq-8, putative         108   2e-23    
ref|XP_008643622.1|  PREDICTED: LOC100281496 isoform X2                 110   2e-23    
gb|ACG29222.1|  ATATH13                                                 110   2e-23    
gb|ABI68773.1|  conserved hypothetical protein                          109   2e-23    
ref|WP_006198362.1|  hypothetical protein                               109   2e-23    
gb|EPS70274.1|  hypothetical protein M569_04484                         108   3e-23    
gb|AAM94595.1|  putative ABC transporter                                103   3e-23    
emb|CDP15035.1|  unnamed protein product                                108   3e-23    
ref|WP_045001760.1|  transporter                                        108   3e-23    
ref|WP_043884213.1|  2-octaprenylphenol hydroxylase                     108   3e-23    
ref|WP_040951746.1|  hypothetical protein                               109   3e-23    
ref|XP_008643621.1|  PREDICTED: LOC100281496 isoform X1                 110   3e-23    
ref|WP_012636157.1|  2-octaprenylphenol hydroxylase                     108   3e-23    
ref|XP_012079898.1|  PREDICTED: uncharacterized aarF domain-conta...    108   3e-23    
ref|WP_017296332.1|  hypothetical protein                               108   3e-23    
ref|XP_004474075.1|  PREDICTED: uncharacterized aarF domain-conta...    107   3e-23    
gb|AEJ53456.1|  ABC1 family protein                                     108   3e-23    
ref|XP_011072918.1|  PREDICTED: uncharacterized aarF domain-conta...    108   3e-23    
emb|CCQ68602.1|  Ubiquinone biosynthesis monooxygenase UbiB             103   3e-23    
ref|WP_009546998.1|  MULTISPECIES: ABC transporter                      108   3e-23    
ref|XP_012079900.1|  PREDICTED: uncharacterized aarF domain-conta...    107   3e-23    
ref|XP_009781732.1|  PREDICTED: uncharacterized aarF domain-conta...    106   3e-23    
gb|KCZ71559.1|  putative unusual protein kinase                         108   4e-23    
ref|XP_002951699.1|  hypothetical protein VOLCADRAFT_34029              102   4e-23    
ref|XP_009004643.1|  PREDICTED: uncharacterized aarF domain-conta...    107   4e-23    
ref|WP_014634460.1|  transporter                                        108   4e-23    
ref|WP_040906343.1|  2-octaprenylphenol hydroxylase                     105   4e-23    
ref|WP_004635187.1|  MULTISPECIES: ABC transporter                      108   4e-23    
ref|WP_004401600.1|  MULTISPECIES: 2-octaprenylphenol hydroxylase       108   4e-23    
ref|XP_005267943.1|  PREDICTED: uncharacterized aarF domain-conta...    107   4e-23    
gb|KJP89854.1|  Atypical/ABC1 protein kinase                            110   4e-23    
ref|WP_029688581.1|  2-octaprenylphenol hydroxylase                     108   4e-23    
ref|WP_044184541.1|  ABC transporter                                    108   4e-23    
emb|CDX71623.1|  BnaC09g26640D                                          107   4e-23    
ref|XP_005967617.1|  PREDICTED: uncharacterized aarF domain-conta...    108   4e-23    
ref|WP_042131415.1|  ABC transporter                                    108   5e-23    
ref|XP_004952869.1|  PREDICTED: uncharacterized aarF domain-conta...    109   5e-23    
gb|ACA60230.1|  ABC-1 domain protein                                    108   5e-23    
ref|XP_004881946.1|  PREDICTED: uncharacterized aarF domain-conta...    107   5e-23    
ref|XP_006680699.1|  hypothetical protein BATDEDRAFT_26559              107   5e-23    
emb|CDQ60491.1|  unnamed protein product                                106   5e-23    
ref|WP_045053344.1|  hypothetical protein                               108   5e-23    
ref|WP_041571300.1|  ABC transporter                                    108   5e-23    
ref|XP_006366834.1|  PREDICTED: uncharacterized aarF domain-conta...    106   5e-23    
ref|WP_013990644.1|  transporter                                        108   5e-23    
ref|XP_002452330.1|  hypothetical protein SORBIDRAFT_04g023800          109   5e-23    
ref|XP_008959237.1|  PREDICTED: uncharacterized aarF domain-conta...    107   5e-23    
ref|WP_043429373.1|  ABC transporter                                    108   5e-23    
gb|EPX62802.1|  Ubiquinone biosynthesis monooxygenase UbiB              108   5e-23    
ref|XP_005267942.1|  PREDICTED: uncharacterized aarF domain-conta...    107   5e-23    
ref|WP_003092663.1|  transporter                                        107   6e-23    
ref|XP_007184603.1|  PREDICTED: uncharacterized aarF domain-conta...    107   6e-23    
ref|NP_001116521.1|  uncharacterized aarF domain-containing prote...    107   6e-23    
ref|WP_042192546.1|  ABC transporter                                    108   6e-23    
ref|XP_007448208.1|  PREDICTED: uncharacterized aarF domain-conta...    107   6e-23    
ref|XP_002926404.1|  PREDICTED: uncharacterized aarF domain-conta...    107   6e-23    
gb|AIS52869.1|  2-polyprenylphenol 6-hydroxylase                        108   6e-23    
ref|WP_036253436.1|  MULTISPECIES: ubiquinone biosynthesis protei...    108   6e-23    
ref|WP_012446781.1|  ABC transporter                                    108   6e-23    
ref|WP_044180588.1|  hypothetical protein                               106   6e-23    
ref|XP_002754275.1|  PREDICTED: uncharacterized aarF domain-conta...    107   7e-23    
gb|EFB30056.1|  hypothetical protein PANDA_016049                       107   7e-23    
ref|XP_004317902.1|  PREDICTED: uncharacterized aarF domain-conta...    107   7e-23    
ref|XP_010974721.1|  PREDICTED: uncharacterized aarF domain-conta...    107   7e-23    
ref|XP_006184495.1|  PREDICTED: uncharacterized aarF domain-conta...    107   7e-23    
ref|XP_008440678.1|  PREDICTED: uncharacterized aarF domain-conta...    108   8e-23    
ref|WP_007306696.1|  hypothetical protein                               108   8e-23    
ref|WP_041233163.1|  ABC transporter                                    107   8e-23    
ref|XP_001652210.1|  AAEL006808-PA                                      107   8e-23    
ref|XP_004474073.1|  PREDICTED: uncharacterized aarF domain-conta...    107   8e-23    
ref|WP_015156388.1|  ABC-1 domain-containing protein                    107   8e-23    
ref|WP_021789257.1|  hypothetical protein                               107   8e-23    
ref|XP_008440677.1|  PREDICTED: uncharacterized aarF domain-conta...    108   8e-23    
gb|AFZ26045.1|  putative unusual protein kinase                         107   8e-23    
ref|WP_009544341.1|  MULTISPECIES: hypothetical protein                 107   8e-23    
ref|WP_025224718.1|  ubiquinone biosynthesis protein UbiB               107   8e-23    
ref|WP_040098291.1|  ubiquinone biosynthesis protein UbiB               107   9e-23    
ref|XP_010482343.1|  PREDICTED: uncharacterized aarF domain-conta...    106   9e-23    
ref|WP_020182615.1|  hypothetical protein                               107   9e-23    
ref|XP_510098.3|  PREDICTED: uncharacterized aarF domain-containi...    107   9e-23    
ref|XP_006283641.1|  hypothetical protein CARUB_v10004698mg             106   9e-23    
ref|WP_017712317.1|  hypothetical protein                               108   9e-23    
ref|XP_003924657.1|  PREDICTED: uncharacterized aarF domain-conta...    107   9e-23    
ref|NP_065154.2|  uncharacterized aarF domain-containing protein ...    107   9e-23    
ref|XP_007985614.1|  PREDICTED: uncharacterized aarF domain-conta...    107   9e-23    
ref|XP_004055571.1|  PREDICTED: uncharacterized aarF domain-conta...    107   1e-22    
ref|XP_010248835.1|  PREDICTED: uncharacterized aarF domain-conta...    105   1e-22    
ref|WP_041026002.1|  ABC transporter                                    107   1e-22    
ref|XP_006374554.1|  hypothetical protein POPTR_0015s10290g             106   1e-22    
ref|WP_011553909.1|  ABC transporter                                    107   1e-22    
ref|WP_014063169.1|  2-octaprenylphenol hydroxylase                     107   1e-22    
ref|XP_003260866.1|  PREDICTED: uncharacterized aarF domain-conta...    107   1e-22    
ref|XP_007095067.1|  PREDICTED: uncharacterized aarF domain-conta...    107   1e-22    
ref|XP_010937033.1|  PREDICTED: uncharacterized aarF domain-conta...    108   1e-22    
ref|XP_010643895.1|  PREDICTED: uncharacterized aarF domain-conta...    106   1e-22    
ref|XP_005908478.1|  PREDICTED: uncharacterized aarF domain-conta...    106   1e-22    
ref|XP_002321677.2|  hypothetical protein POPTR_0015s10290g             106   1e-22    
ref|WP_021144202.1|  Ubiquinone biosynthesis monooxygenase UbiB         107   1e-22    
ref|WP_041280738.1|  hypothetical protein                               104   1e-22    
ref|XP_010937035.1|  PREDICTED: uncharacterized aarF domain-conta...    108   1e-22    
ref|WP_013323958.1|  ABC transporter                                    107   1e-22    
ref|WP_038098788.1|  ubiquinone biosynthesis protein UbiB               107   1e-22    
gb|EPS58071.1|  hypothetical protein M569_16745                         105   1e-22    
ref|WP_037600603.1|  transporter                                        107   1e-22    
ref|WP_002890918.1|  transporter                                        107   1e-22    
gb|ELR47107.1|  Putative aarF domain-containing protein kinase 1        106   1e-22    
ref|WP_037601300.1|  transporter                                        107   1e-22    
ref|WP_026098477.1|  hypothetical protein                               107   1e-22    
ref|XP_004242845.1|  PREDICTED: uncharacterized aarF domain-conta...    106   1e-22    
ref|XP_009038639.1|  hypothetical protein AURANDRAFT_2094               105   1e-22    
ref|XP_005686228.1|  PREDICTED: uncharacterized aarF domain-conta...    107   1e-22    
ref|XP_004649736.1|  PREDICTED: uncharacterized aarF domain-conta...    107   1e-22    
ref|WP_015043397.1|  ABC transporter                                    107   1e-22    
ref|WP_013897668.1|  2-octoprenyl-3-methyl-6-methoxy-1,4-benzoqui...    107   1e-22    
ref|XP_007037893.1|  Kinase superfamily protein isoform 2               106   1e-22    
ref|XP_006283642.1|  hypothetical protein CARUB_v10004698mg             106   1e-22    
ref|XP_006516308.1|  PREDICTED: uncharacterized aarF domain-conta...    106   1e-22    
ref|WP_041522259.1|  ubiquinone biosynthesis protein UbiB               107   1e-22    
ref|NP_001253831.1|  uncharacterized aarF domain-containing prote...    106   1e-22    
ref|XP_006933094.1|  PREDICTED: uncharacterized aarF domain-conta...    107   1e-22    
ref|XP_007985612.1|  PREDICTED: uncharacterized aarF domain-conta...    106   1e-22    
gb|AGY57712.1|  ubiquinone biosynthesis protein UbiB                    107   1e-22    
ref|XP_004881944.1|  PREDICTED: uncharacterized aarF domain-conta...    106   1e-22    
gb|EHE92707.1|  UbiB                                                    105   1e-22    
ref|WP_009052952.1|  2-octaprenylphenol hydroxylase                     107   1e-22    
ref|WP_018166228.1|  hypothetical protein                               106   1e-22    
ref|XP_005561970.1|  PREDICTED: uncharacterized aarF domain-conta...    106   1e-22    
ref|XP_003786999.1|  PREDICTED: uncharacterized aarF domain-conta...    106   1e-22    
gb|EHB01250.1|  hypothetical protein GW7_03447                          106   1e-22    
ref|WP_022893285.1|  hypothetical protein                               107   1e-22    
ref|WP_013940527.1|  ABC transporter                                    107   1e-22    
ref|WP_035154603.1|  ABC transporter                                    107   1e-22    
ref|WP_028989451.1|  ubiquinone biosynthesis protein UbiB               107   1e-22    
gb|AAK32842.1|AF361830_1  AT5g64940/MXK3_17                             107   1e-22    
ref|WP_039713886.1|  ABC transporter                                    107   2e-22    
ref|WP_027844801.1|  hypothetical protein                               107   2e-22    
ref|WP_015150531.1|  putative unusual protein kinase                    107   2e-22    
ref|WP_024978825.1|  ABC transporter                                    107   2e-22    
ref|WP_019560898.1|  ubiquinone biosynthesis protein UbiB               106   2e-22    
ref|XP_007985610.1|  PREDICTED: uncharacterized aarF domain-conta...    106   2e-22    
ref|XP_004010872.1|  PREDICTED: uncharacterized aarF domain-conta...    106   2e-22    
ref|XP_010643891.1|  PREDICTED: uncharacterized aarF domain-conta...    106   2e-22    
gb|KJB08057.1|  hypothetical protein B456_001G061200                    106   2e-22    
ref|XP_010248834.1|  PREDICTED: uncharacterized aarF domain-conta...    105   2e-22    
ref|WP_015137234.1|  putative unusual protein kinase                    106   2e-22    
ref|XP_004309792.1|  PREDICTED: uncharacterized aarF domain-conta...    106   2e-22    
ref|XP_009781731.1|  PREDICTED: uncharacterized aarF domain-conta...    106   2e-22    
gb|AIF23905.1|  putative protein kinase                                 106   2e-22    
ref|XP_008398371.1|  PREDICTED: uncharacterized aarF domain-conta...    106   2e-22    
ref|XP_003987938.1|  PREDICTED: uncharacterized aarF domain-conta...    106   2e-22    
gb|ETE41440.1|  transporter                                             106   2e-22    
emb|CCQ67489.1|  Ubiquinone biosynthesis monooxygenase UbiB             106   2e-22    
ref|XP_008061517.1|  PREDICTED: uncharacterized aarF domain-conta...    106   2e-22    
gb|EKD76942.1|  hypothetical protein ACD_42C00527G0004                  105   2e-22    
gb|EWM59175.1|  transporter                                             106   2e-22    
ref|WP_027843676.1|  ABC transporter                                    106   2e-22    
ref|WP_028915364.1|  ABC transporter substrate-binding protein          106   2e-22    
ref|WP_007305081.1|  hypothetical protein                               106   2e-22    
ref|WP_026010515.1|  ABC transporter substrate-binding protein          106   2e-22    
ref|WP_013559495.1|  hypothetical protein                               106   2e-22    
ref|WP_041243791.1|  hypothetical protein                               107   2e-22    
ref|XP_006402132.1|  hypothetical protein EUTSA_v10013416mg             105   2e-22    
gb|AIF04668.1|  putative protein kinase                                 106   2e-22    
ref|XP_004152513.1|  PREDICTED: uncharacterized aarF domain-conta...    105   2e-22    
ref|WP_021829408.1|  Ubiquinone biosynthesis monooxygenase UbiB         106   2e-22    
ref|WP_015187548.1|  ABC-1 domain-containing protein                    106   2e-22    
emb|CCQ61554.1|  Ubiquinone biosynthesis monooxygenase UbiB             106   2e-22    
ref|WP_021832319.1|  Ubiquinone biosynthesis monooxygenase UbiB         106   2e-22    
ref|WP_013778737.1|  2-polyprenylphenol 6-hydroxylase                   106   2e-22    
ref|XP_002864932.1|  hypothetical protein ARALYDRAFT_919821             107   2e-22    
ref|XP_010462545.1|  PREDICTED: uncharacterized aarF domain-conta...    107   2e-22    
ref|WP_008277261.1|  hypothetical protein                               106   2e-22    
ref|WP_020676669.1|  hypothetical protein                               106   2e-22    
gb|KFO24289.1|  Putative aarF domain-containing protein kinase 1        106   2e-22    
ref|WP_011226013.1|  transporter                                        106   2e-22    
ref|XP_009803011.1|  PREDICTED: uncharacterized aarF domain-conta...    105   2e-22    
ref|WP_020157238.1|  ubiquinone biosynthesis protein UbiB               106   2e-22    
ref|WP_013376224.1|  ABC transporter                                    106   2e-22    
ref|XP_011040411.1|  PREDICTED: uncharacterized aarF domain-conta...    105   2e-22    
emb|CCQ64394.1|  Ubiquinone biosynthesis monooxygenase UbiB             106   2e-22    
ref|WP_008939548.1|  ubiquinone biosynthesis protein UbiB               106   2e-22    
ref|WP_046010185.1|  ubiquinone biosynthesis protein UbiB               106   2e-22    
ref|XP_010444454.1|  PREDICTED: uncharacterized aarF domain-conta...    107   2e-22    
ref|XP_004237437.1|  PREDICTED: uncharacterized aarF domain-conta...    107   2e-22    
ref|XP_010276253.1|  PREDICTED: uncharacterized aarF domain-conta...    106   2e-22    
ref|XP_007037892.1|  Kinase superfamily protein isoform 1               106   2e-22    
ref|WP_007308095.1|  ABC transporter                                    106   2e-22    
ref|WP_015349556.1|  hypothetical protein                               106   2e-22    
ref|XP_010276254.1|  PREDICTED: uncharacterized aarF domain-conta...    106   2e-22    
gb|KHG19498.1|  hypothetical protein F383_05501                         105   2e-22    
tpg|DAA25013.1|  TPA: aarF domain containing kinase 1                   105   3e-22    
ref|NP_001047212.1|  Os02g0575500                                       107   3e-22    
ref|XP_010248833.1|  PREDICTED: probable serine/threonine-protein...    105   3e-22    
ref|XP_006351500.1|  PREDICTED: uncharacterized aarF domain-conta...    105   3e-22    
ref|NP_201299.2|  oxidative stress-related ABC1-like protein 1          107   3e-22    
ref|WP_020739396.1|  hypothetical protein                               106   3e-22    
ref|NP_001070363.1|  uncharacterized aarF domain-containing prote...    105   3e-22    
ref|XP_011024079.1|  PREDICTED: uncharacterized aarF domain-conta...    105   3e-22    
emb|CDP12922.1|  unnamed protein product                                107   3e-22    



>ref|XP_008337091.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like [Malus domestica]
Length=243

 Score =   320 bits (819),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MG G+IYKRR KV  +   IYLDYKALQ+REKW +K K DALW+ AH+RNAKR+L+ ++E
Sbjct  1    MGCGNIYKRRMKVCTVAFLIYLDYKALQQREKWTNKTKTDALWENAHKRNAKRVLSWIVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAYI LLKQLQDSLPPRPLEEVCQTIQ ELGKSM++LF++
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYICLLKQLQDSLPPRPLEEVCQTIQKELGKSMNELFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F  VPLATASIAQVHRATL +G+EVVVKVQH+G+  IILEDLKNAKSIVDWIAWAEPQYN
Sbjct  121  FVNVPLATASIAQVHRATLLNGREVVVKVQHEGIKTIILEDLKNAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            FNPM+DEWC
Sbjct  181  FNPMMDEWC  189



>ref|XP_006355214.1| PREDICTED: uncharacterized protein LOC102585966 [Solanum tuberosum]
Length=956

 Score =   339 bits (870),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IYKRR KVFA+ + IY DYKALQ+REKW +KLKI +LW+KAHERNAKR+LNL++E
Sbjct  1    MGWGNIYKRRVKVFAVALIIYFDYKALQQREKWANKLKIASLWEKAHERNAKRVLNLIVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAY  LLKQLQDSLPPR L+EVC+TI+ ELGK+MDDLF++
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYTRLLKQLQDSLPPRSLKEVCKTIEKELGKTMDDLFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD VPLATASIAQVHRATLSDGQEVVVKVQHDG+  +ILEDLKNAKSIVDWIAWAEPQYN
Sbjct  121  FDKVPLATASIAQVHRATLSDGQEVVVKVQHDGIKAVILEDLKNAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FHPMIDEWC  189



>ref|XP_004246076.1| PREDICTED: uncharacterized protein LOC101247741 [Solanum lycopersicum]
 ref|XP_010325664.1| PREDICTED: uncharacterized protein LOC101247741 [Solanum lycopersicum]
 ref|XP_010325665.1| PREDICTED: uncharacterized protein LOC101247741 [Solanum lycopersicum]
Length=956

 Score =   337 bits (863),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IYKRR KVFA+ + IY DYKALQ+REKW +KLKI +LW+KAHERNAKR+LNL+++
Sbjct  1    MGWGNIYKRRVKVFAVALIIYFDYKALQQREKWANKLKIASLWEKAHERNAKRVLNLIVD  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAY  LLKQLQDSLPPR L+EVC+TI+ ELGK+MDDLF+ 
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYTRLLKQLQDSLPPRSLKEVCKTIEKELGKTMDDLFLY  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD VPLATASIAQVHRATLSDGQEVVVKVQHDG+  +ILEDLKNAKSIVDWIAWAEPQYN
Sbjct  121  FDKVPLATASIAQVHRATLSDGQEVVVKVQHDGIKAVILEDLKNAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FHPMIDEWC  189



>ref|XP_009622901.1| PREDICTED: uncharacterized protein LOC104114217 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009622902.1| PREDICTED: uncharacterized protein LOC104114217 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009622903.1| PREDICTED: uncharacterized protein LOC104114217 isoform X1 [Nicotiana 
tomentosiformis]
Length=953

 Score =   331 bits (849),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IYKRR KVF + + IY DYKALQ+REKW +K K  +LW+KAHERNAKR+LNL++E
Sbjct  1    MGWGNIYKRRVKVFTVALIIYFDYKALQQREKWANKSKKASLWEKAHERNAKRVLNLIVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAY  LLKQLQDSLPPR L+EVC+TI+ E GK+MDDLF++
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYTCLLKQLQDSLPPRSLKEVCRTIEKEFGKTMDDLFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD VPLATASIAQVHRATLSDGQEVVVKVQHDG+  +ILEDLKNAKSIVDW+AWAEPQYN
Sbjct  121  FDNVPLATASIAQVHRATLSDGQEVVVKVQHDGIKAVILEDLKNAKSIVDWVAWAEPQYN  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FHPMIDEWC  189



>ref|XP_009403302.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=947

 Score =   331 bits (849),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IYKRR KVF L + IYLDYKA+QKREKW SK K +ALWQ+ HERNAKR+LNLMIE
Sbjct  1    MGWGNIYKRRLKVFTLALVIYLDYKAVQKREKWFSKSKKEALWQRTHERNAKRVLNLMIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            +EGLWVK GQYLSTRADVLPEAYIYLLKQLQDSLPPRPL+EV QTI+ ELGKS++D+F +
Sbjct  61   MEGLWVKLGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLKEVSQTIEKELGKSVNDIFSH  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATAS+AQVHRATL DGQEVVVKVQH+G+ ++ILEDLKNAKSIVDWIAWAEPQY+
Sbjct  121  FVEAPLATASLAQVHRATLRDGQEVVVKVQHEGIKEVILEDLKNAKSIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_008391427.1| PREDICTED: uncharacterized protein LOC103453649 [Malus domestica]
Length=963

 Score =   330 bits (846),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IYKRR KV  +   IYLDYKALQ+REKW +K K DALW+ AH+RNAKR+L+LM+E
Sbjct  1    MGWGNIYKRRMKVCTVAFLIYLDYKALQQREKWANKTKTDALWENAHKRNAKRVLSLMVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAYI LLKQLQDSLPPRPLEEVC+TIQ ELGKSM++LF++
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYIRLLKQLQDSLPPRPLEEVCRTIQKELGKSMNELFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F  VPLATASIAQVHRATL +G+EVVVKVQH+G+  IILEDLKNAKSIVDWIAWAEPQYN
Sbjct  121  FVNVPLATASIAQVHRATLLNGREVVVKVQHEGIKTIILEDLKNAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_006483623.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X7 [Citrus sinensis]
Length=500

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR  VF++ I IYLDYKA+Q+REKWI K KI ALWQ+AHERNAKR+LNL+I+
Sbjct  1    MGWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIK  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI LLKQLQDSLPPRP++EV QTI+ E G+SM  +FM+
Sbjct  61   LEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL DG++VVVKVQH G+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  121  FVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNP+IDEWC
Sbjct  181  FNPIIDEWC  189



>ref|XP_002527984.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis]
 gb|EEF34396.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis]
Length=965

 Score =   329 bits (843),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IYKRR +VFA+ I IYLDYKA+Q+R+KW  K K  ALW+KAHERNAKR+LNL+IE
Sbjct  1    MGWGNIYKRRVRVFAVAIMIYLDYKAIQQRDKWTIKSKKTALWEKAHERNAKRVLNLIIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP AYI LLK+LQDSLPPRPL+EVCQTIQ ELGKS+DDLF  
Sbjct  61   LEGLWVKLGQYLSTRADVLPHAYISLLKKLQDSLPPRPLQEVCQTIQKELGKSLDDLFSY  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVHRATL +GQEVVVKVQH+G+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  121  FDRTPLATASIAQVHRATLINGQEVVVKVQHEGIKTIILEDLKNAKSIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_007225353.1| hypothetical protein PRUPE_ppa000948mg [Prunus persica]
 gb|EMJ26552.1| hypothetical protein PRUPE_ppa000948mg [Prunus persica]
Length=953

 Score =   329 bits (843),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IYKRR KV ++ + IYLDYKALQ+REKWISK K   LW+ AHERNAKR+L+L+IE
Sbjct  1    MGWGNIYKRRMKVCSVALMIYLDYKALQQREKWISKSKGATLWESAHERNAKRVLSLIIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAYI LLKQLQDSLPPRPLEEVC+TIQ E GKSMD+LF++
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYISLLKQLQDSLPPRPLEEVCRTIQKEFGKSMDELFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F  VPLATASIAQVHRATL +GQEVVVKVQH+G+  IILEDLKNAKSIVDWIAWAEPQ+N
Sbjct  121  FVKVPLATASIAQVHRATLLNGQEVVVKVQHEGIKTIILEDLKNAKSIVDWIAWAEPQFN  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_008219987.1| PREDICTED: uncharacterized protein LOC103320134 isoform X1 [Prunus 
mume]
 ref|XP_008219988.1| PREDICTED: uncharacterized protein LOC103320134 isoform X1 [Prunus 
mume]
Length=954

 Score =   329 bits (843),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IYKRR KV  + + IYLDYKALQ+REKWISK K   LW+ AHERNAKR+L+L+IE
Sbjct  1    MGWGNIYKRRMKVCTVALMIYLDYKALQQREKWISKTKGATLWESAHERNAKRVLSLIIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAYI LLKQLQDSLPPRPLEEVC+TIQ E GKSMD+LF++
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYISLLKQLQDSLPPRPLEEVCRTIQKEFGKSMDELFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F  VPLATASIAQVHRATL +GQEVVVKVQH+G+  IILEDLKNAKSIVDWIAWAEPQ+N
Sbjct  121  FVKVPLATASIAQVHRATLLNGQEVVVKVQHEGIKTIILEDLKNAKSIVDWIAWAEPQFN  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_009367941.1| PREDICTED: uncharacterized protein LOC103957500 [Pyrus x bretschneideri]
 ref|XP_009367942.1| PREDICTED: uncharacterized protein LOC103957500 [Pyrus x bretschneideri]
 ref|XP_009367943.1| PREDICTED: uncharacterized protein LOC103957500 [Pyrus x bretschneideri]
Length=959

 Score =   328 bits (842),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IYKRR KV  +   IYLDYKALQ+REKW +K K DALW+ AH+RNAKR+L L++E
Sbjct  1    MGWGNIYKRRMKVCTVAFLIYLDYKALQQREKWTNKTKTDALWENAHKRNAKRVLGLIVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAYI LLKQLQDSLPPRPLEEVCQTIQ ELGKSM++LF++
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYICLLKQLQDSLPPRPLEEVCQTIQKELGKSMNELFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F  VPLATASIAQVHRATL +G+EVVVKVQH+G+  IILEDLKNAKSIVDWIAWAEPQYN
Sbjct  121  FVDVPLATASIAQVHRATLLNGREVVVKVQHEGIKTIILEDLKNAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            FNPM+DEWC
Sbjct  181  FNPMMDEWC  189



>ref|XP_011082268.1| PREDICTED: uncharacterized protein LOC105165093 [Sesamum indicum]
Length=984

 Score =   328 bits (841),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +2

Query  239  IGFATCL*HMGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNA  418
            I FA  L  MGWG+IYKRR KVF L I IY+DYK LQ REKW    K   LW KAHERNA
Sbjct  32   IQFARKLIQMGWGNIYKRRVKVFTLAILIYIDYKVLQHREKWTKNSKRADLWDKAHERNA  91

Query  419  KRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELG  598
            +R+L L+++LEGLWVK GQYLSTRADVLP AYI LLKQLQDSLPPRPLEEVCQTI  ELG
Sbjct  92   RRVLKLIVQLEGLWVKLGQYLSTRADVLPPAYIRLLKQLQDSLPPRPLEEVCQTITVELG  151

Query  599  KSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDW  778
            KSM DLF+NFD  PLATASIAQVHRATL+DGQEVVVKVQH+G+ +IILEDLKNAKSIVDW
Sbjct  152  KSMTDLFLNFDDTPLATASIAQVHRATLADGQEVVVKVQHEGIKEIILEDLKNAKSIVDW  211

Query  779  IAWAEPQYNFNPMIDEWC  832
            IAWAEPQY+FNPMIDEWC
Sbjct  212  IAWAEPQYDFNPMIDEWC  229



>emb|CBI20791.3| unnamed protein product [Vitis vinifera]
Length=683

 Score =   322 bits (824),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF +   IYLDYKALQ+REKW SK K  ALW++AHERNAKR+LNL++E
Sbjct  1    MGWGNIYRRRVKVFTVAFIIYLDYKALQQREKWSSKSKKAALWERAHERNAKRVLNLIVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAYI LLKQLQDSLPPRPL+EVC+TI+ ELGKSMDDLF +
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYISLLKQLQDSLPPRPLKEVCRTIEKELGKSMDDLFSS  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL  G++VVVKVQH+G+  +ILEDLKNAKSI DWIAWAEPQY+
Sbjct  121  FVDAPLATASIAQVHRATLRSGEDVVVKVQHEGIKTVILEDLKNAKSIADWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>gb|EYU22093.1| hypothetical protein MIMGU_mgv1a000993mg [Erythranthe guttata]
Length=918

 Score =   327 bits (837),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWGSIYKRR KVFAL + IYLDYK+LQ REKW    K   LW+KAHE NAKR+LNL++E
Sbjct  1    MGWGSIYKRRMKVFALAVVIYLDYKSLQLREKWTKNSKKADLWEKAHECNAKRLLNLIVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP AYI LLKQLQDSLPPRPL+EV QTI  ELGKSMD+LF++
Sbjct  61   LEGLWVKLGQYLSTRADVLPPAYIRLLKQLQDSLPPRPLKEVRQTINKELGKSMDNLFLS  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVHRATLSDGQEVVVKVQH+G+ +IILEDLKNAKSIVDWIAWAEPQYN
Sbjct  121  FDNAPLATASIAQVHRATLSDGQEVVVKVQHEGIKEIILEDLKNAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_009798287.1| PREDICTED: uncharacterized protein LOC104244540 [Nicotiana sylvestris]
 ref|XP_009798288.1| PREDICTED: uncharacterized protein LOC104244540 [Nicotiana sylvestris]
 ref|XP_009798289.1| PREDICTED: uncharacterized protein LOC104244540 [Nicotiana sylvestris]
Length=957

 Score =   327 bits (839),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IYKRR KVF + + IY DYKALQ+REKW +K K  +LW+KAHERNAKR+LNL++E
Sbjct  1    MGWGNIYKRRVKVFTVALIIYFDYKALQQREKWANKSKKASLWEKAHERNAKRVLNLIVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAY  LLKQLQDSLPPR L+EVCQTI+ E GK+MDDLF++
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYTCLLKQLQDSLPPRSLKEVCQTIEKEFGKTMDDLFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F  VPLATASIAQVHRATLSDGQ+VVVKVQHDG+  +ILEDLKNAKSIVDWIAWAEPQYN
Sbjct  121  FVKVPLATASIAQVHRATLSDGQDVVVKVQHDGIKAVILEDLKNAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FHPMIDEWC  189



>ref|XP_011003019.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X3 [Populus euphratica]
 ref|XP_011003021.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X3 [Populus euphratica]
Length=239

 Score =   306 bits (784),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR  VF L + IY+DYKALQKREK++ K K DALW+KAHERNAKR+ NLM+E
Sbjct  1    MGWGNIYRRRANVFTLAMIIYIDYKALQKREKFMKKPKSDALWKKAHERNAKRVFNLMVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLS+RADVLP A+I +LKQLQDSLPPRP EEVC+TI+ ELGKS  +LF++
Sbjct  61   LEGLWVKLGQYLSSRADVLPSAFISILKQLQDSLPPRPFEEVCRTIEKELGKSTKELFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVH ATL D Q+VVVKVQ++ + KIILEDLK+AKSIVDWIAWAEPQYN
Sbjct  121  FDENPLATASIAQVHHATLIDRQKVVVKVQYEDIKKIILEDLKDAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FSPMIDEWC  189



>ref|XP_009375716.1| PREDICTED: uncharacterized protein LOC103964508 [Pyrus x bretschneideri]
Length=963

 Score =   327 bits (838),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+I KRR KV A+ + IYLDYKALQ+REKW +K K DALW+ AH+RNAKR+L+L++E
Sbjct  1    MGWGNICKRRMKVCAVALLIYLDYKALQQREKWANKTKTDALWENAHKRNAKRVLSLIVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAYI LLKQLQDSLPPRPLEEVC+TIQ ELGKSM++LF++
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYIRLLKQLQDSLPPRPLEEVCRTIQKELGKSMNELFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F  VPLATASIAQVHRATL +G+EVVVKVQH+G+  IILEDLKNAKSIVDWIAWAEPQYN
Sbjct  121  FVNVPLATASIAQVHRATLLNGREVVVKVQHEGIKTIILEDLKNAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_006850925.1| PREDICTED: uncharacterized protein LOC18440724 [Amborella trichopoda]
 gb|ERN12506.1| hypothetical protein AMTR_s00025p00182260 [Amborella trichopoda]
Length=924

 Score =   326 bits (835),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWGSIYKRR KVF + + IYLDYKALQKREKW SK K  ALW+ AHERNAKR+LNL+IE
Sbjct  1    MGWGSIYKRRVKVFTVALIIYLDYKALQKREKWFSKPKRSALWEMAHERNAKRVLNLIIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI LLKQLQDSLPPRPL+EVC TI+ ELGKS  DLF  
Sbjct  61   LEGLWVKLGQYLSTRADVLPEPYITLLKQLQDSLPPRPLQEVCHTIEKELGKSTSDLFSR  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRA L DG+EVVVKVQH+G+  IILEDLKNAK+IVDWIAWAEPQYN
Sbjct  121  FVETPLATASIAQVHRACLKDGKEVVVKVQHEGIKAIILEDLKNAKAIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_011003016.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X2 [Populus euphratica]
 ref|XP_011003017.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X2 [Populus euphratica]
 ref|XP_011003018.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X2 [Populus euphratica]
Length=249

 Score =   306 bits (784),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR  VF L + IY+DYKALQKREK++ K K DALW+KAHERNAKR+ NLM+E
Sbjct  1    MGWGNIYRRRANVFTLAMIIYIDYKALQKREKFMKKPKSDALWKKAHERNAKRVFNLMVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLS+RADVLP A+I +LKQLQDSLPPRP EEVC+TI+ ELGKS  +LF++
Sbjct  61   LEGLWVKLGQYLSSRADVLPSAFISILKQLQDSLPPRPFEEVCRTIEKELGKSTKELFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVH ATL D Q+VVVKVQ++ + KIILEDLK+AKSIVDWIAWAEPQYN
Sbjct  121  FDENPLATASIAQVHHATLIDRQKVVVKVQYEDIKKIILEDLKDAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FSPMIDEWC  189



>ref|XP_011003015.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X1 [Populus euphratica]
Length=280

 Score =   307 bits (786),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR  VF L + IY+DYKALQKREK++ K K DALW+KAHERNAKR+ NLM+E
Sbjct  1    MGWGNIYRRRANVFTLAMIIYIDYKALQKREKFMKKPKSDALWKKAHERNAKRVFNLMVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLS+RADVLP A+I +LKQLQDSLPPRP EEVC+TI+ ELGKS  +LF++
Sbjct  61   LEGLWVKLGQYLSSRADVLPSAFISILKQLQDSLPPRPFEEVCRTIEKELGKSTKELFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVH ATL D Q+VVVKVQ++ + KIILEDLK+AKSIVDWIAWAEPQYN
Sbjct  121  FDENPLATASIAQVHHATLIDRQKVVVKVQYEDIKKIILEDLKDAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FSPMIDEWC  189



>ref|XP_008798142.1| PREDICTED: uncharacterized protein LOC103713116 isoform X1 [Phoenix 
dactylifera]
Length=957

 Score =   325 bits (834),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG IYKRR KVF L + IYLDYKA+QKR KWI++ K DALW++ HERNA+R+LNL+++
Sbjct  1    MGWGDIYKRRLKVFTLALMIYLDYKAVQKRAKWINRSKRDALWERTHERNARRVLNLIVK  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAYI LLKQLQDSLPPRPL+EVCQTI+ ELGKSM+DLF +
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYICLLKQLQDSLPPRPLQEVCQTIEKELGKSMNDLFSD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL DGQEVV KVQH G+ +IILEDLKNAKSI DWIAWAEPQY+
Sbjct  121  FVERPLATASIAQVHRATLKDGQEVVAKVQHKGIKEIILEDLKNAKSITDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_008798143.1| PREDICTED: uncharacterized protein LOC103713116 isoform X2 [Phoenix 
dactylifera]
Length=956

 Score =   325 bits (833),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG IYKRR KVF L + IYLDYKA+QKR KWI++ K DALW++ HERNA+R+LNL+++
Sbjct  1    MGWGDIYKRRLKVFTLALMIYLDYKAVQKRAKWINRSKRDALWERTHERNARRVLNLIVK  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAYI LLKQLQDSLPPRPL+EVCQTI+ ELGKSM+DLF +
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYICLLKQLQDSLPPRPLQEVCQTIEKELGKSMNDLFSD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL DGQEVV KVQH G+ +IILEDLKNAKSI DWIAWAEPQY+
Sbjct  121  FVERPLATASIAQVHRATLKDGQEVVAKVQHKGIKEIILEDLKNAKSITDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_011003022.1| PREDICTED: probable serine/threonine-protein kinase abkD isoform 
X4 [Populus euphratica]
Length=226

 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR  VF L + IY+DYKALQKREK++ K K DALW+KAHERNAKR+ NLM+E
Sbjct  1    MGWGNIYRRRANVFTLAMIIYIDYKALQKREKFMKKPKSDALWKKAHERNAKRVFNLMVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLS+RADVLP A+I +LKQLQDSLPPRP EEVC+TI+ ELGKS  +LF++
Sbjct  61   LEGLWVKLGQYLSSRADVLPSAFISILKQLQDSLPPRPFEEVCRTIEKELGKSTKELFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVH ATL D Q+VVVKVQ++ + KIILEDLK+AKSIVDWIAWAEPQYN
Sbjct  121  FDENPLATASIAQVHHATLIDRQKVVVKVQYEDIKKIILEDLKDAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FSPMIDEWC  189



>ref|XP_010927205.1| PREDICTED: uncharacterized protein LOC105049295 [Elaeis guineensis]
 ref|XP_010927206.1| PREDICTED: uncharacterized protein LOC105049295 [Elaeis guineensis]
Length=956

 Score =   324 bits (830),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGW  IYKRR KVF L + IYLDYKA+QKR KWIS+ K DALW++ HERNA+R+LNL+++
Sbjct  1    MGWRDIYKRRLKVFTLALVIYLDYKAVQKRAKWISRSKRDALWERTHERNARRVLNLIVK  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAYI LL+QLQDSLPPRPL+EVC+TI+ ELGKSM+DLF N
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYICLLRQLQDSLPPRPLQEVCRTIEKELGKSMNDLFSN  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL DGQEVVVKVQH+G+ +IILEDLKNAKSI DWIAWAEPQY+
Sbjct  121  FVETPLATASIAQVHRATLKDGQEVVVKVQHEGIKEIILEDLKNAKSITDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FSPMIDEWC  189



>ref|XP_004291221.1| PREDICTED: uncharacterized protein LOC101315016 [Fragaria vesca 
subsp. vesca]
Length=956

 Score =   324 bits (830),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MG GSIYKRR KV  L + IYLDYKALQ+R+KWISK K  ALW+ AH+RNAKR+L L+++
Sbjct  1    MGRGSIYKRRMKVGTLALLIYLDYKALQQRDKWISKSKSAALWENAHQRNAKRVLRLIVQ  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAYI LLKQLQDSLPPRPLEEV +TIQ ELGKSMD+LF++
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYISLLKQLQDSLPPRPLEEVSRTIQEELGKSMDELFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F  VPLATASIAQVHRATL DGQEVVVKVQH+G+  IILEDLKNAKSIVDWIAWAEPQYN
Sbjct  121  FVKVPLATASIAQVHRATLLDGQEVVVKVQHEGIKTIILEDLKNAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>gb|KDO67203.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
 gb|KDO67204.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
Length=645

 Score =   316 bits (809),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR  VF++ I IYLDYKA+Q+REKWI K KI ALWQ+AHERNAKR+LNL+I+
Sbjct  1    MGWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIK  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI LLKQLQDSLPPRP++EV QTI+ E G+SM  +FM+
Sbjct  61   LEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL DG++VVVKVQH G+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  121  FVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNP+IDEWC
Sbjct  181  FNPIIDEWC  189



>ref|XP_006286769.1| hypothetical protein CARUB_v10003319mg [Capsella rubella]
 gb|EOA19667.1| hypothetical protein CARUB_v10003319mg [Capsella rubella]
Length=1011

 Score =   323 bits (829),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 181/216 (84%), Gaps = 10/216 (5%)
 Frame = +2

Query  185  FIIPCSQFQRNSKRF*SEIGFATCL*HMGWGSIYKRRFKVFALTIFIYLDYKALQKREKW  364
            F+   + F+R  ++F S          MGWG+IYKRR KVF++ I IYLDYK +Q++EKW
Sbjct  31   FVRLSANFKRLFRKFAS----------MGWGNIYKRRMKVFSVAILIYLDYKGVQQKEKW  80

Query  365  ISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDS  544
            I K K+ ALW+KAHERNAKR+LNL++ELEGLWVK GQYLSTRADVLP+AYI LLKQLQDS
Sbjct  81   IKKSKVPALWEKAHERNAKRVLNLIVELEGLWVKLGQYLSTRADVLPQAYISLLKQLQDS  140

Query  545  LPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDG  724
            LPPRP++EVC+TI+ ELG SM+ LF +F   PLATASIAQVHRATL++GQ+VVVKVQHDG
Sbjct  141  LPPRPVQEVCRTIERELGHSMNVLFTDFVNEPLATASIAQVHRATLANGQDVVVKVQHDG  200

Query  725  VDKIILEDLKNAKSIVDWIAWAEPQYNFNPMIDEWC  832
            +  IILEDLKNAKSIVDWIAWAEPQY+FNPMIDEWC
Sbjct  201  IRAIILEDLKNAKSIVDWIAWAEPQYDFNPMIDEWC  236



>gb|KDO67201.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
Length=666

 Score =   316 bits (809),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR  VF++ I IYLDYKA+Q+REKWI K KI ALWQ+AHERNAKR+LNL+I+
Sbjct  1    MGWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIK  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI LLKQLQDSLPPRP++EV QTI+ E G+SM  +FM+
Sbjct  61   LEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL DG++VVVKVQH G+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  121  FVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNP+IDEWC
Sbjct  181  FNPIIDEWC  189



>ref|XP_002283043.1| PREDICTED: uncharacterized protein LOC100242392 isoform X1 [Vitis 
vinifera]
 ref|XP_010648444.1| PREDICTED: uncharacterized protein LOC100242392 isoform X1 [Vitis 
vinifera]
Length=978

 Score =   323 bits (827),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF +   IYLDYKALQ+REKW SK K  ALW++AHERNAKR+LNL++E
Sbjct  1    MGWGNIYRRRVKVFTVAFIIYLDYKALQQREKWSSKSKKAALWERAHERNAKRVLNLIVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAYI LLKQLQDSLPPRPL+EVC+TI+ ELGKSMDDLF +
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYISLLKQLQDSLPPRPLKEVCRTIEKELGKSMDDLFSS  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL  G++VVVKVQH+G+  +ILEDLKNAKSI DWIAWAEPQY+
Sbjct  121  FVDAPLATASIAQVHRATLRSGEDVVVKVQHEGIKTVILEDLKNAKSIADWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_010541528.1| PREDICTED: uncharacterized protein LOC104814963 isoform X3 [Tarenaya 
hassleriana]
Length=964

 Score =   322 bits (825),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF + + IY DYKA+Q+REKW  K K+  LW+KAHERNAKR+L+L++E
Sbjct  1    MGWGNIYRRRMKVFTVALVIYFDYKAVQQREKWTKKSKVPTLWEKAHERNAKRVLSLIVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LLKQLQDSLPPRPL+EVC TI++ELG SMD LFM+
Sbjct  61   LEGLWVKLGQYLSTRADVLPQAYISLLKQLQDSLPPRPLKEVCHTIESELGHSMDVLFMD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL++GQ+VVVKVQHDG+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  121  FVDEPLATASIAQVHRATLANGQDVVVKVQHDGIRTIILEDLKNAKSIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>gb|KDO67202.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
Length=685

 Score =   316 bits (809),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR  VF++ I IYLDYKA+Q+REKWI K KI ALWQ+AHERNAKR+LNL+I+
Sbjct  1    MGWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIK  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI LLKQLQDSLPPRP++EV QTI+ E G+SM  +FM+
Sbjct  61   LEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL DG++VVVKVQH G+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  121  FVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNP+IDEWC
Sbjct  181  FNPIIDEWC  189



>ref|XP_007011534.1| ABC1 family protein [Theobroma cacao]
 gb|EOY29153.1| ABC1 family protein [Theobroma cacao]
Length=963

 Score =   321 bits (823),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IYKRR KVF++   IYLDYKA+Q+REKW +K K  ALW+KAHERNAKR+L+L+IE
Sbjct  2    MGWGNIYKRRVKVFSVAFLIYLDYKAVQQREKWTNKSKSAALWEKAHERNAKRVLSLIIE  61

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LLKQLQDSLPPRPL+EVC+TI+ E GK+MD LF +
Sbjct  62   LEGLWVKLGQYLSTRADVLPQAYISLLKQLQDSLPPRPLKEVCRTIEKEFGKTMDVLFAD  121

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL DGQEVVVKVQHDG+  IILEDLKNAKS+VDWIAWAEPQY+
Sbjct  122  FLEEPLATASIAQVHRATLIDGQEVVVKVQHDGIKAIILEDLKNAKSVVDWIAWAEPQYD  181

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  182  FNPMIDEWC  190



>gb|KJB55249.1| hypothetical protein B456_009G069300 [Gossypium raimondii]
Length=985

 Score =   321 bits (823),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF   + IYLDYKA+Q+R KW SK K  ALW+KAHERNAKR+L+L+I+
Sbjct  41   MGWGNIYRRRMKVFTAALIIYLDYKAVQQRGKWTSKSKRTALWEKAHERNAKRVLSLIIK  100

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAYI LLKQLQDSLPPRPL+EVC+TIQ E GKSMDDLF  
Sbjct  101  LEGLWVKLGQYLSTRADVLPEAYISLLKQLQDSLPPRPLKEVCRTIQKEFGKSMDDLFAE  160

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL +GQEVVVKVQHDG+  IILEDLKNAKSIV+WIAWAEPQY+
Sbjct  161  FVEKPLATASIAQVHRATLLNGQEVVVKVQHDGIKAIILEDLKNAKSIVNWIAWAEPQYD  220

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  221  FNPMIDEWC  229



>ref|XP_010541526.1| PREDICTED: uncharacterized protein LOC104814963 isoform X2 [Tarenaya 
hassleriana]
Length=1006

 Score =   322 bits (824),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF + + IY DYKA+Q+REKW  K K+  LW+KAHERNAKR+L+L++E
Sbjct  43   MGWGNIYRRRMKVFTVALVIYFDYKAVQQREKWTKKSKVPTLWEKAHERNAKRVLSLIVE  102

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LLKQLQDSLPPRPL+EVC TI++ELG SMD LFM+
Sbjct  103  LEGLWVKLGQYLSTRADVLPQAYISLLKQLQDSLPPRPLKEVCHTIESELGHSMDVLFMD  162

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL++GQ+VVVKVQHDG+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  163  FVDEPLATASIAQVHRATLANGQDVVVKVQHDGIRTIILEDLKNAKSIVDWIAWAEPQYD  222

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  223  FNPMIDEWC  231



>gb|KHG17463.1| putative aarF domain-containing protein kinase 1 [Gossypium arboreum]
Length=1052

 Score =   322 bits (825),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF   + IYLDYKA+Q+R KW SK K +ALW+KAHERNAKR+L+L+I+
Sbjct  41   MGWGNIYRRRMKVFTAALIIYLDYKAVQQRGKWTSKSKRNALWEKAHERNAKRVLSLIIK  100

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAYI LLKQLQDSLPPRPL+EVC+TIQ E GKSMDDLF  
Sbjct  101  LEGLWVKLGQYLSTRADVLPEAYISLLKQLQDSLPPRPLKEVCRTIQKEFGKSMDDLFAE  160

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL +GQEVVVKVQHDG+  IILEDLKNAKSIV+WIAWAEPQY+
Sbjct  161  FVEKPLATASIAQVHRATLLNGQEVVVKVQHDGIKAIILEDLKNAKSIVNWIAWAEPQYD  220

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  221  FNPMIDEWC  229



>ref|XP_010421323.1| PREDICTED: uncharacterized protein LOC104706794 [Camelina sativa]
Length=1011

 Score =   321 bits (823),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF++ I IYLDYK +Q++EKWI K K+ ALW+KAH+RNAKR+LNL++E
Sbjct  48   MGWGNIYRRRVKVFSVAILIYLDYKGVQQKEKWIKKSKVPALWEKAHDRNAKRVLNLIVE  107

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LL+QLQDSLPPRPL+EVC+TI+ ELG SM+ LF +
Sbjct  108  LEGLWVKMGQYLSTRADVLPQAYISLLRQLQDSLPPRPLQEVCRTIERELGHSMNVLFTD  167

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL++GQ+VVVKVQHDG+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  168  FADEPLATASIAQVHRATLANGQDVVVKVQHDGIRAIILEDLKNAKSIVDWIAWAEPQYD  227

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  228  FNPMIDEWC  236



>ref|XP_010470869.1| PREDICTED: uncharacterized protein LOC104750728 [Camelina sativa]
Length=1011

 Score =   321 bits (823),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF++ I IYLDYK +Q++EKWI K K+ ALW+KAH+RNAKR+LNL++E
Sbjct  48   MGWGNIYRRRVKVFSVAILIYLDYKGVQQKEKWIKKSKVPALWEKAHDRNAKRVLNLIVE  107

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LL+QLQDSLPPRPL+EVC+TI+ ELG SM+ LF +
Sbjct  108  LEGLWVKMGQYLSTRADVLPQAYISLLRQLQDSLPPRPLQEVCRTIERELGHSMNVLFTD  167

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL++GQ+VVVKVQHDG+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  168  FADEPLATASIAQVHRATLANGQDVVVKVQHDGIRAIILEDLKNAKSIVDWIAWAEPQYD  227

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  228  FNPMIDEWC  236



>ref|XP_010541525.1| PREDICTED: uncharacterized protein LOC104814963 isoform X1 [Tarenaya 
hassleriana]
Length=1015

 Score =   321 bits (823),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF + + IY DYKA+Q+REKW  K K+  LW+KAHERNAKR+L+L++E
Sbjct  52   MGWGNIYRRRMKVFTVALVIYFDYKAVQQREKWTKKSKVPTLWEKAHERNAKRVLSLIVE  111

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LLKQLQDSLPPRPL+EVC TI++ELG SMD LFM+
Sbjct  112  LEGLWVKLGQYLSTRADVLPQAYISLLKQLQDSLPPRPLKEVCHTIESELGHSMDVLFMD  171

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL++GQ+VVVKVQHDG+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  172  FVDEPLATASIAQVHRATLANGQDVVVKVQHDGIRTIILEDLKNAKSIVDWIAWAEPQYD  231

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  232  FNPMIDEWC  240



>ref|XP_007161530.1| hypothetical protein PHAVU_001G077100g [Phaseolus vulgaris]
 gb|ESW33524.1| hypothetical protein PHAVU_001G077100g [Phaseolus vulgaris]
Length=964

 Score =   320 bits (821),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG IY+RR +VF + I IYLDYK +Q+REKW SK +  A+W+KAHERNAKR+LNL+IE
Sbjct  1    MGWGDIYRRRIRVFTMAIVIYLDYKGVQQREKWTSKSRQAAMWEKAHERNAKRVLNLIIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            +EGLWVK GQY+STRADVLP AYI LLKQLQDSLPPRPLEEV  TIQ E+GKSMD+LF +
Sbjct  61   MEGLWVKLGQYMSTRADVLPAAYIRLLKQLQDSLPPRPLEEVYGTIQKEMGKSMDELFAD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL +GQEVV+KVQHDG+  +ILEDLKNAKSIVDWIAWAEPQYN
Sbjct  121  FVNEPLATASIAQVHRATLLNGQEVVIKVQHDGIKTVILEDLKNAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_012076305.1| PREDICTED: uncharacterized protein LOC105637451 [Jatropha curcas]
 gb|KDP33424.1| hypothetical protein JCGZ_06995 [Jatropha curcas]
Length=966

 Score =   320 bits (821),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR +VFA+ + IYLDYKA+Q+R+KW  K K  ALW++AHERN +RILNL+IE
Sbjct  1    MGWGNIYRRRLRVFAVAVMIYLDYKAVQQRDKWTLKSKRFALWERAHERNGRRILNLIIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP AYI LLKQLQDSLPPR L+EVCQTI+ ELGKSMDDLF  
Sbjct  61   LEGLWVKLGQYLSTRADVLPHAYISLLKQLQDSLPPRSLQEVCQTIEKELGKSMDDLFSY  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVHRATL  G+EVVVKVQH+G+  IILEDLKNAKSI+DWIAWAEPQY+
Sbjct  121  FDKTPLATASIAQVHRATLISGREVVVKVQHEGIKTIILEDLKNAKSIIDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>emb|CDX88133.1| BnaA06g27240D [Brassica napus]
Length=980

 Score =   320 bits (821),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF++ I IY DYK++Q+REKWI K K+ ALW+KAHERNAKR+LNL++E
Sbjct  44   MGWGNIYRRRMKVFSVAIIIYFDYKSVQQREKWIKKSKVPALWEKAHERNAKRVLNLIVE  103

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LL QLQDSLPPRPL+EVC+TI+ ELG SM+ LF +
Sbjct  104  LEGLWVKMGQYLSTRADVLPQAYISLLTQLQDSLPPRPLQEVCRTIERELGHSMEVLFAD  163

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL++GQ+VVVKVQH+G+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  164  FSDEPLATASIAQVHRATLANGQDVVVKVQHNGIRAIILEDLKNAKSIVDWIAWAEPQYD  223

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  224  FNPMIDEWC  232



>ref|XP_010263230.1| PREDICTED: uncharacterized protein LOC104601555 [Nelumbo nucifera]
Length=973

 Score =   320 bits (820),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF L + IYLDYKALQ+REKW +K K D+LW++AHERNAKR+L+L+IE
Sbjct  1    MGWGNIYRRRVKVFTLALIIYLDYKALQQREKWFNKSKRDSLWERAHERNAKRVLSLIIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPEAYI  LKQLQDSLPPRPL+EVC+TI+ ELGK M DLF  
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYIRFLKQLQDSLPPRPLQEVCRTIEKELGKPMVDLFSY  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL +G+EVVVKVQH+G+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  121  FVETPLATASIAQVHRATLDNGREVVVKVQHEGIKTIILEDLKNAKSIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_003544660.1| PREDICTED: uncharacterized protein LOC100802638 isoform X1 [Glycine 
max]
 ref|XP_006596168.1| PREDICTED: uncharacterized protein LOC100802638 isoform X2 [Glycine 
max]
 gb|KHN45585.1| Hypothetical protein glysoja_047536 [Glycine soja]
Length=965

 Score =   320 bits (820),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG IYKRR +VF + + IYLDYK++Q+REKW SK +  +LW+KAHERNAKR+LNL+IE
Sbjct  1    MGWGDIYKRRVRVFTMAVIIYLDYKSVQQREKWTSKSRQASLWEKAHERNAKRVLNLIIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            +EGLWVK GQY+STRADVLP AYI LLKQLQDSLPPRPLEEV  TIQ ELGKSMD+LF +
Sbjct  61   MEGLWVKLGQYMSTRADVLPAAYIRLLKQLQDSLPPRPLEEVYGTIQKELGKSMDELFAD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL +G EVVVKVQHDG+  IILEDLKNAKSIVDWIAWAEPQYN
Sbjct  121  FVNKPLATASIAQVHRATLLNGHEVVVKVQHDGIKTIILEDLKNAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>emb|CDX80470.1| BnaC07g29740D [Brassica napus]
Length=1009

 Score =   320 bits (821),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF++ I IY DYK++Q+REKWI K K+ ALW+KAHERNAKR+LNL++E
Sbjct  44   MGWGNIYRRRMKVFSVAIIIYFDYKSVQQREKWIKKSKVPALWEKAHERNAKRVLNLIVE  103

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LL QLQDSLPPRPL+EVC+TI+ ELG SM+ LF +
Sbjct  104  LEGLWVKMGQYLSTRADVLPQAYISLLTQLQDSLPPRPLQEVCRTIERELGHSMEVLFTD  163

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL++GQ+VVVKVQH+G+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  164  FSDEPLATASIAQVHRATLANGQDVVVKVQHNGIRAIILEDLKNAKSIVDWIAWAEPQYD  223

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  224  FNPMIDEWC  232



>ref|XP_009151006.1| PREDICTED: uncharacterized protein LOC103874346 [Brassica rapa]
Length=994

 Score =   320 bits (820),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF++ I IY DYK++Q+REKWI K K+ ALW+KAHERNAKR+LNL++E
Sbjct  44   MGWGNIYRRRMKVFSVAIIIYFDYKSVQQREKWIKKSKVPALWEKAHERNAKRVLNLIVE  103

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LL QLQDSLPPRPL+EVC+TI+ ELG SM+ LF +
Sbjct  104  LEGLWVKMGQYLSTRADVLPQAYISLLTQLQDSLPPRPLQEVCRTIERELGHSMEVLFAD  163

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL++GQ+VVVKVQH+G+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  164  FSDEPLATASIAQVHRATLANGQDVVVKVQHNGIRAIILEDLKNAKSIVDWIAWAEPQYD  223

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  224  FNPMIDEWC  232



>ref|XP_006394732.1| hypothetical protein EUTSA_v10003586mg [Eutrema salsugineum]
 gb|ESQ32018.1| hypothetical protein EUTSA_v10003586mg [Eutrema salsugineum]
Length=1003

 Score =   320 bits (820),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF++ I IYLDYK +Q+REKWI K K+ ALW+KAH+RNAKR+LNL++E
Sbjct  47   MGWGNIYRRRMKVFSVAILIYLDYKGVQQREKWIKKSKVPALWEKAHDRNAKRVLNLIVE  106

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LL QLQDSLPPRPL+EVC+TI+ ELG SMD LF +
Sbjct  107  LEGLWVKLGQYLSTRADVLPQAYISLLTQLQDSLPPRPLQEVCRTIERELGHSMDVLFTD  166

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL++GQ+VVVKVQH G+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  167  FVDEPLATASIAQVHRATLANGQDVVVKVQHAGIRAIILEDLKNAKSIVDWIAWAEPQYD  226

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  227  FNPMIDEWC  235



>ref|XP_008360489.1| PREDICTED: uncharacterized protein LOC103424180 [Malus domestica]
Length=943

 Score =   319 bits (817),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 169/201 (84%), Gaps = 12/201 (6%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IYKRR KV  +   IYLDYKALQ+REKW +K K DALW+ AH RNAKR+L+LM+E
Sbjct  1    MGWGNIYKRRMKVCTVAFLIYLDYKALQQREKWANKTKTDALWENAHXRNAKRVLSLMVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEE------------VCQTIQN  589
            LEGLWVK GQYLSTRADVLPEAYI LLKQLQDSLPPRPLEE            VC+TIQ 
Sbjct  61   LEGLWVKLGQYLSTRADVLPEAYIRLLKQLQDSLPPRPLEEVVSIGFESYNIKVCRTIQK  120

Query  590  ELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSI  769
            ELGKSM++LF++F  VPLATA IAQVHRATL +G+EVVVKVQH+G+  IILEDLKNAKSI
Sbjct  121  ELGKSMNELFLDFVNVPLATAXIAQVHRATLLNGREVVVKVQHEGIKTIILEDLKNAKSI  180

Query  770  VDWIAWAEPQYNFNPMIDEWC  832
            VDWIAWAEPQYNFNPMIDEWC
Sbjct  181  VDWIAWAEPQYNFNPMIDEWC  201



>ref|XP_003550103.1| PREDICTED: uncharacterized protein LOC100775929 isoformX1 [Glycine 
max]
 ref|XP_006601037.1| PREDICTED: uncharacterized protein LOC100775929 isoform X2 [Glycine 
max]
 gb|KHN19730.1| Hypothetical protein glysoja_047190 [Glycine soja]
Length=966

 Score =   319 bits (817),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG IYKRR +VF + + +YLDYK +Q+REKW SK +  ALW+KAHERNAKR+LNL+IE
Sbjct  1    MGWGDIYKRRVRVFTMALIVYLDYKGVQQREKWTSKSRQAALWEKAHERNAKRVLNLIIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            +EGLWVK GQY+STRADVLP AYI LLKQLQDSLPPRPLEEV  TIQ ELGKSMD+LF +
Sbjct  61   MEGLWVKLGQYMSTRADVLPAAYIRLLKQLQDSLPPRPLEEVYGTIQKELGKSMDELFAD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL +G EVVVKVQHDG+  IILEDLKNAKSIVDWIAWAEPQYN
Sbjct  121  FVNEPLATASIAQVHRATLLNGLEVVVKVQHDGIKTIILEDLKNAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|NP_568458.1| ABC1 family protein [Arabidopsis thaliana]
 gb|AAL24393.1| Unknown protein [Arabidopsis thaliana]
 gb|AAQ22645.1| At5g24810/F6A4.20 [Arabidopsis thaliana]
 gb|AED93364.1| ABC1 family protein [Arabidopsis thaliana]
Length=1009

 Score =   320 bits (819),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MG G+IY+RR KVF++ I IYLDYK +Q++EKWI K K+ ALW KAH+RNAKR+LNL++E
Sbjct  48   MGLGNIYRRRMKVFSIAILIYLDYKGVQQKEKWIKKSKVPALWDKAHDRNAKRVLNLIVE  107

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LL QLQDSLPPRPL+EVC+TI+ ELG SMD LF +
Sbjct  108  LEGLWVKLGQYLSTRADVLPQAYISLLTQLQDSLPPRPLQEVCRTIERELGNSMDVLFTD  167

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL++GQ+VVVKVQHDG+  IILEDLKNAKSIVDWIAWAEPQYN
Sbjct  168  FVDEPLATASIAQVHRATLANGQDVVVKVQHDGIRAIILEDLKNAKSIVDWIAWAEPQYN  227

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  228  FNPMIDEWC  236



>ref|XP_011045052.1| PREDICTED: uncharacterized protein LOC105140069 isoform X2 [Populus 
euphratica]
Length=914

 Score =   318 bits (814),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF L + IY+DYKALQKREK++ K K DALW+KAHERNAKR+ NLM+E
Sbjct  1    MGWGNIYRRRAKVFTLALIIYIDYKALQKREKFMKKPKSDALWKKAHERNAKRVFNLMVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLS+RADVLP A+I +LKQLQDSLPPRP EEVC TI+ ELGKS  +LF++
Sbjct  61   LEGLWVKLGQYLSSRADVLPSAFISILKQLQDSLPPRPFEEVCHTIKKELGKSTKELFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVHRATL DGQ+VVVKVQH+ + KIILEDLK+AKSIVDWIAWAEPQYN
Sbjct  121  FDENPLATASIAQVHRATLIDGQKVVVKVQHEDIKKIILEDLKDAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FSPMIDEWC  189



>ref|NP_001058483.1| Os06g0701300 [Oryza sativa Japonica Group]
 dbj|BAD53771.1| ABC transporter-like [Oryza sativa Japonica Group]
 dbj|BAF20397.1| Os06g0701300 [Oryza sativa Japonica Group]
Length=632

 Score =   311 bits (797),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+   RR KVF++ +FIY DYKA+QKR KW+   K DA+W K HERNA+R+LNLMIE
Sbjct  1    MGWGNTLTRRLKVFSMALFIYFDYKAVQKRVKWVGAGKKDAIWTKTHERNARRVLNLMIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI +LKQLQDSLPPRPLEEV  TI+ ELGK M+DLF N
Sbjct  61   LEGLWVKMGQYLSTRADVLPEPYINVLKQLQDSLPPRPLEEVRGTIEKELGKPMNDLFAN  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL DG+EVVVK+QHDG+  IILEDLKNAKS+V+WIAWAEPQYN
Sbjct  121  FVLDPLATASIAQVHRATLVDGREVVVKIQHDGIKDIILEDLKNAKSLVEWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_010049790.1| PREDICTED: uncharacterized protein LOC104438365 [Eucalyptus grandis]
 ref|XP_010049791.1| PREDICTED: uncharacterized protein LOC104438365 [Eucalyptus grandis]
 gb|KCW82600.1| hypothetical protein EUGRSUZ_C03989 [Eucalyptus grandis]
Length=966

 Score =   318 bits (816),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR +VF++ + IYLDYKALQ+REKW SK K  ALW+KAH RNA+R+LNL+IE
Sbjct  1    MGWGNIYRRRMRVFSVALVIYLDYKALQQREKWASKSKGSALWEKAHHRNARRVLNLIIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LLKQLQDSLPPRPLEEV ++I+ ELGK++DDLF  
Sbjct  61   LEGLWVKLGQYLSTRADVLPQAYITLLKQLQDSLPPRPLEEVNRSIERELGKALDDLFSK  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL DG+EVVVKVQH+G+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  121  FVESPLATASIAQVHRATLKDGREVVVKVQHEGIKAIILEDLKNAKSIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_011045051.1| PREDICTED: uncharacterized protein LOC105140069 isoform X1 [Populus 
euphratica]
Length=973

 Score =   318 bits (815),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF L + IY+DYKALQKREK++ K K DALW+KAHERNAKR+ NLM+E
Sbjct  1    MGWGNIYRRRAKVFTLALIIYIDYKALQKREKFMKKPKSDALWKKAHERNAKRVFNLMVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLS+RADVLP A+I +LKQLQDSLPPRP EEVC TI+ ELGKS  +LF++
Sbjct  61   LEGLWVKLGQYLSSRADVLPSAFISILKQLQDSLPPRPFEEVCHTIKKELGKSTKELFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVHRATL DGQ+VVVKVQH+ + KIILEDLK+AKSIVDWIAWAEPQYN
Sbjct  121  FDENPLATASIAQVHRATLIDGQKVVVKVQHEDIKKIILEDLKDAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FSPMIDEWC  189



>ref|XP_011003023.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105109860 
[Populus euphratica]
Length=861

 Score =   316 bits (810),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF L + IY+DYKALQKREK++ K K DALW+KAHERNAKR+ NLM+E
Sbjct  1    MGWGNIYRRRAKVFTLALIIYIDYKALQKREKFMKKPKSDALWKKAHERNAKRVFNLMVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLS+RADVLP A+I +LKQLQDSLPPRP EEVC TI+ ELGKS  +LF++
Sbjct  61   LEGLWVKLGQYLSSRADVLPSAFISILKQLQDSLPPRPFEEVCHTIEKELGKSTKELFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVH ATL DGQ+VVVKVQH+ + KIILEDLK+AKSIVDWIAWAEPQYN
Sbjct  121  FDKNPLATASIAQVHHATLIDGQKVVVKVQHEDIKKIILEDLKDAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FSPMIDEWC  189



>gb|EPS66438.1| hypothetical protein M569_08337 [Genlisea aurea]
Length=944

 Score =   317 bits (813),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 171/198 (86%), Gaps = 9/198 (5%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IYKRR KVF L + IY+DYKALQ+R+KW  + K+  LW+KAHERNA+R+LNL+++
Sbjct  1    MGWGNIYKRRMKVFTLAVVIYMDYKALQQRQKWTKEPKMSELWEKAHERNARRVLNLIVQ  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEE---------VCQTIQNELG  598
            LEGLWVK GQYLSTRADVLP AYI LLK+LQDSLPPRP+EE         VC+TI  E G
Sbjct  61   LEGLWVKLGQYLSTRADVLPPAYIQLLKKLQDSLPPRPIEEAFSPFIKDSVCKTICTEFG  120

Query  599  KSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDW  778
            K+M+DLF+NFD +PLATASIAQVHRATL+DGQEVVVKVQH+ + +IILEDLKNAKSIVDW
Sbjct  121  KTMEDLFLNFDKIPLATASIAQVHRATLNDGQEVVVKVQHESIKEIILEDLKNAKSIVDW  180

Query  779  IAWAEPQYNFNPMIDEWC  832
            IAWAEPQY+FNPMIDEWC
Sbjct  181  IAWAEPQYDFNPMIDEWC  198



>gb|KDO67191.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
Length=941

 Score =   317 bits (811),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR  VF++ I IYLDYKA+Q+REKWI K KI ALWQ+AHERNAKR+LNL+I+
Sbjct  1    MGWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIK  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI LLKQLQDSLPPRP++EV QTI+ E G+SM  +FM+
Sbjct  61   LEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL DG++VVVKVQH G+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  121  FVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNP+IDEWC
Sbjct  181  FNPIIDEWC  189



>gb|KDO67192.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
Length=968

 Score =   317 bits (812),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR  VF++ I IYLDYKA+Q+REKWI K KI ALWQ+AHERNAKR+LNL+I+
Sbjct  1    MGWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIK  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI LLKQLQDSLPPRP++EV QTI+ E G+SM  +FM+
Sbjct  61   LEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL DG++VVVKVQH G+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  121  FVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNP+IDEWC
Sbjct  181  FNPIIDEWC  189



>ref|XP_006483617.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X1 [Citrus sinensis]
 ref|XP_006483618.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X2 [Citrus sinensis]
 ref|XP_006483619.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X3 [Citrus sinensis]
 ref|XP_006483620.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X4 [Citrus sinensis]
 ref|XP_006483621.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X5 [Citrus sinensis]
 ref|XP_006483622.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X6 [Citrus sinensis]
 gb|KDO67193.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
 gb|KDO67194.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
 gb|KDO67195.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
 gb|KDO67196.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
 gb|KDO67197.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
 gb|KDO67198.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
Length=977

 Score =   317 bits (811),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR  VF++ I IYLDYKA+Q+REKWI K KI ALWQ+AHERNAKR+LNL+I+
Sbjct  1    MGWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIK  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI LLKQLQDSLPPRP++EV QTI+ E G+SM  +FM+
Sbjct  61   LEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL DG++VVVKVQH G+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  121  FVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNP+IDEWC
Sbjct  181  FNPIIDEWC  189



>ref|XP_006450111.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
 ref|XP_006450112.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
 ref|XP_006450113.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
 ref|XP_006450114.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
 gb|ESR63351.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
 gb|ESR63352.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
 gb|ESR63353.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
 gb|ESR63354.1| hypothetical protein CICLE_v10007354mg [Citrus clementina]
Length=977

 Score =   317 bits (811),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR  VF++ I IYLDYKA+Q+REKWI K KI ALWQ+AHERNAKR+LNL+I+
Sbjct  1    MGWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIK  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI LLKQLQDSLPPRP++EV QTI+ E G+SM  +FM+
Sbjct  61   LEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL DG++VVVKVQH G+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  121  FVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNP+IDEWC
Sbjct  181  FNPIIDEWC  189



>ref|XP_002874225.1| ABC1 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50484.1| ABC1 family protein [Arabidopsis lyrata subsp. lyrata]
Length=1011

 Score =   317 bits (812),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MG G+IY+RR KVF++ I IYLDYK +Q++EKWI   K+ ALW KAH+RNAKR+LNL++E
Sbjct  48   MGLGNIYRRRMKVFSVAILIYLDYKGVQQKEKWIKNSKVPALWDKAHDRNAKRVLNLIVE  107

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LL QLQDSLPPRPL+EVC+TI+ ELG SMD LF +
Sbjct  108  LEGLWVKLGQYLSTRADVLPQAYISLLTQLQDSLPPRPLQEVCRTIERELGHSMDVLFTD  167

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL++GQ+VVVKVQHDG+  IILEDLKNAKSIVDWIAWAEPQYN
Sbjct  168  FVDEPLATASIAQVHRATLANGQDVVVKVQHDGIRAIILEDLKNAKSIVDWIAWAEPQYN  227

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  228  FNPMIDEWC  236



>ref|XP_002438956.1| hypothetical protein SORBIDRAFT_10g028960 [Sorghum bicolor]
 gb|EER90323.1| hypothetical protein SORBIDRAFT_10g028960 [Sorghum bicolor]
Length=479

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+   RR KVF++ +FIY DYKA+QKR +W+S  K  ++W+K HERNA+R+LNLMIE
Sbjct  1    MGWGNTITRRLKVFSMALFIYFDYKAVQKRVQWVSTGKKSSIWKKTHERNARRVLNLMIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI +LKQLQDSLPPRP EEV  TI+ ELG+ M DLF +
Sbjct  61   LEGLWVKMGQYLSTRADVLPEPYINVLKQLQDSLPPRPFEEVRGTIEKELGEPMSDLFAD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL+DG+EVVVK+QHDGV +IILEDLKNAKS+V+WIAWAEPQY+
Sbjct  121  FVEDPLATASIAQVHRATLADGREVVVKIQHDGVKEIILEDLKNAKSLVEWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>gb|KGN60194.1| hypothetical protein Csa_3G888530 [Cucumis sativus]
Length=966

 Score =   316 bits (809),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            M WG+IY+RR KVF L + IYLDYKAL++REKWISK K  ALW+KAHERNAKR+L+L+IE
Sbjct  1    MAWGNIYRRRMKVFTLALVIYLDYKALEQREKWISKSKRAALWEKAHERNAKRVLSLIIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVKFGQYLSTRADV+PEAYI LLKQLQDSLPPRPL+EV QTIQ ELGK   D+F N
Sbjct  61   LEGLWVKFGQYLSTRADVVPEAYIRLLKQLQDSLPPRPLQEVRQTIQKELGKPTTDIFTN  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRAT  DG+EVV+KVQH+G+  +ILEDLKNAK+IVDWIAWAEPQY+
Sbjct  121  FVEAPLATASIAQVHRATFLDGREVVIKVQHEGIKTVILEDLKNAKAIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNP+IDEWC
Sbjct  181  FNPIIDEWC  189



>ref|XP_004136301.1| PREDICTED: uncharacterized protein LOC101216220 [Cucumis sativus]
Length=965

 Score =   316 bits (809),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            M WG+IY+RR KVF L + IYLDYKAL++REKWISK K  ALW+KAHERNAKR+L+L+IE
Sbjct  1    MAWGNIYRRRMKVFTLALVIYLDYKALEQREKWISKSKRAALWEKAHERNAKRVLSLIIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVKFGQYLSTRADV+PEAYI LLKQLQDSLPPRPL+EV QTIQ ELGK   D+F N
Sbjct  61   LEGLWVKFGQYLSTRADVVPEAYIRLLKQLQDSLPPRPLQEVRQTIQKELGKPTTDIFTN  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRAT  DG+EVV+KVQH+G+  +ILEDLKNAK+IVDWIAWAEPQY+
Sbjct  121  FVEAPLATASIAQVHRATFLDGREVVIKVQHEGIKTVILEDLKNAKAIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNP+IDEWC
Sbjct  181  FNPIIDEWC  189



>ref|XP_006371822.1| hypothetical protein POPTR_0018s03950g [Populus trichocarpa]
 gb|ERP49619.1| hypothetical protein POPTR_0018s03950g [Populus trichocarpa]
Length=951

 Score =   315 bits (807),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF L + IY+DYKALQKREK++ K K DALW+KAHERNAKR+ NLM+E
Sbjct  1    MGWGNIYRRRAKVFTLAMIIYIDYKALQKREKFMKKPKSDALWKKAHERNAKRVFNLMVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQY+S+RADVLP A+I  LKQLQDSLPPRP EEVC TI+ ELGKS  ++F++
Sbjct  61   LEGLWVKLGQYMSSRADVLPSAFISNLKQLQDSLPPRPFEEVCHTIEKELGKSTKEIFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVHRATL DGQ+VVVKVQH+ + KIILEDLK+AKSIVDWIAWAEPQYN
Sbjct  121  FDENPLATASIAQVHRATLIDGQKVVVKVQHEDIKKIILEDLKDAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FSPMIDEWC  189



>gb|EMT12092.1| hypothetical protein F775_11904 [Aegilops tauschii]
Length=491

 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 164/200 (82%), Gaps = 11/200 (6%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYK-----------ALQKREKWISKLKIDALWQKAHER  412
            MGWG++  RR KVF+L +F+Y DYK           A+QKR +W+S +K +A+W K HER
Sbjct  1    MGWGTLITRRLKVFSLALFVYFDYKKQINIFPRCKQAVQKRVQWVSTVKKNAIWAKTHER  60

Query  413  NAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNE  592
            NA+R+L LMIELEGLWVK GQYLSTRADVLPE YI +LKQLQDSLPPRPLEEVC TI+ E
Sbjct  61   NARRVLKLMIELEGLWVKMGQYLSTRADVLPEPYIEVLKQLQDSLPPRPLEEVCGTIEKE  120

Query  593  LGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIV  772
            LGK M  LF  FD  PLATASIAQVHRATL DG+EVVVKVQHDG+ +IILEDLKNAKS++
Sbjct  121  LGKPMRQLFATFDVDPLATASIAQVHRATLEDGREVVVKVQHDGIKEIILEDLKNAKSLI  180

Query  773  DWIAWAEPQYNFNPMIDEWC  832
            +WIAWAEPQY+FNPMIDEWC
Sbjct  181  EWIAWAEPQYDFNPMIDEWC  200



>ref|XP_006371820.1| hypothetical protein POPTR_0018s03950g [Populus trichocarpa]
 gb|ERP49617.1| hypothetical protein POPTR_0018s03950g [Populus trichocarpa]
Length=962

 Score =   315 bits (807),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF L + IY+DYKALQKREK++ K K DALW+KAHERNAKR+ NLM+E
Sbjct  1    MGWGNIYRRRAKVFTLAMIIYIDYKALQKREKFMKKPKSDALWKKAHERNAKRVFNLMVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQY+S+RADVLP A+I  LKQLQDSLPPRP EEVC TI+ ELGKS  ++F++
Sbjct  61   LEGLWVKLGQYMSSRADVLPSAFISNLKQLQDSLPPRPFEEVCHTIEKELGKSTKEIFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVHRATL DGQ+VVVKVQH+ + KIILEDLK+AKSIVDWIAWAEPQYN
Sbjct  121  FDENPLATASIAQVHRATLIDGQKVVVKVQHEDIKKIILEDLKDAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FSPMIDEWC  189



>ref|XP_006371821.1| hypothetical protein POPTR_0018s03950g [Populus trichocarpa]
 gb|ERP49618.1| hypothetical protein POPTR_0018s03950g [Populus trichocarpa]
Length=978

 Score =   315 bits (807),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF L + IY+DYKALQKREK++ K K DALW+KAHERNAKR+ NLM+E
Sbjct  1    MGWGNIYRRRAKVFTLAMIIYIDYKALQKREKFMKKPKSDALWKKAHERNAKRVFNLMVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQY+S+RADVLP A+I  LKQLQDSLPPRP EEVC TI+ ELGKS  ++F++
Sbjct  61   LEGLWVKLGQYMSSRADVLPSAFISNLKQLQDSLPPRPFEEVCHTIEKELGKSTKEIFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVHRATL DGQ+VVVKVQH+ + KIILEDLK+AKSIVDWIAWAEPQYN
Sbjct  121  FDENPLATASIAQVHRATLIDGQKVVVKVQHEDIKKIILEDLKDAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FSPMIDEWC  189



>ref|XP_008466267.1| PREDICTED: uncharacterized protein LOC103503727 [Cucumis melo]
Length=967

 Score =   315 bits (807),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            M WG+IY+RR KVFAL + IYLDYKAL++REKWISK K  ALW+KAHERNAKR L+L+IE
Sbjct  1    MAWGNIYRRRMKVFALALVIYLDYKALEQREKWISKSKRSALWEKAHERNAKRALSLIIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVKFGQYLSTRADV+P+AYI LLKQLQDSLPPRPL+EV QTIQ ELGK + D+F N
Sbjct  61   LEGLWVKFGQYLSTRADVVPDAYIRLLKQLQDSLPPRPLQEVRQTIQKELGKPITDIFAN  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL +G+EVV+KVQH+G+  +ILEDLKNAK+IVDWIAWAEPQY+
Sbjct  121  FVEAPLATASIAQVHRATLLNGREVVIKVQHEGIKAVILEDLKNAKAIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNP+IDEWC
Sbjct  181  FNPIIDEWC  189



>ref|XP_004498548.1| PREDICTED: uncharacterized protein LOC101504060 [Cicer arietinum]
Length=957

 Score =   313 bits (803),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MG G++Y+RR +VFA+ I +YLDYK +Q+REKWISK K   LW+KAHERNAKRIL L+IE
Sbjct  1    MGLGNLYRRRIRVFAMAILVYLDYKGVQQREKWISKSKQHVLWEKAHERNAKRILKLIIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            +EGLWVK GQY+STRADVLP  YI  L+QLQDSLPPRPLEEV  TIQ ELGKSMD+LF +
Sbjct  61   MEGLWVKLGQYMSTRADVLPAPYINNLRQLQDSLPPRPLEEVYGTIQKELGKSMDELFSD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL +GQEVVVKVQHDG++ +ILEDLKNAKSIVDWIAWAEPQYN
Sbjct  121  FVNKPLATASIAQVHRATLLNGQEVVVKVQHDGINTVILEDLKNAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_010112151.1| hypothetical protein L484_019890 [Morus notabilis]
 gb|EXC32776.1| hypothetical protein L484_019890 [Morus notabilis]
Length=988

 Score =   313 bits (802),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF + + +Y DYKALQ+REK   K K  ALW+KAHERNA+RILNL++E
Sbjct  1    MGWGNIYRRRMKVFTVALIVYFDYKALQQREKLTKKSKRAALWEKAHERNARRILNLIVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP AYI LLKQLQDSLPPRPL+EVC++I+ ELGKSMD+LF  
Sbjct  61   LEGLWVKLGQYLSTRADVLPGAYISLLKQLQDSLPPRPLQEVCRSIEKELGKSMDELFSE  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F  VPLATASIAQVH A L +GQEVVVKVQHDG+  +ILEDLKNAKSIVDWIAWAEPQY+
Sbjct  121  FVEVPLATASIAQVHCAILLNGQEVVVKVQHDGIKTVILEDLKNAKSIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_006371818.1| hypothetical protein POPTR_0018s03930g [Populus trichocarpa]
 gb|ERP49615.1| hypothetical protein POPTR_0018s03930g [Populus trichocarpa]
Length=957

 Score =   312 bits (800),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG IY+RR KVF L + IY+DYKALQKREK++ K K DALW+KAHERNAKR+ NLM+E
Sbjct  1    MGWGYIYRRRAKVFTLAMIIYIDYKALQKREKFMKKPKSDALWKKAHERNAKRVFNLMVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQY+S+RADVLP A+I  LKQLQDSLPPRP EEVC TI+ ELGKS  ++F++
Sbjct  61   LEGLWVKLGQYMSSRADVLPSAFISNLKQLQDSLPPRPFEEVCHTIEKELGKSTKEIFLD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVHRATL DGQ+VVVKVQH  + KIILEDLK+AKSIVDWIAWAEPQYN
Sbjct  121  FDENPLATASIAQVHRATLIDGQKVVVKVQHKDIKKIILEDLKDAKSIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FSPMIDEWC  189



>dbj|BAJ86975.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=938

 Score =   312 bits (799),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG++  RR KVF+L +F+YLDYKA+QKR +W+S +K  A+W K HERNA+R+LNLMIE
Sbjct  1    MGWGTLISRRLKVFSLALFVYLDYKAVQKRVQWVSAVKKHAIWAKTHERNARRVLNLMIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI +LKQLQDSLPPRPLEEV  TI+ ELGK M +LF  
Sbjct  61   LEGLWVKMGQYLSTRADVLPEPYIEVLKQLQDSLPPRPLEEVRGTIEKELGKPMSELFAT  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVHRATL DG+EVVVKVQHDG+ +IILEDLKNAKS+++WIAWAEPQY+
Sbjct  121  FDLDPLATASIAQVHRATLEDGREVVVKVQHDGIKEIILEDLKNAKSLIEWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_009129999.1| PREDICTED: uncharacterized protein LOC103854785 [Brassica rapa]
Length=999

 Score =   311 bits (797),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MG GS+Y+RR KVF++ I IYLDYK++Q+REKWI K K+ ALW+KAHERNAKR+LNL++E
Sbjct  51   MGLGSLYRRRVKVFSVAILIYLDYKSVQQREKWIKKSKVPALWEKAHERNAKRVLNLIVE  110

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LL QLQDSLPPRPL+EV +TI+ ELG SM+ LF +
Sbjct  111  LEGLWVKLGQYLSTRADVLPQAYISLLTQLQDSLPPRPLQEVRRTIERELGDSMEVLFTD  170

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL++GQ+VVVKVQH+G+  IILEDLKNAK+IVDWIAWAEPQY+
Sbjct  171  FANEPLATASIAQVHRATLANGQDVVVKVQHNGIRAIILEDLKNAKAIVDWIAWAEPQYD  230

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  231  FNPMIDEWC  239



>ref|XP_010432830.1| PREDICTED: uncharacterized protein LOC104717024 [Camelina sativa]
Length=965

 Score =   310 bits (795),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IY+RR KVF + I IYLDYK ++ +EKWI   K+ ALW+KAH+RNAKR+LNL++E
Sbjct  1    MGWGNIYRRRVKVFLVAILIYLDYKGVELKEKWIKNSKVPALWEKAHDRNAKRVLNLLVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+ YI +L+QLQDSLPPRPL EVC+TI+ ELG SM+ LF +
Sbjct  61   LEGLWVKIGQYLSTRADVLPQGYISILRQLQDSLPPRPLHEVCRTIERELGHSMNVLFTD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL++GQ+VVVKVQHDG+  IILEDLKNAKSIVDWIAWAEPQY+
Sbjct  121  FAEEPLATASIAQVHRATLANGQDVVVKVQHDGIRAIILEDLKNAKSIVDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  181  FHPMIDEWC  189



>emb|CDY05396.1| BnaC02g41040D [Brassica napus]
Length=998

 Score =   311 bits (796),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MG GS+Y+RR KVF++ I IYLDYK++Q+REKWI K K+ ALW+KAHERNAKR+LNL++E
Sbjct  50   MGLGSLYRRRIKVFSVAILIYLDYKSVQQREKWIKKAKVPALWEKAHERNAKRVLNLIVE  109

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LL QLQDSLPPRPL+EV +TI+ ELG SM+ LF +
Sbjct  110  LEGLWVKLGQYLSTRADVLPQAYISLLTQLQDSLPPRPLQEVRRTIERELGDSMEVLFTD  169

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL++GQ+VVVKVQH+G+  IILEDLKNAK+IVDWIAWAEPQY+
Sbjct  170  FVNEPLATASIAQVHRATLANGQDVVVKVQHNGIRAIILEDLKNAKAIVDWIAWAEPQYD  229

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  230  FNPMIDEWC  238



>ref|XP_003563512.1| PREDICTED: uncharacterized protein LOC100845772 isoform X1 [Brachypodium 
distachyon]
Length=940

 Score =   310 bits (794),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+I  RR KVF+L +F+YLDYKA+QKR +W+S +K +A+W K HERNA+R+L+LMIE
Sbjct  1    MGWGTILSRRLKVFSLALFVYLDYKAVQKRVQWVSTVKKNAIWAKTHERNARRVLSLMIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI +LKQLQDSLPPRPLEEV  TI+ ELGK M +LF +
Sbjct  61   LEGLWVKMGQYLSTRADVLPEPYINVLKQLQDSLPPRPLEEVRGTIEKELGKPMGELFAS  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVHRATL +G+EVVVK+QHDG+ +IILEDLKNAKS+++WIAWAEPQY+
Sbjct  121  FDIDPLATASIAQVHRATLENGREVVVKIQHDGIKEIILEDLKNAKSLIEWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>emb|CDY05459.1| BnaA02g32320D [Brassica napus]
Length=1000

 Score =   311 bits (796),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MG GS+Y+RR KVF++ I IYLDYK++Q+REKWI K K+ ALW+KAHERNAKR+LNL++E
Sbjct  51   MGLGSLYRRRVKVFSVAILIYLDYKSVQQREKWIKKAKVPALWEKAHERNAKRVLNLIVE  110

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLP+AYI LL QLQDSLPPRPL+EV +TI+ ELG SM+ LF +
Sbjct  111  LEGLWVKLGQYLSTRADVLPQAYISLLTQLQDSLPPRPLQEVRRTIERELGDSMEVLFTD  170

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL++GQ+VVVKVQH+G+  IILEDLKNAK+IVDWIAWAEPQY+
Sbjct  171  FVNEPLATASIAQVHRATLANGQDVVVKVQHNGIRAIILEDLKNAKAIVDWIAWAEPQYD  230

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  231  FNPMIDEWC  239



>gb|AES58845.2| ABC1 family protein [Medicago truncatula]
Length=832

 Score =   306 bits (785),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MG G++Y+RR +VF + I +YLDYK +Q+REKW+SK K   LW KAHERNAKRIL L+IE
Sbjct  1    MGLGNLYRRRIRVFTMAIVVYLDYKGVQQREKWLSKSKQATLWAKAHERNAKRILKLIIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            +EGLWVK GQY+STRADVLP AYI  LKQLQDSLPPRPLEEV  TIQ ELGKSMD+LF +
Sbjct  61   MEGLWVKLGQYMSTRADVLPAAYINNLKQLQDSLPPRPLEEVYGTIQKELGKSMDELFSD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL +G++VVVKVQHDG+  +ILEDLKNAK+IVDWIAWAEPQYN
Sbjct  121  FVNEPLATASIAQVHRATLLNGRDVVVKVQHDGIKTVILEDLKNAKAIVDWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_003588594.1| aarF domain-containing protein kinase, putative [Medicago truncatula]
Length=953

 Score =   307 bits (787),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MG G++Y+RR +VF + I +YLDYK +Q+REKW+SK K   LW KAHERNAKRIL L+IE
Sbjct  9    MGLGNLYRRRIRVFTMAIVVYLDYKGVQQREKWLSKSKQATLWAKAHERNAKRILKLIIE  68

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            +EGLWVK GQY+STRADVLP AYI  LKQLQDSLPPRPLEEV  TIQ ELGKSMD+LF +
Sbjct  69   MEGLWVKLGQYMSTRADVLPAAYINNLKQLQDSLPPRPLEEVYGTIQKELGKSMDELFSD  128

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL +G++VVVKVQHDG+  +ILEDLKNAK+IVDWIAWAEPQYN
Sbjct  129  FVNEPLATASIAQVHRATLLNGRDVVVKVQHDGIKTVILEDLKNAKAIVDWIAWAEPQYN  188

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  189  FNPMIDEWC  197



>ref|XP_006656445.1| PREDICTED: uncharacterized protein LOC102706948 [Oryza brachyantha]
Length=949

 Score =   306 bits (785),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG++  RR KVF++ +FIY DYKA+QKR KW++  K DA+W K HERNA+R+L+LMIE
Sbjct  1    MGWGNVLTRRLKVFSMALFIYFDYKAVQKRVKWVTTSKKDAIWTKTHERNARRVLSLMIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI +LKQLQDSLPPRP+EEV  TI+ EL K M+DLF N
Sbjct  61   LEGLWVKLGQYLSTRADVLPEPYINVLKQLQDSLPPRPIEEVRGTIEKELAKPMNDLFSN  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL DG+EVVVK+QHDG+ +IILEDLKNAKS+++WIAWAEPQY+
Sbjct  121  FVLDPLATASIAQVHRATLVDGREVVVKIQHDGIKEIILEDLKNAKSLIEWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_008648079.1| PREDICTED: uncharacterized protein LOC100382198 isoform X1 [Zea 
mays]
 gb|AFW75860.1| hypothetical protein ZEAMMB73_026023 [Zea mays]
Length=959

 Score =   306 bits (783),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+   RR KVF++ +FIY DYKA+QKR +W+S  K  A+W+K HERNA+R+LNLMIE
Sbjct  1    MGWGNTITRRLKVFSMALFIYFDYKAVQKRVQWVSTGKKSAIWKKTHERNARRVLNLMIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI +LKQLQDSLPPRP EEV +TI+ ELG+ M DLF +
Sbjct  61   LEGLWVKLGQYLSTRADVLPEPYINVLKQLQDSLPPRPFEEVRETIEKELGEPMSDLFAD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL+DG+EVVVK+QHDGV +IILEDLKNAKS+++WIAWAEPQY+
Sbjct  121  FVLDPLATASIAQVHRATLADGREVVVKIQHDGVKEIILEDLKNAKSLIEWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>gb|AGT16406.1| hypothetical protein SHCRBa_024_H17_F_120 [Saccharum hybrid cultivar 
R570]
Length=949

 Score =   306 bits (783),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+   RR KVF++ +FIY DYKA+QKR +W+S  K  A+W+K HERNA+R+LNLMIE
Sbjct  1    MGWGNTITRRLKVFSMALFIYFDYKAVQKRVQWVSTGKKSAIWKKTHERNARRVLNLMIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI +LKQLQDSLPPRP EEV  TI+ ELG+ M DLF +
Sbjct  61   LEGLWVKMGQYLSTRADVLPEPYINVLKQLQDSLPPRPFEEVRGTIEKELGEPMSDLFAD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL+DG+EVVVK+QHDGV +IILEDLKNAKS+V+WIAWAEPQY+
Sbjct  121  FVVDPLATASIAQVHRATLADGREVVVKIQHDGVKEIILEDLKNAKSLVEWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_006371847.1| hypothetical protein POPTR_0018s04280g [Populus trichocarpa]
 gb|ERP49644.1| hypothetical protein POPTR_0018s04280g [Populus trichocarpa]
Length=236

 Score =   286 bits (731),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 160/189 (85%), Gaps = 3/189 (2%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG IY+RR KVF L + IY+DYKALQKREK++ K K DALW+KAHERNAKR+ NLM+E
Sbjct  1    MGWGYIYRRRAKVFTLAMIIYIDYKALQKREKFMMKPKSDALWKKAHERNAKRVFNLMVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQY+S+RADVLP A+I  LKQLQDSL       VC TI+ ELGKS  +LF++
Sbjct  61   LEGLWVKLGQYMSSRADVLPSAFISNLKQLQDSLS---SSSVCHTIEKELGKSTKELFLD  117

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVHRATL DGQ+VVVKVQH+ + KIILEDLK+AKSIVDWIAWAEPQYN
Sbjct  118  FDENPLATASIAQVHRATLIDGQKVVVKVQHEDIKKIILEDLKDAKSIVDWIAWAEPQYN  177

Query  806  FNPMIDEWC  832
            F+PMIDEWC
Sbjct  178  FSPMIDEWC  186



>ref|XP_004966108.1| PREDICTED: uncharacterized protein LOC101759876 [Setaria italica]
Length=942

 Score =   305 bits (780),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+   RR KVF++ + IY DYKA+QKR +W+S  K  A+W K HERNA+R+LNLMIE
Sbjct  1    MGWGNTITRRLKVFSMALLIYFDYKAVQKRVQWVSTGKKSAIWTKTHERNARRVLNLMIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI +LKQLQDSLPPRP EEV  TI+ ELGK M DLF +
Sbjct  61   LEGLWVKMGQYLSTRADVLPEPYINVLKQLQDSLPPRPSEEVRGTIEKELGKPMSDLFAD  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL+DG+EVVVK+QHDG+ +IILEDLKNAKS+++WIAWAEPQYN
Sbjct  121  FALDPLATASIAQVHRATLADGREVVVKIQHDGIKEIILEDLKNAKSLIEWIAWAEPQYN  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_011008661.1| PREDICTED: uncharacterized protein LOC105113984 [Populus euphratica]
Length=982

 Score =   302 bits (773),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWI-SKLKIDALWQKAHERNAKRILNLMI  442
            MGWG+IY+RR KVF+L + IYLDYKA QKRE+++ +  KI+ LW++ HERNAKR+ N+MI
Sbjct  1    MGWGNIYRRRVKVFSLAVLIYLDYKASQKREEFMKNNGKIEELWKRTHERNAKRLRNMMI  60

Query  443  ELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFM  622
            +L GLWVK GQYLSTRADVLP AYI LLK+LQDSLPPRPL+EVC+TI+ ELGKSM ++F+
Sbjct  61   KLGGLWVKLGQYLSTRADVLPSAYISLLKKLQDSLPPRPLQEVCRTIERELGKSMKEIFL  120

Query  623  NFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQY  802
            +FD   LATASIAQVHRATL DG+EVVVKVQH+ +  IILEDL++AKSIVDWIAWAEPQY
Sbjct  121  DFDENSLATASIAQVHRATLIDGREVVVKVQHEDIKAIILEDLRDAKSIVDWIAWAEPQY  180

Query  803  NFNPMIDEWC  832
            NFNPMIDEWC
Sbjct  181  NFNPMIDEWC  190



>ref|NP_001190388.1| ABC1 family protein [Arabidopsis thaliana]
 gb|AED93365.1| ABC1 family protein [Arabidopsis thaliana]
Length=1040

 Score =   303 bits (776),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 168/220 (76%), Gaps = 31/220 (14%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MG G+IY+RR KVF++ I IYLDYK +Q++EKWI K K+ ALW KAH+RNAKR+LNL++E
Sbjct  48   MGLGNIYRRRMKVFSIAILIYLDYKGVQQKEKWIKKSKVPALWDKAHDRNAKRVLNLIVE  107

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQ----------------  577
            LEGLWVK GQYLSTRADVLP+AYI LL QLQDSLPPRPL+EVC+                
Sbjct  108  LEGLWVKLGQYLSTRADVLPQAYISLLTQLQDSLPPRPLQEVCKIYLNVNIRGYTKKEKY  167

Query  578  ---------------TIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKV  712
                           TI+ ELG SMD LF +F   PLATASIAQVHRATL++GQ+VVVKV
Sbjct  168  FFDIMSMWYDFKVCRTIERELGNSMDVLFTDFVDEPLATASIAQVHRATLANGQDVVVKV  227

Query  713  QHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMIDEWC  832
            QHDG+  IILEDLKNAKSIVDWIAWAEPQYNFNPMIDEWC
Sbjct  228  QHDGIRAIILEDLKNAKSIVDWIAWAEPQYNFNPMIDEWC  267



>ref|XP_010669479.1| PREDICTED: uncharacterized protein LOC104886700 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=968

 Score =   298 bits (764),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWI-SKLKIDALWQKAHERNAKRILNLMI  442
            M WG+IYKRR +VF L + IYLDYKALQKR KWI +K K  ++W+KAHERNA+RIL  MI
Sbjct  1    MAWGNIYKRRIRVFTLALIIYLDYKALQKRSKWIKNKSKKASVWKKAHERNARRILKFMI  60

Query  443  ELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFM  622
            ++EGLWVK GQYLSTRADVLPE YI LLKQLQDSLPPRP+ EV  TI+ E GK +++LF 
Sbjct  61   QMEGLWVKLGQYLSTRADVLPEPYIQLLKQLQDSLPPRPVNEVRNTIEEEFGKPVEELFS  120

Query  623  NFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQY  802
             F  VPLATASIAQVHRATL +GQEVVVKVQH+G+  +ILEDLKNAKSIV+WIAWAEP Y
Sbjct  121  EFVEVPLATASIAQVHRATLRNGQEVVVKVQHEGIKHVILEDLKNAKSIVEWIAWAEPVY  180

Query  803  NFNPMIDEWC  832
            NFNPMIDEWC
Sbjct  181  NFNPMIDEWC  190



>ref|XP_010669478.1| PREDICTED: uncharacterized protein LOC104886700 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=988

 Score =   298 bits (764),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWI-SKLKIDALWQKAHERNAKRILNLMI  442
            M WG+IYKRR +VF L + IYLDYKALQKR KWI +K K  ++W+KAHERNA+RIL  MI
Sbjct  21   MAWGNIYKRRIRVFTLALIIYLDYKALQKRSKWIKNKSKKASVWKKAHERNARRILKFMI  80

Query  443  ELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFM  622
            ++EGLWVK GQYLSTRADVLPE YI LLKQLQDSLPPRP+ EV  TI+ E GK +++LF 
Sbjct  81   QMEGLWVKLGQYLSTRADVLPEPYIQLLKQLQDSLPPRPVNEVRNTIEEEFGKPVEELFS  140

Query  623  NFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQY  802
             F  VPLATASIAQVHRATL +GQEVVVKVQH+G+  +ILEDLKNAKSIV+WIAWAEP Y
Sbjct  141  EFVEVPLATASIAQVHRATLRNGQEVVVKVQHEGIKHVILEDLKNAKSIVEWIAWAEPVY  200

Query  803  NFNPMIDEWC  832
            NFNPMIDEWC
Sbjct  201  NFNPMIDEWC  210



>ref|XP_006382184.1| ABC1 family protein [Populus trichocarpa]
 gb|ERP59981.1| ABC1 family protein [Populus trichocarpa]
Length=972

 Score =   296 bits (758),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 165/190 (87%), Gaps = 4/190 (2%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWI-SKLKIDALWQKAHERNAKRILNLMI  442
            MGWG+IY+RR KVF+L + IYLDYK   KRE+++ +  K + LW++AHERNAKR+ N+MI
Sbjct  1    MGWGNIYRRRLKVFSLAVLIYLDYK---KREEFMKNNEKSEELWKRAHERNAKRVRNMMI  57

Query  443  ELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFM  622
            +L GLWVK GQYLSTRADVLP AYI LLKQLQDSLPPRPL+EVC+TI+ ELGKSM ++F+
Sbjct  58   QLGGLWVKLGQYLSTRADVLPSAYISLLKQLQDSLPPRPLQEVCRTIERELGKSMKEIFL  117

Query  623  NFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQY  802
            +FD   LATASIAQVHRATL DG+EVVVKVQH+ +  IILEDLK+AKSIVDWIAWAEPQY
Sbjct  118  DFDENSLATASIAQVHRATLIDGREVVVKVQHEDIKAIILEDLKDAKSIVDWIAWAEPQY  177

Query  803  NFNPMIDEWC  832
            NFNPMIDEWC
Sbjct  178  NFNPMIDEWC  187



>ref|XP_009403305.1| PREDICTED: uncharacterized protein LOC103986888 [Musa acuminata 
subsp. malaccensis]
Length=912

 Score =   290 bits (743),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGW ++YKRR KVF   + IYLDYKA+Q  + W S  + D LW+  HERNAKR+L+LMI+
Sbjct  1    MGWVTLYKRRLKVFTTALLIYLDYKAVQMIDNWYSGSRRDDLWEGTHERNAKRVLDLMIQ  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRAD LP+AY+ LLK+LQDSLP RPLEEV QTI+ ELGK M+D+F +
Sbjct  61   LEGLWVKLGQYLSTRADALPDAYVRLLKRLQDSLPRRPLEEVRQTIEKELGKPMNDIFSH  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATAS+AQVHRATL DGQ+VVVKVQH G+ ++ILEDLKNAKSI DWIAWAEPQY+
Sbjct  121  FVEEPLATASVAQVHRATLRDGQDVVVKVQHAGIKEVILEDLKNAKSITDWIAWAEPQYD  180

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  181  FNPMIDEWC  189



>ref|XP_003588582.1| aarF domain-containing protein kinase, putative [Medicago truncatula]
Length=872

 Score =   288 bits (737),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 157/189 (83%), Gaps = 6/189 (3%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MG G++Y+RR +VF + I +YLDYK +Q+REKW+SK K   LW KAHERNAKRIL L+IE
Sbjct  9    MGLGNLYRRRIRVFTMAIVVYLDYKGVQQREKWLSKSKQATLWAKAHERNAKRILKLIIE  68

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            +EGLWVK GQY+STRADVLP AYI  LKQLQDSLPPRPLEEV  TIQ ELGKSMD+LF +
Sbjct  69   MEGLWVKLGQYMSTRADVLPAAYINNLKQLQDSLPPRPLEEVYGTIQKELGKSMDELFSD  128

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            F   PLATASIAQVHRATL +G++VVVKVQHDG+  +ILE      +IVDWIAWAEPQYN
Sbjct  129  FVNEPLATASIAQVHRATLLNGRDVVVKVQHDGIKTVILE------AIVDWIAWAEPQYN  182

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  183  FNPMIDEWC  191



>gb|EEC81263.1| hypothetical protein OsI_24357 [Oryza sativa Indica Group]
Length=926

 Score =   283 bits (723),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 151/185 (82%), Gaps = 11/185 (6%)
 Frame = +2

Query  311  LTIFIYLDYK-----------ALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGL  457
            + +FIY DYK           A+QKR KW+   K DA+W K HERNA+R+LNLMIELEGL
Sbjct  1    MALFIYFDYKKQINIFLRYKQAVQKRVKWVGAGKKDAIWTKTHERNARRVLNLMIELEGL  60

Query  458  WVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGV  637
            WVK GQYLSTRADVLPE YI +LKQLQDSLPPRPLEEV  TI+ ELGK M+DLF NF   
Sbjct  61   WVKMGQYLSTRADVLPEPYINVLKQLQDSLPPRPLEEVRGTIEKELGKPMNDLFANFVLD  120

Query  638  PLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            PLATASIAQVHRATL DG+EVVVK+QHDG+  IILEDLKNAKS+V+WIAWAEPQYNFNPM
Sbjct  121  PLATASIAQVHRATLVDGREVVVKIQHDGIKDIILEDLKNAKSLVEWIAWAEPQYNFNPM  180

Query  818  IDEWC  832
            IDEWC
Sbjct  181  IDEWC  185



>gb|EEE66303.1| hypothetical protein OsJ_22534 [Oryza sativa Japonica Group]
Length=926

 Score =   283 bits (723),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 151/185 (82%), Gaps = 11/185 (6%)
 Frame = +2

Query  311  LTIFIYLDYK-----------ALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGL  457
            + +FIY DYK           A+QKR KW+   K DA+W K HERNA+R+LNLMIELEGL
Sbjct  1    MALFIYFDYKKQINIFLRYKQAVQKRVKWVGAGKKDAIWTKTHERNARRVLNLMIELEGL  60

Query  458  WVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGV  637
            WVK GQYLSTRADVLPE YI +LKQLQDSLPPRPLEEV  TI+ ELGK M+DLF NF   
Sbjct  61   WVKMGQYLSTRADVLPEPYINVLKQLQDSLPPRPLEEVRGTIEKELGKPMNDLFANFVLD  120

Query  638  PLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            PLATASIAQVHRATL DG+EVVVK+QHDG+  IILEDLKNAKS+V+WIAWAEPQYNFNPM
Sbjct  121  PLATASIAQVHRATLVDGREVVVKIQHDGIKDIILEDLKNAKSLVEWIAWAEPQYNFNPM  180

Query  818  IDEWC  832
            IDEWC
Sbjct  181  IDEWC  185



>gb|KFK27753.1| hypothetical protein AALP_AA8G424500 [Arabis alpina]
Length=955

 Score =   279 bits (714),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  335  YKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAY  514
            ++ +Q+REKW  K K+ ALW+KAH+RNAKR+LNL++ELEGLWVK GQYLSTRADVLP+AY
Sbjct  14   FQGVQQREKWTKKTKVPALWEKAHDRNAKRVLNLIVELEGLWVKLGQYLSTRADVLPQAY  73

Query  515  IYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQ  694
            I LL+QLQDSLPPRPL+EVC+TI+ ELG SMD LF +F   PLATASIAQVHRATL++GQ
Sbjct  74   ISLLRQLQDSLPPRPLKEVCRTIERELGNSMDVLFTDFVDEPLATASIAQVHRATLANGQ  133

Query  695  EVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMIDEWC  832
            +VVVKVQH G+  +ILEDLKNAKSIVDWIAWAEPQY+FNPMIDEWC
Sbjct  134  DVVVKVQHAGIRAVILEDLKNAKSIVDWIAWAEPQYDFNPMIDEWC  179



>gb|EPS65049.1| hypothetical protein M569_09728, partial [Genlisea aurea]
Length=717

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 161/215 (75%), Gaps = 26/215 (12%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWGSI++RR ++F + I ++ +YK LQ RE+W  + K+  LW+KAHERNAKRIL+L+++
Sbjct  5    MGWGSIFQRRIRIFTIAIVMFTEYKVLQLRERWTKRPKMFELWKKAHERNAKRILDLIVQ  64

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEE-------------------  568
            LEGLWVK GQYLSTR DVLP AYI LLKQL+DSLPPRPLEE                   
Sbjct  65   LEGLWVKLGQYLSTRVDVLPPAYIQLLKQLEDSLPPRPLEEAISLFWKAQINDDCFILMA  124

Query  569  -------VCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGV  727
                   V +TI  E GK++++LF+NF+ +PL TA+ AQVHRATLSDG EVVVKVQH+G+
Sbjct  125  LQCSFTQVRKTISREFGKTVEELFLNFERIPLTTAADAQVHRATLSDGLEVVVKVQHEGI  184

Query  728  DKIILEDLKNAKSIVDWIAWAEPQYNFNPMIDEWC  832
             +IILEDLK  KS+V W+AWAEP+Y+FNP+IDEWC
Sbjct  185  KEIILEDLKILKSVVYWVAWAEPKYDFNPIIDEWC  219



>ref|XP_010227425.1| PREDICTED: uncharacterized protein LOC100845772 isoform X2 [Brachypodium 
distachyon]
Length=917

 Score =   259 bits (662),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 145/189 (77%), Gaps = 23/189 (12%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+I  RR KVF+L +F+YLDYKA+QKR +W+S +K +A+W K HERNA+R+L+LMIE
Sbjct  1    MGWGTILSRRLKVFSLALFVYLDYKAVQKRVQWVSTVKKNAIWAKTHERNARRVLSLMIE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVK GQYLSTRADVLPE YI +LKQLQDSLPPRPLEEV  TI+ ELGK M +LF +
Sbjct  61   LEGLWVKMGQYLSTRADVLPEPYINVLKQLQDSLPPRPLEEVRGTIEKELGKPMGELFAS  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVHRATL +G+EVVVK+QHD                       EPQY+
Sbjct  121  FDIDPLATASIAQVHRATLENGREVVVKIQHD-----------------------EPQYD  157

Query  806  FNPMIDEWC  832
            FNPMIDEWC
Sbjct  158  FNPMIDEWC  166



>ref|XP_011016557.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like [Populus euphratica]
 ref|XP_011016558.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like [Populus euphratica]
Length=169

 Score =   238 bits (606),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 134/164 (82%), Gaps = 8/164 (5%)
 Frame = +2

Query  269  GWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIEL  448
            G G+IY+RR KVF L + IY+DYKALQKREK++ K K DALW+KAHERNAKR+ NLM+EL
Sbjct  10   GVGNIYRRRAKVFTLAMIIYIDYKALQKREKFMKKPKSDALWKKAHERNAKRVFNLMVEL  69

Query  449  EGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNF  628
            EGLWVK GQYLS+RADVLP A+I +LKQLQDSLPPRP EE C TI+ ELGKS  +LF++F
Sbjct  70   EGLWVKLGQYLSSRADVLPSAFISILKQLQDSLPPRPFEEFCHTIEKELGKSRKELFLDF  129

Query  629  DGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNA  760
            D  PLATASIAQVHRATL DGQ+ VVKVQH        ED+KN+
Sbjct  130  DENPLATASIAQVHRATLIDGQKAVVKVQH--------EDIKNS  165



>ref|XP_002965001.1| hypothetical protein SELMODRAFT_266894 [Selaginella moellendorffii]
 gb|EFJ33839.1| hypothetical protein SELMODRAFT_266894 [Selaginella moellendorffii]
Length=891

 Score =   245 bits (625),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            M WGS   RR KVF + + ++LDY+A +K+   + K   + LW + H RNA+RIL  + E
Sbjct  1    MAWGSTLWRRVKVFRVALQVFLDYRAARKKAAGLPKEDQNLLWDRIHHRNAERILAAITE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWVKFGQYLSTRADVLPEAYI + +QLQDSLPPRP+ E     Q +LGK +D+LF  
Sbjct  61   LEGLWVKFGQYLSTRADVLPEAYISMFRQLQDSLPPRPIAEATCFPQKQLGKPLDELFSE  120

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            FD  PLATASIAQVHRA + DG++VVVKVQH G+ + +L+DL NA+ IV+W+AWAEP Y+
Sbjct  121  FDRKPLATASIAQVHRARMKDGRDVVVKVQHQGIKECVLQDLYNARVIVEWVAWAEPDYD  180

Query  806  FNPMIDEWC  832
            F P++DEWC
Sbjct  181  FGPVLDEWC  189



>ref|XP_001766095.1| predicted protein [Physcomitrella patens]
 gb|EDQ69154.1| predicted protein [Physcomitrella patens]
Length=936

 Score =   242 bits (618),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 147/190 (77%), Gaps = 5/190 (3%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWI-SKLKIDALWQKAHERNAKRILNLMI  442
            MGWG    R+ +VF + + ++++Y+ +Q+REKW  S    + LW+KAHERNAKRI N ++
Sbjct  1    MGWG----RQMRVFLVALRVFVEYRVVQRREKWAKSTSDRNKLWKKAHERNAKRIHNAIV  56

Query  443  ELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFM  622
             LEGLWVK GQYLSTRADVLP+ YI +L+ LQDSLPPR ++EV  TI+ ELGK   +LF 
Sbjct  57   GLEGLWVKAGQYLSTRADVLPDPYIEVLRLLQDSLPPRSIKEVKATIKKELGKDPSELFA  116

Query  623  NFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQY  802
             FD  PLATASIAQVHRA   +G++VVVK+QH G+  IIL+DLKNA++IV W+AWAEP Y
Sbjct  117  EFDTTPLATASIAQVHRARTKEGRDVVVKIQHQGIKDIILQDLKNARTIVQWVAWAEPDY  176

Query  803  NFNPMIDEWC  832
            +F P++DEWC
Sbjct  177  DFAPVMDEWC  186



>ref|XP_002977076.1| hypothetical protein SELMODRAFT_106221 [Selaginella moellendorffii]
 gb|EFJ21685.1| hypothetical protein SELMODRAFT_106221 [Selaginella moellendorffii]
Length=965

 Score =   239 bits (609),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 146/211 (69%), Gaps = 22/211 (10%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            M WGS   RR KVF + + ++LDY+A +K+   + K   + LW + H RNA+RIL  + E
Sbjct  1    MAWGSALWRRVKVFRVALQVFLDYRAARKKAAGLPKEDQNLLWDRIHHRNAERILAAITE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEE-------------------  568
            LEGLWVKFGQYLSTRADVLPEAYI + +QLQDSLPPRP+ E                   
Sbjct  61   LEGLWVKFGQYLSTRADVLPEAYISMFRQLQDSLPPRPIAEATCFPHFLFFFVLSLLILL  120

Query  569  ---VCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKII  739
               V  TI+ +LGK +D+LF  FD  PLATASIAQVHRA + DG++VVVKVQH G+ + +
Sbjct  121  FRQVSATIEKQLGKPLDELFSEFDRKPLATASIAQVHRARMKDGRDVVVKVQHQGIKECV  180

Query  740  LEDLKNAKSIVDWIAWAEPQYNFNPMIDEWC  832
            L+DL NA+ IV+W+AWAEP Y+F P++DEWC
Sbjct  181  LQDLYNARVIVEWVAWAEPDYDFGPVLDEWC  211



>ref|XP_001767436.1| predicted protein [Physcomitrella patens]
 gb|EDQ67760.1| predicted protein [Physcomitrella patens]
Length=962

 Score =   234 bits (597),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 143/190 (75%), Gaps = 5/190 (3%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWI-SKLKIDALWQKAHERNAKRILNLMI  442
            MGW     R+ +VF + + ++ +Y+ +QKREK   S  +   LW+  HERNAKR+ N ++
Sbjct  1    MGW----FRQIRVFFVALTVFFEYRLVQKREKRAKSSSEKTKLWKNVHERNAKRVYNAIV  56

Query  443  ELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFM  622
             LEGLWVK GQYLSTRADVLP+ YI +L+QLQDSLPPRP++EV  TI+ ELGK   ++F 
Sbjct  57   GLEGLWVKAGQYLSTRADVLPDPYIQVLRQLQDSLPPRPIKEVSATIKKELGKDPSEIFA  116

Query  623  NFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQY  802
             FD   LATASIAQVHRA   +G +VV+KVQH+G+  IIL+DLKNA++IV W+AWAEP Y
Sbjct  117  RFDTTALATASIAQVHRALTKEGVDVVIKVQHEGIKDIILQDLKNARTIVQWVAWAEPDY  176

Query  803  NFNPMIDEWC  832
            +F P++DEWC
Sbjct  177  DFGPVMDEWC  186



>ref|XP_010454806.1| PREDICTED: uncharacterized protein LOC104736503 [Camelina sativa]
Length=897

 Score =   214 bits (544),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +2

Query  467  FGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLA  646
             GQYLSTRADVLP+AYI LL+QLQDSLPPRPL+EVC+TI+ ELG SM+ LF +F   PLA
Sbjct  1    MGQYLSTRADVLPQAYISLLRQLQDSLPPRPLQEVCRTIERELGHSMNVLFTDFADEPLA  60

Query  647  TASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMIDE  826
            TASIAQVHRATL++GQ+VVVKVQHDG+  IILEDLKNAKSIVDWIAWAEPQY+FNPMIDE
Sbjct  61   TASIAQVHRATLANGQDVVVKVQHDGIRAIILEDLKNAKSIVDWIAWAEPQYDFNPMIDE  120

Query  827  WC  832
            WC
Sbjct  121  WC  122



>ref|XP_002965004.1| hypothetical protein SELMODRAFT_439199 [Selaginella moellendorffii]
 gb|EFJ33842.1| hypothetical protein SELMODRAFT_439199 [Selaginella moellendorffii]
Length=1273

 Score =   208 bits (530),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 130/190 (68%), Gaps = 23/190 (12%)
 Frame = +2

Query  332  DYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEA  511
            D  A +K+   + K   + LW + H RNA+RIL  + ELEGLWVKFGQYLSTRADVLPEA
Sbjct  174  DATAARKKAAGLPKEDQNLLWDRIHHRNAERILAAITELEGLWVKFGQYLSTRADVLPEA  233

Query  512  YIYLLKQLQDSLPPRPLEE------VCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHR  673
            YI + +QLQDSLPPRP+ E      V  TI+ +LGK +D+LF  FD  PLATASIAQVHR
Sbjct  234  YISMFRQLQDSLPPRPIAEATCFPRVSATIEKQLGKPLDELFSEFDRKPLATASIAQVHR  293

Query  674  ATLSDGQEVVVKVQHDGVDKIIL-----------------EDLKNAKSIVDWIAWAEPQY  802
            A + DG++VVVKVQH G+ + +L                 +DL NA+ IV+W+AWAEP Y
Sbjct  294  ARMKDGRDVVVKVQHQGIKECVLQRRDLILMPAIDRESLVQDLYNARVIVEWVAWAEPDY  353

Query  803  NFNPMIDEWC  832
            +F P++DEWC
Sbjct  354  DFGPVLDEWC  363



>ref|XP_007011535.1| ABC1 family protein, putative [Theobroma cacao]
 gb|EOY29154.1| ABC1 family protein, putative [Theobroma cacao]
Length=779

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 115/170 (68%), Gaps = 30/170 (18%)
 Frame = +2

Query  323  IYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVL  502
            +Y   + +Q REKW ++ +  ALW+KAH+RNAKR++  MIE++GLWVK GQ+LST A+V 
Sbjct  1    MYTGVQTVQHREKWTNESERAALWEKAHKRNAKRVVGFMIEMKGLWVKLGQFLSTHAEVF  60

Query  503  PEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATL  682
            PEAYI LLKQLQ SLPPRP +EVCQTIQNE GK+MDDLF +F   PLATAS         
Sbjct  61   PEAYISLLKQLQVSLPPRPFKEVCQTIQNEFGKTMDDLFADFTKEPLATAS---------  111

Query  683  SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMIDEWC  832
                                 DLKNAK IVD IAWAEP+ +FNPM+DEWC
Sbjct  112  ---------------------DLKNAKWIVDRIAWAEPECDFNPMMDEWC  140



>ref|XP_004365160.1| ABC1 family protein [Capsaspora owczarzaki ATCC 30864]
 gb|KJE88683.1| ABC1 family protein [Capsaspora owczarzaki ATCC 30864]
Length=1470

 Score =   174 bits (442),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 79/185 (43%), Positives = 121/185 (65%), Gaps = 2/185 (1%)
 Frame = +2

Query  281  IYKRRFKVF--ALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEG  454
            ++ RR  V+  A+ +  +L +  L      +SK + D  WQ  H RNA+R+ N ++ L+G
Sbjct  596  LFARRVSVYYTAVVVISHLKFAQLYSSYFRLSKEEDDLYWQTVHSRNARRVFNAIVSLKG  655

Query  455  LWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDG  634
             WVK GQY+S R+DVLP+A+I  L +LQD +PP+P  +V  TI+ + G+   +LF   + 
Sbjct  656  FWVKVGQYMSARSDVLPDAWITELVRLQDQMPPQPFSDVEATIREDFGREAHELFETIEK  715

Query  635  VPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNP  814
             P+A ASIAQVHRATL +G  VVVKVQH  VD+I+ +D+ N + I+  +A+  P+++F P
Sbjct  716  TPIAAASIAQVHRATLKNGTPVVVKVQHRDVDRIMRQDMVNLEVIMTGVAYLNPEFDFRP  775

Query  815  MIDEW  829
            ++ EW
Sbjct  776  VVVEW  780



>ref|XP_009033315.1| hypothetical protein AURANDRAFT_20383, partial [Aureococcus anophagefferens]
 gb|EGB12245.1| hypothetical protein AURANDRAFT_20383, partial [Aureococcus anophagefferens]
Length=311

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 116/185 (63%), Gaps = 0/185 (0%)
 Frame = +2

Query  275  GSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEG  454
             ++  RR +V+    +I+  Y + +++ + +    ++  W  AH R A   +     L G
Sbjct  23   AALLARRLQVYGAAYYIFNTYCSYEEQAEHLYGEALEKHWADAHTRLASVAVWHATSLLG  82

Query  455  LWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDG  634
            LWVK  Q++S+R DVLPE +I  L QLQDS+PPRP  EV  T+  ELG    DLF +   
Sbjct  83   LWVKLAQFMSSRTDVLPEPWIAALAQLQDSVPPRPYREVATTLAEELGADFADLFESVSA  142

Query  635  VPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNP  814
             PLA ASIAQVHRATL  G +VV+KVQH GV +++L+DL+NA  + +++A  +P+++F  
Sbjct  143  EPLAAASIAQVHRATLRGGADVVLKVQHRGVRQVVLQDLENATYLCEYVAAQKPEHDFRE  202

Query  815  MIDEW  829
            ++ EW
Sbjct  203  LLREW  207



>ref|XP_001743916.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ91494.1| predicted protein, partial [Monosiga brevicollis MX1]
Length=302

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = +2

Query  383  DALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPL  562
            D  W++ HE NA+ +   +  L G WVK GQY+S+R DV+P A++  L +LQD++P R  
Sbjct  22   DERWERVHEFNARLVERNVRILRGFWVKVGQYMSSRGDVMPAAWVRELSKLQDAMPKRSG  81

Query  563  EEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIIL  742
             EV   I+ ELG  +D +F +F+ V LA+ASIAQVHRATL  GQ+VV KVQH  +  I+ 
Sbjct  82   HEVRADIEAELGCPLDTVFTDFEDVALASASIAQVHRATLKTGQQVVCKVQHRNIQTIMK  141

Query  743  EDLKNAKSIVDWIAWAEPQYNFNPMIDEW  829
             DL+N   IVDW+A+ +P Y+F P++DEW
Sbjct  142  HDLQNLFVIVDWVAYFDPSYDFRPVLDEW  170



>emb|CBJ30466.1| conserved unknown protein [Ectocarpus siliculosus]
Length=1145

 Score =   160 bits (406),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 91/259 (35%), Positives = 139/259 (54%), Gaps = 26/259 (10%)
 Frame = +2

Query  62   RPVTIKGDAKGKVILQNGTVFP*AHRLRPS---YASAPPLFSLCFIIPCSQFQRNSKRF*  232
            RP   KG  + +   + G+  P + +LR S   Y +   L  +C I+     QR S+   
Sbjct  10   RPPESKGQQRPQQDDEPGSALP-SGKLRLSMSLYWAVMALVVVCLIV----HQRRSE---  61

Query  233  SEIGFATCL*HMGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHER  412
                            +  RR K F L        K  +   + +S  + D  W   H+ 
Sbjct  62   ---------------GLILRRVKTFCLAGTAIFALKMTKTLTQGMSSDESDDTWADVHKL  106

Query  413  NAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNE  592
             A  +   ++++ G+WVK GQYLS+RADV+P+ Y+  L +LQD++P  P EEV +T++ +
Sbjct  107  LAPFVYQSILDVAGMWVKTGQYLSSRADVMPQPYLDELSKLQDAVPASPFEEVDETVREQ  166

Query  593  LGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIV  772
            LG+ + +LF   D   LA+AS+AQVHR  L DG+E V+KVQH  V  + LEDL+N   +V
Sbjct  167  LGRPLAELFATIDREALASASVAQVHRCKLKDGREAVIKVQHRRVRTLFLEDLRNISRLV  226

Query  773  DWIAWAEPQYNFNPMIDEW  829
              +AWAE  Y+F P+++EW
Sbjct  227  RMVAWAEKDYDFRPIMNEW  245



>ref|XP_002977079.1| hypothetical protein SELMODRAFT_443434 [Selaginella moellendorffii]
 gb|EFJ21688.1| hypothetical protein SELMODRAFT_443434 [Selaginella moellendorffii]
Length=866

 Score =   157 bits (398),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 113/206 (55%), Gaps = 53/206 (26%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            M WGS   RR KVF + + ++LDY+A +K+   + K   + LW + H RNA+RIL  + E
Sbjct  1    MAWGSALWRRVKVFRVALQVFLDYRAARKKAAGLPKEDQNLLWDRIHHRNAERILAAITE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
            LEGLWV                                      TI+ +LGK +D+LF+ 
Sbjct  61   LEGLWVS------------------------------------ATIEKQLGKPLDELFLE  84

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIIL-----------------EDLK  754
            FD  P ATASIAQVHRA + DG++VVVKVQH G+ + +L                 +DL 
Sbjct  85   FDRKPFATASIAQVHRARMKDGRDVVVKVQHQGIKECVLQRRDLILMPAIDRDSLVQDLY  144

Query  755  NAKSIVDWIAWAEPQYNFNPMIDEWC  832
            NA+ IV+W+AWAEP Y+F P++DEWC
Sbjct  145  NARVIVEWVAWAEPDYDFGPVLDEWC  170



>ref|XP_004997282.1| serine/threonine protein kinase [Salpingoeca rosetta]
 gb|EGD80721.1| serine/threonine protein kinase [Salpingoeca rosetta]
Length=4337

 Score =   159 bits (402),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 71/147 (48%), Positives = 105/147 (71%), Gaps = 1/147 (1%)
 Frame = +2

Query  392  WQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEV  571
            W + HE NA+R+  L   L G WVK GQYLS+R DV+PE ++  L+ LQD++P +P  +V
Sbjct  610  WNRLHEANARRVQLLARRLRGFWVKVGQYLSSRGDVMPEPWVRELRSLQDTMPFQPFADV  669

Query  572  CQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQ-EVVVKVQHDGVDKIILED  748
               ++ +LG  + +LF +F+ +P+A+ASIAQVH ATL   + +VVVKVQH  +D+I+ +D
Sbjct  670  KAIVEEDLGHPLTELFSSFEELPIASASIAQVHIATLKRSKHQVVVKVQHKNIDRIMKQD  729

Query  749  LKNAKSIVDWIAWAEPQYNFNPMIDEW  829
            LKN   IV W+A+ EPQY+F P+++EW
Sbjct  730  LKNLFVIVSWVAYLEPQYDFRPVLEEW  756



>emb|CDJ60647.1| hypothetical protein EMWEY_00033290, partial [Eimeria maxima]
Length=247

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 111/182 (61%), Gaps = 1/182 (1%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+++       +YL +K  Q R + + + K  A W++ HE  A  + + + EL+G WV
Sbjct  4    WNRKWRTLWCWSNVYLGWKVAQARSRALPQDKQAAYWEQRHEHFANLVWDNIKELKGWWV  63

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LSTR+D+LP+ YI+ L +LQD +P  P   + +T+Q ELG  +  +F   +  PL
Sbjct  64   KVGQFLSTRSDLLPQQYIHHLIKLQDMMPTTPYAVIEKTLQTELG-DLSQIFSRIEEKPL  122

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+ASI QVHRA L+DG  VVVKVQH  V+ +++ D+ N K +       E   NF P+++
Sbjct  123  ASASIGQVHRAWLTDGTAVVVKVQHADVESLLMHDMANLKQLSWAFGMLEQGMNFAPILE  182

Query  824  EW  829
            EW
Sbjct  183  EW  184



>emb|CDI87049.1| ABC1 family beta-lactamase, putative [Eimeria praecox]
Length=1367

 Score =   144 bits (364),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 72/182 (40%), Positives = 111/182 (61%), Gaps = 1/182 (1%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+++       +YL +K  Q R + + + K  A W++ HE  A  + + + EL+G WV
Sbjct  21   WNRKWRTLWCWSNVYLGWKVAQARSRALPQDKQAAYWEQRHEHFANLVWDNIKELKGWWV  80

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LSTR+D+LP+ YI+ L +LQD +P  P   + +T+Q ELG  +  +F   +  PL
Sbjct  81   KVGQFLSTRSDLLPQQYIHHLIKLQDMMPTTPYAVIEKTLQTELG-DLSKIFSKIEEKPL  139

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+ASI QVHRA L+DG  VVVKVQH  V+ +++ D+ N K +       E   NF P+++
Sbjct  140  ASASIGQVHRAWLTDGTAVVVKVQHADVESLLMHDMANLKQLSWAFGLLEQGMNFAPILE  199

Query  824  EW  829
            EW
Sbjct  200  EW  201



>emb|CDI84207.1| hypothetical protein EAH_00014140 [Eimeria acervulina]
Length=1347

 Score =   144 bits (364),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 72/182 (40%), Positives = 111/182 (61%), Gaps = 1/182 (1%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+++       +YL +K  Q R + + + K  A W++ HE  A  + + + EL+G WV
Sbjct  4    WNRKWRTLWCWSNVYLGWKVAQARSRALPQDKQAAYWEQRHEHFANLVWDNIKELKGWWV  63

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LSTR+D+LP+ YI+ L +LQD +P  P   + +T+Q ELG  +  +F   +  PL
Sbjct  64   KVGQFLSTRSDLLPQQYIHHLIKLQDMMPTTPYAVIEKTLQTELG-DLSQIFSKIEEKPL  122

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+ASI QVHRA L+DG  VVVKVQH  V+ +++ D+ N K +       E   NF P+++
Sbjct  123  ASASIGQVHRAWLTDGTAVVVKVQHADVESLLMHDMANLKQLSWAFGMLEQGMNFAPILE  182

Query  824  EW  829
            EW
Sbjct  183  EW  184



>emb|CDJ47204.1| ABC1 family beta-lactamase, putative [Eimeria brunetti]
Length=1856

 Score =   144 bits (364),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 70/169 (41%), Positives = 107/169 (63%), Gaps = 1/169 (1%)
 Frame = +2

Query  323  IYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVL  502
            +Y+ +K  Q R + + + K  A W++ HE  A  + + + EL+G WVK GQ+LSTR+D+L
Sbjct  37   VYVGWKVAQARSRALPQDKQAAYWEQRHEHFANLVWDNIKELKGWWVKVGQFLSTRSDLL  96

Query  503  PEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATL  682
            P+ YI+ L +LQD +P  P   + +T+Q ELG  ++++F   +  PLA+ASI QVHRA L
Sbjct  97   PQQYIHHLIKLQDMMPTTPYAVIEKTLQTELG-DLNEIFSKIEEKPLASASIGQVHRAWL  155

Query  683  SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMIDEW  829
             DG  VVVKVQH  V+ +++ D+ N K +       E   NF P+++EW
Sbjct  156  KDGTAVVVKVQHADVESLLMHDMANLKQLSWAFGLLEQGMNFAPILEEW  204



>ref|XP_008370903.1| PREDICTED: uncharacterized protein LOC103434348 [Malus domestica]
Length=121

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
            MGWG+IYKRR KV  +   IYLDYKALQ+REKW +K   DALW+ AH+RNAKR+L+L++E
Sbjct  1    MGWGNIYKRRMKVCTVAFLIYLDYKALQQREKWTNKTTTDALWENAHKRNAKRVLSLIVE  60

Query  446  LEGLWVKFGQYLSTRADVLPEAY  514
            LEGLWVK GQYLSTRADVLP A+
Sbjct  61   LEGLWVKLGQYLSTRADVLPYAF  83



>emb|CDJ37043.1| hypothetical protein ETH_00005180 [Eimeria tenella]
Length=1373

 Score =   142 bits (359),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 71/169 (42%), Positives = 106/169 (63%), Gaps = 1/169 (1%)
 Frame = +2

Query  323  IYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVL  502
            +YL +K  Q R + + + K  A W++ HE  A  + + + EL+G WVK GQ+LSTR+D+L
Sbjct  53   VYLGWKVAQARSRALPQDKQAAYWEQRHEHFANLVWDNIKELKGWWVKVGQFLSTRSDLL  112

Query  503  PEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATL  682
            P+ YI+ L +LQD +P  P E + +T++ ELG  ++ +F   D  PLA+ASI QVHRA L
Sbjct  113  PQQYIHHLIKLQDMMPTTPFEVIEKTLRTELG-DLNLIFSKIDEQPLASASIGQVHRAWL  171

Query  683  SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMIDEW  829
             DG  VVVKVQH  V+ +++ D+ N K +       E   N  P+++EW
Sbjct  172  LDGTAVVVKVQHADVESLLMHDMANLKQLSWAFGMLEQGMNLTPILEEW  220



>ref|XP_002367048.1| ABC1 family beta-lactamase, putative [Toxoplasma gondii ME49]
 gb|EPT24869.1| ABC1 family protein [Toxoplasma gondii ME49]
Length=1900

 Score =   142 bits (358),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 72/182 (40%), Positives = 108/182 (59%), Gaps = 1/182 (1%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+++       +Y+ +K  Q R + + K +    W++ HE  A  I   + EL G WV
Sbjct  4    WNRKWRTLWCWSNVYVGWKVSQARARALPKEEQAEFWEQRHEHFANVIWENIKELRGWWV  63

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ++STR+D+LP+ YI+ L +LQD +P      + QTI +ELG  +D++F   D V L
Sbjct  64   KVGQFMSTRSDLLPQQYIHHLVKLQDMMPTSDFASIRQTIADELG-DVDEIFERIDPVAL  122

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+ASI QVHRA L DG  VVVKVQH  V+ ++  D++N K +       E   NF P+++
Sbjct  123  ASASIGQVHRAWLKDGSSVVVKVQHADVETLLSHDMQNLKQLSWAFGLLESGLNFAPILE  182

Query  824  EW  829
            EW
Sbjct  183  EW  184



>gb|KFH16184.1| ABC1 family protein [Toxoplasma gondii MAS]
Length=1900

 Score =   142 bits (357),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 72/182 (40%), Positives = 108/182 (59%), Gaps = 1/182 (1%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+++       +Y+ +K  Q R + + K +    W++ HE  A  I   + EL G WV
Sbjct  4    WNRKWRTLWCWSNVYVGWKVSQARARALPKEEQAEFWEQRHEHFANVIWENIKELRGWWV  63

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ++STR+D+LP+ YI+ L +LQD +P      + QTI +ELG  +D++F   D V L
Sbjct  64   KVGQFMSTRSDLLPQQYIHHLVKLQDMMPTSDFASIRQTIADELG-DVDEIFERIDPVAL  122

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+ASI QVHRA L DG  VVVKVQH  V+ ++  D++N K +       E   NF P+++
Sbjct  123  ASASIGQVHRAWLKDGSPVVVKVQHADVETLLSHDMQNLKQLSWAFGLLESGLNFAPILE  182

Query  824  EW  829
            EW
Sbjct  183  EW  184



>gb|KFH12447.1| ABC1 family protein [Toxoplasma gondii VAND]
Length=1900

 Score =   142 bits (357),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 72/182 (40%), Positives = 108/182 (59%), Gaps = 1/182 (1%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+++       +Y+ +K  Q R + + K +    W++ HE  A  I   + EL G WV
Sbjct  4    WNRKWRTLWCWSNVYVGWKVSQARARALPKEEQAEFWEQRHEHFANVIWENIKELRGWWV  63

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ++STR+D+LP+ YI+ L +LQD +P      + QTI +ELG  +D++F   D V L
Sbjct  64   KVGQFMSTRSDLLPQQYIHHLVKLQDMMPTSDFASIRQTIADELG-DVDEIFERIDPVAL  122

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+ASI QVHRA L DG  VVVKVQH  V+ ++  D++N K +       E   NF P+++
Sbjct  123  ASASIGQVHRAWLKDGSPVVVKVQHADVETLLSHDMQNLKQLSWAFGLLESGLNFAPILE  182

Query  824  EW  829
            EW
Sbjct  183  EW  184



>gb|KFG47948.1| ABC1 family protein [Toxoplasma gondii p89]
Length=1900

 Score =   142 bits (357),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 72/182 (40%), Positives = 108/182 (59%), Gaps = 1/182 (1%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+++       +Y+ +K  Q R + + K +    W++ HE  A  I   + EL G WV
Sbjct  4    WNRKWRTLWCWSNVYVGWKVSQARARALPKEEQAEFWEQRHEHFANVIWENIKELRGWWV  63

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ++STR+D+LP+ YI+ L +LQD +P      + QTI +ELG  +D++F   D V L
Sbjct  64   KVGQFMSTRSDLLPQQYIHHLVKLQDMMPTSDFASIRQTIADELG-DVDEIFERIDPVAL  122

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+ASI QVHRA L DG  VVVKVQH  V+ ++  D++N K +       E   NF P+++
Sbjct  123  ASASIGQVHRAWLKDGSPVVVKVQHADVETLLSHDMQNLKQLSWAFGLLESGLNFAPILE  182

Query  824  EW  829
            EW
Sbjct  183  EW  184



>gb|ESS34195.1| ABC1 family protein [Toxoplasma gondii VEG]
 gb|KFG46896.1| ABC1 family protein [Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=1900

 Score =   142 bits (357),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 72/182 (40%), Positives = 108/182 (59%), Gaps = 1/182 (1%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+++       +Y+ +K  Q R + + K +    W++ HE  A  I   + EL G WV
Sbjct  4    WNRKWRTLWCWSNVYVGWKVSQARARALPKEEQAEFWEQRHEHFANVIWENIKELRGWWV  63

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ++STR+D+LP+ YI+ L +LQD +P      + QTI +ELG  +D++F   D V L
Sbjct  64   KVGQFMSTRSDLLPQQYIHHLVKLQDMMPTSDFASIRQTIADELG-DVDEIFERIDPVAL  122

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+ASI QVHRA L DG  VVVKVQH  V+ ++  D++N K +       E   NF P+++
Sbjct  123  ASASIGQVHRAWLKDGSPVVVKVQHADVETLLSHDMQNLKQLSWAFGLLESGLNFAPILE  182

Query  824  EW  829
            EW
Sbjct  183  EW  184



>gb|KFG64585.1| ABC1 family protein [Toxoplasma gondii RUB]
Length=1901

 Score =   142 bits (357),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 72/182 (40%), Positives = 108/182 (59%), Gaps = 1/182 (1%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+++       +Y+ +K  Q R + + K +    W++ HE  A  I   + EL G WV
Sbjct  4    WNRKWRTLWCWSNVYVGWKVSQARARALPKEEQAEFWEQRHEHFANVIWENIKELRGWWV  63

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ++STR+D+LP+ YI+ L +LQD +P      + QTI +ELG  +D++F   D V L
Sbjct  64   KVGQFMSTRSDLLPQQYIHHLVKLQDMMPTSDFASIRQTIADELG-DVDEIFERIDPVAL  122

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+ASI QVHRA L DG  VVVKVQH  V+ ++  D++N K +       E   NF P+++
Sbjct  123  ASASIGQVHRAWLKDGSPVVVKVQHADVETLLSHDMQNLKQLSWAFGLLESGLNFAPILE  182

Query  824  EW  829
            EW
Sbjct  183  EW  184



>emb|CDJ68611.1| ABC1 family beta-lactamase, putative [Eimeria necatrix]
Length=1374

 Score =   141 bits (356),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 71/169 (42%), Positives = 106/169 (63%), Gaps = 1/169 (1%)
 Frame = +2

Query  323  IYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVL  502
            +YL +K  Q R + + + K  A W++ HE  A  + + + EL+G WVK GQ+LSTR+D+L
Sbjct  53   VYLGWKVAQARSRALPQDKQAAYWEQRHEHFANLVWDNIKELKGWWVKVGQFLSTRSDLL  112

Query  503  PEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATL  682
            P+ YI+ L +LQD +P  P E + +T++ ELG  ++ +F   D  PLA+ASI QVHRA L
Sbjct  113  PQQYIHHLIKLQDMMPTTPFEVIEKTLRTELG-DLNLIFSKIDEKPLASASIGQVHRAWL  171

Query  683  SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMIDEW  829
             DG  VVVKVQH  V+ +++ D+ N K +       E   N  P+++EW
Sbjct  172  LDGTAVVVKVQHADVESLLMHDMANLKQLSWAFGMLEQGMNLAPILEEW  220



>gb|KFG53925.1| ABC1 family protein [Toxoplasma gondii FOU]
Length=1900

 Score =   141 bits (355),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 72/182 (40%), Positives = 108/182 (59%), Gaps = 1/182 (1%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+++       +Y+ +K  Q R + + K +    W++ HE  A  I   + EL G WV
Sbjct  4    WNRKWRTLWCWSNVYVGWKVSQARARALPKEEQAEFWEQRHEHFANVIWENIKELRGWWV  63

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ++STR+D+LP+ YI+ L +LQD +P      + QTI +ELG  +D++F   D V L
Sbjct  64   KVGQFMSTRSDLLPQQYIHHLVKLQDMMPTSDYASIRQTIADELG-DVDEIFERIDPVAL  122

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+ASI QVHRA L DG  VVVKVQH  V+ ++  D++N K +       E   NF P+++
Sbjct  123  ASASIGQVHRAWLKDGSPVVVKVQHADVETLLSHDMQNLKQLSWAFGLLESGLNFAPILE  182

Query  824  EW  829
            EW
Sbjct  183  EW  184



>gb|EPR63601.1| ABC1 family protein [Toxoplasma gondii GT1]
Length=1900

 Score =   141 bits (355),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 72/182 (40%), Positives = 108/182 (59%), Gaps = 1/182 (1%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+++       +Y+ +K  Q R + + K +    W++ HE  A  I   + EL G WV
Sbjct  4    WNRKWRTLWCWSNVYVGWKVSQARARALPKEEQAEFWEQRHEHFANVIWENIKELRGWWV  63

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ++STR+D+LP+ YI+ L +LQD +P      + QTI +ELG  +D++F   D V L
Sbjct  64   KVGQFMSTRSDLLPQQYIHHLVKLQDMMPTSDYASIRQTIADELG-DVDEIFERIDPVAL  122

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+ASI QVHRA L DG  VVVKVQH  V+ ++  D++N K +       E   NF P+++
Sbjct  123  ASASIGQVHRAWLKDGSPVVVKVQHADVETLLSHDMQNLKQLSWAFGLLESGLNFAPILE  182

Query  824  EW  829
            EW
Sbjct  183  EW  184



>ref|XP_008219989.1| PREDICTED: uncharacterized protein LOC103320134 isoform X2 [Prunus 
mume]
Length=841

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  605  MDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIA  784
            MD+LF++F  VPLATASIAQVHRATL +GQEVVVKVQH+G+  IILEDLKNAKSIVDWIA
Sbjct  1    MDELFLDFVKVPLATASIAQVHRATLLNGQEVVVKVQHEGIKTIILEDLKNAKSIVDWIA  60

Query  785  WAEPQYNFNPMIDEWC  832
            WAEPQ+NFNPMIDEWC
Sbjct  61   WAEPQFNFNPMIDEWC  76



>emb|CDJ31169.1| Beta-lactamase family protein, related [Eimeria mitis]
Length=1196

 Score =   140 bits (354),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 70/182 (38%), Positives = 110/182 (60%), Gaps = 1/182 (1%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+++       +YL +K  Q R + + + K  A W++ HE  A  + + + EL+G WV
Sbjct  4    WNRKWRTLWCWSNVYLGWKVAQARSRALPQDKQAAYWEQRHEHFANLVWDNIKELKGWWV  63

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LSTR+D+LP+ YI+ L +LQD +P  P   + + ++ ELG  +  +F   +  PL
Sbjct  64   KVGQFLSTRSDLLPQQYIHHLIKLQDMMPTTPYAVIEKALETELG-DLSQIFSKIEEKPL  122

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+ASI QVHRA L+DG  VVVKVQH  V+ +++ D+ N K +       E   NF P+++
Sbjct  123  ASASIGQVHRAWLTDGTAVVVKVQHADVESLLMHDMANLKQLSWAFGLLEQGMNFAPILE  182

Query  824  EW  829
            EW
Sbjct  183  EW  184



>ref|XP_002139221.1| ABC1 family protein [Cryptosporidium muris RN66]
 gb|EEA04872.1| ABC1 family protein [Cryptosporidium muris RN66]
Length=321

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 103/182 (57%), Gaps = 0/182 (0%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+++      ++Y+ YK  Q   + + +   +  W K H   A+ I   + EL G WV
Sbjct  7    WNRKWRTLWCWTYMYVHYKRAQAHARSLPEEAQNIYWSKQHSHFAELIWQNISELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LSTR+D+LP  YI  L +LQD +P  P  ++ + ++ ELG      F     +P+
Sbjct  67   KVGQFLSTRSDLLPHEYIVYLSKLQDMMPTTPWPQIKEILEKELGIEWSSKFQEIKEIPM  126

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+ASIAQVH A L DG +V+VKVQH  V++I+ +D+ N   +       E   NF PMI+
Sbjct  127  ASASIAQVHSAKLRDGTKVIVKVQHPNVEEILQQDMTNLTQLSWAFGIVEKNINFLPMIE  186

Query  824  EW  829
            EW
Sbjct  187  EW  188



>ref|XP_008883720.1| ABC1 family protein [Hammondia hammondi]
 gb|KEP65509.1| ABC1 family protein [Hammondia hammondi]
Length=1888

 Score =   138 bits (348),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 71/182 (39%), Positives = 107/182 (59%), Gaps = 1/182 (1%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+++       +Y+ +K  Q R + + K +    W++ HE  A  I   + EL G WV
Sbjct  4    WNRKWRTLWCWSNVYVGWKVSQARARALPKEEQAEFWEQRHEHFANVIWENIKELRGWWV  63

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ++STR+D+LP+ YI+ L +LQD +P      + QTI +ELG  +D +F   D V L
Sbjct  64   KVGQFMSTRSDLLPQQYIHHLVKLQDMMPTSDFASIRQTIADELG-DVDAIFERIDPVAL  122

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+ASI QVHRA L +G  VVVKVQH  V+ ++  D++N K +       E   NF P+++
Sbjct  123  ASASIGQVHRAWLKNGSPVVVKVQHADVETLLSHDMQNLKQLSWAFGLLESGLNFAPILE  182

Query  824  EW  829
            EW
Sbjct  183  EW  184



>gb|KJB55250.1| hypothetical protein B456_009G069300 [Gossypium raimondii]
Length=832

 Score =   137 bits (344),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +2

Query  605  MDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIA  784
            MDDLF  F   PLATASIAQVHRATL +GQEVVVKVQHDG+  IILEDLKNAKSIV+WIA
Sbjct  1    MDDLFAEFVEKPLATASIAQVHRATLLNGQEVVVKVQHDGIKAIILEDLKNAKSIVNWIA  60

Query  785  WAEPQYNFNPMIDEWC  832
            WAEPQY+FNPMIDEWC
Sbjct  61   WAEPQYDFNPMIDEWC  76



>ref|XP_003885939.1| putative ABC1 family beta-lactamase [Neospora caninum Liverpool]
 emb|CBZ55913.1| putative ABC1 family beta-lactamase [Neospora caninum Liverpool]
Length=1794

 Score =   135 bits (340),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 70/182 (38%), Positives = 105/182 (58%), Gaps = 1/182 (1%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+++       +Y+ +K  Q R + + K      W++ HE  A  I   + EL G WV
Sbjct  4    WNRKWRTLWCWSNVYVGWKVSQARARALPKEAQAEFWEQRHEHFANVIWENIKELRGWWV  63

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ++STR+D+LP+ YI+ L +LQD +P      + +TI +ELG  +D +F   D   L
Sbjct  64   KVGQFMSTRSDLLPQQYIHHLVKLQDMMPTSDFASIRKTIADELG-DVDAIFEKIDPNAL  122

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+ASI QVHRA L DG  VVVKVQH  V+ ++  D++N K +       E   NF P+++
Sbjct  123  ASASIGQVHRAWLKDGSPVVVKVQHADVETLLSHDMQNLKQLSWAFGLLESGLNFAPILE  182

Query  824  EW  829
            EW
Sbjct  183  EW  184



>ref|WP_013767326.1| ABC transporter [Haliscomenobacter hydrossis]
 gb|AEE52791.1| ABC-1 domain-containing protein [Haliscomenobacter hydrossis 
DSM 1100]
Length=555

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 105/177 (59%), Gaps = 4/177 (2%)
 Frame = +2

Query  290  RRF-KVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVK  466
            RRF K +     + L Y  L   ++   +   D   +K H RNA+R+   ++EL+GL++K
Sbjct  8    RRFRKAYRTAAQVMLSYAFLLLGKRIFGQRYSDLRIEKLHVRNAERVKRAILELDGLFIK  67

Query  467  FGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLA  646
             GQ LS  ++ LPE +   L++LQD +P RP  +V + I +ELGK+ +DLF  FD VPLA
Sbjct  68   IGQMLSILSNFLPETFQKPLEELQDKIPARPYAQVRERIVSELGKAPEDLFARFDEVPLA  127

Query  647  TASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
             ASI Q HRA L DG EVVVKVQH G++ I   DL+  + ++   AW    YN   M
Sbjct  128  AASIGQAHRAQLKDGTEVVVKVQHMGIEAIARIDLEIIRRLIQVSAWF---YNIKGM  181



>ref|XP_674400.1| hypothetical protein [Plasmodium berghei strain ANKA]
 emb|CAH99091.1| conserved hypothetical protein [Plasmodium berghei]
Length=360

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 106/193 (55%), Gaps = 14/193 (7%)
 Frame = +2

Query  290  RRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKF  469
            RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WVK 
Sbjct  9    RRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWVKV  68

Query  470  GQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLAT  649
            GQ+LST+ +++P AYI    +LQD +P  P E++   ++ ELG SM +LF   D  PLA+
Sbjct  69   GQFLSTQENIMPVAYIEKFTKLQDMMPTSPFEKIEVILKRELG-SMYELFEYIDKTPLAS  127

Query  650  ASIAQVHRATLSDGQ-------------EVVVKVQHDGVDKIILEDLKNAKSIVDWIAWA  790
            ASI QVH+A L  G               V++K+QH+G+DK +  D+   K +       
Sbjct  128  ASIGQVHKARLKKGMIIDNMNKSYKNDYNVIIKIQHEGIDKFLSSDISTLKKVSWAFGLI  187

Query  791  EPQYNFNPMIDEW  829
            +  +NF   I+EW
Sbjct  188  DKNFNFGDYIEEW  200



>gb|KDO67199.1| hypothetical protein CISIN_1g002031mg [Citrus sinensis]
Length=864

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +2

Query  605  MDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIA  784
            M  +FM+F   PLATASIAQVHRATL DG++VVVKVQH G+  IILEDLKNAKSIVDWIA
Sbjct  1    MGGMFMDFVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIA  60

Query  785  WAEPQYNFNPMIDEWC  832
            WAEPQY+FNP+IDEWC
Sbjct  61   WAEPQYDFNPIIDEWC  76



>ref|WP_038682564.1| hypothetical protein [Rubrobacter radiotolerans]
 gb|AHY47378.1| putative unusual protein kinase [Rubrobacter radiotolerans]
Length=533

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 99/172 (58%), Gaps = 5/172 (3%)
 Frame = +2

Query  323  IYLDYKALQKREKWISKLKIDALWQKA----HERNAKRILNLMIELEGLWVKFGQYLSTR  490
            +Y  Y A ++R +W + L  + + ++     H R A R L++   L G  +K GQ+ STR
Sbjct  116  LYTSYAAFRERSRWFTGLAEEKVRERELEALHRRGAGRALDVAQALGGSLIKAGQFASTR  175

Query  491  ADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVH  670
             D+LP AY   L  LQD +PPRP   + + ++ E G+ + + F  FD   +A ASIAQVH
Sbjct  176  PDLLPPAYTKTLSTLQDRVPPRPFAVIKRAVERETGRPLKETFSEFDREAVAAASIAQVH  235

Query  671  RATL-SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            RA L   G+EV VKV++  V  +I EDL + ++I D +A  EP+    P+ D
Sbjct  236  RARLKGSGREVAVKVRYPEVAGLIEEDLDSLEAIFDGLARLEPEVRLRPISD  287



>gb|EUD73740.1| Atypical/ABC1 protein kinase [Plasmodium vinckei petteri]
Length=588

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 110/197 (56%), Gaps = 22/197 (11%)
 Frame = +2

Query  290  RRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKF  469
            RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WVK 
Sbjct  32   RRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWVKV  91

Query  470  GQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLAT  649
            GQ+LST+ +++P AYI    +LQD +P  P E++   ++ ELG SM +LF   D  PLA+
Sbjct  92   GQFLSTQENIMPVAYIEKFTKLQDMMPTSPFEKIEVILKRELG-SMYELFDYIDKTPLAS  150

Query  650  ASIAQVHRATLSDGQ-------------EVVVKVQHDGVDKIILEDLKNAKSIVDWIAWA  790
            ASI QVH+A L  G               V++K+QH+G+DK +  D+    S +  ++WA
Sbjct  151  ASIGQVHKARLKTGSMIEDISKSYKNDYNVIIKIQHEGIDKFLSSDI----STLKKVSWA  206

Query  791  ----EPQYNFNPMIDEW  829
                +  +NF   I+EW
Sbjct  207  FGLIDKNFNFGDYIEEW  223



>gb|EWM21892.1| abc1 family protein [Nannochloropsis gaditana]
Length=1362

 Score =   130 bits (328),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 65/184 (35%), Positives = 107/184 (58%), Gaps = 0/184 (0%)
 Frame = +2

Query  278  SIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGL  457
            ++Y+R    F++   + +  +  + R       + +ALW++A+      +      L+G 
Sbjct  382  TLYRRSATAFSVAAVLVVAIELTKVRVGTRLATESEALWEEANYIYGAYLRLAFFRLKGS  441

Query  458  WVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGV  637
            ++K  QY+S+RAD++P+A+   L  LQD++PP P+  +   I+  LG  +D+ F  F+  
Sbjct  442  YIKMAQYISSRADIVPDAFSDELSALQDAVPPSPITAIRPMIEKALGSRLDEAFYTFESE  501

Query  638  PLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
             LA+ASIAQVHRA   DG +VVVKVQH  V +++  DL+N   I+  I W EP Y+F+ +
Sbjct  502  ALASASIAQVHRARRKDGTDVVVKVQHPDVARLLSIDLRNIVVILTLIGWIEPDYDFSMV  561

Query  818  IDEW  829
              EW
Sbjct  562  AREW  565



>ref|XP_008890245.1| hypothetical protein PPTG_00585 [Phytophthora parasitica INRA-310]
 gb|ETI56917.1| hypothetical protein F443_00700 [Phytophthora parasitica P1569]
 gb|ETL50054.1| hypothetical protein L916_00642 [Phytophthora parasitica]
 gb|ETM03115.1| hypothetical protein L917_00612 [Phytophthora parasitica]
 gb|ETM56380.1| hypothetical protein L914_00633 [Phytophthora parasitica]
 gb|ETN24148.1| hypothetical protein PPTG_00585 [Phytophthora parasitica INRA-310]
 gb|ETO85688.1| hypothetical protein F444_00693 [Phytophthora parasitica P1976]
 gb|ETP26700.1| hypothetical protein F441_00689 [Phytophthora parasitica CJ01A1]
 gb|ETP54692.1| hypothetical protein F442_00660 [Phytophthora parasitica P10297]
Length=550

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 97/162 (60%), Gaps = 5/162 (3%)
 Frame = +2

Query  323  IYLDYKALQ--KREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRAD  496
            IYL Y+A Q       +S  + DA ++K HE+ A  + ++++EL+G +VK  Q  STR D
Sbjct  47   IYLHYRAAQLYMEHAQLSDEEQDAEYEKLHEKYAPEVFDIVLELKGFYVKLAQTGSTRPD  106

Query  497  VLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRA  676
            VLP+ Y+    +LQD  P +P+EE+C  I++  GK +D +F + D  PL  ASI Q HRA
Sbjct  107  VLPKQYLERAAKLQDDAPSKPVEEICAIIEHSYGKPIDQVFQSIDSKPLGAASIGQAHRA  166

Query  677  TLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQY  802
             L DGQEV VKVQH   +     D+   K+I D+  + +P +
Sbjct  167  VLLDGQEVAVKVQHPDAETFFRWDI---KTIQDFCRYFQPAH  205



>gb|ETK96708.1| hypothetical protein L915_00641 [Phytophthora parasitica]
Length=550

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 97/162 (60%), Gaps = 5/162 (3%)
 Frame = +2

Query  323  IYLDYKALQ--KREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRAD  496
            IYL Y+A Q       +S  + DA ++K HE+ A  + ++++EL+G +VK  Q  STR D
Sbjct  47   IYLHYRAAQLYMEHAQLSDEEQDAEYEKLHEKYAPEVFDIVLELKGFYVKLAQTGSTRPD  106

Query  497  VLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRA  676
            VLP+ Y+    +LQD  P +P+EE+C  I++  GK +D +F + D  PL  ASI Q HRA
Sbjct  107  VLPKQYLERAAKLQDDAPSKPVEEICAIIEHSYGKPIDQVFQSIDSKPLGAASIGQAHRA  166

Query  677  TLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQY  802
             L DGQEV VKVQH   +     D+   K+I D+  + +P +
Sbjct  167  VLLDGQEVAVKVQHPDAETFFRWDI---KTIQDFCRYFQPAH  205



>emb|CDU21766.1| atypical protein kinase, ABC-1 family, putative [Plasmodium chabaudi 
chabaudi]
Length=2082

 Score =   129 bits (324),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 69/195 (35%), Positives = 107/195 (55%), Gaps = 14/195 (7%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P  P E++   ++ ELG SM +LF   D  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSPFEKIEVILKRELG-SMYELFDYIDKTPL  125

Query  644  ATASIAQVHRATLSDGQ-------------EVVVKVQHDGVDKIILEDLKNAKSIVDWIA  784
            A+ASI QVH+A L  G               V++K+QH+G+DK +  D+   K +     
Sbjct  126  ASASIGQVHKARLKTGDMIENMSKSYKNDYNVIIKIQHEGIDKFLSSDISTLKKVSWAFG  185

Query  785  WAEPQYNFNPMIDEW  829
              +  +NF   I+EW
Sbjct  186  LIDKNFNFGDYIEEW  200



>ref|WP_022984014.1| hypothetical protein [Alcanivorax sp. P2S70]
 gb|ERP93032.1| hypothetical protein Q670_08255 [Alcanivorax sp. P2S70]
Length=531

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 97/168 (58%), Gaps = 0/168 (0%)
 Frame = +2

Query  323  IYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVL  502
            +   Y+    R  ++     D+  Q  H+RNA+R     +E  G ++K GQ LS+R D+L
Sbjct  107  VVASYRLWGTRSAFLPASMRDSALQALHQRNARRFCETSLEQGGAFLKIGQLLSSRPDLL  166

Query  503  PEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATL  682
            P+A+I  L  LQD   P P E V Q ++ E GK ++ LF +FD  PLA ASI QVHRA L
Sbjct  167  PQAWIDELAVLQDQASPLPYETVRQVLEEEFGKPVEQLFAHFDRDPLAAASIGQVHRARL  226

Query  683  SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMIDE  826
             DGQEV VKVQ  G+D+++  D+   K  +D +  A P  + + ++ E
Sbjct  227  LDGQEVAVKVQRPGLDELVELDMTLLKVFMDAVKSALPPMDMDTIVSE  274



>ref|WP_035248985.1| ABC transporter [Alcanivorax jadensis]
 gb|KGD60549.1| hypothetical protein T9A_02505 [Alcanivorax jadensis T9]
Length=530

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 104/185 (56%), Gaps = 0/185 (0%)
 Frame = +2

Query  272  WGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELE  451
            W +  KR  K   +   +   Y+    R  ++     +A  +  H+RNA+R  +  +E  
Sbjct  90   WPTRLKRLSKTGWMLTKVVASYRLWGTRSAFLPTSMREAALESLHQRNARRFRDTSLEQG  149

Query  452  GLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFD  631
            G ++K GQ LS+R D+LP+A++  L  LQD   P P +E+   ++ E G+ +D LF +FD
Sbjct  150  GAFLKIGQLLSSRPDLLPQAWVDELTILQDQANPVPFDEIALVLEQEFGQPLDQLFAHFD  209

Query  632  GVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFN  811
              PLA ASI QVHRA L DG+EV VKVQ  G+D+++  D+   K  +D +  A P  + +
Sbjct  210  PEPLAAASIGQVHRARLHDGREVAVKVQRPGLDEVVELDMALLKVFMDAVKSALPPMDMD  269

Query  812  PMIDE  826
             ++ E
Sbjct  270  TIVSE  274



>emb|CDU21353.1| atypical protein kinase, ABC-1 family, putative [Plasmodium berghei 
ANKA]
Length=2117

 Score =   128 bits (322),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 69/195 (35%), Positives = 107/195 (55%), Gaps = 14/195 (7%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P  P E++   ++ ELG SM +LF   D  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSPFEKIEVILKRELG-SMYELFEYIDKTPL  125

Query  644  ATASIAQVHRATLSDGQ-------------EVVVKVQHDGVDKIILEDLKNAKSIVDWIA  784
            A+ASI QVH+A L  G               V++K+QH+G+DK +  D+   K +     
Sbjct  126  ASASIGQVHKARLKKGMIIDNMNKSYKNDYNVIIKIQHEGIDKFLSSDISTLKKVSWAFG  185

Query  785  WAEPQYNFNPMIDEW  829
              +  +NF   I+EW
Sbjct  186  LIDKNFNFGDYIEEW  200



>ref|XP_002902200.1| glycoside hydrolase, putative [Phytophthora infestans T30-4]
 gb|EEY56872.1| glycoside hydrolase, putative [Phytophthora infestans T30-4]
Length=490

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 95/160 (59%), Gaps = 5/160 (3%)
 Frame = +2

Query  323  IYLDYKALQ--KREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRAD  496
            IYL Y+A Q       +S  + DA ++K HE+ A  + ++++EL+G +VK  Q  STR D
Sbjct  47   IYLHYRAAQLYMEHAQLSDEEQDAEYEKLHEKYAPEVFDIVLELKGFYVKLAQTGSTRPD  106

Query  497  VLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRA  676
            VLP+ Y+    +LQD  P +P+EE+C  I+   GK +D +F + D  PL  ASI Q HRA
Sbjct  107  VLPKQYLDRAAKLQDDAPAKPVEEICAIIEQSYGKPIDPVFQSIDSKPLGAASIGQAHRA  166

Query  677  TLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEP  796
             L DGQEV VKVQH   +     D+   K+I D+  + +P
Sbjct  167  VLLDGQEVAVKVQHPDAETFFRWDI---KTIQDFCRYFQP  203



>gb|ETB59539.1| hypothetical protein, variant 1 [Plasmodium yoelii 17X]
 gb|ETB59540.1| hypothetical protein, variant 2 [Plasmodium yoelii 17X]
Length=2049

 Score =   127 bits (320),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 68/195 (35%), Positives = 106/195 (54%), Gaps = 14/195 (7%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P  P E++   ++ ELG SM + F   D  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSPFEKIEIILKRELG-SMYEFFEYIDKTPL  125

Query  644  ATASIAQVHRATLSDG-------------QEVVVKVQHDGVDKIILEDLKNAKSIVDWIA  784
            A+ASI QVH+A L  G               V++K+QH+G+DK +  D+   K +     
Sbjct  126  ASASIGQVHKARLKKGIVIDNMNKSYKNDYNVIIKIQHEGIDKFLSSDISTLKKVSWAFG  185

Query  785  WAEPQYNFNPMIDEW  829
              +  +NF   I+EW
Sbjct  186  LIDKNFNFGDYIEEW  200



>gb|ETB59538.1| hypothetical protein YYC_02994 [Plasmodium yoelii 17X]
Length=2073

 Score =   127 bits (320),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 68/195 (35%), Positives = 106/195 (54%), Gaps = 14/195 (7%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P  P E++   ++ ELG SM + F   D  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSPFEKIEIILKRELG-SMYEFFEYIDKTPL  125

Query  644  ATASIAQVHRATLSDG-------------QEVVVKVQHDGVDKIILEDLKNAKSIVDWIA  784
            A+ASI QVH+A L  G               V++K+QH+G+DK +  D+   K +     
Sbjct  126  ASASIGQVHKARLKKGIVIDNMNKSYKNDYNVIIKIQHEGIDKFLSSDISTLKKVSWAFG  185

Query  785  WAEPQYNFNPMIDEW  829
              +  +NF   I+EW
Sbjct  186  LIDKNFNFGDYIEEW  200



>emb|CDU85136.1| atypical protein kinase, ABC-1 family, putative [Plasmodium yoelii]
Length=2064

 Score =   127 bits (319),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 68/195 (35%), Positives = 106/195 (54%), Gaps = 14/195 (7%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P  P E++   ++ ELG SM + F   D  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSPFEKIEIILKRELG-SMYEFFEYIDKTPL  125

Query  644  ATASIAQVHRATLSDG-------------QEVVVKVQHDGVDKIILEDLKNAKSIVDWIA  784
            A+ASI QVH+A L  G               V++K+QH+G+DK +  D+   K +     
Sbjct  126  ASASIGQVHKARLKKGIVIDNMNKSYKNDYNVIIKIQHEGIDKFLSSDISTLKKVSWAFG  185

Query  785  WAEPQYNFNPMIDEW  829
              +  +NF   I+EW
Sbjct  186  LIDKNFNFGDYIEEW  200



>ref|XP_005535054.1| unknown kinase with aarF domain, fused with possible beta-lactamase 
[Cyanidioschyzon merolae strain 10D]
 dbj|BAM78768.1| unknown kinase with aarF domain, fused with possible beta-lactamase 
[Cyanidioschyzon merolae strain 10D]
Length=1035

 Score =   127 bits (318),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 74/193 (38%), Positives = 120/193 (62%), Gaps = 9/193 (5%)
 Frame = +2

Query  278  SIYKRRFKVFALTIFIYLDYKALQKREKWISK--LKIDALWQKAHERNAKRILNLMIELE  451
            +++ RR  V+ + + +Y+D +  ++R +   +   +   LW + H R A+R+L  M+ L 
Sbjct  6    ALWARRIVVYYVALRVYVDVRWTRRRARAFGEDDARYALLWSRCHRRCARRLLRSMLRLR  65

Query  452  GLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKS-----MDDL  616
            GLW+K GQY+STRADV+P  Y+  L QLQD++P    + V   ++ EL ++     + D+
Sbjct  66   GLWLKAGQYVSTRADVVPVEYVEELMQLQDAVPAEAGDRVRARLERELARAPFQRGLLDV  125

Query  617  FMNFD-GVPLATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWA  790
            F N D   PL  ASIAQVHRA L     +VVVK++H GV +++ +DL+N + I DWIA+ 
Sbjct  126  FANIDLEEPLGCASIAQVHRARLRGSNAQVVVKLRHRGVKRVVEQDLENLRIIFDWIAYY  185

Query  791  EPQYNFNPMIDEW  829
            EP +++  ++ EW
Sbjct  186  EPDFDWRELVREW  198



>ref|WP_045120201.1| hypothetical protein, partial [Haliangium ochraceum]
Length=512

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 108/173 (62%), Gaps = 2/173 (1%)
 Frame = +2

Query  290  RRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKF  469
            R FKV+ +T  +   Y  L+ + ++ S+  I+ L +K H RNA+R+   +IEL+GL++K 
Sbjct  3    RFFKVYWVTFVVIGSYLWLRLQARFRSRASIERLTRKLHVRNARRVERAIIELQGLFIKV  62

Query  470  GQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNEL-GKSMDDLFMNFDGVPLA  646
            GQ +S   + LP A+   L+ LQD +PPRP +++ + ++ E  G+  + LF +F+ VP+A
Sbjct  63   GQLISIMTNYLPAAFREQLEGLQDQVPPRPYDDIERRLREEFDGRGPEALFASFERVPVA  122

Query  647  TASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            +AS+ QVH A L  G  V VKVQ+ G++KI+  DL+  + I+ W+      Y+
Sbjct  123  SASVGQVHLAELHGGGRVAVKVQYPGIEKIVRSDLRAMRRIL-WLVGHVTHYD  174



>emb|CDZ16902.1| atypical protein kinase, ABC-1 family, putative [Plasmodium yoelii]
Length=2076

 Score =   127 bits (319),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 68/195 (35%), Positives = 106/195 (54%), Gaps = 14/195 (7%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P  P E++   ++ ELG SM + F   D  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSPFEKIEIILKRELG-SMYEFFEYIDKTPL  125

Query  644  ATASIAQVHRATLSDG-------------QEVVVKVQHDGVDKIILEDLKNAKSIVDWIA  784
            A+ASI QVH+A L  G               V++K+QH+G+DK +  D+   K +     
Sbjct  126  ASASIGQVHKARLKKGIVIDNMNKSYKNDYNVIIKIQHEGIDKFLSSDISTLKKVSWAFG  185

Query  785  WAEPQYNFNPMIDEW  829
              +  +NF   I+EW
Sbjct  186  LIDKNFNFGDYIEEW  200



>ref|XP_008624003.1| Atypical/ABC1 protein kinase [Plasmodium vinckei vinckei]
 gb|KEG03182.1| Atypical/ABC1 protein kinase [Plasmodium vinckei vinckei]
Length=2100

 Score =   127 bits (319),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 68/195 (35%), Positives = 106/195 (54%), Gaps = 14/195 (7%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WV
Sbjct  48   WNRRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWV  107

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P  P E++   ++ ELG  M +LF   D  PL
Sbjct  108  KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSPFEKIEVILKRELG-DMYELFDYIDKTPL  166

Query  644  ATASIAQVHRATLSDGQ-------------EVVVKVQHDGVDKIILEDLKNAKSIVDWIA  784
            A+ASI QVH+A L  G               V++K+QH+G+DK +  D+   K +     
Sbjct  167  ASASIGQVHKARLKTGSMIENMSKSYKNDYNVIIKIQHEGIDKFLSSDISTLKKVSWAFG  226

Query  785  WAEPQYNFNPMIDEW  829
              +  +NF   I+EW
Sbjct  227  LIDKNFNFGDYIEEW  241



>ref|WP_027420298.1| hypothetical protein [Crocinitomix catalasitica]
Length=544

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 100/167 (60%), Gaps = 0/167 (0%)
 Frame = +2

Query  287  KRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVK  466
            KR  K + L   I  +Y  L  R+K   +   D      H++NA+RI   ++EL GL+VK
Sbjct  8    KRARKAYRLAYRIMWNYLWLFARKKVFGQQYFDKRIGAVHQKNAERIKGAILELRGLFVK  67

Query  467  FGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLA  646
             GQ LS  + +LP+AY  +L+ LQD+ P  P  E   TIQ ELG+S+  LF  FD VP+A
Sbjct  68   VGQLLSVMSTILPDAYAEVLESLQDAAPASPFSETEATIQKELGESISALFAEFDEVPIA  127

Query  647  TASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAW  787
            +ASI QV++A L  G++V VK+QH  ++ +   DL   +++V  +++
Sbjct  128  SASIGQVYKARLKTGEQVAVKIQHSNIEALAELDLNIVENLVKKVSF  174



>gb|ACY14511.1| ABC-1 domain protein [Haliangium ochraceum DSM 14365]
Length=564

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 108/173 (62%), Gaps = 2/173 (1%)
 Frame = +2

Query  290  RRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKF  469
            R FKV+ +T  +   Y  L+ + ++ S+  I+ L +K H RNA+R+   +IEL+GL++K 
Sbjct  11   RFFKVYWVTFVVIGSYLWLRLQARFRSRASIERLTRKLHVRNARRVERAIIELQGLFIKV  70

Query  470  GQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNEL-GKSMDDLFMNFDGVPLA  646
            GQ +S   + LP A+   L+ LQD +PPRP +++ + ++ E  G+  + LF +F+ VP+A
Sbjct  71   GQLISIMTNYLPAAFREQLEGLQDQVPPRPYDDIERRLREEFDGRGPEALFASFERVPVA  130

Query  647  TASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYN  805
            +AS+ QVH A L  G  V VKVQ+ G++KI+  DL+  + I+ W+      Y+
Sbjct  131  SASVGQVHLAELHGGGRVAVKVQYPGIEKIVRSDLRAMRRIL-WLVGHVTHYD  182



>ref|XP_004828896.1| hypothetical protein BEWA_020770 [Babesia equi]
 gb|AFZ79230.1| hypothetical protein BEWA_020770 [Babesia equi strain WA]
Length=1140

 Score =   125 bits (313),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 59/132 (45%), Positives = 86/132 (65%), Gaps = 5/132 (4%)
 Frame = +2

Query  392  WQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEV  571
            W+K H++ A  IL  +  L+G WVK GQ+LST++ VLP  Y+    QLQD +P     E+
Sbjct  56   WEKMHKKMADSILANIKSLKGCWVKLGQFLSTKSGVLPSCYLEAFSQLQDYMPSSDFGEI  115

Query  572  CQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDL  751
              +I+ +LG  MDD++ NFD +PLA+ASIAQVH+A L DG  V +KVQH   ++ +L D+
Sbjct  116  IDSIETDLG-YMDDIYKNFDSIPLASASIAQVHKAVLHDGTSVAIKVQHKSSEQNLLNDI  174

Query  752  KNAKSIVDWIAW  787
            +    I+  I+W
Sbjct  175  E----ILKMISW  182



>gb|EKD51091.1| hypothetical protein ACD_62C00350G0019 [uncultured bacterium]
Length=553

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 106/181 (59%), Gaps = 1/181 (1%)
 Frame = +2

Query  287  KRRF-KVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            K RF + +  T  I L Y AL    + +   +  AL+++AH R AK+I+  ++ L+GL++
Sbjct  13   KTRFIRAYYTTFNILLRYLALMFFARLLDAERSLALFERAHVRTAKQIIRTLLNLKGLYI  72

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ LS   ++LP++    L+ LQD +PP    E+ +    + GK+ ++LF   D  P+
Sbjct  73   KLGQTLSAMGNILPQSLTQELELLQDQVPPHAFAEINERFLTDFGKTAEELFRKIDPQPI  132

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
            A+AS+ QVH A   +G+++ VK+Q+  +DK++  DLK  K+I   I +  P YN   ++ 
Sbjct  133  ASASLGQVHVAYHKNGEKLAVKLQYPNIDKLVQADLKTIKNIFAIIHFIFPGYNLKTVVS  192

Query  824  E  826
            E
Sbjct  193  E  193



>ref|WP_015738287.1| ABC-1 domain-containing protein [Ammonifex degensii]
 gb|ACX51409.1| ABC-1 domain protein [Ammonifex degensii KC4]
Length=544

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 88/141 (62%), Gaps = 3/141 (2%)
 Frame = +2

Query  416  AKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNEL  595
            A+R+   + EL   +VK GQ+LSTRAD+LPE YI  L  LQD++PP P +E+ + I+ E 
Sbjct  52   ARRLRLALTELGPTFVKLGQFLSTRADLLPEEYIKELSLLQDTVPPLPAKEIVRVIEQEF  111

Query  596  GKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVD  775
            G  +D LF  F+  PL +ASIAQVHRA L  G+EVVVKV+  GV ++I  DL   K +  
Sbjct  112  GCHLDSLFSYFEPEPLGSASIAQVHRARLLSGEEVVVKVRRPGVLEVIETDLAILKRVAR  171

Query  776  WIAWAEP---QYNFNPMIDEW  829
            W     P    Y F  M++E+
Sbjct  172  WAEKHTPWGKIYPFAEMVEEF  192



>ref|XP_011128574.1| putative of plant or bacterial origin [Gregarina niphandrodes]
 gb|EZG88400.1| putative of plant or bacterial origin [Gregarina niphandrodes]
Length=1619

 Score =   121 bits (304),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 110/186 (59%), Gaps = 8/186 (4%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + R+ +       +YL +K  Q   + + + K  A W+  H + A+ I   + +L G WV
Sbjct  9    WNRKVRTLYTWSHLYLGFKVAQVHSRMLPQQKRAAYWKHRHSKFAQAIWTNIADLRGWWV  68

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LSTRAD+LP+ Y+  L ++QD +P    E V   I++ELG+ +D++F   +   L
Sbjct  69   KVGQFLSTRADLLPDEYVSELAKVQDMMPTSCFEIVRGIIEHELGRPLDEIFEYVEEKAL  128

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWA----EPQYNFN  811
            A+ASI QVH+A L  G+ VV+KVQH  VDK++ +D+    +++  ++WA    E   +F 
Sbjct  129  ASASIGQVHKAKLLTGELVVIKVQHPNVDKMLSQDM----ALLGQLSWAFGLLERGLSFT  184

Query  812  PMIDEW  829
             ++DEW
Sbjct  185  SVLDEW  190



>ref|XP_010696179.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X3 [Beta vulgaris subsp. vulgaris]
Length=353

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 99/165 (60%), Gaps = 3/165 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKI-DALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +A T  IY  YK  Q R  ++  +K  + +W++ HE  A +I N+  E+ G +
Sbjct  23   WQRSFQFWARTAEIYTGYKVFQARVSFVKDVKKQEEMWERQHEVAADKIYNMCYEMGGFF  82

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q +  + D+ P A++  L  L D  PP P E V   ++ ELG+S+ +LF  FD  P
Sbjct  83   LKIAQIIG-KPDLAPAAWVRRLVTLCDQAPPTPYEVVRIVVEKELGESISELFDQFDANP  141

Query  641  LATASIAQVHRATLSDG-QEVVVKVQHDGVDKIILEDLKNAKSIV  772
            L +ASIAQVHRA L     +VVVKVQH GV ++++ D++N ++  
Sbjct  142  LGSASIAQVHRARLKGNINDVVVKVQHPGVQELMMTDIRNLQAFA  186



>gb|AHK78811.1| ABC transporter [Halorhodospira halochloris str. A]
Length=523

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 94/167 (56%), Gaps = 0/167 (0%)
 Frame = +2

Query  323  IYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVL  502
            +++ Y  L++R +W   L     W+  HER A R+L     L G  +K  Q+ S+R D+L
Sbjct  116  LWMGYAVLRERGRWAPWLATSRDWELQHERGAHRVLAAAQSLGGSLIKAAQFASSRPDLL  175

Query  503  PEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATL  682
            P  Y  +L QLQD + P+P   + Q +  ELG+ +  +F   D  P+A ASIAQVH A L
Sbjct  176  PLTYTKILSQLQDRVTPQPWPVIEQALTQELGQPIHRVFAEVDPQPVAAASIAQVHHARL  235

Query  683  SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
             DG+ V +KVQ+  +  +I  DL   + I++ I+  EP+    P++D
Sbjct  236  HDGRRVALKVQYPDMQNLIEADLAAMEHILNGISRLEPELRLEPVLD  282



>ref|WP_027356835.1| ABC transporter [Desulfotomaculum thermocisternum]
Length=564

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 91/151 (60%), Gaps = 3/151 (2%)
 Frame = +2

Query  386  ALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLE  565
            AL  +      +R+   + EL   ++K GQ LSTR+D+LP  YI  L++LQD +PP P  
Sbjct  57   ALTVREQPSPPERLRQALEELGPAFIKLGQVLSTRSDLLPPQYIAELEKLQDQVPPFPFA  116

Query  566  EVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILE  745
            +V + IQ ELG  ++++F +F+  PLA ASI QVHRA L DG+ VVVKVQ  GV+K IL 
Sbjct  117  QVRERIQMELGAPLEEIFDHFEATPLAAASIGQVHRANLRDGRPVVVKVQRPGVEKTILT  176

Query  746  D---LKNAKSIVDWIAWAEPQYNFNPMIDEW  829
            D   L +   +VD        Y F  M++E+
Sbjct  177  DIEILHDVARLVDRHGPWRELYRFEEMVEEF  207



>ref|XP_005772328.1| hypothetical protein EMIHUDRAFT_444785 [Emiliania huxleyi CCMP1516]
 gb|EOD19899.1| hypothetical protein EMIHUDRAFT_444785 [Emiliania huxleyi CCMP1516]
Length=614

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 105/168 (63%), Gaps = 4/168 (2%)
 Frame = +2

Query  290  RRFKVFALTIFIYL-DYKALQKREKWI--SKLKIDALWQKAHERNAKRILNLMIELEGLW  460
            RR   F  T+  ++ +Y++++ R +W      +++A  Q  H R+A R +++++ L G++
Sbjct  28   RRSVCFWSTVAPFVGEYQSIRLRARWERWEPSELEAAQQHFHHRSALRAVDVILRLGGIY  87

Query  461  VKFGQYLST-RADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGV  637
            +K GQ+ ST  A VL +AYI  L+ LQD +PPR L EV + I+ ++G  M +LF +FD  
Sbjct  88   IKIGQFASTMGAGVLEDAYIQALRPLQDGVPPRSLTEVSRIIEADIGVPMGELFSSFDPE  147

Query  638  PLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWI  781
            P+  ASIAQ HRATL DG+EV+VKVQ+  V  +   D  N + +  ++
Sbjct  148  PVGAASIAQAHRATLLDGREVIVKVQYPEVPTLYEADFDNLEIVTRFL  195



>gb|AHG92313.1| ABC-1 domain-containing protein [Gemmatimonadetes bacterium KBS708]
Length=554

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 102/183 (56%), Gaps = 3/183 (2%)
 Frame = +2

Query  287  KRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVK  466
             R  +++A T  +   Y  L+ R   + + +  A  ++ H  +A+RI   +++  GL++K
Sbjct  8    SRFLRIWATTARVIASYLWLRVRRPLMRRARYAAAVERTHRASARRIHRAILDAGGLFIK  67

Query  467  FGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLA  646
             GQ +S   +VLP  +   L+ LQD LPPRP +E+   I+ ELG+    LF   D VP+A
Sbjct  68   VGQLISILTNVLPPEFRGELEGLQDRLPPRPFDEIAARIRAELGQDPSALFRELDTVPVA  127

Query  647  TASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAK---SIVDWIAWAEPQYNFNPM  817
            TAS+AQVH A L DG+ V VK QH  ++++  EDL   +   ++V +        +++P 
Sbjct  128  TASLAQVHIAVLPDGRRVAVKAQHADIERVAREDLDTIRRLLAVVQFFTGVRGIESYHPE  187

Query  818  IDE  826
            I +
Sbjct  188  ISQ  190



>ref|XP_005709275.1| aarF domain-containing kinase [Galdieria sulphuraria]
 gb|EME32755.1| aarF domain-containing kinase [Galdieria sulphuraria]
Length=553

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 110/181 (61%), Gaps = 1/181 (1%)
 Frame = +2

Query  290  RRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKF  469
            R ++ ++  I IY+ YK  QK  + + + +   LW+K HE  ++++  L  EL G ++K 
Sbjct  116  RTWQFWSRVIPIYIGYKITQKEAQTLPEEEKRLLWEKRHEWGSEKVYKLCTELRGFYLKD  175

Query  470  GQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLAT  649
            GQ+L TRAD +P A+I  LK LQD +PP P +++ +TI+  L K + +LF   D VPLA+
Sbjct  176  GQFLGTRADFMPAAWIRRLKTLQDEVPPAPFQDIRRTIETSLDKPIVELFDWIDPVPLAS  235

Query  650  ASIAQVHRATLS-DGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMIDE  826
            A+IAQVH A L  +GQ V VK Q+   +++   DL N   +  ++   + +++   +++E
Sbjct  236  ATIAQVHCARLKMNGQLVAVKAQYADQERLCQLDLSNLSRLAVFLQRHDLKFDLVSIVEE  295

Query  827  W  829
            +
Sbjct  296  F  296



>ref|XP_005783551.1| ABC family protein [Emiliania huxleyi CCMP1516]
 gb|EOD31122.1| ABC family protein [Emiliania huxleyi CCMP1516]
Length=614

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 106/168 (63%), Gaps = 4/168 (2%)
 Frame = +2

Query  290  RRFKVFALTIFIYL-DYKALQKREKWI--SKLKIDALWQKAHERNAKRILNLMIELEGLW  460
            RR   F  T+  ++ +Y++++ R +W      +++A  Q  H R+A R +++++ L G++
Sbjct  28   RRSVCFWSTVAPFVGEYQSIRLRARWERWEPSELEAAQQHFHHRSALRAVDVILRLGGIY  87

Query  461  VKFGQYLST-RADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGV  637
            +K GQ+ ST  A VL +AYI  L+ LQD +PPR L EV + I+ ++G  M++LF +FD  
Sbjct  88   IKIGQFASTMGAGVLEDAYIQALRPLQDGVPPRSLTEVRRIIEADIGVPMEELFSSFDPE  147

Query  638  PLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWI  781
            P+  ASIAQ HRATL DG+EV+VKVQ+  V  +   D  N + +  ++
Sbjct  148  PVGAASIAQAHRATLLDGREVIVKVQYPEVPTLYEADFDNLEIVTRFL  195



>ref|XP_008817520.1| Atypical/ABC1 protein kinase [Plasmodium inui San Antonio 1]
 gb|EUD65982.1| Atypical/ABC1 protein kinase [Plasmodium inui San Antonio 1]
Length=2411

 Score =   120 bits (300),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 62/196 (32%), Positives = 105/196 (54%), Gaps = 15/196 (8%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ + +   K    W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSRKMPVEKKTEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P    +++   ++ ELG ++ D+F + +  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSSFDKIEVILKRELG-NIYDIFEHIEKEPL  125

Query  644  ATASIAQVHRATLSDGQE--------------VVVKVQHDGVDKIILEDLKNAKSIVDWI  781
            A+ASI QVHRA L   +               V++K+QH+G+D+ +  D+   K +    
Sbjct  126  ASASIGQVHRAKLKKHEHDPNPAAVVKKNDYNVIIKIQHEGIDQFLSSDINTLKKVSWAF  185

Query  782  AWAEPQYNFNPMIDEW  829
               +  + F   IDEW
Sbjct  186  GLIDKNFYFTDFIDEW  201



>ref|XP_010696177.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X1 [Beta vulgaris subsp. vulgaris]
Length=483

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 107/183 (58%), Gaps = 3/183 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKI-DALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +A T  IY  YK  Q R  ++  +K  + +W++ HE  A +I N+  E+ G +
Sbjct  23   WQRSFQFWARTAEIYTGYKVFQARVSFVKDVKKQEEMWERQHEVAADKIYNMCYEMGGFF  82

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q +  + D+ P A++  L  L D  PP P E V   ++ ELG+S+ +LF  FD  P
Sbjct  83   LKIAQIIG-KPDLAPAAWVRRLVTLCDQAPPTPYEVVRIVVEKELGESISELFDQFDANP  141

Query  641  LATASIAQVHRATLSDG-QEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            L +ASIAQVHRA L     +VVVKVQH GV ++++ D++N ++   ++   + +++   +
Sbjct  142  LGSASIAQVHRARLKGNINDVVVKVQHPGVQELMMTDIRNLQAFALYMQKTDIKFDLYSV  201

Query  818  IDE  826
              E
Sbjct  202  TKE  204



>gb|EDX89446.1| ABC1 family protein [Alcanivorax sp. DG881]
Length=543

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 100/185 (54%), Gaps = 0/185 (0%)
 Frame = +2

Query  272  WGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELE  451
            W +  KR  K   +   +   Y+    R  ++     DA     H+RNAKR  +  +E  
Sbjct  96   WPARLKRLTKTGWMLTKVVTSYRLWGTRAAFLPGSMRDAALANLHKRNAKRFRDTSLEQG  155

Query  452  GLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFD  631
            G ++K GQ LS+R D+LP+A++  L  LQD   P    ++   ++ E  + +D LF + D
Sbjct  156  GAFLKIGQLLSSRPDLLPQAWVDELAVLQDQASPVAFADIAAVLEQEFNQPLDTLFAHVD  215

Query  632  GVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFN  811
              PLA ASI QVHRA L DG+EV VKVQ  G+D+++  D+   K  +D +  A P  + +
Sbjct  216  PQPLAAASIGQVHRARLHDGREVAVKVQRPGLDEVVELDMTLLKVFMDAVKSALPPMDID  275

Query  812  PMIDE  826
             +++E
Sbjct  276  TIVNE  280



>emb|CCF74655.1| unnamed protein product [Babesia microti strain RI]
Length=1154

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 90/136 (66%), Gaps = 5/136 (4%)
 Frame = +2

Query  380  IDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRP  559
            +++ W++ HE  A  I N +IEL G W+K GQ++ST  D+LPE YI +L +LQDS+P  P
Sbjct  86   VESFWKEMHENVATSIWNNIIELRGFWIKLGQFMSTNHDLLPEQYIRILSRLQDSIPGDP  145

Query  560  LEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKII  739
             E V + I +E G++   +F  F+ VP+A+AS+AQ H ATL +G +V+VK+ HD V+K  
Sbjct  146  PEVVLKLINSEYGET-SKIFRKFNLVPIASASVAQAHLATLLNGDKVIVKILHDNVEKTF  204

Query  740  LEDLKNAKSIVDWIAW  787
            L D    +++   +AW
Sbjct  205  LYD----QTMFGNLAW  216



>ref|WP_041581201.1| hypothetical protein, partial [Bacillus sp. 1NLA3E]
Length=546

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 99/167 (59%), Gaps = 1/167 (1%)
 Frame = +2

Query  281  IYKRRFKVFALTIFIYL-DYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGL  457
            I  +RF+  +L  F ++  +  L K ++++SK K+D  +   +   AKR  +  IE+ GL
Sbjct  8    ISNKRFRKTSLMFFGFIAQFWWLGKTKRFMSKEKVDRKYHALYLSQAKRFTSEAIEMGGL  67

Query  458  WVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGV  637
             +K GQ++S+R D+LP+ Y   L QLQDS+ P   +E+   I+ E    + D+F +F+  
Sbjct  68   IIKLGQFVSSRVDILPKEYTDTLSQLQDSVSPEDTDEIINRIEEERSSKIGDIFSHFEQT  127

Query  638  PLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDW  778
            PLA AS+ QVH+ATL DG  V VKV   G++ I+  DL   + ++ +
Sbjct  128  PLAAASLGQVHKATLPDGTWVAVKVMRPGIEDIVALDLATMRVLIAF  174



>ref|WP_027725713.1| hypothetical protein [Tuberibacillus calidus]
Length=435

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 94/155 (61%), Gaps = 0/155 (0%)
 Frame = +2

Query  287  KRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVK  466
            KRR  +  L +   LDY+ +Q+  K +S  +++    +   +  +R+ N   +++G+ VK
Sbjct  6    KRRILLIRLALSFVLDYRKIQRLNKRLSGGELEREVNRICAKAGRRMRNTAFQMKGIIVK  65

Query  467  FGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLA  646
             GQ+LS R DVLP+A+I  L  LQD+LP  P + +   I+ EL K +D++F  FD + +A
Sbjct  66   VGQFLSMRKDVLPKAFIQELADLQDALPAEPFQNIKPFIEKELKKGIDEVFQEFDEIAVA  125

Query  647  TASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDL  751
             AS+AQVHRA L DG EV VK+    ++++   DL
Sbjct  126  AASLAQVHRAVLKDGTEVAVKILRPRIEELAQADL  160



>gb|AGK55351.1| hypothetical protein B1NLA3E_18035 [Bacillus sp. 1NLA3E]
Length=556

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 99/167 (59%), Gaps = 1/167 (1%)
 Frame = +2

Query  281  IYKRRFKVFALTIFIYL-DYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGL  457
            I  +RF+  +L  F ++  +  L K ++++SK K+D  +   +   AKR  +  IE+ GL
Sbjct  8    ISNKRFRKTSLMFFGFIAQFWWLGKTKRFMSKEKVDRKYHALYLSQAKRFTSEAIEMGGL  67

Query  458  WVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGV  637
             +K GQ++S+R D+LP+ Y   L QLQDS+ P   +E+   I+ E    + D+F +F+  
Sbjct  68   IIKLGQFVSSRVDILPKEYTDTLSQLQDSVSPEDTDEIINRIEEERSSKIGDIFSHFEQT  127

Query  638  PLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDW  778
            PLA AS+ QVH+ATL DG  V VKV   G++ I+  DL   + ++ +
Sbjct  128  PLAAASLGQVHKATLPDGTWVAVKVMRPGIEDIVALDLATMRVLIAF  174



>ref|XP_007472793.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1 isoform X2 [Monodelphis domestica]
 ref|XP_007472794.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1 isoform X3 [Monodelphis domestica]
Length=522

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 89/148 (60%), Gaps = 0/148 (0%)
 Frame = +2

Query  383  DALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPL  562
            D +  K H R+A+R+  L     G ++K GQ+L++   +LP  Y   LK LQ   P  PL
Sbjct  68   DEIKSKVHLRSAERLRKLCFANRGTFIKVGQHLASLEYLLPSEYTRTLKVLQSQAPQSPL  127

Query  563  EEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIIL  742
            EE+ Q I+ +LGK + D+F +FD  PL TAS+AQVH+A L DG+ V VKVQH  V     
Sbjct  128  EEIEQVIEEDLGKEIKDIFKSFDKTPLGTASLAQVHKAVLHDGRTVAVKVQHPKVQAQSS  187

Query  743  EDLKNAKSIVDWIAWAEPQYNFNPMIDE  826
            +D+   + +V  + +  P++ F+ ++DE
Sbjct  188  KDIMLMEMLVSAVKYLFPEFEFSWLVDE  215



>ref|WP_012594648.1| MULTISPECIES: hypothetical protein [Cyanothece]
 gb|ACK65374.1| ABC-1 domain protein [Cyanothece sp. PCC 8801]
 gb|ACV00261.1| ABC-1 domain protein [Cyanothece sp. PCC 8802]
Length=562

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = +2

Query  395  QKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVC  574
            ++ H R A+ ++  ++EL   ++K GQ LSTRAD++P  YI  L QLQD +PP   EE  
Sbjct  50   KRRHSR-ARWLVKKLLELGPTFIKIGQSLSTRADLIPLEYIQELSQLQDRVPPFSSEEAI  108

Query  575  QTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKII  739
              I++ELGKS++DLF+ F+  PLA+AS+ QVHRA L  GQEVVVKVQ  G++KI 
Sbjct  109  AVIESELGKSINDLFLYFEATPLASASLGQVHRAKLYTGQEVVVKVQRPGLEKIF  163



>emb|CDR96921.1| beta-lactamase family protein, putative [Babesia bigemina]
Length=1303

 Score =   119 bits (297),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 93/148 (63%), Gaps = 2/148 (1%)
 Frame = +2

Query  359  KWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQ  538
             +++  K D  W+++H   A+ I++ +  L+G WVK GQ LST+  +LP  Y+  L QLQ
Sbjct  44   SFVTSDKKDRYWKESHRAMAQLIVDSIKNLKGCWVKVGQILSTKPGMLPRCYVEALSQLQ  103

Query  539  DSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQH  718
            D +      E+  T++ E+G  MDD+F NFD +PLA+ASIAQVH+A L DG  V +KVQH
Sbjct  104  DRMGHSDFAEIIDTLEEEVGY-MDDIFKNFDSIPLASASIAQVHKAMLHDGNVVAIKVQH  162

Query  719  DGVDKIILEDLKNAKSIVDWIAWAEPQY  802
               ++ +  DL+  K I+ W+A +  QY
Sbjct  163  RCSEQNLRNDLEILKMIL-WVAQSMGQY  189



>ref|WP_003352824.1| ABC transporter [Bacillus smithii]
 gb|EHL79245.1| 2-polyprenylphenol 6-hydroxylase [Bacillus smithii 7_3_47FAA]
Length=558

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 96/149 (64%), Gaps = 3/149 (2%)
 Frame = +2

Query  395  QKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVC  574
            +KA +   +RI  ++ EL   +VK GQ  STR D++PE  I  L++LQD +PP   +EV 
Sbjct  49   KKASKSVGERIRIVLEELGPTFVKLGQIASTRPDLIPEEIIRELEKLQDHVPPFSFQEVR  108

Query  575  QTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKII---LE  745
            + +QNELG+ ++++F++F+ VPLA ASI QVHRATL +G++V VK+Q   +  +I   LE
Sbjct  109  EIVQNELGEEIENIFLHFEDVPLAAASIGQVHRATLRNGEQVAVKIQRPNITTVIETDLE  168

Query  746  DLKNAKSIVDWIAWAEPQYNFNPMIDEWC  832
             L++  ++ +  +    +Y    MIDE+ 
Sbjct  169  ILQDLATLAEQRSELAAKYQIRDMIDEFS  197



>ref|WP_039927528.1| ABC transporter, partial [Alcanivorax sp. DG881]
Length=274

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 88/148 (59%), Gaps = 0/148 (0%)
 Frame = +2

Query  383  DALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPL  562
            DA     H+RNAKR  +  +E  G ++K GQ LS+R D+LP+A++  L  LQD   P   
Sbjct  7    DAALANLHKRNAKRFRDTSLEQGGAFLKIGQLLSSRPDLLPQAWVDELAVLQDQASPVAF  66

Query  563  EEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIIL  742
             ++   ++ E  + +D LF + D  PLA ASI QVHRA L DG+EV VKVQ  G+D+++ 
Sbjct  67   ADIAAVLEQEFNQPLDTLFAHVDPQPLAAASIGQVHRARLHDGREVAVKVQRPGLDEVVE  126

Query  743  EDLKNAKSIVDWIAWAEPQYNFNPMIDE  826
             D+   K  +D +  A P  + + +++E
Sbjct  127  LDMTLLKVFMDAVKSALPPMDIDTIVNE  154



>emb|CDR36674.1| CYFA0S01e03488g1_1 [Cyberlindnera fabianii]
Length=546

 Score =   116 bits (290),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 97/175 (55%), Gaps = 9/175 (5%)
 Frame = +2

Query  266  MGWGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIE  445
              W S  KR  +       I +DYK   K  K + KL         HERNA R+ NL+ E
Sbjct  46   FAWDSTGKRTLRAITTLSMIGIDYKLNFKENKDVLKL---------HERNADRLFNLLNE  96

Query  446  LEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMN  625
             +GL++KFGQ L+ +A +LP+ +      L DS    P  +V + ++ +LG++  D F+ 
Sbjct  97   NKGLYIKFGQNLANQAAILPKPFQDKFALLYDSAGTDPWTKVEKILREDLGETYSDQFIE  156

Query  626  FDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWA  790
            FD  P+A+ASIAQVHRA L  G +V VKVQH  + K I  DL   ++ V+  +WA
Sbjct  157  FDKEPIASASIAQVHRAQLKSGDKVAVKVQHYYIQKQIKADLWTYRAFVNLFSWA  211



>gb|KHN34388.1| Putative serine/threonine-protein kinase abkB [Glycine soja]
Length=466

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 105/183 (57%), Gaps = 3/183 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKL-KIDALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +   I IY  YK  Q R  ++    K +A+W+K HE  A +I  +  +L G +
Sbjct  23   WQRSFQFWVRAIDIYTGYKVFQVRVNFVKDAQKQEAMWEKQHELAADKIFAMCYDLGGFF  82

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q +  + D+ P A++  L  L D  PP P + V   ++NELG+ +DD+F  FD  P
Sbjct  83   LKIAQIIG-KPDLAPAAWVKRLVTLCDRAPPTPFDVVKLVLENELGQGIDDVFERFDVEP  141

Query  641  LATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            L +ASIAQVHRA L  D  +VVVKVQH G+  +++ D+ N ++   ++   + +++   +
Sbjct  142  LGSASIAQVHRARLKGDTGDVVVKVQHPGIQDLMMTDIHNLQAFALYMQKTDIKFDLYSV  201

Query  818  IDE  826
              E
Sbjct  202  TKE  204



>ref|XP_001616808.1| hypothetical protein [Plasmodium vivax Sal-1]
 gb|EDL47081.1| hypothetical protein, conserved [Plasmodium vivax]
Length=2408

 Score =   118 bits (296),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 61/196 (31%), Positives = 106/196 (54%), Gaps = 15/196 (8%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ + +   K    W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSRKMPVEKKTEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P    +++   ++ ELG ++ D+F + +  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSSFDKIEVILKRELG-NIYDIFEHIEKEPL  125

Query  644  ATASIAQVHRATL--------------SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWI  781
            A+ASI QVHRA +              ++   V++K+QH+G+D+ +  D+   K +    
Sbjct  126  ASASIGQVHRAKIKKHGHDATPDEVSKTNDYNVIIKIQHEGIDQFLSSDINTLKKVSWAF  185

Query  782  AWAEPQYNFNPMIDEW  829
               +  + F   IDEW
Sbjct  186  GLIDKNFYFTDFIDEW  201



>ref|XP_001418611.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO96904.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=299

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 87/143 (61%), Gaps = 2/143 (1%)
 Frame = +2

Query  404  HERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTI  583
            H+RNAKR+  +     GL+VK GQ+ ST   V PEAY   L +LQD + P P + V + +
Sbjct  1    HDRNAKRLHAMCGANGGLYVKAGQFASTAGGV-PEAYARRLSKLQDEVAPSPRDAVLKVV  59

Query  584  QNELG-KSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNA  760
            +NE G ++ + LF  F+  P+A AS+AQVHRA L  G+ V VK+Q  G+++ I  D+   
Sbjct  60   RNEFGGRAPEALFETFEPEPMAAASLAQVHRAVLKSGRTVAVKIQRPGLERSIESDISTM  119

Query  761  KSIVDWIAWAEPQYNFNPMIDEW  829
             ++V +     P ++F  M+DE+
Sbjct  120  SALVRFTRLFFPSFDFGFMVDEF  142



>ref|WP_035463079.1| hypothetical protein, partial [Alicyclobacillus macrosporangiidus]
Length=375

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 79/126 (63%), Gaps = 0/126 (0%)
 Frame = +2

Query  404  HERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTI  583
            ++R   R     + L+GL VK GQ+LS RADVLP A+   L QLQD++P  P  EV   +
Sbjct  2    YQRAGARFRTTALRLQGLIVKVGQFLSARADVLPAAFTRELTQLQDTVPGAPFPEVRALV  61

Query  584  QNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAK  763
            + ELG  + ++F  FD  P+A AS+ QVH+A L+DG  V VKVQ  G++++   DL+  +
Sbjct  62   EAELGAPLSEVFTAFDETPIAAASLGQVHQAVLADGTPVAVKVQRPGIERLARTDLQALR  121

Query  764  SIVDWI  781
             +V ++
Sbjct  122  KVVRFL  127



>ref|XP_764917.1| ABC1 protein [Theileria parva strain Muguga]
 gb|EAN32634.1| ABC1 protein, putative [Theileria parva]
Length=1264

 Score =   118 bits (295),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 57/136 (42%), Positives = 88/136 (65%), Gaps = 1/136 (1%)
 Frame = +2

Query  362  WISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQD  541
            ++S  + +  W   H++ A+ IL+ +  L+G WVK GQ+LST++  LP  Y+  L QLQD
Sbjct  46   FVSNSEREKYWDNMHKKMAQSILDNIKTLKGCWVKLGQFLSTKSGFLPRYYLEALSQLQD  105

Query  542  SLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHD  721
             +P     E+  TI+ +LG  MDD++ +FD +P+A+ASIAQVH+  L+DG  V VKVQH 
Sbjct  106  VMPNSDFSEIIDTIEEDLG-YMDDIYSSFDSIPIASASIAQVHKGRLADGSLVAVKVQHK  164

Query  722  GVDKIILEDLKNAKSI  769
              ++ +L D++  K I
Sbjct  165  SSEQNMLNDIEILKMI  180



>ref|XP_007472792.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1 isoform X1 [Monodelphis domestica]
Length=596

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 89/148 (60%), Gaps = 0/148 (0%)
 Frame = +2

Query  383  DALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPL  562
            D +  K H R+A+R+  L     G ++K GQ+L++   +LP  Y   LK LQ   P  PL
Sbjct  142  DEIKSKVHLRSAERLRKLCFANRGTFIKVGQHLASLEYLLPSEYTRTLKVLQSQAPQSPL  201

Query  563  EEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIIL  742
            EE+ Q I+ +LGK + D+F +FD  PL TAS+AQVH+A L DG+ V VKVQH  V     
Sbjct  202  EEIEQVIEEDLGKEIKDIFKSFDKTPLGTASLAQVHKAVLHDGRTVAVKVQHPKVQAQSS  261

Query  743  EDLKNAKSIVDWIAWAEPQYNFNPMIDE  826
            +D+   + +V  + +  P++ F+ ++DE
Sbjct  262  KDIMLMEMLVSAVKYLFPEFEFSWLVDE  289



>ref|WP_035231376.1| ABC transporter [Alcanivorax sp. 19-m-6]
 gb|KGD65352.1| hypothetical protein Y5S_01245 [Alcanivorax sp. 19-m-6]
Length=530

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 87/141 (62%), Gaps = 0/141 (0%)
 Frame = +2

Query  404  HERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTI  583
            HERNA+R L+   +  G ++K GQ LS+R D+LP+ ++  L  LQD + P   EEV   I
Sbjct  132  HERNAQRFLDTSQKQGGAFLKIGQLLSSRPDLLPQPWVDALAILQDQVSPISFEEVRAVI  191

Query  584  QNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAK  763
            +N+ G+ ++ LF  FD  PLA ASI QVHRA L DG EV VKVQ  G+++++  D+   K
Sbjct  192  ENDFGQPLEQLFTKFDPEPLAAASIGQVHRARLPDGTEVAVKVQRPGLEELVELDMAILK  251

Query  764  SIVDWIAWAEPQYNFNPMIDE  826
              VD +  A P  + + ++ E
Sbjct  252  VFVDAVKSALPPMDTDTIVRE  272



>ref|XP_003525637.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoformX1 [Glycine max]
Length=469

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 95/160 (59%), Gaps = 3/160 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKL-KIDALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +   I IY  YK  Q R  ++    K +A+W+K HE  A +I  +  +L G +
Sbjct  23   WQRSFQFWVRAIDIYTGYKVFQVRVNFVKDAQKQEAMWEKQHELAADKIFAMCYDLGGFF  82

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q +  + D+ P A++  L  L D  PP P + V   ++NELG+ +DD+F  FD  P
Sbjct  83   LKIAQIIG-KPDLAPAAWVKRLVTLCDRAPPTPFDVVKLVLENELGQGIDDVFERFDVEP  141

Query  641  LATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKN  757
            L +ASIAQVHRA L  D  +VVVKVQH G+  +++ D+ N
Sbjct  142  LGSASIAQVHRARLKGDTGDVVVKVQHPGIQDLMMTDIHN  181



>ref|XP_002260847.1| protein kinase  [Plasmodium knowlesi strain H]
 emb|CAQ42819.1| protein kinase, putative [Plasmodium knowlesi strain H]
Length=2274

 Score =   117 bits (294),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 62/196 (32%), Positives = 105/196 (54%), Gaps = 15/196 (8%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ + +   K    W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSRKMPVEKKTEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P    +++   ++ ELG ++ D+F   +  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSSFDKIEVILKKELG-NIYDIFEYIEKEPL  125

Query  644  ATASIAQVHRATL--------------SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWI  781
            A+ASI QVHRA L              ++   V++K+QH+G+D+ +  D+   K +    
Sbjct  126  ASASIGQVHRAKLKKHEHDVVQDNVSKNNDYNVIIKIQHEGIDQFLSSDINTLKKVSWAF  185

Query  782  AWAEPQYNFNPMIDEW  829
               +  + F   IDEW
Sbjct  186  GLIDKNFYFTDFIDEW  201



>ref|XP_008865582.1| hypothetical protein H310_03486 [Aphanomyces invadans]
 gb|ETW05805.1| hypothetical protein H310_03486 [Aphanomyces invadans]
Length=588

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 104/184 (57%), Gaps = 8/184 (4%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKL---KIDALWQKAHERNAKRILNLMIELEG  454
            + R    +A  +  Y+DY+  Q   + I KL   + D  +++ H R +  I ++++ L+G
Sbjct  82   FSRSAYFYAKVLPAYVDYRMTQIYVEDILKLPDAEQDVYYERLHNRYSDEIFDVILNLKG  141

Query  455  LWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDG  634
             ++K  Q  STR D +P+ Y+   KQLQ   P + ++EV   I+N  GK MD++F +FD 
Sbjct  142  FYIKIAQLSSTRDDFVPKQYLDRAKQLQSDAPCKTIDEVKAIIENAYGKRMDEVFASFDP  201

Query  635  VPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNP  814
             PL  ASI QVH+A L DG  VVVKVQ+   +K    D+   KS   + A A+P +   P
Sbjct  202  TPLGAASIGQVHKAVLLDGTTVVVKVQYPDAEKNFRNDIGTIKS---FCALAQPAH--LP  256

Query  815  MIDE  826
            M++E
Sbjct  257  MMNE  260



>gb|AIF06367.1| ABC-1 domain-containing protein [uncultured marine thaumarchaeote 
KM3_191_E02]
Length=198

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 107/161 (66%), Gaps = 5/161 (3%)
 Frame = +2

Query  335  YKALQK-REKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEA  511
            + AL+K R+ WI K   + + +K   +NA++ILN+ I L  +++KFGQ+LS+RAD+LP+ 
Sbjct  4    FLALRKDRKLWI-KQDGNNVDEKRFRKNARKILNVCISLGPVYIKFGQWLSSRADILPQP  62

Query  512  YIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDG  691
            Y+  L +LQDS+P  P E+V   I+ ++GK +++ F + D   L+ AS+ QVHRAT  +G
Sbjct  63   YLEELSKLQDSVPAVPFEKVKPIIEKDIGK-IEEKFDDLDENSLSGASLGQVHRAT-KNG  120

Query  692  QEVVVKVQHDGVDKIILEDLKNAKSIVDWI-AWAEPQYNFN  811
            Q+V+VKV+  G++K +  DLK    I+ ++  + +P   F+
Sbjct  121  QQVIVKVRRPGIEKQVERDLKVLMKIIPFVMKFVDPNLRFS  161



>gb|KHN14080.1| Hypothetical protein glysoja_033307 [Glycine soja]
Length=467

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 106/183 (58%), Gaps = 3/183 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKL-KIDALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +   I IY  YK  Q R  ++    K +A+W+K HE  A +I ++  +L G +
Sbjct  23   WQRSFQFWVRAIDIYTGYKVFQVRVNFVKDAQKQEAMWEKQHELAADKIFSMCYDLGGFF  82

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q +  + D+ P A++  L  L D  PP P + V   ++NELG+ ++D+F  FD  P
Sbjct  83   LKIAQIIG-KPDLAPAAWVKRLVTLCDRAPPTPFDVVKLVLENELGQGINDVFDRFDVEP  141

Query  641  LATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            L +ASIAQVHRA L  D  +VVVKVQH G+  +++ D+ N ++   ++   + +++   +
Sbjct  142  LGSASIAQVHRARLKGDTGDVVVKVQHPGIQDLMMTDIHNLQAFALYMQKTDIKFDLYSV  201

Query  818  IDE  826
              E
Sbjct  202  TKE  204



>ref|WP_007551557.1| protein kinase [Candidatus Nitrosoarchaeum koreensis]
 gb|EGP94546.1| ABC-1 domain protein [Candidatus Nitrosoarchaeum koreensis MY1]
Length=515

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 104/159 (65%), Gaps = 5/159 (3%)
 Frame = +2

Query  341  ALQK-REKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYI  517
            AL+K R KW+     D   +K + +NA+++LN  I L  +++K GQ+LS+RAD+LP+ Y+
Sbjct  19   ALRKDRRKWVKTEGKDTDLEK-YRKNARKVLNTFISLGPVYIKLGQWLSSRADILPQPYL  77

Query  518  YLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQE  697
              L +LQDS+P  P + V   I+N++G  +D+ F + D  PL+ AS+ QV+R  +S GQE
Sbjct  78   EELAKLQDSVPAAPFDLVKPIIENDIG-PLDEKFESIDQNPLSGASLGQVYRGRIS-GQE  135

Query  698  VVVKVQHDGVDKIILEDLKNAKSIVDW-IAWAEPQYNFN  811
            +V+KV+  G++K++ EDLK  K I+   + + +P   F+
Sbjct  136  IVIKVKRPGIEKVVEEDLKVLKKILPMALRFVDPNLRFS  174



>ref|XP_009522474.1| hypothetical protein PHYSODRAFT_497640 [Phytophthora sojae]
 gb|EGZ19757.1| hypothetical protein PHYSODRAFT_497640 [Phytophthora sojae]
Length=487

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 91/162 (56%), Gaps = 5/162 (3%)
 Frame = +2

Query  323  IYLDYKALQ--KREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRAD  496
            IYL Y+A Q       +S  +    ++K H++ A  + ++++EL+G +VK  Q  STR D
Sbjct  47   IYLHYRAAQLYMEHLQLSDEEQSVEYEKLHDKYAPEVFDIVLELKGFYVKLAQTGSTRPD  106

Query  497  VLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRA  676
            VLP+ Y+    QLQD  P +P+ E+C  I+   GK +  +F   D  PL  ASI Q HRA
Sbjct  107  VLPKQYLDRAAQLQDDAPSKPVSEICAIIEQSYGKPVGQVFRAIDPKPLGAASIGQAHRA  166

Query  677  TLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQY  802
             L DGQEV VKVQH   +     D+   K+I D+  + +P +
Sbjct  167  ELLDGQEVAVKVQHPDAETFFRWDI---KTIQDFCRYFQPAH  205



>ref|WP_014965975.1| MULTISPECIES: protein kinase [Nitrosopumilus]
 ref|YP_006776551.1| hypothetical protein NSED_09095 [Candidatus Nitrosopumilus sp. 
AR2]
 gb|AFS83609.1| hypothetical protein NSED_09095 [Candidatus Nitrosopumilus sp. 
AR2]
Length=514

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 113/168 (67%), Gaps = 7/168 (4%)
 Frame = +2

Query  341  ALQK-REKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYI  517
            AL+K R+KWI++ K + +  +   +NA+++L+  I L  +++K GQ+LS+RAD+LP+ Y+
Sbjct  19   ALRKDRKKWINQEK-NQIDSEQFRKNARKVLDTFISLGPVYIKLGQWLSSRADILPQPYL  77

Query  518  YLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQE  697
              L +LQDS+PP P ++V   I+ ELG  +++ F   D   ++ AS+ QV+R T+SD Q+
Sbjct  78   DELSKLQDSVPPAPFDQVKPIIEKELG-PINEKFDEIDPNSISGASLGQVYRGTVSD-QQ  135

Query  698  VVVKVQHDGVDKIILEDLKNAKSIVDW-IAWAEP--QYNFNPMIDEWC  832
            +VVKV+  G++KI+ EDLK  K I+   + + +P  +Y+ N M+ ++ 
Sbjct  136  IVVKVKRPGIEKIVAEDLKVLKKILPLALRFVDPNLRYSANAMLSQFI  183



>ref|XP_006476976.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X2 [Citrus sinensis]
Length=467

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 107/183 (58%), Gaps = 3/183 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKL-KIDALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +     IY  YKA Q R  ++  + K DA+W++ HE  A++I  +  +L G +
Sbjct  20   WQRSFQFWVRAAEIYAGYKAFQVRVSFVKDVQKQDAMWERQHELAAEKIYAMCSDLGGFF  79

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q +  + D+ P A++  L  L D  P  P + V   ++NELG+S+ ++F  FD  P
Sbjct  80   LKVAQVVG-KPDLAPAAWVRRLVTLCDRAPATPYDTVQLVVENELGRSVSEMFETFDRDP  138

Query  641  LATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            L +ASIAQVHRA L  D  +VVVKVQH GV  +++ D++N ++   ++   + +++   +
Sbjct  139  LGSASIAQVHRARLRGDKDDVVVKVQHPGVRDLMMTDIRNLQAFALYMQKTDIKFDLFSI  198

Query  818  IDE  826
              E
Sbjct  199  TKE  201



>gb|AIF01855.1| ABC-1 domain-containing protein [uncultured marine thaumarchaeote 
KM3_150_B03]
 gb|AIF13953.1| putative protein kinase [uncultured marine thaumarchaeote KM3_65_D04]
Length=516

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 117/184 (64%), Gaps = 11/184 (6%)
 Frame = +2

Query  302  VFALTIFIYLDYK----ALQK-REKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVK  466
            V A TI +++       AL+K R  WIS+   D + +K   RNA+RILN  I L  +++K
Sbjct  2    VVARTIHVFIKLVPAILALRKDRILWISQEGKD-IDEKRFRRNAQRILNTCISLGPVFIK  60

Query  467  FGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLA  646
            FGQ+LS+RAD+LP+ Y+  L +LQDS+P  P E+V   I+ ++GK +++ F + D   L+
Sbjct  61   FGQWLSSRADILPQPYLEELSKLQDSVPAVPFEKVKPIIEKDIGK-IEEKFDDLDQNSLS  119

Query  647  TASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDW-IAWAEPQYNFN--PM  817
             AS+ QVHRAT  +GQ+V+VKV+  G++K +  DLK    I+ + + + +P   F+  P+
Sbjct  120  GASLGQVHRAT-KNGQQVIVKVKRPGIEKQVERDLKVLMKIIPFAMKFVDPNLRFSIIPI  178

Query  818  IDEW  829
            + ++
Sbjct  179  MKQF  182



>ref|XP_002305258.2| hypothetical protein POPTR_0004s07340g [Populus trichocarpa]
 gb|EEE85769.2| hypothetical protein POPTR_0004s07340g [Populus trichocarpa]
Length=500

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 105/183 (57%), Gaps = 11/183 (6%)
 Frame = +2

Query  290  RRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQK---AHERNAKRILNLMIELEGLW  460
            R     ALTI    DYK L  R   ++    D+ +QK    H R+AKRIL L  E +G +
Sbjct  57   RAISTIALTI---ADYK-LSLRNLPVNS---DSYYQKLSEVHLRSAKRILKLCEENKGFY  109

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            VK GQ++++   V P+ Y  +L  LQD   P   +++ Q +Q+ LG+ + ++F++FD  P
Sbjct  110  VKAGQFVASLKQV-PQEYSLMLSSLQDQAVPCSFKDIKQVLQSNLGRDLKNIFLSFDEQP  168

Query  641  LATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMI  820
            +A ASIAQVH A L D QEV VKVQ+ G++  +  D+     +   +AW  P Y FN ++
Sbjct  169  VAAASIAQVHHAILKDHQEVAVKVQYPGLESQMKIDITTMSFLSKSVAWLFPDYRFNWLV  228

Query  821  DEW  829
             E+
Sbjct  229  TEF  231



>gb|AIF06811.1| putative protein kinase [uncultured marine thaumarchaeote KM3_196_E01]
Length=516

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 117/184 (64%), Gaps = 11/184 (6%)
 Frame = +2

Query  302  VFALTIFIYLDYK----ALQK-REKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVK  466
            V A TI +++       AL+K R  WIS+   D + +K   RNA+RILN  I L  +++K
Sbjct  2    VVARTIHVFIKLVPAILALRKDRILWISQEGKD-IDEKRFRRNAQRILNTCISLGPVFIK  60

Query  467  FGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLA  646
            FGQ+LS+RAD+LP+ Y+  L +LQDS+P  P E+V   I+ ++GK +++ F + D   L+
Sbjct  61   FGQWLSSRADILPQPYLEELSKLQDSVPAVPFEKVKPIIEKDIGK-IEEKFDDLDQNSLS  119

Query  647  TASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDW-IAWAEPQYNFN--PM  817
             AS+ QVHRAT  +GQ+V+VKV+  G++K +  DLK    I+ + + + +P   F+  P+
Sbjct  120  GASLGQVHRAT-KNGQQVIVKVKRPGIEKQVERDLKVLMKIIPFAMKFVDPNLRFSIIPI  178

Query  818  IDEW  829
            + ++
Sbjct  179  MKQF  182



>ref|WP_020536755.1| hypothetical protein [Lewinella cohaerens]
Length=555

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +2

Query  404  HERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTI  583
            H++NA R+   ++EL+GL++K GQ LS   + LPEA+   L+ LQD +P RP E+V Q +
Sbjct  51   HQKNATRVKTAVLELQGLFIKVGQLLSILTNFLPEAFQEPLESLQDQVPARPYEQVKQRV  110

Query  584  QNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAK  763
              ELG   + LF  F   PLA ASI Q HRA L  G+EVVVKVQH  ++ +   DLK  +
Sbjct  111  VTELGADPEQLFATFSKEPLAAASIGQAHRAQLKSGEEVVVKVQHLDIESVAEVDLKIIQ  170

Query  764  SIVDWIAW  787
             +   ++W
Sbjct  171  RLQSIMSW  178



>gb|AIF01655.1| putative protein kinase [uncultured marine thaumarchaeote KM3_14_C04]
 gb|AIF06043.1| putative protein kinase [uncultured marine thaumarchaeote KM3_18_F10]
Length=211

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 111/176 (63%), Gaps = 9/176 (5%)
 Frame = +2

Query  302  VFALTIFIYLDY----KALQK-REKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVK  466
            V A TI +++       AL+K R  WIS+   D + +K   RNA+RILN  I L  +++K
Sbjct  2    VVARTIHVFIKLIPAILALRKDRILWISQEGKD-IDEKRFRRNAQRILNTCISLGPVFIK  60

Query  467  FGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLA  646
            FGQ+LS+RAD+LP+ Y+  L +LQDS+P  P E+V   I+ ++GK +++ F + D   L+
Sbjct  61   FGQWLSSRADILPQPYLEELSKLQDSVPAVPFEKVKPIIEKDIGK-IEEKFDDLDQNSLS  119

Query  647  TASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDW-IAWAEPQYNFN  811
             AS+ QVH AT  +GQ+V+VKV+  G++K +  DLK    I+ + + + +P   F+
Sbjct  120  GASLGQVHLAT-KNGQQVIVKVKRPGIEKQVERDLKVLMKIIPFAMKFVDPNLRFS  174



>ref|WP_008929554.1| ABC transporter [Alcanivorax hongdengensis]
 gb|EKF73782.1| hypothetical protein A11A3_11898 [Alcanivorax hongdengensis A-11-3]
Length=530

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 101/185 (55%), Gaps = 0/185 (0%)
 Frame = +2

Query  272  WGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELE  451
            W +  KR  K   +   +   Y+    +  ++      A  +  H RNA+R  +  ++  
Sbjct  90   WPARLKRLTKTGWMLTKVVASYRLWGTKAAFLPGSMRQAALENLHRRNARRFRDTSLQQG  149

Query  452  GLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFD  631
            G ++K GQ LS+R D+LP+A+I  L  LQD     P E++   ++ E  + +D+LF + D
Sbjct  150  GAFLKIGQLLSSRPDLLPQAWIDELAILQDQATAVPFEQIQAVLEAEFDQPLDELFADID  209

Query  632  GVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFN  811
              PLA ASI QVHRA L DG++V VKVQ  G+D+++  D+   K  +D +  A P  +F+
Sbjct  210  VEPLAAASIGQVHRARLHDGRDVAVKVQRPGLDEVVELDMALLKVFIDAVKSALPPMDFD  269

Query  812  PMIDE  826
             ++ E
Sbjct  270  TIVSE  274



>ref|XP_011015766.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like [Populus euphratica]
Length=546

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 105/183 (57%), Gaps = 11/183 (6%)
 Frame = +2

Query  290  RRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQK---AHERNAKRILNLMIELEGLW  460
            R     ALTI    DYK L  R   ++    D+ +QK    H R+AKRIL L  E +G +
Sbjct  57   RAISTIALTI---ADYK-LSLRNLPVNS---DSYYQKISEVHLRSAKRILKLCEENKGFY  109

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            VK GQ++++   V P+ Y  +L  LQD   P   +++ Q +Q+ LG+ + ++F++FD  P
Sbjct  110  VKAGQFVASLKQV-PQEYSLMLSSLQDQAVPCSFKDIKQVLQSNLGRDLKNIFLSFDEQP  168

Query  641  LATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMI  820
            +A ASIAQVH A L D QEV VKVQ+ G++  +  D+     +   +AW  P Y FN ++
Sbjct  169  VAAASIAQVHHAILKDHQEVAVKVQYPGLESQMKIDITTMSFLSKSVAWLFPDYRFNWLV  228

Query  821  DEW  829
             E+
Sbjct  229  SEF  231



>ref|XP_952368.1| ABC1-related protein [Theileria annulata strain Ankara]
 emb|CAI74636.1| ABC1-related protein, putative [Theileria annulata]
Length=1265

 Score =   115 bits (289),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 85/136 (63%), Gaps = 1/136 (1%)
 Frame = +2

Query  362  WISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQD  541
            ++S    +  W   H++ A+ IL+ +  L+G WVK GQ+LST+   LP  Y+    QLQD
Sbjct  46   FVSNSDREEYWDNMHKKMAQSILDNIKTLKGCWVKLGQFLSTKTGFLPRYYLEAFSQLQD  105

Query  542  SLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHD  721
             +P     E+  TI+ +LG  MDD++ +FD +P+A+ASIAQVH+  L DG +V VKVQH 
Sbjct  106  YMPNSDFSEIIDTIEEDLG-YMDDIYSSFDSIPIASASIAQVHKGRLVDGSQVAVKVQHK  164

Query  722  GVDKIILEDLKNAKSI  769
              ++ ++ D++  K I
Sbjct  165  SSEQNLMNDIEILKMI  180



>ref|XP_011005926.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like [Populus euphratica]
Length=546

 Score =   114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 105/183 (57%), Gaps = 11/183 (6%)
 Frame = +2

Query  290  RRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQK---AHERNAKRILNLMIELEGLW  460
            R     ALTI    DYK L  R   ++    D+ +QK    H R+AKRIL L  E +G +
Sbjct  57   RAISTIALTI---ADYK-LSLRNLPVNS---DSYYQKISEVHLRSAKRILKLCEENKGFY  109

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            VK GQ++++   V P+ Y  +L  LQD   P   +++ Q +Q+ LG+ + ++F++FD  P
Sbjct  110  VKAGQFVASLKQV-PQEYSLMLSSLQDQAVPCSFKDIKQVLQSNLGRDLKNIFLSFDEQP  168

Query  641  LATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMI  820
            +A ASIAQVH A L D QEV VKVQ+ G++  +  D+     +   +AW  P Y FN ++
Sbjct  169  VAAASIAQVHHAILKDHQEVAVKVQYPGLESQMKIDITTMSFLSKSVAWLFPDYRFNWLV  228

Query  821  DEW  829
             E+
Sbjct  229  SEF  231



>ref|XP_003550862.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like [Glycine max]
Length=475

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 106/183 (58%), Gaps = 3/183 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKL-KIDALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +   I IY  YK  Q R  ++    K +A+W++ HE  A +I ++  +L G +
Sbjct  23   WQRSFQFWVRAIDIYTGYKVFQVRVNFVKDAQKQEAMWERQHELAADKIFSMCYDLGGFF  82

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q +  + D+ P A++  L  L D  PP P + V   ++NELG+ ++D+F  FD  P
Sbjct  83   LKIAQIIG-KPDLAPAAWVKRLVTLCDRAPPTPFDVVKLVLENELGQGINDVFDRFDVEP  141

Query  641  LATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            L +ASIAQVHRA L  D  +VVVKVQH G+  +++ D+ N ++   ++   + +++   +
Sbjct  142  LGSASIAQVHRARLKGDTGDVVVKVQHPGIQDLMMTDIHNLQAFALYMQKTDIKFDLYSV  201

Query  818  IDE  826
              E
Sbjct  202  TKE  204



>ref|XP_006413380.1| hypothetical protein EUTSA_v10027088mg, partial [Eutrema salsugineum]
 gb|ESQ54833.1| hypothetical protein EUTSA_v10027088mg, partial [Eutrema salsugineum]
Length=283

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 98/160 (61%), Gaps = 3/160 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKI-DALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +A    IY  YK  Q R  ++  +K  + +W++ HE  A +I  +  +L G +
Sbjct  20   WQRSFQFWARASDIYTGYKVFQLRVSFVKDVKKQEEMWERQHELAAHKIYAMCSDLGGFF  79

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q L  + D+ P A++  L  L D  P  P + V   ++ ELGKS+D++F  FD  P
Sbjct  80   LKVAQILG-KPDLAPAAWVKKLVTLCDQAPATPFDAVRAVLEKELGKSIDEVFETFDDKP  138

Query  641  LATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKN  757
            L +ASIAQVHRA +  + ++VVVKVQH GV+K+++ D++N
Sbjct  139  LGSASIAQVHRARVKGEKRDVVVKVQHPGVEKLMMTDIRN  178



>ref|XP_320250.2| AGAP012287-PA [Anopheles gambiae str. PEST]
 gb|EAA00298.2| AGAP012287-PA [Anopheles gambiae str. PEST]
Length=518

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 99/181 (55%), Gaps = 3/181 (2%)
 Frame = +2

Query  293  RFKVFALTIF-IYLDYKALQKREKWISKLKIDALWQKA--HERNAKRILNLMIELEGLWV  463
            R      T+F I   Y+A     +W  K   + L  K+  H   A+R+L L     G+++
Sbjct  37   RLGRAGATVFDIATTYQANLYSREWTDKKSAEYLKVKSDTHRAAAERLLELCRTNRGVYI  96

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ++     +LP  Y+  +K L  + P  P+E++ + I+ +L     DLF +FD  PL
Sbjct  97   KVGQHIGALEYLLPAEYVSTMKVLHSNAPQNPVEDLYRVIRQDLRVEPSDLFESFDPEPL  156

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
             TAS+AQVHRATL DG+EV VKVQH  V    + D+K  + +V  +AW  P + F  ++D
Sbjct  157  GTASLAQVHRATLKDGREVAVKVQHPYVKGNSIVDIKTMEVLVKLVAWTFPDFKFQWLVD  216

Query  824  E  826
            E
Sbjct  217  E  217



>ref|XP_006476975.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1-like isoform X1 [Citrus sinensis]
Length=480

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 107/183 (58%), Gaps = 3/183 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKL-KIDALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +     IY  YKA Q R  ++  + K DA+W++ HE  A++I  +  +L G +
Sbjct  20   WQRSFQFWVRAAEIYAGYKAFQVRVSFVKDVQKQDAMWERQHELAAEKIYAMCSDLGGFF  79

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q +  + D+ P A++  L  L D  P  P + V   ++NELG+S+ ++F  FD  P
Sbjct  80   LKVAQVVG-KPDLAPAAWVRRLVTLCDRAPATPYDTVQLVVENELGRSVSEMFETFDRDP  138

Query  641  LATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            L +ASIAQVHRA L  D  +VVVKVQH GV  +++ D++N ++   ++   + +++   +
Sbjct  139  LGSASIAQVHRARLRGDKDDVVVKVQHPGVRDLMMTDIRNLQAFALYMQKTDIKFDLFSI  198

Query  818  IDE  826
              E
Sbjct  199  TKE  201



>ref|WP_045052988.1| ABC transporter [Chroococcales cyanobacterium CENA595]
 gb|KJH73633.1| ABC transporter [Chroococcales cyanobacterium CENA595]
Length=548

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 84/136 (62%), Gaps = 2/136 (1%)
 Frame = +2

Query  431  NLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMD  610
            N++++L  ++VK GQ LSTR D+LP +YI  L  LQD +PP P  EV   I+ +L KS+D
Sbjct  47   NILVDLGPVYVKLGQLLSTRPDLLPSSYIEELSTLQDEVPPVPWSEVEVFIRKQLKKSLD  106

Query  611  DLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWA  790
            + F + D VP+A  SIAQ H A L DG+EV VKVQ  G+D  + +D+   + + D +A  
Sbjct  107  ETFASIDPVPVAAGSIAQTHHAILVDGREVAVKVQRPGIDATVAQDISLIRGVADLVART  166

Query  791  E--PQYNFNPMIDEWC  832
            E    Y  + + +E+ 
Sbjct  167  EFGQSYEVDSLAEEFA  182



>emb|CBJ48471.1| conserved unknown protein [Ectocarpus siliculosus]
Length=553

 Score =   113 bits (283),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 95/160 (59%), Gaps = 3/160 (2%)
 Frame = +2

Query  323  IYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVL  502
            I+L Y+ +Q +   + + + D  +   H+ +AK  +++++ L+G ++K GQ  STRAD L
Sbjct  55   IWLRYRVVQWKVDGLPEKEQDEAYAPLHDAHAKEAVDIILRLKGFYIKIGQLASTRADFL  114

Query  503  PEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATL  682
            P  Y   +K LQ   P  PL+ +   ++  LG+ +D +F +F+  PL  ASI QVHR T+
Sbjct  115  PPQYYDRVKMLQSDTPAEPLDYIRGLVEQSLGQPIDTMFRSFEERPLGAASIGQVHRVTM  174

Query  683  SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQY  802
             DG++ VVKV   GV+ +   D+K  K   D+ A A+P++
Sbjct  175  KDGRQAVVKVMFPGVETMFRSDIKTMK---DFCALAQPEH  211



>ref|WP_013822906.1| ABC transporter [Desulfotomaculum kuznetsovii]
 gb|AEG15392.1| ABC-1 domain-containing protein [Desulfotomaculum kuznetsovii 
DSM 6115]
Length=564

 Score =   113 bits (283),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 103/172 (60%), Gaps = 8/172 (5%)
 Frame = +2

Query  332  DYKALQKREKWISKLKIDALWQKAHERNA--KRILNLMIELEGLWVKFGQYLSTRADVLP  505
            ++ +L +R K   +L  D    +  ER +  +R+   + EL   ++K GQ LSTR+D+L 
Sbjct  38   EFLSLGRRHKLARRLS-DKGSLRVVERPSPPERLRQALEELGPTFIKLGQMLSTRSDLLS  96

Query  506  EAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLS  685
              YI  L++LQD +PP    +V + IQ ELG  ++++F +F+  PLA ASI QVHRA L 
Sbjct  97   PEYIAELEKLQDQVPPFSFAQVRERIQMELGVPLEEIFAHFEATPLAAASIGQVHRANLR  156

Query  686  DGQEVVVKVQHDGVDKIILEDLK---NAKSIVDWIA-WAEPQYNFNPMIDEW  829
            DG+ VVVKVQ  G +KI+L D++   +   +VD    W E  Y F  M++E+
Sbjct  157  DGRPVVVKVQRPGTEKILLTDIEILYDVARLVDRHGPWRE-LYRFEEMVEEF  207



>gb|ETW45822.1| hypothetical protein PFMALIP_06148 [Plasmodium falciparum MaliPS096_E11]
Length=2374

 Score =   115 bits (288),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 63/196 (32%), Positives = 105/196 (54%), Gaps = 15/196 (8%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P    +++   ++ ELG ++ +LF   D  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSSFDKIENILKKELG-NIYELFEYIDKEPL  125

Query  644  ATASIAQVHRATLSDGQE--------------VVVKVQHDGVDKIILEDLKNAKSIVDWI  781
            A+ASI QVH+A L    +              V++K+QH+G+D+ +  D+   K +    
Sbjct  126  ASASIGQVHKAKLKKYDKHICDIDSRKHKDYNVIIKIQHEGIDQFLSSDISTLKKVSWAF  185

Query  782  AWAEPQYNFNPMIDEW  829
               +  + F   IDEW
Sbjct  186  GLIDKNFYFTDFIDEW  201



>ref|WP_044107482.1| hypothetical protein [cyanobacterium endosymbiont of Epithemia 
turgida]
 dbj|BAP18614.1| ABC transporter [cyanobacterium endosymbiont of Epithemia turgida 
isolate EtSB Lake Yunoko]
Length=563

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = +2

Query  395  QKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVC  574
            ++ H+R A+ ++  ++EL   ++K GQ LSTR D++P  YI  L QLQD +PP   +E  
Sbjct  50   KRRHKR-ARWLVKNLLELGPTFIKIGQSLSTRVDIIPFEYIQELSQLQDRVPPFNSDEAI  108

Query  575  QTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKII  739
            + I+ ELGKS+++LF +F  +PLA+AS+ QVHRA L  GQEVVVKVQ  G++KI 
Sbjct  109  KVIETELGKSINELFKDFKSIPLASASLGQVHRAKLYTGQEVVVKVQRTGLEKIF  163



>gb|KFB49811.1| AGAP012287-PA-like protein [Anopheles sinensis]
Length=521

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 101/181 (56%), Gaps = 3/181 (2%)
 Frame = +2

Query  293  RFKVFALTIF-IYLDYKALQKREKWISKLKIDALWQKA--HERNAKRILNLMIELEGLWV  463
            R      T+F I   YKA     +W  K   + L  K+  H   A+++L+L     G+++
Sbjct  37   RLGRAGATVFDIATTYKAKLYSREWPDKKAPEYLQLKSETHRAAAEKLLDLCRTNRGVYI  96

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ++     +LP  Y+  +K L  + P  P+E++ + I+ +L    D+LF +FD  PL
Sbjct  97   KVGQHIGALEYLLPPEYVNTMKVLHSNAPQNPVEDLYRVIRQDLRVEPDELFESFDPQPL  156

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
             TAS+AQVHRATL DG+EV VKVQH  V    + D+K  + +V  +AW  P + F  ++D
Sbjct  157  GTASLAQVHRATLRDGREVAVKVQHPYVKGNSIVDIKTMEVLVKLVAWTFPDFKFQWLVD  216

Query  824  E  826
            E
Sbjct  217  E  217



>ref|XP_001348316.2| Atypical protein kinase, ABC-1 family, putative [Plasmodium falciparum 
3D7]
 gb|AAN36755.2| Atypical protein kinase, ABC-1 family, putative [Plasmodium falciparum 
3D7]
Length=2763

 Score =   115 bits (287),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 62/196 (32%), Positives = 105/196 (54%), Gaps = 15/196 (8%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P    +++   ++ ELG ++ ++F   D  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSSFDKIENILKKELG-NIYEMFEYIDKEPL  125

Query  644  ATASIAQVHRATLSDGQE--------------VVVKVQHDGVDKIILEDLKNAKSIVDWI  781
            A+ASI QVH+A L    +              V++K+QH+G+D+ +  D+   K +    
Sbjct  126  ASASIGQVHKAKLKKYDKHICDIDSRKHKDYNVIIKIQHEGIDQFLSSDISTLKKVSWAF  185

Query  782  AWAEPQYNFNPMIDEW  829
               +  + F   IDEW
Sbjct  186  GLIDKNFYFTDFIDEW  201



>gb|AIF08841.1| putative protein kinase [uncultured marine thaumarchaeote KM3_33_B12]
Length=516

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 117/185 (63%), Gaps = 11/185 (6%)
 Frame = +2

Query  302  VFALTIFIYL----DYKALQK-REKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVK  466
            V   TI++++       AL+K R  WIS  K D + ++  +R+A+RILN  I L  +++K
Sbjct  2    VLGRTIYVFIKLLPSIMALRKDRVLWISDDKKD-VDEERFKRHARRILNTCISLGPVYIK  60

Query  467  FGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLA  646
            FGQ+LS+RAD+LPE Y+  L +LQD +P    E+V   I+ ++GK +D+ F + D   L+
Sbjct  61   FGQWLSSRADILPEPYMKELSKLQDDVPAESFEKVRPVIEQDIGK-IDEKFDSLDTTALS  119

Query  647  TASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDW-IAWAEPQYNFN--PM  817
             AS+ QV+R T  +GQ+++VKV+  G++K++ +DLK    I+ + + + +P   F+  P+
Sbjct  120  GASLGQVYRGT-RNGQQIIVKVKRPGIEKVVEKDLKVLMKIIPFAMKFVDPNLRFSIIPI  178

Query  818  IDEWC  832
            + ++ 
Sbjct  179  MKQFV  183



>ref|XP_009690377.1| uncharacterized protein TOT_020000340 [Theileria orientalis strain 
Shintoku]
 dbj|BAM40076.1| uncharacterized protein TOT_020000340 [Theileria orientalis strain 
Shintoku]
Length=1236

 Score =   114 bits (286),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 55/126 (44%), Positives = 84/126 (67%), Gaps = 1/126 (1%)
 Frame = +2

Query  392  WQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEV  571
            W + H++ A+ IL+ +  L+G WVK GQ+LST++  LP  Y+  L QLQD +P     E+
Sbjct  56   WDEMHKKMAQSILDNIKTLKGCWVKLGQFLSTKSGFLPPYYLEALTQLQDVMPNSDFGEI  115

Query  572  CQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDL  751
             +T++ +LG  MD ++ NFD +P+A+ASIAQVH+A L DG  V VKVQH   ++ ++ D+
Sbjct  116  IETLEEDLG-FMDVVYGNFDSIPIASASIAQVHKAKLVDGSPVAVKVQHKSSEQNLMNDI  174

Query  752  KNAKSI  769
            +  K I
Sbjct  175  EILKMI  180



>gb|EUT78640.1| hypothetical protein PFAG_05215 [Plasmodium falciparum Santa 
Lucia]
Length=2459

 Score =   115 bits (287),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 62/196 (32%), Positives = 105/196 (54%), Gaps = 15/196 (8%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P    +++   ++ ELG ++ ++F   D  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSSFDKIENILKKELG-NIYEMFEYIDKEPL  125

Query  644  ATASIAQVHRATLSDGQE--------------VVVKVQHDGVDKIILEDLKNAKSIVDWI  781
            A+ASI QVH+A L    +              V++K+QH+G+D+ +  D+   K +    
Sbjct  126  ASASIGQVHKAKLKKYDKHICDIDSRKHKDYNVIIKIQHEGIDQFLSSDISTLKKVSWAF  185

Query  782  AWAEPQYNFNPMIDEW  829
               +  + F   IDEW
Sbjct  186  GLIDKNFYFTDFIDEW  201



>gb|ETW58928.1| hypothetical protein PFMC_05113 [Plasmodium falciparum CAMP/Malaysia]
Length=2676

 Score =   115 bits (287),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 62/196 (32%), Positives = 105/196 (54%), Gaps = 15/196 (8%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P    +++   ++ ELG ++ ++F   D  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSSFDKIENILKKELG-NIYEMFEYIDKEPL  125

Query  644  ATASIAQVHRATLSDGQE--------------VVVKVQHDGVDKIILEDLKNAKSIVDWI  781
            A+ASI QVH+A L    +              V++K+QH+G+D+ +  D+   K +    
Sbjct  126  ASASIGQVHKAKLKKYDKHICDIDSRKHKDYNVIIKIQHEGIDQFLSSDISTLKKVSWAF  185

Query  782  AWAEPQYNFNPMIDEW  829
               +  + F   IDEW
Sbjct  186  GLIDKNFYFTDFIDEW  201



>gb|EWC74049.1| hypothetical protein C923_05245 [Plasmodium falciparum UGT5.1]
Length=2419

 Score =   114 bits (286),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 62/196 (32%), Positives = 105/196 (54%), Gaps = 15/196 (8%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P    +++   ++ ELG ++ ++F   D  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSSFDKIENILKKELG-NIYEMFEYIDKEPL  125

Query  644  ATASIAQVHRATLSDGQE--------------VVVKVQHDGVDKIILEDLKNAKSIVDWI  781
            A+ASI QVH+A L    +              V++K+QH+G+D+ +  D+   K +    
Sbjct  126  ASASIGQVHKAKLKKYDKHICDIDSRKHKDYNVIIKIQHEGIDQFLSSDISTLKKVSWAF  185

Query  782  AWAEPQYNFNPMIDEW  829
               +  + F   IDEW
Sbjct  186  GLIDKNFYFTDFIDEW  201



>ref|XP_004624946.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1 [Octodon degus]
Length=523

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 96/179 (54%), Gaps = 1/179 (1%)
 Frame = +2

Query  290  RRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKF  469
            R  +  A T  I  DY    +   + S+  +  L  K H R+A+R+  L     G ++K 
Sbjct  38   RVGRAVATTAAISYDYLTSLRHVPYGSEEYLQ-LRSKVHLRSARRLCELCCANRGTFIKV  96

Query  470  GQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLAT  649
            GQ+L     +LPE Y   LK L    P   ++EVCQ I+ +LGK + DLF++FD  PL  
Sbjct  97   GQHLGALDYLLPEEYTSTLKVLHSQAPQSSMQEVCQVIREDLGKELHDLFLSFDDTPLGA  156

Query  650  ASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMIDE  826
            AS+AQVH+A L DG+ V VKVQH  V     +D+   + +V  +    P++ F  ++DE
Sbjct  157  ASLAQVHKAVLRDGRTVAVKVQHPKVQAQSSKDILLMEVLVLAVKQLFPEFEFMWLVDE  215



>gb|ETW40302.1| hypothetical protein PFNF135_05344 [Plasmodium falciparum NF135/5.C10]
Length=2432

 Score =   114 bits (286),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 62/196 (32%), Positives = 105/196 (54%), Gaps = 15/196 (8%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P    +++   ++ ELG ++ ++F   D  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSSFDKIENILKKELG-NIYEMFEYIDKEPL  125

Query  644  ATASIAQVHRATLSDGQE--------------VVVKVQHDGVDKIILEDLKNAKSIVDWI  781
            A+ASI QVH+A L    +              V++K+QH+G+D+ +  D+   K +    
Sbjct  126  ASASIGQVHKAKLKKYDKHICDIDSRKHKDYNVIIKIQHEGIDQFLSSDISTLKKVSWAF  185

Query  782  AWAEPQYNFNPMIDEW  829
               +  + F   IDEW
Sbjct  186  GLIDKNFYFTDFIDEW  201



>gb|ETW29210.1| hypothetical protein PFFCH_03335 [Plasmodium falciparum FCH/4]
Length=2449

 Score =   114 bits (286),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 62/196 (32%), Positives = 105/196 (54%), Gaps = 15/196 (8%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P    +++   ++ ELG ++ ++F   D  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSSFDKIENILKKELG-NIYEMFEYIDKEPL  125

Query  644  ATASIAQVHRATLSDGQE--------------VVVKVQHDGVDKIILEDLKNAKSIVDWI  781
            A+ASI QVH+A L    +              V++K+QH+G+D+ +  D+   K +    
Sbjct  126  ASASIGQVHKAKLKKYDKHICDIDSRKHKDYNVIIKIQHEGIDQFLSSDISTLKKVSWAF  185

Query  782  AWAEPQYNFNPMIDEW  829
               +  + F   IDEW
Sbjct  186  GLIDKNFYFTDFIDEW  201



>gb|ETW16230.1| hypothetical protein PFFVO_04764 [Plasmodium falciparum Vietnam 
Oak-Knoll (FVO)]
Length=2470

 Score =   114 bits (286),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 62/196 (32%), Positives = 105/196 (54%), Gaps = 15/196 (8%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            + RR +       +Y++YK   ++ K +   K +  W+K HE  A ++LN + EL G WV
Sbjct  7    WNRRIRTIWYCSSLYVEYKNALRKSKKMPVEKKNEYWEKKHEEFATKMLNNIYELRGWWV  66

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ+LST+ +++P AYI    +LQD +P    +++   ++ ELG ++ ++F   D  PL
Sbjct  67   KVGQFLSTQENIMPVAYIEKFTKLQDMMPTSSFDKIENILKKELG-NIYEMFEYIDKEPL  125

Query  644  ATASIAQVHRATLSDGQE--------------VVVKVQHDGVDKIILEDLKNAKSIVDWI  781
            A+ASI QVH+A L    +              V++K+QH+G+D+ +  D+   K +    
Sbjct  126  ASASIGQVHKAKLKKYDKHICDIDSRKHKDYNVIIKIQHEGIDQFLSSDISTLKKVSWAF  185

Query  782  AWAEPQYNFNPMIDEW  829
               +  + F   IDEW
Sbjct  186  GLIDKNFYFTDFIDEW  201



>ref|WP_009633994.1| putative unusual protein kinase [Synechocystis sp. PCC 7509]
Length=548

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 85/136 (63%), Gaps = 2/136 (1%)
 Frame = +2

Query  431  NLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMD  610
            N++I+L  ++VK GQ LSTR D+LP AYI  L  LQD +P  P  ++   ++ +L + MD
Sbjct  47   NILIDLGPVYVKLGQLLSTRPDLLPAAYIDELSTLQDEVPAVPWADIEVLLRQQLTQPMD  106

Query  611  DLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWA  790
            + F +F  +P+A  SIAQ HRATL+DG+EV VKVQ  G+D  + +D+   + + D +A  
Sbjct  107  ETFSSFSAIPVAAGSIAQTHRATLTDGREVAVKVQRPGIDLTVAQDIALIRGVADLVART  166

Query  791  E--PQYNFNPMIDEWC  832
            E    Y  + + +E+ 
Sbjct  167  EFGQSYEVDSLAEEFA  182



>ref|XP_004610349.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1 [Sorex araneus]
Length=526

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 96/176 (55%), Gaps = 1/176 (1%)
 Frame = +2

Query  299  KVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQY  478
            +  A T  I  DY    +   + S+ + + L  + H R+A+R+  L     G ++K GQ+
Sbjct  41   RAIATTAVISYDYLTSLRSVPYGSE-EYEQLRSQVHLRSARRLRELCRANRGTFIKVGQH  99

Query  479  LSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASI  658
            L +   +LPE Y   L+ L    P   L EVCQ I+ ELGK + DLF++FD  PL  AS+
Sbjct  100  LGSLDYLLPEEYTSTLRVLHSQAPQSSLREVCQVIREELGKEIHDLFVSFDDTPLGAASL  159

Query  659  AQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMIDE  826
            AQVH+A + DG+ V VKVQH  V    L D+   + +V  +    P++ F  ++DE
Sbjct  160  AQVHKAVMHDGRTVAVKVQHPKVQTQSLTDILLMEMLVLAVKKLFPEFEFMWLVDE  215



>ref|XP_006440042.1| hypothetical protein CICLE_v10020267mg [Citrus clementina]
 ref|XP_006440043.1| hypothetical protein CICLE_v10020267mg [Citrus clementina]
 gb|ESR53282.1| hypothetical protein CICLE_v10020267mg [Citrus clementina]
 gb|ESR53283.1| hypothetical protein CICLE_v10020267mg [Citrus clementina]
Length=426

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 106/183 (58%), Gaps = 3/183 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKL-KIDALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +     IY  YKA Q R  ++  + K DA+W+  HE  A++I  +  +L G +
Sbjct  20   WQRSFQFWVRAAEIYAGYKAFQVRVSFVKDVQKQDAMWEIQHELAAEKIYAMCSDLGGFF  79

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q +  + D+ P A++  L  L D  P  P + V   ++NELG+S+ ++F  FD  P
Sbjct  80   LKVAQVVG-KPDLAPAAWVRRLVTLCDRAPATPYDTVQLVVENELGRSVSEMFETFDPDP  138

Query  641  LATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            L +ASIAQVHRA L  D  +VVVKVQH GV  +++ D++N ++   ++   + +++   +
Sbjct  139  LGSASIAQVHRARLRGDKDDVVVKVQHPGVRDLMMTDIRNLQAFALYMQKTDIKFDLFSI  198

Query  818  IDE  826
              E
Sbjct  199  TKE  201



>gb|KFK29020.1| hypothetical protein AALP_AA7G078300 [Arabis alpina]
Length=477

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 97/160 (61%), Gaps = 3/160 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKI-DALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +     IY  YK  Q R  ++  LK  + LW++ HE  A +I ++  +L G +
Sbjct  20   WQRSFQFWTHAADIYTGYKVFQLRVSFVKDLKKQEDLWERQHELAALKIYSMCSDLGGFF  79

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q L  + D+ P A++  L  L D  P  P + +   ++ ELGKS+D +F  FD  P
Sbjct  80   LKIAQILG-KPDMAPAAWVRKLVTLCDQAPATPFDAIRVVLEKELGKSIDQVFETFDDKP  138

Query  641  LATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKN  757
            L +ASIAQVHRA +  D ++VVVKVQH GV+K+++ D++N
Sbjct  139  LGSASIAQVHRARVKGDKRDVVVKVQHPGVEKLMMTDIRN  178



>gb|KHO45261.1| ubiquinone biosynthesis protein [archaeon GW2011_AR4]
Length=549

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +2

Query  443  ELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFM  622
            EL G +VK GQ LS R D++PE+Y    ++L+D++ P P  +V  TI++ELG  + DLF 
Sbjct  66   ELGGSFVKLGQLLSIRPDLVPESYCQAFRRLRDTVAPFPFSDVQSTIKHELGHDIQDLFT  125

Query  623  NFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDL  751
            +FD VPLA ASI+QVHRATL  G++VVVKVQ  G+  I+  D+
Sbjct  126  SFDKVPLAAASISQVHRATLKSGEKVVVKVQRPGIQGIMETDI  168



>ref|XP_003575213.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Brachypodium distachyon]
Length=755

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 99/176 (56%), Gaps = 13/176 (7%)
 Frame = +2

Query  272  WGSIYKRRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELE  451
            WGS++   FKV+         Y+     EK + + K+ A W K            ++ L 
Sbjct  179  WGSVFAFIFKVWLNNQ--KFTYRGGMTEEKRVMRRKVLAKWLKES----------ILRLG  226

Query  452  GLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFD  631
              ++K GQ  STR D+LP+ Y+  L +LQD +PP P E    T++ ELG  ++++F  FD
Sbjct  227  PTFIKIGQQFSTRVDILPQEYVDQLSELQDQVPPFPSETAVSTVEEELGAPVNEIFDRFD  286

Query  632  GVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQ  799
              P+A AS+ QVHRA L +GQEVV+KVQ  G+ ++   DLKN + I +++   +P+
Sbjct  287  FEPIAAASLGQVHRACL-NGQEVVIKVQRPGLKELFDIDLKNLRVIAEYLQKVDPK  341



>ref|XP_009109235.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1 [Brassica rapa]
Length=478

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 98/160 (61%), Gaps = 3/160 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKI-DALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +A    IY  YK  Q R  ++  +K  + +W+  HE  A +I  +  +L G +
Sbjct  20   WQRSFQFWARASDIYTGYKVFQLRVSFVKDVKKQEEMWETQHELAAHKIYAMCSDLGGFF  79

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q L  + D+ P A++  L  L D  P  P + +   ++ ELGKS+D++F +FD  P
Sbjct  80   LKVAQILG-KPDLAPAAWVRKLVTLCDQAPATPFDSIRLVLEKELGKSIDEVFESFDDKP  138

Query  641  LATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKN  757
            L +ASIAQVHRA +  D ++VVVKVQH GV+K+++ D++N
Sbjct  139  LGSASIAQVHRARVKGDKRDVVVKVQHPGVEKLMMTDIRN  178



>ref|WP_027724350.1| ABC transporter [Tuberibacillus calidus]
Length=558

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 95/163 (58%), Gaps = 11/163 (7%)
 Frame = +2

Query  365  ISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDS  544
            I K KID   + +    A RI   + E+   +VK GQ +STR+D+LP+  +  L++LQD 
Sbjct  39   IRKRKIDQAGEASASHRAVRIRRFIEEMGPTFVKLGQLMSTRSDILPKDILSELEKLQDH  98

Query  545  LPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDG  724
            +PP   +EV   I++EL + M+  F +F+ +P+A+ASI QVHRA L  G+EV VKV+  G
Sbjct  99   VPPFSFDEVKMVIEHELKRPMEVFFASFEEIPIASASIGQVHRAVLHSGEEVAVKVRRPG  158

Query  725  VDKIILEDL-------KNAKSIVDWIAWAEPQYNFNPMIDEWC  832
            ++K +L DL         A+    W+A    +Y    +++E+ 
Sbjct  159  IEKTVLTDLDILEELAAVAEHRFQWVA----EYRLRELVEEFS  197



>gb|EYU23157.1| hypothetical protein MIMGU_mgv1a005533mg [Erythranthe guttata]
Length=480

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 104/183 (57%), Gaps = 3/183 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKW-ISKLKIDALWQKAHERNAKRILNLMIELEGLW  460
            +KR F+ +   + IY  YK +Q R  +  +  K DA+W+  H+  A +I N+   L G +
Sbjct  20   WKRSFQFWVRAVDIYTGYKVVQVRANFEKNAAKRDAMWENQHQLAADKIYNMCTHLGGFF  79

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q +  + D+ P A++  L  L D  P  P   V   ++ ELG+S+D+LF  FD  P
Sbjct  80   LKVAQIIG-KPDLAPAAWVKRLVTLCDQAPATPYSVVKVVLEKELGQSIDELFERFDADP  138

Query  641  LATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            L +ASIAQVHRA L  D  +VVVKVQH GV  +++ D++N ++   ++   + +++   +
Sbjct  139  LGSASIAQVHRARLKGDKIDVVVKVQHPGVQDLMMTDIRNLQAFALYMQKTDIKFDLFSV  198

Query  818  IDE  826
              E
Sbjct  199  TKE  201



>ref|NP_001031709.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AEE84964.1| protein kinase family protein [Arabidopsis thaliana]
Length=481

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 107/183 (58%), Gaps = 3/183 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKL-KIDALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +A    IY  YK  Q R  ++  + K + +W++ HE  A ++ ++  +L G +
Sbjct  20   WQRSFQFWARATDIYTGYKVFQLRMNFVKDVNKHEEMWERQHELAAHKVYSMCSDLGGFF  79

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q L  + D+ P A++  L  L D  P  P + V   ++ ELGKS++ +F  FD  P
Sbjct  80   LKIAQILG-KPDLAPAAWVRKLVTLCDQAPATPFDAVRVVLEKELGKSIEQVFETFDEKP  138

Query  641  LATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            L +ASIAQVHRA +  D ++VVVKVQH GV+K+++ D++N +    ++   + +++   M
Sbjct  139  LGSASIAQVHRARVKGDKRDVVVKVQHPGVEKLMMVDIRNLQIFALYMQKTDIKFDLFSM  198

Query  818  IDE  826
              E
Sbjct  199  TKE  201



>ref|WP_044240828.1| hypothetical protein, partial [Chondromyces apiculatus]
Length=556

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 83/138 (60%), Gaps = 0/138 (0%)
 Frame = +2

Query  383  DALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPL  562
            +A   + H RNA+RI   +++L+GL++K GQ LS  A+ LP      L  LQD +PPRP 
Sbjct  45   EARIGEVHRRNARRIERTIMQLQGLFIKVGQLLSIMANFLPVELREGLTGLQDQVPPRPY  104

Query  563  EEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIIL  742
             E+   ++ ELGK + +LF  F   P+A+AS+ QVH A L DG  V VKVQH  +D+I+ 
Sbjct  105  AEIAVRVEAELGKPIPELFARFTERPIASASLGQVHEAWLKDGTHVAVKVQHRDIDEIVR  164

Query  743  EDLKNAKSIVDWIAWAEP  796
             DL   + I+  ++   P
Sbjct  165  LDLATIRRIMAIVSMFVP  182



>ref|WP_027349433.1| ubiquinone biosynthesis protein UbiB [Halotalea alkalilenta]
Length=541

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 78/121 (64%), Gaps = 0/121 (0%)
 Frame = +2

Query  389  LWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEE  568
            L+ +  E    R+   +  L  ++VKFGQ LSTR D+LP      LK+LQD +PP P E 
Sbjct  42   LFPRGSESRGARLRLALETLGPIYVKFGQMLSTRRDLLPPDIALELKKLQDQVPPFPSEL  101

Query  569  VCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILED  748
               T+++ELG S++ LF  FD  PLA+ASIAQVH ATL DG EVVVK+   G+D+++  D
Sbjct  102  ARATVESELGASVETLFAKFDPTPLASASIAQVHAATLHDGAEVVVKIIRPGIDRVMRSD  161

Query  749  L  751
            +
Sbjct  162  I  162



>ref|WP_007223959.1| ubiquinone biosynthesis protein UbiB [marine gamma proteobacterium 
HTCC2143]
 gb|EAW32585.1| 2-polyprenylphenol 6-hydroxylase [marine gamma proteobacterium 
HTCC2143]
Length=540

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 84/131 (64%), Gaps = 0/131 (0%)
 Frame = +2

Query  389  LWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEE  568
            L+    +    R+  ++ EL  ++VKFGQ LSTR D+LP+  I  L +LQD +PP P ++
Sbjct  43   LFPIPDQTRGARLRQVLEELGPIFVKFGQMLSTRRDLLPDDIIDELAKLQDQVPPFPSQQ  102

Query  569  VCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILED  748
                I+  LGKS+DDLF  F   P+A+AS+AQVH ATL  G+EVVVKV   G++  IL+D
Sbjct  103  AVDIIEGALGKSVDDLFAQFSSQPMASASVAQVHAATLFSGEEVVVKVVRPGIELTILQD  162

Query  749  LKNAKSIVDWI  781
            +K   ++ + I
Sbjct  163  IKLLFTLAELI  173



>gb|KDO69332.1| hypothetical protein CISIN_1g045839mg, partial [Citrus sinensis]
Length=466

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 106/183 (58%), Gaps = 3/183 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKL-KIDALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +     IY  YKA Q R  ++  + K DA+W+  HE  A++I  +  +L G +
Sbjct  20   WQRSFQFWVRAAEIYAGYKAFQVRVSFVKDVQKQDAMWEIQHELAAEKIYAMCSDLGGFF  79

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q +  + D+ P A++  L  L D  P  P + V   ++NELG+S+ ++F  FD  P
Sbjct  80   LKVAQVVG-KPDLAPAAWVRRLVTLCDRAPATPYDTVQLVVENELGRSVSEMFETFDRDP  138

Query  641  LATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            L +ASIAQVHRA L  D  +VVVKVQH GV  +++ D++N ++   ++   + +++   +
Sbjct  139  LGSASIAQVHRARLRGDKDDVVVKVQHPGVRDLMMTDIRNLQAFALYMQKTDIKFDLFSI  198

Query  818  IDE  826
              E
Sbjct  199  TKE  201



>emb|CDY24848.1| BnaA08g14620D [Brassica napus]
Length=471

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 98/160 (61%), Gaps = 3/160 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKLKI-DALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +A    IY  YK  Q R  ++  +K  + +W+  HE  A +I  +  +L G +
Sbjct  20   WQRSFQFWARASDIYTGYKVFQLRVSFVKDVKKQEEMWETQHELAAHKIYAMCSDLGGFF  79

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q L  + D+ P A++  L  L D  P  P + +   ++ ELGKS+D++F +FD  P
Sbjct  80   LKVAQILG-KPDLAPAAWVRKLVTLCDQAPATPFDSIRLVLEKELGKSIDEVFESFDDKP  138

Query  641  LATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKN  757
            L +ASIAQVHRA +  D ++VVVKVQH GV+K+++ D++N
Sbjct  139  LGSASIAQVHRARVKGDERDVVVKVQHPGVEKLMMTDIRN  178



>ref|XP_002670533.1| predicted protein [Naegleria gruberi]
 gb|EFC37789.1| predicted protein [Naegleria gruberi]
Length=704

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 82/125 (66%), Gaps = 0/125 (0%)
 Frame = +2

Query  395  QKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVC  574
            ++AH+RNA+R+L+L IE  G+++K GQ+LS+    +P+ YI  LK L+D  P  P ++V 
Sbjct  221  KQAHKRNAERLLDLFIEQRGVYIKIGQFLSSLVSAIPDEYIDTLKVLRDRAPTIPFDDVR  280

Query  575  QTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLK  754
            + I  + GKS+++LF  FD  P+A ASIAQVHRA   DG+ V VKVQ+  V      D++
Sbjct  281  KVIHQDFGKSIEELFDEFDEKPIAAASIAQVHRARTKDGRLVAVKVQYPFVRSYFEGDMR  340

Query  755  NAKSI  769
               S+
Sbjct  341  TNDSM  345



>ref|WP_037611223.1| transporter [Streptococcus sp. SR4]
 gb|ETS91894.1| ABC1 family protein [Streptococcus sp. SR4]
Length=525

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 82/122 (67%), Gaps = 5/122 (4%)
 Frame = +2

Query  458  WVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGV  637
            +VK GQ LSTR+D+LPEAYI  L +LQ S+PP   EEV   I+ EL   + D F++F   
Sbjct  48   FVKIGQILSTRSDLLPEAYIRELSKLQSSVPPLNKEEVMTAIRRELPSELSDSFLDFSEE  107

Query  638  PLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            PLA+ S+AQ HRA L  GQEV+VK+Q  G+D+++ ED++    ++  +A   P++ F PM
Sbjct  108  PLASGSVAQTHRARLLSGQEVIVKIQRHGIDEVVKEDIQ----LLIKLARHIPKH-FIPM  162

Query  818  ID  823
            +D
Sbjct  163  VD  164



>ref|XP_008838028.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
1 [Nannospalax galili]
Length=523

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 96/179 (54%), Gaps = 1/179 (1%)
 Frame = +2

Query  290  RRFKVFALTIFIYLDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKF  469
            R  +  A T  I  DY    +R  + SK  +  L  + H R+A+R+  L     G ++K 
Sbjct  38   RVGRAVATTAVISYDYLTSLRRVPYGSKEYLQ-LRSQVHLRSARRLCELCCANRGTFIKV  96

Query  470  GQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLAT  649
            GQ+L     +LPE Y   LK L    P   + EV Q I+ +LGK + DLF++FD  PL  
Sbjct  97   GQHLGALDYLLPEEYTSTLKVLHSQAPQSSMREVRQVIREDLGKEIHDLFLSFDDTPLGA  156

Query  650  ASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMIDE  826
            AS+AQVH+A L DG+ V VKVQH  V    L+D+   + +V  +    P++ F  ++DE
Sbjct  157  ASLAQVHKAVLRDGRTVAVKVQHPKVQAQSLKDILLMEVLVLAVKQLFPEFEFMWLVDE  215



>ref|WP_004182566.1| transporter [Streptococcus salivarius]
 gb|EGX30014.1| 2-octaprenylphenol hydroxylase [Streptococcus salivarius M18]
Length=525

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 82/122 (67%), Gaps = 5/122 (4%)
 Frame = +2

Query  458  WVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGV  637
            +VK GQ LSTR+D+LPEAYI  L +LQ S+PP   EEV   I+ EL   + D F++F   
Sbjct  48   FVKIGQILSTRSDLLPEAYIRELSKLQSSVPPLNKEEVMTAIRRELPSGLSDSFLDFSEE  107

Query  638  PLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            PLA+ S+AQ HRA L  GQEV+VK+Q  G+D+++ ED++    ++  +A   P++ F PM
Sbjct  108  PLASGSVAQTHRARLLSGQEVIVKIQRPGIDEVVKEDIQ----LLIKLARHIPKH-FIPM  162

Query  818  ID  823
            +D
Sbjct  163  VD  164



>ref|WP_024545946.1| hypothetical protein [Synechococcus sp. NKBG15041c]
Length=581

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 103/192 (54%), Gaps = 12/192 (6%)
 Frame = +2

Query  278  SIYKRRFK--VFALTIFIYLDYKALQKREKWISKLKIDALWQKAHER-NAKRILNLMIEL  448
            S  +RRF   VF LT+     +K ++  +KW               R  AK I + ++EL
Sbjct  39   SKTRRRFDIWVFVLTLI----FKLIRNGKKWTYAGGFTEEKLTVRRRIQAKWIKDSLLEL  94

Query  449  EGLWVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNF  628
               ++K GQ  STRAD+ PE Y+  L QLQD +P    E+  Q I+ +LGK ++ LF +F
Sbjct  95   GPTFIKVGQLFSTRADLFPEEYVSELSQLQDRVPAFSYEQTRQIIEADLGKPLNTLFRSF  154

Query  629  DGVPLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNF  808
            D VPLA AS+ QVH+A L  G+EVVVKVQ  G+ ++   DL   K I  W     P++  
Sbjct  155  DPVPLAAASLGQVHKAQLHSGEEVVVKVQRPGLKQLFTIDLAILKKIA-WYFQNHPRWGK  213

Query  809  N----PMIDEWC  832
            N     + DE C
Sbjct  214  NRDWLGIYDECC  225



>gb|ABZ07050.1| putative ABC1 family protein [uncultured marine crenarchaeote 
HF4000_ANIW97J3]
Length=503

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 112/169 (66%), Gaps = 7/169 (4%)
 Frame = +2

Query  335  YKALQK-REKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPEA  511
            + AL+K R+ WI K   + + +K   +NA++ILN+ I L  +++KFGQ+LS+RAD+LP+ 
Sbjct  4    FLALRKDRKLWI-KQDGNNVDEKRFRKNARKILNVCISLGPVYIKFGQWLSSRADILPQP  62

Query  512  YIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSDG  691
            Y+  L +LQDS+P  P E+V   I+ ++GK +++ F + D   L+ AS+ QVHRAT  +G
Sbjct  63   YLEELSKLQDSVPAVPFEKVKPIIEKDIGK-IEEKFDDLDENSLSGASLGQVHRAT-KNG  120

Query  692  QEVVVKVQHDGVDKIILEDLKNAKSIVDWI-AWAEPQYNFN--PMIDEW  829
            Q+V+VKV+  G++K +  DLK    I+ ++  + +P   F+  P++ ++
Sbjct  121  QQVIVKVRRPGIEKQVERDLKVLMKIIPFVMKFVDPNLRFSIIPIMKQF  169



>ref|WP_038675975.1| transporter [Streptococcus salivarius]
 gb|AIY21151.1| transporter [Streptococcus salivarius]
Length=525

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 82/122 (67%), Gaps = 5/122 (4%)
 Frame = +2

Query  458  WVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGV  637
            +VK GQ LSTR+D+LPEAYI  L +LQ S+PP   EEV   I+ EL   + D F++F   
Sbjct  48   FVKIGQILSTRSDLLPEAYIRELSKLQSSVPPLNKEEVMTAIRRELPSGLSDSFLDFSEE  107

Query  638  PLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            PLA+ S+AQ HRA L  GQEV+VK+Q  G+D+++ ED++    ++  +A   P++ F PM
Sbjct  108  PLASGSVAQTHRARLLSGQEVIVKIQRPGIDEVVKEDIQ----LLIKLARHIPKH-FIPM  162

Query  818  ID  823
            +D
Sbjct  163  VD  164



>ref|XP_007155516.1| hypothetical protein PHAVU_003G208300g [Phaseolus vulgaris]
 gb|ESW27510.1| hypothetical protein PHAVU_003G208300g [Phaseolus vulgaris]
Length=475

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 106/183 (58%), Gaps = 3/183 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKL-KIDALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +   I IY  YK  Q R  ++  + K +A+W++ HE  A +I  L  +L G +
Sbjct  27   WQRSFQFWVRAIDIYTGYKVFQVRVNFVKDVQKQEAMWERQHELAADKIFALCSDLGGFF  86

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q +  + D+ P A++  L  L D  PP P + +   +++ELG+ +D++F  FD  P
Sbjct  87   LKIAQIVG-KPDLAPAAWVKRLVTLCDRAPPTPFDVMKLVLESELGQGIDNVFERFDVEP  145

Query  641  LATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            L +ASIAQVHRA L  D  +VVVKVQH G+  +++ D+ N ++   ++   + +++   +
Sbjct  146  LGSASIAQVHRARLKGDTSDVVVKVQHPGIQDLMMTDIHNLQAFALYMQKTDIKFDLYSV  205

Query  818  IDE  826
              E
Sbjct  206  TKE  208



>gb|ETN61401.1| ABC1 family protein [Anopheles darlingi]
Length=516

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 98/181 (54%), Gaps = 3/181 (2%)
 Frame = +2

Query  293  RFKVFALTIF-IYLDYKALQKREKWISKLKID--ALWQKAHERNAKRILNLMIELEGLWV  463
            R      T+F I   Y+A     KW  K   +   L  + H   A+R+L L     G+++
Sbjct  37   RLARAGATVFDIARTYQANLYSRKWPDKKAAEYVKLKSETHRLAAERLLELCRTNRGVYI  96

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPL  643
            K GQ++     +LP  Y+  +K L  + P  P+E++ + I+ +L    D+LF +FD  PL
Sbjct  97   KVGQHIGALEYLLPPEYVNTMKVLHSNAPQNPVEDLYRVIRQDLRIEPDELFESFDPEPL  156

Query  644  ATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPMID  823
             TAS+AQVHRATL DG+EV VKVQH  V      D+K  + +V  +AW  P + F  ++D
Sbjct  157  GTASLAQVHRATLKDGREVAVKVQHPYVKGNSTVDIKTMEVLVKLVAWTFPDFKFQWLVD  216

Query  824  E  826
            E
Sbjct  217  E  217



>ref|WP_002885037.1| transporter [Streptococcus salivarius]
 gb|EEK10101.1| ABC1 family protein [Streptococcus salivarius SK126]
Length=525

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 82/122 (67%), Gaps = 5/122 (4%)
 Frame = +2

Query  458  WVKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGV  637
            +VK GQ LSTR+D+LPEAYI  L +LQ S+PP   EEV   I+ EL   + D F++F   
Sbjct  48   FVKIGQILSTRSDLLPEAYIRELSKLQSSVPPLNKEEVMTAIRRELPSELSDSFLDFSEE  107

Query  638  PLATASIAQVHRATLSDGQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            PLA+ S+AQ HRA L  GQEV+VK+Q  G+D+++ ED++    ++  +A   P++ F PM
Sbjct  108  PLASGSVAQTHRARLLSGQEVIVKIQRPGIDEVVKEDIQ----LLIKLARHIPKH-FIPM  162

Query  818  ID  823
            +D
Sbjct  163  VD  164



>ref|XP_005716547.1| unnamed protein product [Chondrus crispus]
 emb|CDF36728.1| unnamed protein product [Chondrus crispus]
Length=988

 Score =   112 bits (281),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 103/199 (52%), Gaps = 19/199 (10%)
 Frame = +2

Query  290  RRFKVFALTIFIY--LDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWV  463
            RR  +F+  + +Y  L   +L  R        +DA W  ++   A+ IL       GLW+
Sbjct  12   RRLHIFSTALLVYFTLQLTSLLNRLLRRDAAAVDAAWSASNTCAARLILRTASARRGLWI  71

Query  464  KFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKS-------------  604
            K  QY++ R D LP  Y  +L Q  D  PP P   V  T+  +L  +             
Sbjct  72   KCCQYVAARPDALPPEYSQVLSQSLDDCPPTPAARVIATVNEQLRHTECGRQWQETEGRP  131

Query  605  --MDDLFMNFDGV-PLATASIAQVHRATL-SDGQEVVVKVQHDGVDKIILEDLKNAKSIV  772
               +D F  FD   P+A+ASIAQVH A L S GQ VV+KVQH GV  ++L DL + K+++
Sbjct  132  AVANDFFHEFDPAKPIASASIAQVHAAVLRSSGQRVVLKVQHPGVKPMLLRDLIDLKTLL  191

Query  773  DWIAWAEPQYNFNPMIDEW  829
             WIA A+P+++  P++D W
Sbjct  192  KWIAGAQPRFDMRPVLDAW  210



>ref|XP_009416860.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=756

 Score =   112 bits (280),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 90/157 (57%), Gaps = 11/157 (7%)
 Frame = +2

Query  329  LDYKALQKREKWISKLKIDALWQKAHERNAKRILNLMIELEGLWVKFGQYLSTRADVLPE  508
              Y+     EK +S+ K  A W K            ++ L   ++K GQ  STR D+LP+
Sbjct  197  FSYRGGMTEEKKVSRRKALAKWLKES----------ILRLGPTFIKTGQQFSTRVDILPQ  246

Query  509  AYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVPLATASIAQVHRATLSD  688
             Y+  L +LQD +PP P E     I+ ELG S+DD+F  FD  P+A AS+ QVHRA+L +
Sbjct  247  EYVDQLSELQDQVPPFPSETAISIIEEELGASLDDIFDRFDYEPIAAASLGQVHRASL-N  305

Query  689  GQEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQ  799
            GQEVV+KVQ   + ++   DLKN + I +++   +P+
Sbjct  306  GQEVVIKVQRPALKELFDIDLKNLRVIAEYLQKVDPK  342



>ref|XP_002867643.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43902.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=481

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 107/183 (58%), Gaps = 3/183 (2%)
 Frame = +2

Query  284  YKRRFKVFALTIFIYLDYKALQKREKWISKL-KIDALWQKAHERNAKRILNLMIELEGLW  460
            ++R F+ +A    IY  YK  Q R  ++  + K + +W++ HE  A +I ++  +L G +
Sbjct  20   WQRSFQFWARATDIYTGYKVFQLRMNFVKDVNKHEDMWERQHELAAHKIYSMCSDLGGFF  79

Query  461  VKFGQYLSTRADVLPEAYIYLLKQLQDSLPPRPLEEVCQTIQNELGKSMDDLFMNFDGVP  640
            +K  Q L  + D+ P A++  L  L D  P    + +   ++ ELGKS++D+F  FD  P
Sbjct  80   LKIAQILG-KPDLAPAAWVRKLVTLCDQAPATSFDAIRVVLEKELGKSIEDVFETFDEKP  138

Query  641  LATASIAQVHRATLSDG-QEVVVKVQHDGVDKIILEDLKNAKSIVDWIAWAEPQYNFNPM  817
            L +ASIAQVHRA +  G ++VVVKVQH GV+K+++ D++N +    ++   + +++   M
Sbjct  139  LGSASIAQVHRARVKGGKRDVVVKVQHPGVEKLMMVDIRNLQIFALYMQKTDIKFDLFSM  198

Query  818  IDE  826
              E
Sbjct  199  TKE  201



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1793589148520