BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8845

Length=768
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009600050.1|  PREDICTED: serine carboxypeptidase-like 42         250   3e-76   Nicotiana tomentosiformis
ref|XP_009798650.1|  PREDICTED: serine carboxypeptidase-like 42 i...    248   2e-75   Nicotiana sylvestris
ref|XP_004237734.1|  PREDICTED: serine carboxypeptidase-like 42         246   1e-74   Solanum lycopersicum
ref|XP_006356286.1|  PREDICTED: serine carboxypeptidase-like 42-like    244   7e-74   Solanum tuberosum [potatoes]
ref|XP_007019398.1|  Serine carboxypeptidase-like 42 isoform 2          243   9e-74   
ref|XP_007019399.1|  Serine carboxypeptidase-like 42 isoform 3          243   1e-73   
ref|XP_006434390.1|  hypothetical protein CICLE_v10000998mg             239   2e-73   
gb|KDO83625.1|  hypothetical protein CISIN_1g0117641mg                  238   3e-73   Citrus sinensis [apfelsine]
ref|XP_007019397.1|  Serine carboxypeptidase-like 42 isoform 1          243   3e-73   
gb|KDO83623.1|  hypothetical protein CISIN_1g0117641mg                  238   7e-73   Citrus sinensis [apfelsine]
gb|KDO83622.1|  hypothetical protein CISIN_1g0117641mg                  238   2e-72   Citrus sinensis [apfelsine]
gb|KDO83613.1|  hypothetical protein CISIN_1g0117641mg                  238   2e-72   Citrus sinensis [apfelsine]
gb|KDO83614.1|  hypothetical protein CISIN_1g0117641mg                  238   3e-72   Citrus sinensis [apfelsine]
ref|XP_006434389.1|  hypothetical protein CICLE_v10000998mg             238   4e-72   
ref|XP_006434388.1|  hypothetical protein CICLE_v10000998mg             239   1e-71   Citrus clementina [clementine]
ref|XP_011101717.1|  PREDICTED: serine carboxypeptidase-like 42         237   5e-71   Sesamum indicum [beniseed]
ref|XP_006472927.1|  PREDICTED: serine carboxypeptidase-like 42-like    236   9e-71   
ref|XP_002278193.1|  PREDICTED: serine carboxypeptidase-like 42 i...    236   1e-70   Vitis vinifera
ref|XP_007161487.1|  hypothetical protein PHAVU_001G0732001g            227   1e-70   Phaseolus vulgaris [French bean]
gb|EYU17411.1|  hypothetical protein MIMGU_mgv1a005783mg                234   4e-70   Erythranthe guttata [common monkey flower]
ref|XP_010245825.1|  PREDICTED: serine carboxypeptidase-like 42         233   1e-69   Nelumbo nucifera [Indian lotus]
ref|XP_007201403.1|  hypothetical protein PRUPE_ppa008027mg             230   1e-69   
ref|XP_010244030.1|  PREDICTED: serine carboxypeptidase-like 42 i...    233   1e-69   Nelumbo nucifera [Indian lotus]
ref|XP_009360732.1|  PREDICTED: serine carboxypeptidase-like 42         233   2e-69   Pyrus x bretschneideri [bai li]
ref|XP_010244029.1|  PREDICTED: serine carboxypeptidase-like 42 i...    233   3e-69   
ref|XP_010930631.1|  PREDICTED: serine carboxypeptidase-like 42         232   4e-69   Elaeis guineensis
ref|XP_009377728.1|  PREDICTED: serine carboxypeptidase-like 42         232   5e-69   Pyrus x bretschneideri [bai li]
gb|KHN05260.1|  Serine carboxypeptidase-like 42                         231   7e-69   Glycine soja [wild soybean]
emb|CDP12019.1|  unnamed protein product                                231   8e-69   Coffea canephora [robusta coffee]
ref|XP_003544740.2|  PREDICTED: serine carboxypeptidase-like 42-l...    231   1e-68   Glycine max [soybeans]
ref|XP_010679983.1|  PREDICTED: serine carboxypeptidase-like 42         231   1e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008237677.1|  PREDICTED: serine carboxypeptidase-like 42         230   2e-68   Prunus mume [ume]
ref|XP_011074776.1|  PREDICTED: serine carboxypeptidase-like 42         230   2e-68   Sesamum indicum [beniseed]
ref|XP_010062160.1|  PREDICTED: serine carboxypeptidase-like 42         229   4e-68   Eucalyptus grandis [rose gum]
ref|XP_009377699.1|  PREDICTED: serine carboxypeptidase-like 42         229   4e-68   Pyrus x bretschneideri [bai li]
ref|XP_006393769.1|  hypothetical protein EUTSA_v10011445mg             229   6e-68   Eutrema salsugineum [saltwater cress]
ref|XP_010530237.1|  PREDICTED: serine carboxypeptidase-like 42         229   6e-68   Tarenaya hassleriana [spider flower]
ref|XP_008373914.1|  PREDICTED: serine carboxypeptidase-like 42         229   6e-68   
gb|KHF97371.1|  Serine carboxypeptidase-like 42                         229   9e-68   Gossypium arboreum [tree cotton]
gb|KJB59374.1|  hypothetical protein B456_009G252300                    228   9e-68   Gossypium raimondii
gb|KFK24266.1|  hypothetical protein AALP_AAs40498U001000               228   1e-67   Arabis alpina [alpine rockcress]
ref|XP_011659129.1|  PREDICTED: serine carboxypeptidase-like 42 i...    228   1e-67   Cucumis sativus [cucumbers]
emb|CDX80725.1|  BnaC08g05590D                                          228   1e-67   
ref|XP_009377698.1|  PREDICTED: serine carboxypeptidase-like 42         228   1e-67   Pyrus x bretschneideri [bai li]
ref|XP_004290564.1|  PREDICTED: serine carboxypeptidase-like 42         227   2e-67   Fragaria vesca subsp. vesca
emb|CDY70042.1|  BnaCnng66490D                                          226   4e-67   Brassica napus [oilseed rape]
ref|XP_003522555.2|  PREDICTED: serine carboxypeptidase-like 42-l...    226   4e-67   Glycine max [soybeans]
ref|XP_004490638.1|  PREDICTED: serine carboxypeptidase-like 42-l...    226   6e-67   Cicer arietinum [garbanzo]
ref|XP_009107652.1|  PREDICTED: serine carboxypeptidase-like 44 i...    226   6e-67   
ref|XP_008786550.1|  PREDICTED: serine carboxypeptidase-like 42         226   7e-67   
ref|XP_004490637.1|  PREDICTED: serine carboxypeptidase-like 42-l...    227   9e-67   
ref|XP_010519388.1|  PREDICTED: serine carboxypeptidase-like 42         226   9e-67   Tarenaya hassleriana [spider flower]
ref|XP_002300939.1|  serine carboxypeptidase S10 family protein         226   9e-67   Populus trichocarpa [western balsam poplar]
emb|CDX93108.1|  BnaA03g38300D                                          225   9e-67   
ref|XP_008461495.1|  PREDICTED: serine carboxypeptidase-like 42 i...    226   1e-66   Cucumis melo [Oriental melon]
ref|XP_009107650.1|  PREDICTED: serine carboxypeptidase-like 44 i...    225   1e-66   Brassica rapa
ref|XP_008373913.1|  PREDICTED: serine carboxypeptidase-like 42         225   1e-66   
ref|XP_010493597.1|  PREDICTED: serine carboxypeptidase-like 42         225   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_004502581.1|  PREDICTED: serine carboxypeptidase-like 42-like    225   2e-66   Cicer arietinum [garbanzo]
emb|CDY48945.1|  BnaA08g04690D                                          225   2e-66   Brassica napus [oilseed rape]
ref|XP_009107648.1|  PREDICTED: serine carboxypeptidase-like 44 i...    225   2e-66   Brassica rapa
ref|NP_199039.1|  serine carboxypeptidase-like 42                       224   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280410.1|  hypothetical protein CARUB_v10026343mg             224   4e-66   Capsella rubella
gb|KHN23425.1|  Serine carboxypeptidase-like 42                         224   4e-66   Glycine soja [wild soybean]
ref|XP_010110480.1|  Serine carboxypeptidase-like 42                    223   4e-66   
ref|XP_010482006.1|  PREDICTED: serine carboxypeptidase-like 42         224   5e-66   Camelina sativa [gold-of-pleasure]
ref|XP_002268397.1|  PREDICTED: serine carboxypeptidase-like 42         224   6e-66   Vitis vinifera
ref|XP_003527966.2|  PREDICTED: serine carboxypeptidase-like 42-l...    224   6e-66   Glycine max [soybeans]
ref|XP_003602149.1|  Serine carboxypeptidase-like protein               223   6e-66   Medicago truncatula
ref|XP_010442147.1|  PREDICTED: serine carboxypeptidase-like 42         223   6e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010479023.1|  PREDICTED: serine carboxypeptidase-like 44         223   7e-66   Camelina sativa [gold-of-pleasure]
ref|XP_009136205.1|  PREDICTED: serine carboxypeptidase-like 42         223   9e-66   Brassica rapa
ref|XP_012066078.1|  PREDICTED: serine carboxypeptidase-like 42         223   1e-65   Jatropha curcas
ref|XP_002865546.1|  hypothetical protein ARALYDRAFT_494806             222   2e-65   
ref|XP_004515138.1|  PREDICTED: serine carboxypeptidase-like 42-like    222   3e-65   Cicer arietinum [garbanzo]
ref|XP_006307408.1|  hypothetical protein CARUB_v10009034mg             222   3e-65   
ref|NP_175046.1|  serine carboxypeptidase-like 44                       221   4e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107653.1|  PREDICTED: serine carboxypeptidase-like 44 i...    221   5e-65   Brassica rapa
ref|XP_007137531.1|  hypothetical protein PHAVU_009G134900g             221   6e-65   Phaseolus vulgaris [French bean]
emb|CDY51660.1|  BnaC03g66990D                                          220   7e-65   Brassica napus [oilseed rape]
ref|XP_002891272.1|  predicted protein                                  221   9e-65   Arabidopsis lyrata subsp. lyrata
ref|XP_009586680.1|  PREDICTED: serine carboxypeptidase-like 42         219   2e-64   Nicotiana tomentosiformis
ref|XP_006351861.1|  PREDICTED: serine carboxypeptidase-like 42-like    219   2e-64   Solanum tuberosum [potatoes]
ref|NP_178937.2|  serine carboxypeptidase-like 43                       218   4e-64   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031351.1|  serine carboxypeptidase-like 43                    218   4e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299245.1|  hypothetical protein CARUB_v10015394mg             218   4e-64   
gb|AAD28662.1|  putative serine carboxypeptidase II                     218   6e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004148827.1|  PREDICTED: serine carboxypeptidase-like 42         218   7e-64   Cucumis sativus [cucumbers]
ref|XP_002865553.1|  hypothetical protein ARALYDRAFT_494807             218   7e-64   Arabidopsis lyrata subsp. lyrata
ref|XP_003615811.1|  Serine carboxypeptidase-like protein               218   7e-64   Medicago truncatula
ref|XP_011027377.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    218   8e-64   Populus euphratica
ref|XP_002526159.1|  serine carboxypeptidase, putative                  218   9e-64   
gb|ADE76785.1|  unknown                                                 211   9e-64   Picea sitchensis
emb|CDY23340.1|  BnaA08g12060D                                          218   1e-63   Brassica napus [oilseed rape]
ref|XP_009123167.1|  PREDICTED: serine carboxypeptidase-like 42         218   1e-63   Brassica rapa
ref|XP_010425083.1|  PREDICTED: serine carboxypeptidase-like 43         211   1e-63   
ref|XP_009112251.1|  PREDICTED: serine carboxypeptidase-like 42         217   1e-63   Brassica rapa
ref|NP_199038.1|  serine carboxypeptidase-like 41                       217   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009767156.1|  PREDICTED: serine carboxypeptidase-like 42 i...    216   1e-63   Nicotiana sylvestris
emb|CDY37202.1|  BnaA09g08230D                                          217   2e-63   Brassica napus [oilseed rape]
ref|XP_010496048.1|  PREDICTED: serine carboxypeptidase-like 43         213   2e-63   
ref|XP_009767155.1|  PREDICTED: serine carboxypeptidase-like 42 i...    217   2e-63   Nicotiana sylvestris
ref|NP_001183841.1|  hypothetical protein precursor                     216   5e-63   Zea mays [maize]
ref|XP_010315079.1|  PREDICTED: serine carboxypeptidase-like 42 i...    212   6e-63   
ref|XP_010315078.1|  PREDICTED: serine carboxypeptidase-like 42 i...    212   6e-63   
ref|XP_010468548.1|  PREDICTED: serine carboxypeptidase-like 43         215   7e-63   
ref|XP_006279617.1|  hypothetical protein CARUB_v10026338mg             215   1e-62   Capsella rubella
ref|XP_002863806.1|  hypothetical protein ARALYDRAFT_331179             214   2e-62   Arabidopsis lyrata subsp. lyrata
gb|EPS60190.1|  hypothetical protein M569_14612                         209   2e-62   Genlisea aurea
ref|XP_009406489.1|  PREDICTED: serine carboxypeptidase-like 42         214   3e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH35413.1|  serine carboxypeptidase-like protein                    214   3e-62   Medicago truncatula
ref|XP_004977164.1|  PREDICTED: serine carboxypeptidase-like 42-l...    214   4e-62   Setaria italica
ref|XP_003577714.1|  PREDICTED: serine carboxypeptidase-like 42         213   9e-62   Brachypodium distachyon [annual false brome]
ref|XP_006858474.1|  PREDICTED: serine carboxypeptidase-like 42         213   1e-61   Amborella trichopoda
ref|XP_004230572.1|  PREDICTED: serine carboxypeptidase-like 42 i...    213   1e-61   Solanum lycopersicum
ref|XP_010315077.1|  PREDICTED: serine carboxypeptidase-like 42 i...    213   1e-61   Solanum lycopersicum
ref|XP_006383613.1|  hypothetical protein POPTR_0005s21010g             209   1e-61   
ref|XP_004979109.1|  PREDICTED: serine carboxypeptidase-like 42-like    212   1e-61   Setaria italica
ref|XP_009414969.1|  PREDICTED: serine carboxypeptidase-like 42         212   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002449388.1|  hypothetical protein SORBIDRAFT_05g009120          211   5e-61   Sorghum bicolor [broomcorn]
gb|AFW60601.1|  hypothetical protein ZEAMMB73_172356                    208   6e-61   
gb|KGN47484.1|  hypothetical protein Csa_6G338160                       216   7e-61   Cucumis sativus [cucumbers]
ref|XP_008677381.1|  PREDICTED: serine carboxypeptidase F13S12.6 ...    210   1e-60   Zea mays [maize]
ref|XP_002885858.1|  predicted protein                                  208   3e-60   
gb|AFW60600.1|  serine carboxypeptidase F13S12.6                        208   3e-60   
ref|NP_001067496.1|  Os11g0213600                                       207   7e-60   
gb|ACM17527.1|  putative serine carboxy peptidase                       207   1e-59   Oryza australiensis
ref|NP_001151858.1|  serine carboxypeptidase F13S12.6 precursor         207   1e-59   Zea mays [maize]
gb|ABK25236.1|  unknown                                                 206   2e-59   Picea sitchensis
gb|EEE51848.1|  hypothetical protein OsJ_33355                          201   3e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663298.1|  PREDICTED: serine carboxypeptidase-like 42-like    200   5e-57   
emb|CDY66139.1|  BnaAnng21620D                                          197   7e-56   Brassica napus [oilseed rape]
ref|XP_006596272.1|  PREDICTED: serine carboxypeptidase-like 42-l...    196   1e-55   Glycine max [soybeans]
gb|KJB59377.1|  hypothetical protein B456_009G252300                    195   3e-55   Gossypium raimondii
ref|XP_011659130.1|  PREDICTED: serine carboxypeptidase-like 42 i...    194   3e-55   Cucumis sativus [cucumbers]
ref|XP_008461496.1|  PREDICTED: serine carboxypeptidase-like 42 i...    194   8e-55   Cucumis melo [Oriental melon]
ref|XP_010463193.1|  PREDICTED: serine carboxypeptidase-like 44         193   9e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002974500.1|  serine carboxypeptidase-like enzyme                188   2e-52   
ref|XP_002990798.1|  serine carboxypeptidase-like enzyme                188   2e-52   
emb|CDX81435.1|  BnaC09g08460D                                          181   2e-50   
ref|XP_002972012.1|  serine carboxypeptidase-like enzyme                180   1e-49   Selaginella moellendorffii
ref|XP_002972549.1|  serine carboxypeptidase-like enzyme                180   2e-49   
gb|EMT31513.1|  Serine carboxypeptidase-like 42                         177   2e-48   
ref|XP_002967656.1|  serine carboxypeptidase-like enzyme                174   3e-47   Selaginella moellendorffii
ref|XP_002964377.1|  serine carboxypeptidase-like enzyme                174   3e-47   Selaginella moellendorffii
ref|XP_002971138.1|  serine carboxypeptidase-like enzyme                174   4e-47   
ref|XP_002961948.1|  serine carboxypeptidase-like enzyme                173   7e-47   
ref|XP_007021535.1|  Serine carboxypeptidase 44                         171   8e-47   
ref|XP_011620351.1|  PREDICTED: serine carboxypeptidase-like 44         171   9e-47   Amborella trichopoda
ref|XP_004977165.1|  PREDICTED: serine carboxypeptidase-like 42-l...    172   1e-46   
ref|XP_007021532.1|  Serine carboxypeptidase 44                         172   1e-46   
gb|ERM97972.1|  hypothetical protein AMTR_s00117p00106310               171   5e-46   Amborella trichopoda
emb|CAN74668.1|  hypothetical protein VITISV_005686                     169   2e-45   Vitis vinifera
ref|XP_007021681.1|  Serine carboxypeptidase 44                         169   3e-45   
gb|EYU42662.1|  hypothetical protein MIMGU_mgv1a022120mg                169   3e-45   Erythranthe guttata [common monkey flower]
ref|XP_007021438.1|  Serine carboxypeptidase 44                         169   6e-45   
ref|XP_007021444.1|  Serine carboxypeptidase 44 isoform 2               167   8e-45   
ref|XP_007021448.1|  Serine carboxypeptidase 44                         167   8e-45   
ref|XP_007021443.1|  Serine carboxypeptidase 44 isoform 1               167   8e-45   
ref|XP_007160822.1|  hypothetical protein PHAVU_001G019500g             167   2e-44   Phaseolus vulgaris [French bean]
ref|XP_010279511.1|  PREDICTED: serine carboxypeptidase-like 40 i...    166   5e-44   Nelumbo nucifera [Indian lotus]
ref|XP_007021534.1|  Serine carboxypeptidase 44                         165   6e-44   
gb|KHN46300.1|  Serine carboxypeptidase II-3                            164   1e-43   Glycine soja [wild soybean]
ref|XP_008813040.1|  PREDICTED: serine carboxypeptidase II-3-like       164   1e-43   
gb|KHN05312.1|  Serine carboxypeptidase II-3                            164   2e-43   Glycine soja [wild soybean]
gb|KJB13335.1|  hypothetical protein B456_002G069000                    163   3e-43   Gossypium raimondii
gb|KHN12757.1|  Serine carboxypeptidase II-3                            162   4e-43   Glycine soja [wild soybean]
ref|XP_006595329.1|  PREDICTED: serine carboxypeptidase II-3-like       163   4e-43   Glycine max [soybeans]
gb|KDO66312.1|  hypothetical protein CISIN_1g039871mg                   163   5e-43   Citrus sinensis [apfelsine]
ref|XP_006470494.1|  PREDICTED: serine carboxypeptidase-like 40-like    163   6e-43   
ref|XP_003544446.1|  PREDICTED: serine carboxypeptidase II-3-like...    163   6e-43   
ref|NP_001242872.1|  uncharacterized protein LOC100820473 precursor     163   6e-43   
ref|XP_006595959.1|  PREDICTED: serine carboxypeptidase II-3-like...    163   7e-43   
ref|XP_010261659.1|  PREDICTED: serine carboxypeptidase-like 40         161   2e-42   
ref|XP_008220190.1|  PREDICTED: serine carboxypeptidase II-3-like       161   3e-42   Prunus mume [ume]
ref|XP_006578498.1|  PREDICTED: serine carboxypeptidase II-3-like       162   3e-42   Glycine max [soybeans]
gb|KHN35601.1|  Serine carboxypeptidase II-3                            161   3e-42   Glycine soja [wild soybean]
gb|ERN14540.1|  hypothetical protein AMTR_s00038p00085900               160   6e-42   Amborella trichopoda
ref|XP_006593897.1|  PREDICTED: serine carboxypeptidase II-3-like       160   6e-42   Glycine max [soybeans]
ref|XP_008224993.1|  PREDICTED: serine carboxypeptidase-like 31         160   6e-42   Prunus mume [ume]
ref|XP_010279514.1|  PREDICTED: serine carboxypeptidase-like 40         160   7e-42   Nelumbo nucifera [Indian lotus]
ref|XP_002282331.1|  PREDICTED: serine carboxypeptidase II-3-like       160   7e-42   Vitis vinifera
ref|XP_012071699.1|  PREDICTED: serine carboxypeptidase II-3-like       160   7e-42   
ref|XP_007146042.1|  hypothetical protein PHAVU_006G007800g             160   7e-42   Phaseolus vulgaris [French bean]
ref|XP_004293521.1|  PREDICTED: serine carboxypeptidase-like 31 i...    160   7e-42   Fragaria vesca subsp. vesca
ref|XP_011626549.1|  PREDICTED: serine carboxypeptidase II-3            160   7e-42   
gb|KHN05141.1|  Serine carboxypeptidase II-3                            160   8e-42   Glycine soja [wild soybean]
emb|CBI29056.3|  unnamed protein product                                159   9e-42   Vitis vinifera
ref|XP_006473369.1|  PREDICTED: serine carboxypeptidase II-3-like       159   9e-42   Citrus sinensis [apfelsine]
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         160   1e-41   Vitis vinifera
ref|XP_009794620.1|  PREDICTED: putative serine carboxypeptidase-...    160   1e-41   Nicotiana sylvestris
emb|CDP08509.1|  unnamed protein product                                159   1e-41   Coffea canephora [robusta coffee]
gb|KEH40059.1|  serine carboxypeptidase-like protein                    159   1e-41   Medicago truncatula
ref|XP_010042631.1|  PREDICTED: serine carboxypeptidase-like 40         153   1e-41   Eucalyptus grandis [rose gum]
ref|XP_006434836.1|  hypothetical protein CICLE_v10000968mg             159   1e-41   Citrus clementina [clementine]
ref|XP_006346455.1|  PREDICTED: serine carboxypeptidase-like 26-like    159   1e-41   Solanum tuberosum [potatoes]
ref|XP_011626550.1|  PREDICTED: serine carboxypeptidase II-3            160   1e-41   Amborella trichopoda
ref|XP_007223971.1|  hypothetical protein PRUPE_ppa014620mg             160   2e-41   
gb|KJB62985.1|  hypothetical protein B456_009G446500                    159   2e-41   Gossypium raimondii
ref|XP_011025505.1|  PREDICTED: serine carboxypeptidase-like 40 i...    158   2e-41   Populus euphratica
gb|KDP37687.1|  hypothetical protein JCGZ_06344                         158   2e-41   Jatropha curcas
gb|KJB62986.1|  hypothetical protein B456_009G446600                    157   2e-41   Gossypium raimondii
ref|XP_012072739.1|  PREDICTED: serine carboxypeptidase-like 45         158   2e-41   
ref|XP_003592237.1|  Serine carboxypeptidase II-3                       159   2e-41   
ref|XP_009130122.1|  PREDICTED: serine carboxypeptidase-like 34         159   3e-41   Brassica rapa
gb|EYU37705.1|  hypothetical protein MIMGU_mgv1a005479mg                158   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_006853074.2|  PREDICTED: serine carboxypeptidase II-3            158   3e-41   
gb|ACJ85847.1|  unknown                                                 155   3e-41   Medicago truncatula
gb|KJB49314.1|  hypothetical protein B456_008G112500                    158   3e-41   Gossypium raimondii
ref|XP_008363303.1|  PREDICTED: serine carboxypeptidase-like 40         158   3e-41   
ref|XP_010041326.1|  PREDICTED: serine carboxypeptidase II-3-like       158   3e-41   Eucalyptus grandis [rose gum]
gb|KCW66184.1|  hypothetical protein EUGRSUZ_F00022                     158   3e-41   Eucalyptus grandis [rose gum]
gb|KJB63052.1|  hypothetical protein B456_009G451300                    155   3e-41   Gossypium raimondii
ref|XP_011025504.1|  PREDICTED: serine carboxypeptidase-like 40 i...    158   3e-41   Populus euphratica
gb|EEC75382.1|  hypothetical protein OsI_11848                          158   4e-41   Oryza sativa Indica Group [Indian rice]
emb|CDP19962.1|  unnamed protein product                                159   4e-41   Coffea canephora [robusta coffee]
ref|XP_007017344.1|  Serine carboxypeptidase II-3 chain B isoform 4     155   6e-41   
ref|XP_009354385.1|  PREDICTED: serine carboxypeptidase-like 40         157   6e-41   Pyrus x bretschneideri [bai li]
ref|XP_011088748.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    157   6e-41   
gb|KJB79850.1|  hypothetical protein B456_013G069700                    157   7e-41   Gossypium raimondii
ref|XP_011091773.1|  PREDICTED: serine carboxypeptidase-like 40         157   7e-41   Sesamum indicum [beniseed]
ref|XP_010055750.1|  PREDICTED: serine carboxypeptidase-like 45 i...    156   8e-41   Eucalyptus grandis [rose gum]
gb|EPS67442.1|  hypothetical protein M569_07330                         155   8e-41   Genlisea aurea
emb|CDP08504.1|  unnamed protein product                                158   8e-41   Coffea canephora [robusta coffee]
emb|CDY46950.1|  BnaA02g32960D                                          157   8e-41   Brassica napus [oilseed rape]
gb|ABK25202.1|  unknown                                                 156   9e-41   Picea sitchensis
ref|XP_010916829.1|  PREDICTED: serine carboxypeptidase II-3-like       156   9e-41   
ref|XP_007212080.1|  hypothetical protein PRUPE_ppa005035mg             157   9e-41   Prunus persica
ref|XP_007017343.1|  Serine carboxypeptidase II-3 chain B isoform 3     155   1e-40   
gb|KDO75846.1|  hypothetical protein CISIN_1g0117382mg                  153   1e-40   Citrus sinensis [apfelsine]
gb|AAQ63884.1|  putative serine carboxypeptidase                        157   1e-40   Medicago truncatula
ref|XP_003592239.1|  Serine carboxypeptidase-like protein               157   1e-40   
ref|XP_002318164.2|  hypothetical protein POPTR_0012s10730g             156   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010279510.1|  PREDICTED: serine carboxypeptidase-like 40         157   1e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010454603.1|  PREDICTED: serine carboxypeptidase-like 34         157   1e-40   Camelina sativa [gold-of-pleasure]
gb|EEE59169.1|  hypothetical protein OsJ_11092                          156   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               156   1e-40   Medicago truncatula
gb|KDO83297.1|  hypothetical protein CISIN_1g015244mg                   155   1e-40   Citrus sinensis [apfelsine]
ref|XP_010413138.1|  PREDICTED: serine carboxypeptidase-like 40         157   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006830191.1|  PREDICTED: serine carboxypeptidase II-3            156   2e-40   Amborella trichopoda
ref|XP_004230807.1|  PREDICTED: serine carboxypeptidase-like 26         156   2e-40   Solanum lycopersicum
gb|AAT78819.1|  putative serine carboxypeptidase                        156   2e-40   Oryza sativa Japonica Group [Japonica rice]
gb|KEH30582.1|  serine carboxypeptidase-like protein                    156   2e-40   Medicago truncatula
gb|KJB63053.1|  hypothetical protein B456_009G451300                    155   2e-40   Gossypium raimondii
emb|CBI19568.3|  unnamed protein product                                160   2e-40   Vitis vinifera
ref|XP_010512774.1|  PREDICTED: serine carboxypeptidase-like 40 i...    156   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_008809533.1|  PREDICTED: putative serine carboxypeptidase-...    158   2e-40   
ref|XP_010468839.1|  PREDICTED: serine carboxypeptidase-like 40         156   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009592794.1|  PREDICTED: serine carboxypeptidase-like 40         156   2e-40   Nicotiana tomentosiformis
ref|XP_006292523.1|  hypothetical protein CARUB_v10018754mg             155   2e-40   
gb|KHG12237.1|  Serine carboxypeptidase-like 40                         156   2e-40   Gossypium arboreum [tree cotton]
ref|XP_010055744.1|  PREDICTED: serine carboxypeptidase-like 45 i...    155   2e-40   Eucalyptus grandis [rose gum]
tpg|DAA61817.1|  TPA: hypothetical protein ZEAMMB73_814931              156   2e-40   
ref|XP_008652807.1|  PREDICTED: serine carboxypeptidase-like 26         156   2e-40   
ref|XP_003592243.1|  Serine carboxypeptidase II-3                       155   2e-40   
ref|XP_011041403.1|  PREDICTED: serine carboxypeptidase-like 45         155   2e-40   Populus euphratica
ref|XP_006423055.1|  hypothetical protein CICLE_v10028330mg             155   3e-40   Citrus clementina [clementine]
ref|XP_004231124.2|  PREDICTED: serine carboxypeptidase-like 40         156   3e-40   
gb|AES71591.2|  serine carboxypeptidase-like protein                    155   3e-40   Medicago truncatula
ref|XP_007017341.1|  Serine carboxypeptidase II-3 chain B isoform 1     155   3e-40   
ref|XP_007203526.1|  hypothetical protein PRUPE_ppa026347mg             155   3e-40   Prunus persica
ref|XP_002517750.1|  serine carboxypeptidase, putative                  155   3e-40   Ricinus communis
ref|XP_002521402.1|  serine carboxypeptidase, putative                  155   3e-40   Ricinus communis
ref|XP_008365144.1|  PREDICTED: serine carboxypeptidase II-3-like       154   3e-40   
ref|XP_011042948.1|  PREDICTED: serine carboxypeptidase-like 45         155   3e-40   Populus euphratica
ref|NP_191906.1|  serine carboxypeptidase-like 40                       155   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010278297.1|  PREDICTED: serine carboxypeptidase-like 31         155   4e-40   Nelumbo nucifera [Indian lotus]
ref|XP_011008273.1|  PREDICTED: serine carboxypeptidase-like 40         155   4e-40   Populus euphratica
ref|XP_007220730.1|  hypothetical protein PRUPE_ppa023387mg             150   4e-40   
ref|XP_002298413.2|  putative serine carboxypeptidase family protein    155   4e-40   
gb|KJB77373.1|  hypothetical protein B456_012G134700                    155   4e-40   Gossypium raimondii
ref|XP_008240683.1|  PREDICTED: serine carboxypeptidase-like 45         154   4e-40   Prunus mume [ume]
ref|XP_006345395.1|  PREDICTED: serine carboxypeptidase-like 40-like    155   4e-40   Solanum tuberosum [potatoes]
ref|XP_007043281.1|  Serine carboxypeptidase-like 34 isoform 1          155   5e-40   
gb|AES71590.2|  serine carboxypeptidase-like protein                    155   5e-40   Medicago truncatula
gb|KJB77375.1|  hypothetical protein B456_012G134700                    155   5e-40   Gossypium raimondii
gb|KDP37688.1|  hypothetical protein JCGZ_06345                         154   5e-40   Jatropha curcas
gb|EYU27945.1|  hypothetical protein MIMGU_mgv1a005674mg                155   5e-40   Erythranthe guttata [common monkey flower]
ref|XP_004959516.1|  PREDICTED: serine carboxypeptidase II-3-like       155   5e-40   
ref|XP_003592242.1|  Serine carboxypeptidase-like protein               155   6e-40   
ref|XP_002876119.1|  predicted protein                                  155   6e-40   
ref|XP_012072731.1|  PREDICTED: serine carboxypeptidase-like 45         154   6e-40   
ref|XP_010067798.1|  PREDICTED: serine carboxypeptidase-like 40         155   6e-40   
ref|XP_006438918.1|  hypothetical protein CICLE_v10031327mg             155   6e-40   
ref|XP_011088290.1|  PREDICTED: serine carboxypeptidase II-3-like       154   6e-40   
ref|XP_006482952.1|  PREDICTED: serine carboxypeptidase-like 40-like    155   6e-40   
gb|EYU39591.1|  hypothetical protein MIMGU_mgv1a009171mg                152   6e-40   
ref|XP_003542771.1|  PREDICTED: serine carboxypeptidase-like 31-like    155   6e-40   
ref|XP_003534383.1|  PREDICTED: serine carboxypeptidase-like 40-l...    155   6e-40   
ref|XP_009618061.1|  PREDICTED: serine carboxypeptidase-like 34         149   6e-40   
ref|XP_008800209.1|  PREDICTED: serine carboxypeptidase II-3-like       155   6e-40   
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    154   6e-40   
gb|KDO49122.1|  hypothetical protein CISIN_1g044068mg                   154   6e-40   
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    154   7e-40   
ref|XP_010315500.1|  PREDICTED: serine carboxypeptidase II-3-like       154   7e-40   
ref|XP_009599118.1|  PREDICTED: serine carboxypeptidase-like 45         154   7e-40   
ref|XP_011088747.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    155   7e-40   
ref|XP_009615672.1|  PREDICTED: serine carboxypeptidase-like 45 i...    154   7e-40   
gb|KHN11708.1|  Serine carboxypeptidase-like 40                         154   7e-40   
emb|CDO98312.1|  unnamed protein product                                154   7e-40   
ref|XP_002314061.1|  hypothetical protein POPTR_0009s06080g             154   7e-40   
ref|XP_009759845.1|  PREDICTED: serine carboxypeptidase-like 45         154   7e-40   
gb|KEH17669.1|  serine carboxypeptidase-like protein                    152   7e-40   
ref|XP_009615670.1|  PREDICTED: serine carboxypeptidase-like 45 i...    154   7e-40   
ref|XP_010932885.1|  PREDICTED: serine carboxypeptidase-like 40 i...    154   8e-40   
ref|XP_004303115.1|  PREDICTED: serine carboxypeptidase-like 40         154   8e-40   
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like    154   8e-40   
ref|XP_008231546.1|  PREDICTED: serine carboxypeptidase-like 40         154   8e-40   
gb|EAZ09402.1|  hypothetical protein OsI_31676                          154   8e-40   
ref|XP_003539875.1|  PREDICTED: serine carboxypeptidase-like 40-like    154   9e-40   
ref|XP_009368057.1|  PREDICTED: serine carboxypeptidase-like 40         154   9e-40   
ref|XP_010421120.1|  PREDICTED: serine carboxypeptidase-like 34         154   9e-40   
ref|XP_006402270.1|  hypothetical protein EUTSA_v10005912mg             154   9e-40   
ref|XP_004229672.1|  PREDICTED: serine carboxypeptidase-like 40         154   9e-40   
ref|XP_007015559.1|  Serine carboxypeptidase-like 40, putative is...    152   9e-40   
dbj|BAJ99451.1|  predicted protein                                      154   1e-39   
ref|XP_004959517.1|  PREDICTED: serine carboxypeptidase II-3-like       154   1e-39   
ref|XP_010694765.1|  PREDICTED: serine carboxypeptidase-like 40         154   1e-39   
ref|XP_003542323.2|  PREDICTED: serine carboxypeptidase-like 40-l...    154   1e-39   
ref|XP_004505704.1|  PREDICTED: serine carboxypeptidase-like 34-like    154   1e-39   
ref|XP_007131400.1|  hypothetical protein PHAVU_011G010600g             154   1e-39   
ref|XP_010938742.1|  PREDICTED: serine carboxypeptidase II-3-like       154   1e-39   
ref|XP_002876724.1|  hypothetical protein ARALYDRAFT_486857             154   1e-39   
ref|XP_009801012.1|  PREDICTED: serine carboxypeptidase II-3-like       154   1e-39   
ref|NP_191213.1|  alpha/beta-Hydrolases superfamily protein             149   1e-39   
gb|ABR16719.1|  unknown                                                 153   1e-39   
gb|KCW51319.1|  hypothetical protein EUGRSUZ_J00874                     152   1e-39   
ref|XP_004229673.1|  PREDICTED: serine carboxypeptidase-like 40         154   1e-39   
ref|XP_008813035.1|  PREDICTED: putative serine carboxypeptidase-...    154   1e-39   
ref|XP_002322611.2|  hypothetical protein POPTR_0016s03390g             153   1e-39   
ref|XP_006473888.1|  PREDICTED: serine carboxypeptidase-like 40-like    154   1e-39   
gb|KJB61590.1|  hypothetical protein B456_009G368500                    153   2e-39   
ref|XP_003520484.1|  PREDICTED: serine carboxypeptidase-like 45-like    153   2e-39   
ref|XP_007025718.1|  Serine carboxypeptidase-like 31                    153   2e-39   
ref|XP_010932884.1|  PREDICTED: putative serine carboxypeptidase-...    153   2e-39   
gb|KJB55516.1|  hypothetical protein B456_009G080300                    153   2e-39   
ref|XP_003592240.1|  Serine carboxypeptidase-like protein               154   2e-39   
ref|XP_006495375.1|  PREDICTED: serine carboxypeptidase-like 45-like    150   2e-39   
gb|KEH33266.1|  serine carboxypeptidase-like protein                    152   2e-39   
gb|KDO83183.1|  hypothetical protein CISIN_1g012396mg                   150   2e-39   
ref|XP_003580170.1|  PREDICTED: serine carboxypeptidase-like 35         153   2e-39   
gb|KDP31724.1|  hypothetical protein JCGZ_14937                         152   2e-39   
ref|XP_006434837.1|  hypothetical protein CICLE_v10003343mg             151   2e-39   
ref|XP_009590317.1|  PREDICTED: serine carboxypeptidase-like 26         153   2e-39   
gb|ACU18095.1|  unknown                                                 148   2e-39   
gb|KHN30516.1|  Serine carboxypeptidase-like 40                         153   2e-39   
ref|XP_007219043.1|  hypothetical protein PRUPE_ppa004618mg             153   2e-39   
ref|XP_010067819.1|  PREDICTED: serine carboxypeptidase-like 40         153   2e-39   
gb|KJB13334.1|  hypothetical protein B456_002G068900                    153   2e-39   
ref|XP_010324807.1|  PREDICTED: serine carboxypeptidase-like 40 i...    153   2e-39   
ref|XP_004231125.1|  PREDICTED: serine carboxypeptidase-like 40 i...    153   2e-39   
ref|XP_006467848.1|  PREDICTED: serine carboxypeptidase-like 31-like    153   2e-39   
gb|KCW51318.1|  hypothetical protein EUGRSUZ_J00874                     152   2e-39   
ref|XP_006449285.1|  hypothetical protein CICLE_v10015093mg             153   2e-39   
ref|XP_007052442.1|  Serine carboxypeptidase-like 40                    153   3e-39   
ref|XP_008375221.1|  PREDICTED: serine carboxypeptidase-like 40         150   3e-39   
ref|XP_008442230.1|  PREDICTED: serine carboxypeptidase-like 31         153   3e-39   
ref|NP_176308.2|  serine carboxypeptidase-like 32                       152   3e-39   
emb|CAJ91147.1|  serine carboxypeptidase II                             148   3e-39   
gb|AAB71481.1|  similar to serine carboxypeptidases                     152   3e-39   
gb|EMS55463.1|  Serine carboxypeptidase-like 35                         151   3e-39   
gb|KHN30341.1|  Serine carboxypeptidase-like 45                         152   3e-39   
ref|XP_003592238.1|  Serine carboxypeptidase II-3                       152   3e-39   
ref|XP_007038111.1|  Serine carboxypeptidase-like 45 isoform 2          150   3e-39   
ref|XP_010318664.1|  PREDICTED: serine carboxypeptidase-like 45 i...    152   3e-39   
ref|XP_009592799.1|  PREDICTED: serine carboxypeptidase-like 40         153   4e-39   
ref|XP_010031922.1|  PREDICTED: serine carboxypeptidase-like 34         152   4e-39   
ref|XP_011022036.1|  PREDICTED: serine carboxypeptidase-like 34         152   4e-39   
gb|EYU33331.1|  hypothetical protein MIMGU_mgv1a025174mg                152   4e-39   
emb|CDP16351.1|  unnamed protein product                                152   4e-39   
ref|XP_004306277.2|  PREDICTED: serine carboxypeptidase II-3-like       152   4e-39   
ref|XP_008231545.1|  PREDICTED: serine carboxypeptidase-like 40         152   4e-39   
ref|XP_010938508.1|  PREDICTED: serine carboxypeptidase II-3-like...    151   4e-39   
gb|KDO83182.1|  hypothetical protein CISIN_1g012396mg                   150   4e-39   
ref|XP_009794618.1|  PREDICTED: serine carboxypeptidase-like 26         152   4e-39   
ref|XP_010067794.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    152   4e-39   
ref|XP_006477516.1|  PREDICTED: serine carboxypeptidase-like 45-like    149   4e-39   
gb|KHN32398.1|  Serine carboxypeptidase-like 40                         152   4e-39   
ref|XP_007015558.1|  Serine carboxypeptidase-like 40, putative is...    152   4e-39   
ref|XP_009778790.1|  PREDICTED: serine carboxypeptidase-like 45         152   4e-39   
ref|XP_006341487.1|  PREDICTED: serine carboxypeptidase-like 45-like    152   4e-39   
emb|CDP16360.1|  unnamed protein product                                152   4e-39   
ref|XP_010493441.1|  PREDICTED: serine carboxypeptidase-like 34         152   5e-39   
ref|XP_004146591.1|  PREDICTED: serine carboxypeptidase-like 31         152   5e-39   
ref|XP_004975453.1|  PREDICTED: serine carboxypeptidase-like 45-like    152   5e-39   
ref|XP_002321745.2|  hypothetical protein POPTR_0015s11610g             152   5e-39   
ref|XP_010055754.1|  PREDICTED: serine carboxypeptidase-like 45         152   5e-39   
ref|XP_007015557.1|  Serine carboxypeptidase-like 40, putative is...    151   5e-39   
ref|XP_004235841.1|  PREDICTED: serine carboxypeptidase-like 45 i...    152   5e-39   
ref|XP_004979757.1|  PREDICTED: p-(S)-hydroxymandelonitrile lyase...    152   5e-39   
ref|XP_006394589.1|  hypothetical protein EUTSA_v10004057mg             152   5e-39   
ref|XP_012065630.1|  PREDICTED: serine carboxypeptidase-like 40         152   6e-39   
ref|XP_010271867.1|  PREDICTED: serine carboxypeptidase-like 45 i...    152   6e-39   
ref|XP_012090605.1|  PREDICTED: serine carboxypeptidase-like 45 i...    151   6e-39   
ref|XP_011090479.1|  PREDICTED: serine carboxypeptidase II-3-like       152   6e-39   
ref|XP_007015556.1|  Serine carboxypeptidase II-3, expressed, put...    152   6e-39   
ref|XP_006287580.1|  hypothetical protein CARUB_v10000790mg             152   6e-39   
tpg|DAA38059.1|  TPA: hypothetical protein ZEAMMB73_252249              151   6e-39   
ref|XP_006347176.1|  PREDICTED: serine carboxypeptidase-like 31-like    152   6e-39   
ref|NP_001150027.1|  serine carboxypeptidase K10B2.2 precursor          151   6e-39   
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27         151   6e-39   
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         151   7e-39   
ref|XP_011002097.1|  PREDICTED: serine carboxypeptidase-like 45         151   7e-39   
ref|XP_008667418.1|  PREDICTED: hypothetical protein isoform X2         151   7e-39   
ref|XP_008667417.1|  PREDICTED: hypothetical protein isoform X1         151   7e-39   
ref|XP_004292825.1|  PREDICTED: serine carboxypeptidase II-3-like       152   7e-39   
ref|XP_010271868.1|  PREDICTED: serine carboxypeptidase-like 45 i...    152   7e-39   
ref|XP_006394590.1|  hypothetical protein EUTSA_v10004057mg             152   7e-39   
ref|XP_010249188.1|  PREDICTED: serine carboxypeptidase-like 45         152   7e-39   
ref|XP_007017345.1|  Serine carboxypeptidase 40, putative               152   8e-39   
ref|XP_010239839.1|  PREDICTED: serine carboxypeptidase-like 45         151   8e-39   
emb|CBI32794.3|  unnamed protein product                                151   8e-39   
ref|XP_006345491.1|  PREDICTED: serine carboxypeptidase-like 40-like    151   8e-39   
ref|XP_008222371.1|  PREDICTED: serine carboxypeptidase-like 45 i...    151   8e-39   
ref|XP_008222370.1|  PREDICTED: serine carboxypeptidase-like 45 i...    151   8e-39   
dbj|BAK06523.1|  predicted protein                                      151   9e-39   
gb|KHN30340.1|  Serine carboxypeptidase-like 45                         151   9e-39   
ref|XP_003521119.1|  PREDICTED: serine carboxypeptidase-like 45-like    151   9e-39   
ref|XP_003599510.1|  Serine carboxypeptidase-like protein               151   9e-39   
ref|XP_004984182.1|  PREDICTED: serine carboxypeptidase-like 26-l...    151   9e-39   
gb|EEC84715.1|  hypothetical protein OsI_31677                          151   9e-39   
ref|XP_006346530.1|  PREDICTED: serine carboxypeptidase II-3-like       151   1e-38   
gb|KJB58427.1|  hypothetical protein B456_009G209400                    151   1e-38   
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         150   1e-38   
ref|XP_004984181.1|  PREDICTED: serine carboxypeptidase-like 26-l...    151   1e-38   
gb|AES71588.2|  serine carboxypeptidase-like protein                    151   1e-38   
ref|XP_003601337.1|  Serine carboxypeptidase-like protein               151   1e-38   
ref|XP_011458956.1|  PREDICTED: serine carboxypeptidase II-3-like       151   1e-38   
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         150   1e-38   
ref|XP_006345492.1|  PREDICTED: serine carboxypeptidase-like 40-like    152   1e-38   
ref|XP_010653629.1|  PREDICTED: serine carboxypeptidase-like 45         150   1e-38   
ref|XP_002462503.1|  hypothetical protein SORBIDRAFT_02g026870          151   1e-38   
ref|XP_009601275.1|  PREDICTED: serine carboxypeptidase-like 40         151   1e-38   
ref|XP_002462502.1|  hypothetical protein SORBIDRAFT_02g026860          151   1e-38   
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    151   1e-38   
ref|XP_010938507.1|  PREDICTED: serine carboxypeptidase II-3-like...    151   1e-38   
gb|KHN31265.1|  Serine carboxypeptidase-like 45                         150   1e-38   
gb|KEH17668.1|  serine carboxypeptidase-like protein                    151   1e-38   
gb|KFK35499.1|  hypothetical protein AALP_AA5G292700                    151   1e-38   
emb|CDO99730.1|  unnamed protein product                                150   1e-38   
ref|XP_007038110.1|  Serine carboxypeptidase-like 45 isoform 1          150   1e-38   
ref|XP_010906017.1|  PREDICTED: serine carboxypeptidase II-3-like       151   1e-38   
ref|XP_003593501.1|  Serine carboxypeptidase-like protein               150   1e-38   
ref|XP_012091548.1|  PREDICTED: serine carboxypeptidase-like 32         150   1e-38   
ref|XP_006345490.1|  PREDICTED: serine carboxypeptidase-like 40-like    151   1e-38   
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         150   1e-38   
ref|XP_009619884.1|  PREDICTED: serine carboxypeptidase 24-like         151   1e-38   
emb|CDY40802.1|  BnaC02g41710D                                          151   1e-38   
ref|XP_011040753.1|  PREDICTED: serine carboxypeptidase-like 45         150   1e-38   
ref|XP_006578724.1|  PREDICTED: serine carboxypeptidase-like 45-like    150   1e-38   
ref|XP_006346528.1|  PREDICTED: serine carboxypeptidase II-3-like       151   1e-38   
ref|XP_004230806.1|  PREDICTED: serine carboxypeptidase II-3-like       150   2e-38   
gb|EMT08342.1|  Serine carboxypeptidase-like 40                         147   2e-38   
gb|KJB58430.1|  hypothetical protein B456_009G209400                    151   2e-38   
gb|KJB58426.1|  hypothetical protein B456_009G209400                    150   2e-38   
ref|XP_007224802.1|  hypothetical protein PRUPE_ppa023729mg             150   2e-38   
ref|XP_008652806.1|  PREDICTED: serine carboxypeptidase II-3-like       150   2e-38   
emb|CDX68352.1|  BnaA07g23920D                                          150   2e-38   
ref|XP_009378815.1|  PREDICTED: serine carboxypeptidase-like 45         150   2e-38   
emb|CDY68103.1|  BnaCnng57600D                                          144   2e-38   
ref|XP_010103278.1|  Serine carboxypeptidase-like 40                    150   2e-38   
ref|XP_010664883.1|  PREDICTED: serine carboxypeptidase-like 42 i...    149   2e-38   
ref|XP_004959513.1|  PREDICTED: serine carboxypeptidase-like 40-like    150   2e-38   
gb|KHG24370.1|  Serine carboxypeptidase II-3                            150   2e-38   
gb|AES59494.2|  serine carboxypeptidase-like protein                    150   2e-38   
ref|XP_006583804.1|  PREDICTED: serine carboxypeptidase-like 31-l...    150   2e-38   
ref|XP_002511104.1|  serine carboxypeptidase, putative                  150   2e-38   
ref|XP_008658699.1|  PREDICTED: lysosomal protective protein isof...    150   2e-38   
gb|KJB24944.1|  hypothetical protein B456_004G169200                    150   2e-38   
ref|XP_003589243.1|  Serine carboxypeptidase II-3                       150   2e-38   
ref|NP_001050257.1|  Os03g0386800                                       150   2e-38   
ref|XP_004502015.1|  PREDICTED: serine carboxypeptidase-like 40-like    150   2e-38   
ref|XP_003529304.1|  PREDICTED: serine carboxypeptidase-like 31-l...    150   2e-38   
ref|XP_008783276.1|  PREDICTED: serine carboxypeptidase II-3-like       150   2e-38   
gb|KHG07552.1|  Serine carboxypeptidase-like 45                         150   2e-38   
ref|XP_010316720.1|  PREDICTED: serine carboxypeptidase-like 31         150   2e-38   
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like       150   2e-38   
ref|XP_007159282.1|  hypothetical protein PHAVU_002G224800g             150   2e-38   
gb|EEE69861.1|  hypothetical protein OsJ_29661                          150   2e-38   
ref|XP_006438864.1|  hypothetical protein CICLE_v10031451mg             150   2e-38   
ref|XP_010645362.1|  PREDICTED: serine carboxypeptidase-like 31         150   2e-38   
emb|CDO99599.1|  unnamed protein product                                150   2e-38   
ref|XP_002268172.1|  PREDICTED: serine carboxypeptidase-like 45         150   2e-38   
ref|XP_002446348.1|  hypothetical protein SORBIDRAFT_06g014580          150   2e-38   
gb|KJB09187.1|  hypothetical protein B456_001G128400                    150   2e-38   
gb|KJB29512.1|  hypothetical protein B456_005G104400                    150   2e-38   
emb|CAN82217.1|  hypothetical protein VITISV_020424                     150   2e-38   
gb|KDO47635.1|  hypothetical protein CISIN_1g011108mg                   149   2e-38   
gb|EYU39414.1|  hypothetical protein MIMGU_mgv1a005505mg                150   2e-38   
ref|XP_006483005.1|  PREDICTED: serine carboxypeptidase-like 45-like    150   2e-38   
gb|KDO83181.1|  hypothetical protein CISIN_1g012396mg                   150   2e-38   
ref|XP_008670270.1|  PREDICTED: serine carboxypeptidase II-3-like       149   3e-38   
ref|XP_004514571.1|  PREDICTED: serine carboxypeptidase-like 40-like    150   3e-38   
ref|XP_009777002.1|  PREDICTED: serine carboxypeptidase-like 40         150   3e-38   
gb|KCW66001.1|  hypothetical protein EUGRSUZ_G03291                     149   3e-38   
ref|XP_002467770.1|  hypothetical protein SORBIDRAFT_01g033770          150   3e-38   
gb|AAT78817.1|  putative serine carboxypeptidase                        150   3e-38   
ref|XP_008383787.1|  PREDICTED: serine carboxypeptidase-like 31         150   3e-38   
ref|XP_006480243.1|  PREDICTED: serine carboxypeptidase II-3-like       150   3e-38   
ref|XP_006661322.1|  PREDICTED: serine carboxypeptidase II-3-like       150   3e-38   



>ref|XP_009600050.1| PREDICTED: serine carboxypeptidase-like 42 [Nicotiana tomentosiformis]
Length=472

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLVK LPGQPKV F+QYAGYVDVD+KAGRSLFYYFVEAEVNP  KPLTLWLNGGPG
Sbjct  26   YPEEDLVKALPGQPKVSFRQYAGYVDVDVKAGRSLFYYFVEAEVNPDHKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+PTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI G
Sbjct  86   CSSIGGGAFTELGPFFPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYITG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA TA DMHIFM+EW KKFP ++SR+L+
Sbjct  146  DAKTAMDMHIFMMEWLKKFPEFRSRELY  173



>ref|XP_009798650.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009798651.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nicotiana 
sylvestris]
Length=472

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLVK LPGQPKV F+QYAGYVDVD+KAGRSLFYYFVEAEVNP  KPLTLWLNGGPG
Sbjct  26   YPEEDLVKALPGQPKVSFRQYAGYVDVDVKAGRSLFYYFVEAEVNPDHKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+PTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSIGGGAFTELGPFFPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA TA DMHIFM+EW KKFP+++SR+L+
Sbjct  146  DAKTAMDMHIFMMEWLKKFPAFRSRELY  173



>ref|XP_004237734.1| PREDICTED: serine carboxypeptidase-like 42 [Solanum lycopersicum]
Length=472

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPE+DLVK LPGQPKVGF+QYAGYVDVD+KAGRSLFYYFVEAEV P  KPLTLWLNGGPG
Sbjct  26   YPEKDLVKALPGQPKVGFRQYAGYVDVDVKAGRSLFYYFVEAEVKPDEKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+PTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSIGGGAFTELGPFFPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYTTG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA TA DMH+FM+EW KKFP++KSR+L+
Sbjct  146  DAKTAMDMHMFMMEWVKKFPAFKSRELY  173



>ref|XP_006356286.1| PREDICTED: serine carboxypeptidase-like 42-like [Solanum tuberosum]
Length=472

 Score =   244 bits (623),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLVK LPGQPKVGF+QYAGYV+VD+KAGRSLFYYFVEAEV P  KPL LWLNGGPG
Sbjct  26   YPEEDLVKALPGQPKVGFRQYAGYVEVDVKAGRSLFYYFVEAEVKPDEKPLALWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+PTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSIGGGAFTELGPFFPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYTTG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA TA DMH+FM+EW KKFP++KSR+L+
Sbjct  146  DAKTAMDMHMFMMEWVKKFPAFKSRELY  173



>ref|XP_007019398.1| Serine carboxypeptidase-like 42 isoform 2 [Theobroma cacao]
 gb|EOY16623.1| Serine carboxypeptidase-like 42 isoform 2 [Theobroma cacao]
Length=433

 Score =   243 bits (620),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP+VGF QYAGYVDVD+KAGRSLFYYFVEA+ +P  KPLTLWLNGGPG
Sbjct  27   YPAEDLVVNLPGQPQVGFMQYAGYVDVDVKAGRSLFYYFVEADKDPDKKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLRRNS SWN+ASNLLFVESPAGVGWSYSNTSSDYICG
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTSSDYICG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMHIFM+ W++KFP +KSR+LF
Sbjct  147  DASTAKDMHIFMMNWYEKFPEFKSRELF  174



>ref|XP_007019399.1| Serine carboxypeptidase-like 42 isoform 3, partial [Theobroma 
cacao]
 gb|EOY16624.1| Serine carboxypeptidase-like 42 isoform 3, partial [Theobroma 
cacao]
Length=439

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP+VGF QYAGYVDVD+KAGRSLFYYFVEA+ +P  KPLTLWLNGGPG
Sbjct  27   YPAEDLVVNLPGQPQVGFMQYAGYVDVDVKAGRSLFYYFVEADKDPDKKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLRRNS SWN+ASNLLFVESPAGVGWSYSNTSSDYICG
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTSSDYICG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMHIFM+ W++KFP +KSR+LF
Sbjct  147  DASTAKDMHIFMMNWYEKFPEFKSRELF  174



>ref|XP_006434390.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
 gb|ESR47630.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
Length=331

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGGPG
Sbjct  33   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  92

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  93   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  152

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH+FM+ W++KFP +KSR+LF
Sbjct  153  DASTARDMHVFMMNWYEKFPEFKSRELF  180



>gb|KDO83625.1| hypothetical protein CISIN_1g0117641mg [Citrus sinensis]
Length=330

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGGPG
Sbjct  32   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  91

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH+FM+ W++KFP +KSR+LF
Sbjct  152  DASTARDMHVFMMNWYEKFPEFKSRELF  179



>ref|XP_007019397.1| Serine carboxypeptidase-like 42 isoform 1 [Theobroma cacao]
 gb|EOY16622.1| Serine carboxypeptidase-like 42 isoform 1 [Theobroma cacao]
Length=473

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP+VGF QYAGYVDVD+KAGRSLFYYFVEA+ +P  KPLTLWLNGGPG
Sbjct  27   YPAEDLVVNLPGQPQVGFMQYAGYVDVDVKAGRSLFYYFVEADKDPDKKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLRRNS SWN+ASNLLFVESPAGVGWSYSNTSSDYICG
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTSSDYICG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMHIFM+ W++KFP +KSR+LF
Sbjct  147  DASTAKDMHIFMMNWYEKFPEFKSRELF  174



>gb|KDO83623.1| hypothetical protein CISIN_1g0117641mg [Citrus sinensis]
 gb|KDO83624.1| hypothetical protein CISIN_1g0117641mg [Citrus sinensis]
Length=353

 Score =   238 bits (607),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGGPG
Sbjct  32   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  91

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH+FM+ W++KFP +KSR+LF
Sbjct  152  DASTARDMHVFMMNWYEKFPEFKSRELF  179



>gb|KDO83622.1| hypothetical protein CISIN_1g0117641mg [Citrus sinensis]
Length=396

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGGPG
Sbjct  32   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  91

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH+FM+ W++KFP +KSR+LF
Sbjct  152  DASTARDMHVFMMNWYEKFPEFKSRELF  179



>gb|KDO83613.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=394

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGGPG
Sbjct  32   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  91

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH+FM+ W++KFP +KSR+LF
Sbjct  152  DASTARDMHVFMMNWYEKFPEFKSRELF  179



>gb|KDO83614.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
 gb|KDO83615.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=423

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGGPG
Sbjct  32   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  91

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH+FM+ W++KFP +KSR+LF
Sbjct  152  DASTARDMHVFMMNWYEKFPEFKSRELF  179



>ref|XP_006434389.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
 gb|ESR47629.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
Length=424

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGGPG
Sbjct  33   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  92

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  93   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  152

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH+FM+ W++KFP +KSR+LF
Sbjct  153  DASTARDMHVFMMNWYEKFPEFKSRELF  180



>ref|XP_006434388.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
 gb|ESR47628.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
Length=479

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGGPG
Sbjct  33   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  92

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  93   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  152

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH+FM+ W++KFP +KSR+LF
Sbjct  153  DASTARDMHVFMMNWYEKFPEFKSRELF  180



>ref|XP_011101717.1| PREDICTED: serine carboxypeptidase-like 42 [Sesamum indicum]
Length=469

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +PEEDLV  LPGQP V F+QYAGYVDVD+K GRSLFYYFVEA  +P  KPLTLWLNGGPG
Sbjct  23   FPEEDLVTKLPGQPVVKFRQYAGYVDVDVKNGRSLFYYFVEAAEDPDRKPLTLWLNGGPG  82

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLR NSKSWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  83   CSSVGGGAFTELGPFYPRGDGRGLRINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  142

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMHIF++EW+KKFP++K+RDLF
Sbjct  143  DASTAMDMHIFLMEWYKKFPTFKTRDLF  170



>ref|XP_006472927.1| PREDICTED: serine carboxypeptidase-like 42-like [Citrus sinensis]
Length=478

 Score =   236 bits (602),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQPKV F+QYAGYVDVD+K GRSLFYYFVEAEV P  KPLTLWLNGGPG
Sbjct  32   FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG  91

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGR LRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92   CSSVGGGAFTELGPFYPRGDGRALRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH+FM+ W++KFP +KSR+LF
Sbjct  152  DASTARDMHVFMMNWYEKFPEFKSRELF  179



>ref|XP_002278193.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Vitis 
vinifera]
 emb|CBI19968.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP+VGF+Q+AGYVDVD+KAGRSLFYYFVEAE +P  K LTLWLNGGPG
Sbjct  21   YPEEDLVVRLPGQPEVGFRQFAGYVDVDVKAGRSLFYYFVEAEDDPDTKALTLWLNGGPG  80

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P+GDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  81   CSSMGGGAFTELGPFFPSGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTTSDYTCG  140

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DM +FM++W +KFP++KSR LF
Sbjct  141  DASTARDMRVFMMKWLEKFPAFKSRALF  168



>ref|XP_007161487.1| hypothetical protein PHAVU_001G0732001g, partial [Phaseolus vulgaris]
 gb|ESW33481.1| hypothetical protein PHAVU_001G0732001g, partial [Phaseolus vulgaris]
Length=200

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP VGFKQ+AGYVDVDLK GRSLFYYFVEAE +P  KPLTLWLNGGPG
Sbjct  46   YPAEDLVVRLPGQPNVGFKQFAGYVDVDLKHGRSLFYYFVEAEKDPDKKPLTLWLNGGPG  105

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWNKASNL+FVESPAGVGWSYSNT+SDY  G
Sbjct  106  CSSIGGGAFTELGPFYPNGDGRGLRRNSMSWNKASNLIFVESPAGVGWSYSNTTSDYNSG  165

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA+DM++F+++W++KFPSY++R+LF
Sbjct  166  DVSTANDMYLFLLKWYEKFPSYRTRELF  193



>gb|EYU17411.1| hypothetical protein MIMGU_mgv1a005783mg [Erythranthe guttata]
Length=471

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +PEEDLV  LPGQP V F+QYAGYVDVD+K GRSLFYYFVEA+ NP  KPLTLWLNGGPG
Sbjct  25   FPEEDLVVKLPGQPFVKFRQYAGYVDVDVKKGRSLFYYFVEADNNPDHKPLTLWLNGGPG  84

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P GDGR LR NSKSWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  85   CSSIGGGAFTELGPFFPNGDGRSLRVNSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  144

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH+F++EW+KKFP++K+RDLF
Sbjct  145  DASTAMDMHVFLMEWYKKFPTFKTRDLF  172



>ref|XP_010245825.1| PREDICTED: serine carboxypeptidase-like 42 [Nelumbo nucifera]
Length=470

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQPKV F+Q+AGYVDVD KAGRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  24   YPVEDLVLKLPGQPKVDFRQFAGYVDVDEKAGRSLFYYFVEAEGEPEKKPLTLWLNGGPG  83

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGG+FTELGPF+P GDGRGL+RN+KSWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  84   CSSVGGGSFTELGPFFPRGDGRGLQRNTKSWNKASNLLFVESPAGVGWSYSNTTSDYTCG  143

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMHIF ++WF+K+P YKSRDLF
Sbjct  144  DASTARDMHIFFLKWFEKYPEYKSRDLF  171



>ref|XP_007201403.1| hypothetical protein PRUPE_ppa008027mg [Prunus persica]
 gb|EMJ02602.1| hypothetical protein PRUPE_ppa008027mg [Prunus persica]
Length=348

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+  P  KPLTLWLNGGPG
Sbjct  27   YPAEDLVVRLPGQPNVGFKQYAGYVDVDVKAGRSLFYYFVEADREPDKKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRRNLMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH F+++W++KFP+++SR+LF
Sbjct  147  DASTARDMHTFLLKWYEKFPAFRSRELF  174



>ref|XP_010244030.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nelumbo 
nucifera]
Length=469

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP E LV  LPGQPKV F+Q+AGY+DVD KAGRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  23   YPVEHLVSKLPGQPKVDFRQFAGYIDVDEKAGRSLFYYFVEAEGEPEKKPLTLWLNGGPG  82

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPF+P GDGRGLRRN+KSWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  83   CSSVGGGAFTELGPFFPRGDGRGLRRNTKSWNKASNLLFVESPAGVGWSYSNTTSDYTCG  142

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DAS+A DMH+F+++WF+K+P YKSRDLF
Sbjct  143  DASSARDMHMFLMKWFQKYPEYKSRDLF  170



>ref|XP_009360732.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=473

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+  P  KPLTLWLNGGPG
Sbjct  27   YPAEDLVVSLPGQPSVGFKQYAGYVDVDVKAGRSLFYYFVEADEQPDKKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGLRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87   CSSVGGGAFTELGPFYPTGDGRGLRRNPMSWNRASNLLFVESPAGVGWSYSNTSSDYDSG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH F++EW++KFP+++SR+LF
Sbjct  147  DASTARDMHTFLMEWYEKFPTFRSRELF  174



>ref|XP_010244029.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nelumbo 
nucifera]
Length=505

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP E LV  LPGQPKV F+Q+AGY+DVD KAGRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  59   YPVEHLVSKLPGQPKVDFRQFAGYIDVDEKAGRSLFYYFVEAEGEPEKKPLTLWLNGGPG  118

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPF+P GDGRGLRRN+KSWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  119  CSSVGGGAFTELGPFFPRGDGRGLRRNTKSWNKASNLLFVESPAGVGWSYSNTTSDYTCG  178

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DAS+A DMH+F+++WF+K+P YKSRDLF
Sbjct  179  DASSARDMHMFLMKWFQKYPEYKSRDLF  206



>ref|XP_010930631.1| PREDICTED: serine carboxypeptidase-like 42 [Elaeis guineensis]
Length=476

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV GLPGQPKV F+QYAGYVDVD K G+SLFYYF EA+ N   KPLTLWLNGGPG
Sbjct  26   YPEEDLVVGLPGQPKVEFRQYAGYVDVDTKTGKSLFYYFAEADSNASKKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLRRN KSWNKASNLLFVESP GVGWSYSN SSDY CG
Sbjct  86   CSSIGGGAFTELGPFYPRGDGRGLRRNKKSWNKASNLLFVESPVGVGWSYSNRSSDYTCG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA+DMH+F++ W+ KFP +KSRDLF
Sbjct  146  DESTANDMHVFLLRWYDKFPEFKSRDLF  173



>ref|XP_009377728.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=491

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+  P  KPLTLWLNGGPG
Sbjct  45   YPAEDLVVSLPGQPSVGFKQYAGYVDVDVKAGRSLFYYFVEADKQPDRKPLTLWLNGGPG  104

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  105  CSSIGGGAFTELGPFYPTGDGRGLRRNKMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  164

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH F+++W++KFP+++SR+LF
Sbjct  165  DASTARDMHTFLLKWYEKFPTFRSRELF  192



>gb|KHN05260.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=474

 Score =   231 bits (589),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQPKVGFKQ+AGYVDVD K GRSLFYYFVEAE +P  KPLTLWLNGGPG
Sbjct  28   YPAEDLVVKLPGQPKVGFKQFAGYVDVDAKHGRSLFYYFVEAEQDPHKKPLTLWLNGGPG  87

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  88   CSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNSG  147

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA+DM++FM++W++KFPSY +R+LF
Sbjct  148  DASTANDMYLFMLKWYEKFPSYITRELF  175



>emb|CDP12019.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   231 bits (589),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P ED V+ LPGQPKVGFKQYAGY+DVD+KAGRSLFYYFVEAE +P  KPL LWLNGGPG
Sbjct  24   FPAEDFVEALPGQPKVGFKQYAGYIDVDVKAGRSLFYYFVEAEKDPDQKPLALWLNGGPG  83

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTE GPF+P GDGR LRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  84   CSSIGGGAFTEFGPFFPRGDGRALRRNKMSWNRASNLLFVESPAGVGWSYSNTSSDYNTG  143

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA+TA DMHIFM+EWFKKFPS++SR LF
Sbjct  144  DANTARDMHIFMMEWFKKFPSFRSRALF  171



>ref|XP_003544740.2| PREDICTED: serine carboxypeptidase-like 42-like isoformX1 [Glycine 
max]
Length=487

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQPKVGFKQ+AGYVDVD K GRSLFYYFVEAE +P  KPLTLWLNGGPG
Sbjct  41   YPAEDLVVKLPGQPKVGFKQFAGYVDVDAKHGRSLFYYFVEAEQDPHKKPLTLWLNGGPG  100

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  101  CSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNSG  160

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA+DM++FM++W++KFPSY +R+LF
Sbjct  161  DASTANDMYLFMLKWYEKFPSYITRELF  188



>ref|XP_010679983.1| PREDICTED: serine carboxypeptidase-like 42 [Beta vulgaris subsp. 
vulgaris]
Length=477

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQPKVGFKQ+AGY+DVD+KAGRSLFYYFVEA+ +P  KPLTLWLNGGPG
Sbjct  31   YPMEDLVVNLPGQPKVGFKQFAGYIDVDVKAGRSLFYYFVEAKNDPHSKPLTLWLNGGPG  90

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P+GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  91   CSSMGGGAFTELGPFFPSGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  150

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA++A DM  F+V WF+KFP +KSRDLF
Sbjct  151  DAASAKDMLTFLVNWFEKFPEFKSRDLF  178



>ref|XP_008237677.1| PREDICTED: serine carboxypeptidase-like 42 [Prunus mume]
Length=471

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+  P  KPLTLWLNGGPG
Sbjct  27   YPAEDLVVRLPGQPNVGFKQYAGYVDVDVKAGRSLFYYFVEADKEPDKKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRRNLMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH F+++W++KFP+++SR+LF
Sbjct  147  DASTARDMHTFLLKWYEKFPAFRSRELF  174



>ref|XP_011074776.1| PREDICTED: serine carboxypeptidase-like 42 [Sesamum indicum]
Length=475

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +PE+DLV  LPGQP V F+Q+AGYVDVD+K GRSLFYYFVEA  +P  KPLTLWLNGGPG
Sbjct  29   FPEKDLVVRLPGQPVVKFRQFAGYVDVDVKNGRSLFYYFVEAVEDPDHKPLTLWLNGGPG  88

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P GDGRGLR NSKSWNKASNLLFVESP+GVGWSYSNTSSDY CG
Sbjct  89   CSSIGGGAFTELGPFFPKGDGRGLRINSKSWNKASNLLFVESPSGVGWSYSNTSSDYTCG  148

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMHIFM+EW+KKFP++++RDLF
Sbjct  149  DASTAIDMHIFMMEWYKKFPTFRTRDLF  176



>ref|XP_010062160.1| PREDICTED: serine carboxypeptidase-like 42 [Eucalyptus grandis]
 gb|KCW69227.1| hypothetical protein EUGRSUZ_F02740 [Eucalyptus grandis]
Length=472

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP +DLV  LPGQPKVGF+Q+AGYVDVD+K GRSLFYYFVEA+ +P  KPL LWLNGGPG
Sbjct  26   YPAQDLVVNLPGQPKVGFRQFAGYVDVDVKHGRSLFYYFVEADKDPESKPLALWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWN+ASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  86   CSSIGGGAFTELGPFYPRGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTTSDYNCG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D S+A D+H F ++WF+KFP+YKSRDLF
Sbjct  146  DESSAKDLHTFFLKWFEKFPTYKSRDLF  173



>ref|XP_009377699.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=473

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+  P  K LTLWLNGGPG
Sbjct  27   YPAEDLVVSLPGQPSVGFKQYAGYVDVDVKAGRSLFYYFVEADKQPDKKSLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRRNKMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH F+++W++KFP+++SR+LF
Sbjct  147  DASTAKDMHTFLLKWYEKFPTFRSRELF  174



>ref|XP_006393769.1| hypothetical protein EUTSA_v10011445mg [Eutrema salsugineum]
 gb|ESQ31055.1| hypothetical protein EUTSA_v10011445mg [Eutrema salsugineum]
Length=479

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQPKV F+Q+AGYVDVD++AGRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  32   YPEEDLVTKLPGQPKVAFRQFAGYVDVDVRAGRSLFYYFVEAEKQPHTKPLTLWLNGGPG  91

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLRRN KSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  92   CSSIGGGAFTELGPFYPTGDGRGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  151

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM +FM+ W +KFP++K+++LF
Sbjct  152  DESTAKDMLVFMLRWLEKFPAFKTQNLF  179



>ref|XP_010530237.1| PREDICTED: serine carboxypeptidase-like 42 [Tarenaya hassleriana]
Length=474

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP V F+Q+AGYVDVDLK+GRSLFYYFVEAE  P  KPL+LWLNGGPG
Sbjct  28   YPEEDLVVKLPGQPDVQFRQFAGYVDVDLKSGRSLFYYFVEAEKKPDEKPLSLWLNGGPG  87

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLRRNS SWNKASNLLFVESPAGVGWSYSN +SDY  G
Sbjct  88   CSSIGGGAFTELGPFYPTGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNKTSDYTTG  147

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA+TA DM +F++ WFKKFP +KSRDLF
Sbjct  148  DATTAKDMLVFLLRWFKKFPEFKSRDLF  175



>ref|XP_008373914.1| PREDICTED: serine carboxypeptidase-like 42 [Malus domestica]
Length=474

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP VGFKQYAG VDVD+KAGRSLFYYFVEA+  P  KPLTLWLNGGPG
Sbjct  28   YPAEDLVVSLPGQPSVGFKQYAGSVDVDVKAGRSLFYYFVEADKQPDKKPLTLWLNGGPG  87

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  88   CSSIGGGAFTELGPFYPTGDGRGLRRNKMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  147

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH F+++W++KFP+++SR+LF
Sbjct  148  DASTARDMHAFLLKWYEKFPTFRSRELF  175



>gb|KHF97371.1| Serine carboxypeptidase-like 42 [Gossypium arboreum]
Length=483

 Score =   229 bits (583),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+ NP  +PLTLWLNGGPG
Sbjct  37   YPAEDLVVKLPGQPPVGFKQYAGYVDVDVKAGRSLFYYFVEADKNPEKQPLTLWLNGGPG  96

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGR LR NS SWNKASNLLFVESP GVGWSYSNTSSDYI G
Sbjct  97   CSSVGGGAFTELGPFYPRGDGRSLRINSMSWNKASNLLFVESPVGVGWSYSNTSSDYIRG  156

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DM+IFM++W++KFP +KSR+LF
Sbjct  157  DASTAKDMYIFMMKWYEKFPEFKSRELF  184



>gb|KJB59374.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
 gb|KJB59376.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
 gb|KJB59378.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
Length=483

 Score =   228 bits (582),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+ NP  +PLTLWLNGGPG
Sbjct  37   YPAEDLVVKLPGQPPVGFKQYAGYVDVDVKAGRSLFYYFVEADKNPEKQPLTLWLNGGPG  96

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGR LR NS SWNKASNLLFVESP GVGWSYSNTSSDYI G
Sbjct  97   CSSVGGGAFTELGPFYPRGDGRSLRINSMSWNKASNLLFVESPVGVGWSYSNTSSDYIRG  156

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DM+IFM++W++KFP +KSR+LF
Sbjct  157  DASTAKDMYIFMMKWYEKFPEFKSRELF  184



>gb|KFK24266.1| hypothetical protein AALP_AAs40498U001000 [Arabis alpina]
Length=480

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +PEEDLV  LP QPKV F+Q+AGYVDVD+KAGRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  32   FPEEDLVTKLPRQPKVAFRQFAGYVDVDVKAGRSLFYYFVEAENQPHSKPLTLWLNGGPG  91

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLR+NSKSWNKASNLLFVESPAGVGWSYSNTSSDY   
Sbjct  92   CSSIGGGAFTELGPFYPTGDGRGLRKNSKSWNKASNLLFVESPAGVGWSYSNTSSDYNTD  151

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA+TA DM +FM+ WFKKFP +K+R LF
Sbjct  152  DATTAKDMLVFMLRWFKKFPEFKTRQLF  179



>ref|XP_011659129.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Cucumis 
sativus]
 gb|KGN44500.1| hypothetical protein Csa_7G319000 [Cucumis sativus]
Length=472

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQP V FKQYAGYVD+DLK GRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  26   FPSEDLVLRLPGQPPVSFKQYAGYVDIDLKNGRSLFYYFVEAEEQPEKKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP+GDGRGLR+N  SWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  86   CSSIGGGAFTELGPFYPSGDGRGLRKNPMSWNKASNLLFVESPAGVGWSYSNTSSDYNCG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH+F + W++KFPS+KSR L+
Sbjct  146  DASTARDMHMFFMNWYEKFPSFKSRALY  173



>emb|CDX80725.1| BnaC08g05590D [Brassica napus]
Length=476

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP+V F+Q+AGYVDVD+KAGRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  31   YPEEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQPHTKPLTLWLNGGPG  90

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLRRNSKSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  91   CSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  150

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM +F++ W +KFP +++R+LF
Sbjct  151  DESTAKDMLVFLLRWLEKFPEFRTRNLF  178



>ref|XP_009377698.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=474

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYF EA+  P  KPLTLWLNGGPG
Sbjct  28   YPAEDLVVSLPGQPSVGFKQYAGYVDVDVKAGRSLFYYFAEADKQPDKKPLTLWLNGGPG  87

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLR N  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  88   CSSIGGGAFTELGPFYPTGDGRGLRTNKMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  147

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH F+++W++KFP+++SR+LF
Sbjct  148  DASTARDMHTFLLKWYEKFPTFRSRELF  175



>ref|XP_004290564.1| PREDICTED: serine carboxypeptidase-like 42 [Fragaria vesca subsp. 
vesca]
Length=467

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP+VGFKQYAGYVDVD+K GRSLFYYFVEAE     KPL+LWLNGGPG
Sbjct  21   YPAEDLVVKLPGQPQVGFKQYAGYVDVDVKNGRSLFYYFVEAENQADKKPLSLWLNGGPG  80

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLRRN  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  81   CSSIGGGAFTELGPFYPTGDGRGLRRNPSSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  140

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH F+++W++KFP+YKSR LF
Sbjct  141  DASTARDMHTFLLKWYEKFPAYKSRALF  168



>emb|CDY70042.1| BnaCnng66490D [Brassica napus]
Length=449

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQPKVGF+QYAGYV+VD K GRSLFYYFVEA+  P  KPLTLWLNGGPG
Sbjct  26   YPEEDLVVRLPGQPKVGFRQYAGYVNVDSKNGRSLFYYFVEADKQPDTKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D +TASDM +F++ WF KFP  KSRD F
Sbjct  146  DETTASDMVVFLLRWFDKFPELKSRDFF  173



>ref|XP_003522555.2| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Glycine 
max]
 gb|KHN44256.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=473

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP+EDL+  LPGQPKVGFKQYAGYVD+D+K GRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  27   YPDEDLIVSLPGQPKVGFKQYAGYVDIDVKHGRSLFYYFVEAENGPDKKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWN+ASNLLFVESPAGVGWSYSN +SDY  G
Sbjct  87   CSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNKTSDYNSG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D+STA+DM +F+ +W++KFPSY+SR+LF
Sbjct  147  DSSTATDMLLFLRKWYEKFPSYRSRELF  174



>ref|XP_004490638.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Cicer 
arietinum]
Length=476

 Score =   226 bits (576),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQPKV F QY GYVD+D+K GRSLFYYFVEA+ +P  KPLTLWLNGGPG
Sbjct  30   YPIEDLVVRLPGQPKVKFSQYGGYVDIDVKHGRSLFYYFVEADHHPHKKPLTLWLNGGPG  89

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLR+NS SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  90   CSSIGGGAFTELGPFYPTGDGRGLRKNSMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  149

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DM +F+++W++KFPSYKSRDLF
Sbjct  150  DASTADDMVLFLLKWYEKFPSYKSRDLF  177



>ref|XP_009107652.1| PREDICTED: serine carboxypeptidase-like 44 isoform X3 [Brassica 
rapa]
Length=454

 Score =   226 bits (575),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP+V F+Q+AGYVDVD+KAGRSLFYYFVEAE     KPLTLWLNGGPG
Sbjct  7    YPEEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQQHTKPLTLWLNGGPG  66

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLRRNSKSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  67   CSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  126

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM +F++ W +KFP +++R+LF
Sbjct  127  DESTAKDMLVFLLRWLEKFPEFRTRNLF  154



>ref|XP_008786550.1| PREDICTED: serine carboxypeptidase-like 42 [Phoenix dactylifera]
Length=475

 Score =   226 bits (576),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV GLP QPKVGF+QYAGYVDVD KAGRSLFYYF EA+ N   KPLTLWLNGGPG
Sbjct  25   YPEEDLVVGLPRQPKVGFRQYAGYVDVDEKAGRSLFYYFAEADGNADKKPLTLWLNGGPG  84

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P GDGRGLRRN  SWNKASNLLFVESPAGVGWSYSN +SDY CG
Sbjct  85   CSSIGGGAFTELGPFFPRGDGRGLRRNKMSWNKASNLLFVESPAGVGWSYSNRTSDYTCG  144

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D S A+D+H+F++ W+ KFP +KSRDLF
Sbjct  145  DESAANDLHVFLLRWYDKFPEFKSRDLF  172



>ref|XP_004490637.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Cicer 
arietinum]
Length=509

 Score =   227 bits (578),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQPKV F QY GYVD+D+K GRSLFYYFVEA+ +P  KPLTLWLNGGPG
Sbjct  30   YPIEDLVVRLPGQPKVKFSQYGGYVDIDVKHGRSLFYYFVEADHHPHKKPLTLWLNGGPG  89

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLR+NS SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  90   CSSIGGGAFTELGPFYPTGDGRGLRKNSMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  149

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DM +F+++W++KFPSYKSRDLF
Sbjct  150  DASTADDMVLFLLKWYEKFPSYKSRDLF  177



>ref|XP_010519388.1| PREDICTED: serine carboxypeptidase-like 42 [Tarenaya hassleriana]
Length=471

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP V F+Q+AGYVDVD K+GRSLFYYFVEAE NP  KPLTLWLNGGPG
Sbjct  25   YPEEDLVVKLPGQPDVEFRQFAGYVDVDFKSGRSLFYYFVEAEKNPLDKPLTLWLNGGPG  84

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLR N  SWNKASNLLFVESPAGVGWSYSN +SDY  G
Sbjct  85   CSSIGGGAFTELGPFYPTGDGRGLRVNPMSWNKASNLLFVESPAGVGWSYSNRTSDYNTG  144

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DM +F++ WFKKFP +KSRDLF
Sbjct  145  DASTAKDMLVFLLRWFKKFPEFKSRDLF  172



>ref|XP_002300939.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE80212.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=480

 Score =   226 bits (576),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP +DLV  LPGQPKVGF+QYAGYVDVD+K GRSLFYYFVEA+ +P  KPL LWLNGGPG
Sbjct  34   YPSKDLVLNLPGQPKVGFRQYAGYVDVDVKNGRSLFYYFVEADKDPDQKPLALWLNGGPG  93

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P GDGRGLRRNS SWN+ASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  94   CSSIGGGAFTELGPFFPKGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTTSDYTTG  153

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA TA DMH+F+++W++KFP +KSR+LF
Sbjct  154  DAKTAKDMHMFLLKWYEKFPDFKSRELF  181



>emb|CDX93108.1| BnaA03g38300D [Brassica napus]
Length=449

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP VGF+QYAGYV+VD K GRSLFYYFVEA+  P  KPLTLWLNGGPG
Sbjct  26   YPEEDLVVRLPGQPNVGFRQYAGYVNVDSKNGRSLFYYFVEADKQPNTKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D +TASDM +F++ WF KFP  KSRD F
Sbjct  146  DETTASDMVVFLLRWFNKFPELKSRDFF  173



>ref|XP_008461495.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Cucumis 
melo]
Length=472

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQP V FKQYAGYVD+D+K GRSLFYYFVEAE +P  KPLTLWLNGGPG
Sbjct  26   FPSEDLVLRLPGQPPVSFKQYAGYVDIDVKNGRSLFYYFVEAEEHPEKKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP+GDGRGLR+N  SWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  86   CSSIGGGAFTELGPFYPSGDGRGLRKNPMSWNKASNLLFVESPAGVGWSYSNTSSDYNCG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMHIF + W++KFPS+KS  L+
Sbjct  146  DASTARDMHIFFMNWYEKFPSFKSSALY  173



>ref|XP_009107650.1| PREDICTED: serine carboxypeptidase-like 44 isoform X2 [Brassica 
rapa]
 ref|XP_009107651.1| PREDICTED: serine carboxypeptidase-like 44 isoform X2 [Brassica 
rapa]
Length=464

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP+V F+Q+AGYVDVD+KAGRSLFYYFVEAE     KPLTLWLNGGPG
Sbjct  17   YPEEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQQHTKPLTLWLNGGPG  76

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLRRNSKSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  77   CSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  136

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM +F++ W +KFP +++R+LF
Sbjct  137  DESTAKDMLVFLLRWLEKFPEFRTRNLF  164



>ref|XP_008373913.1| PREDICTED: serine carboxypeptidase-like 42 [Malus domestica]
Length=473

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+  P  K LTLWLNGGPG
Sbjct  27   YPAEDLVVSLPGQPSVGFKQYAGYVDVDVKAGRSLFYYFVEADKQPDKKSLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRG+R N  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGVRSNKMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DMH F+++W++KFP+++SR+LF
Sbjct  147  DASTAKDMHTFLLKWYEKFPTFRSRELF  174



>ref|XP_010493597.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010493598.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010493599.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
Length=462

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYY+VEA   P  KPLTLWLNGGPG
Sbjct  23   YPEEDLVVRLPGQPTVGFKQYAGYVDVDVKAGRSLFYYYVEAVKQPDTKPLTLWLNGGPG  82

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN +SDY  G
Sbjct  83   CSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASNLLFVESPAGVGWSYSNRTSDYNAG  142

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STASDM +F++ W  KFP+ KSRDLF
Sbjct  143  DRSTASDMLVFLLRWLDKFPNLKSRDLF  170



>ref|XP_004502581.1| PREDICTED: serine carboxypeptidase-like 42-like [Cicer arietinum]
Length=468

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV+ LPGQPKV F QYAGYVD+D+K G+SLFYYFVEA  NP  KPLTLWLNGGPG
Sbjct  24   YPSEDLVERLPGQPKVKFSQYAGYVDIDVKNGKSLFYYFVEAHHNPHKKPLTLWLNGGPG  83

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP+G+GRGLR+NSKSWN+ SNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  84   CSSIGGGAFTELGPFYPSGNGRGLRKNSKSWNRVSNLLFVESPAGVGWSYSNTTSDYNAG  143

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA+DM +FM++W++KFP+Y+SR+LF
Sbjct  144  DASTANDMLLFMLKWYEKFPTYRSRELF  171



>emb|CDY48945.1| BnaA08g04690D [Brassica napus]
Length=477

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP+V F+Q+AGYVDVD+KAGRSLFYYFVEAE     KPLTLWLNGGPG
Sbjct  30   YPEEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQQHTKPLTLWLNGGPG  89

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLRRNSKSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  90   CSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  149

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM +F++ W +KFP +++R+LF
Sbjct  150  DESTAKDMLVFLLRWLEKFPEFRTRNLF  177



>ref|XP_009107648.1| PREDICTED: serine carboxypeptidase-like 44 isoform X1 [Brassica 
rapa]
 ref|XP_009107649.1| PREDICTED: serine carboxypeptidase-like 44 isoform X1 [Brassica 
rapa]
Length=477

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP+V F+Q+AGYVDVD+KAGRSLFYYFVEAE     KPLTLWLNGGPG
Sbjct  30   YPEEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQQHTKPLTLWLNGGPG  89

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLRRNSKSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  90   CSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  149

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM +F++ W +KFP +++R+LF
Sbjct  150  DESTAKDMLVFLLRWLEKFPEFRTRNLF  177



>ref|NP_199039.1| serine carboxypeptidase-like 42 [Arabidopsis thaliana]
 sp|Q9FH05.1|SCP42_ARATH RecName: Full=Serine carboxypeptidase-like 42; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK32772.1|AF361604_1 AT5g42240/K5J14_4 [Arabidopsis thaliana]
 dbj|BAB10197.1| serine carboxypeptidase II-like [Arabidopsis thaliana]
 gb|AAN28838.1| At5g42240/K5J14_4 [Arabidopsis thaliana]
 gb|AED94786.1| serine carboxypeptidase-like 42 [Arabidopsis thaliana]
Length=473

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYY+VEA   P  KPLTLWLNGGPG
Sbjct  27   YPEEDLVVRLPGQPTVGFKQYAGYVDVDVKAGRSLFYYYVEAVKQPDSKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLR NS SWNKAS+LLFVESPAGVGWSYSN SSDY  G
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASHLLFVESPAGVGWSYSNKSSDYNTG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA+DM +F++ WF+KFP  KSRDLF
Sbjct  147  DKSTANDMLVFLLRWFEKFPKLKSRDLF  174



>ref|XP_006280410.1| hypothetical protein CARUB_v10026343mg [Capsella rubella]
 gb|EOA13308.1| hypothetical protein CARUB_v10026343mg [Capsella rubella]
Length=471

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEED V  LPGQPKVGF+QYAGYVDVD+KAGRSLFYY+VEA   P  KPLTLWLNGGPG
Sbjct  25   YPEEDFVVRLPGQPKVGFRQYAGYVDVDVKAGRSLFYYYVEAVKQPDTKPLTLWLNGGPG  84

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN S+DY  G
Sbjct  85   CSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASNLLFVESPAGVGWSYSNRSTDYNTG  144

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D +TASDM +F++ WF KFP  KSRDLF
Sbjct  145  DKTTASDMVMFLLRWFDKFPKLKSRDLF  172



>gb|KHN23425.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=457

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P+EDL+  LPGQPKV FKQYAGYVD+D+K GRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  27   HPDEDLIVSLPGQPKVEFKQYAGYVDIDVKHGRSLFYYFVEAENVPDKKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLR NS SWNKASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  87   CSSIGGGAFTELGPFYPKGDGRGLRTNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNSG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D+STA+DM +F+++W++KFPSY+SR+LF
Sbjct  147  DSSTATDMLLFLLKWYQKFPSYRSRELF  174



>ref|XP_010110480.1| Serine carboxypeptidase-like 42 [Morus notabilis]
 gb|EXC26581.1| Serine carboxypeptidase-like 42 [Morus notabilis]
Length=442

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQPKV F QYAGYVDVD  AGRSLFYYFVEA+  P  KPLTLWLNGGPG
Sbjct  27   YPVEDLVVKLPGQPKVSFSQYAGYVDVDFNAGRSLFYYFVEADNEPHKKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGL RNS SWN+ASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  87   CSSVGGGAFTELGPFYPTGDGRGLHRNSMSWNRASNLLFVESPAGVGWSYSNTTSDYNSG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA+ A+DM  FM++W +KFP+YKSRDLF
Sbjct  147  DAAAANDMREFMLKWLEKFPTYKSRDLF  174



>ref|XP_010482006.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
Length=473

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP+EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYY+VEA   P  KPLTLWLNGGPG
Sbjct  27   YPDEDLVVRLPGQPTVGFKQYAGYVDVDVKAGRSLFYYYVEAVKQPDTKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNAG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STASDM +F++ W  KFP  KSRDLF
Sbjct  147  DRSTASDMLVFLLRWLDKFPKLKSRDLF  174



>ref|XP_002268397.1| PREDICTED: serine carboxypeptidase-like 42 [Vitis vinifera]
 emb|CBI20040.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   224 bits (570),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +PEEDLV  LPGQPKVGF+Q+ GYVDVD KAGRS+FYYFVEAE +P+ KPLTLWLNGGPG
Sbjct  29   WPEEDLVVRLPGQPKVGFRQFGGYVDVDEKAGRSMFYYFVEAEEDPQNKPLTLWLNGGPG  88

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFT LGPF+P G  RG+RRNSKSWNK SNLLFVESPAGVGWSYSNTS+DY CG
Sbjct  89   CSSVGGGAFTALGPFFPKGHSRGVRRNSKSWNKVSNLLFVESPAGVGWSYSNTSADYNCG  148

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTASDM  FM++WFKKFP YK R LF
Sbjct  149  DASTASDMLTFMLKWFKKFPGYKLRPLF  176



>ref|XP_003527966.2| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Glycine 
max]
Length=473

 Score =   224 bits (570),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P+EDL+  LPGQPKV FKQYAGYVD+D+K GRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  27   HPDEDLIVSLPGQPKVEFKQYAGYVDIDVKHGRSLFYYFVEAENVPDKKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLR NS SWNKASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  87   CSSIGGGAFTELGPFYPKGDGRGLRTNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNSG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D+STA+DM +F+++W++KFPSY+SR+LF
Sbjct  147  DSSTATDMLLFLLKWYQKFPSYRSRELF  174



>ref|XP_003602149.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES72400.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=465

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQPKV F QYAGYVD+D+K GRSLFYYFVEA+  P  KPLTLWLNGGPG
Sbjct  23   YPIEDLVVKLPGQPKVKFSQYAGYVDIDIKHGRSLFYYFVEADHLPHKKPLTLWLNGGPG  82

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP+GDGRGLR+NSKSWN  SN+LFVESPAGVGWSYSNT+SDY  G
Sbjct  83   CSSIGGGAFTELGPFYPSGDGRGLRKNSKSWNTVSNILFVESPAGVGWSYSNTTSDYNIG  142

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA+DM +FM++W++KFPSYKSR LF
Sbjct  143  DASTANDMLLFMLKWYEKFPSYKSRKLF  170



>ref|XP_010442147.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010442148.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010442149.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
Length=465

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP V FKQYAGYVDVD+KAGRSLFYY+VEA   P  KPLTLWLNGGPG
Sbjct  19   YPEEDLVVRLPGQPTVAFKQYAGYVDVDVKAGRSLFYYYVEAVKQPDTKPLTLWLNGGPG  78

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  79   CSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNAG  138

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STASDM +F++ W  KFP  KSRDLF
Sbjct  139  DRSTASDMLVFLLRWLDKFPKLKSRDLF  166



>ref|XP_010479023.1| PREDICTED: serine carboxypeptidase-like 44 [Camelina sativa]
Length=479

 Score =   223 bits (569),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P+EDLV  LPGQP+V F+Q+AGYVD+D+KAGRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  32   FPKEDLVTKLPGQPEVAFRQFAGYVDIDVKAGRSLFYYFVEAEKQPHTKPLTLWLNGGPG  91

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTG+GRGLRRN KSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  92   CSSIGGGAFTELGPFYPTGNGRGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  151

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D +TA DM +FM+ W +KFP +K+R+LF
Sbjct  152  DETTAKDMLVFMLRWLEKFPQFKTRNLF  179



>ref|XP_009136205.1| PREDICTED: serine carboxypeptidase-like 42 [Brassica rapa]
Length=466

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQPKV F+QYAGYV+VD K GRSLFYYFVEA+  P  KPLTLWLNGGPG
Sbjct  26   YPEEDLVVRLPGQPKVEFRQYAGYVNVDSKNGRSLFYYFVEADKQPDTKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D +TASDM +F++ WF KFP  KSRD F
Sbjct  146  DETTASDMVVFLLRWFNKFPELKSRDFF  173



>ref|XP_012066078.1| PREDICTED: serine carboxypeptidase-like 42 [Jatropha curcas]
 gb|KDP43043.1| hypothetical protein JCGZ_25229 [Jatropha curcas]
Length=491

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP +DLV  LPGQPKV F+Q++GYVDVD+K GRSLFYYFVEA+ +P  KPLTLWLNGGPG
Sbjct  45   YPIKDLVVNLPGQPKVAFRQFSGYVDVDVKNGRSLFYYFVEADKDPDKKPLTLWLNGGPG  104

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWN+ASNLLFVESPAGVGWSYSNTS+DY  G
Sbjct  105  CSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTSTDYTTG  164

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA TA DMH+F+++W++KFP +KSR+LF
Sbjct  165  DAKTAKDMHMFLLKWYEKFPEFKSRELF  192



>ref|XP_002865546.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41805.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP VGF+QYAGYVDVD+KAGRSLFYY+VEA   P  KPLTLWLNGGPG
Sbjct  27   YPEEDLVVRLPGQPTVGFRQYAGYVDVDVKAGRSLFYYYVEAVKQPDTKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN S+DY  G
Sbjct  87   CSSIGGGAFTELGPFYPTGDGRGLRVNSLSWNKASNLLFVESPAGVGWSYSNRSTDYNTG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D +TA DM +F++ WF KFP  KSRDLF
Sbjct  147  DKTTARDMLVFLLRWFDKFPKSKSRDLF  174



>ref|XP_004515138.1| PREDICTED: serine carboxypeptidase-like 42-like [Cicer arietinum]
Length=470

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQPKV F QYAGYVD+D+K G+SLFYYFVEA+ +P  KPLTLWLNGGPG
Sbjct  28   YPMEDLVVRLPGQPKVKFSQYAGYVDIDVKHGKSLFYYFVEADHHPHKKPLTLWLNGGPG  87

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP+GDGRGLRRNSKSWN+ SNLLFVESPAGVGWSYSNT+SDY   
Sbjct  88   CSSIGGGAFTELGPFYPSGDGRGLRRNSKSWNRVSNLLFVESPAGVGWSYSNTTSDYDSD  147

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA+DM +FM++W++KFPSY SR LF
Sbjct  148  DASTANDMVLFMLKWYEKFPSYVSRGLF  175



>ref|XP_006307408.1| hypothetical protein CARUB_v10009034mg [Capsella rubella]
 gb|EOA40306.1| hypothetical protein CARUB_v10009034mg [Capsella rubella]
Length=473

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +PEEDLV  LPGQP+V F+QYAGYVD+D+KAGRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  26   FPEEDLVTKLPGQPEVAFRQYAGYVDIDVKAGRSLFYYFVEAEKEPHTKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTG+G GLRRN KSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  86   CSSIGGGAFTELGPFYPTGNGLGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYNTG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA DM +FM+ W +KFP +K+R+LF
Sbjct  146  DEKTAKDMLMFMLRWLEKFPQFKTRNLF  173



>ref|NP_175046.1| serine carboxypeptidase-like 44 [Arabidopsis thaliana]
 sp|Q9MAR8.1|SCP44_ARATH RecName: Full=Serine carboxypeptidase-like 44; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF63101.1|AC006423_2 Putative serine carboxypeptidases [Arabidopsis thaliana]
 gb|AEE31996.1| serine carboxypeptidase-like 44 [Arabidopsis thaliana]
Length=479

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P +DLV  LPGQP+V F+Q+AGYVD+D+KAGRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  32   FPVQDLVTKLPGQPEVAFRQFAGYVDIDVKAGRSLFYYFVEAEKQPHSKPLTLWLNGGPG  91

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTGD RGLRRN KSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  92   CSSIGGGAFTELGPFYPTGDARGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  151

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM +FM+ W +KFP +K+R+LF
Sbjct  152  DESTAKDMLVFMLRWLEKFPQFKTRNLF  179



>ref|XP_009107653.1| PREDICTED: serine carboxypeptidase-like 44 isoform X4 [Brassica 
rapa]
Length=449

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            EEDLV  LPGQP+V F+Q+AGYVDVD+KAGRSLFYYFVEAE     KPLTLWLNGGPGCS
Sbjct  4    EEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQQHTKPLTLWLNGGPGCS  63

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDA  688
            S+GGGAFTELGPFYP GDGRGLRRNSKSWNKASNLLFV+SPAGVGWSYSNT+SDY  GD 
Sbjct  64   SIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTGDE  123

Query  689  STASDMHIFMVEWFKKFPSYKSRDLF  766
            STA DM +F++ W +KFP +++R+LF
Sbjct  124  STAKDMLVFLLRWLEKFPEFRTRNLF  149



>ref|XP_007137531.1| hypothetical protein PHAVU_009G134900g [Phaseolus vulgaris]
 gb|ESW09525.1| hypothetical protein PHAVU_009G134900g [Phaseolus vulgaris]
Length=472

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDL++ LPGQP VGFKQ+AGYVDVD+K GRSLFYYFVEA+ +   KPLTLWLNGGPG
Sbjct  27   YPAEDLIERLPGQPNVGFKQFAGYVDVDVKHGRSLFYYFVEADNDHHNKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWN+ASNLLF+ESPAGVGWSYSNT+SDY  G
Sbjct  87   CSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNRASNLLFLESPAGVGWSYSNTTSDYSSG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA+D  +F+++W++KFPSY+SR+LF
Sbjct  147  DASTANDTLLFLLKWYEKFPSYRSRELF  174



>emb|CDY51660.1| BnaC03g66990D [Brassica napus]
Length=441

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEE+LV  LPGQPKV F+QYAGYV+VD K GRSLFYYFVEA   P  KPLTLWLNGGPG
Sbjct  19   YPEEELVVRLPGQPKVLFRQYAGYVEVDSKTGRSLFYYFVEAATQPETKPLTLWLNGGPG  78

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  79   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  138

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D +TA DM +F++ WF KFP  KSRD F
Sbjct  139  DETTAKDMLVFLMRWFSKFPELKSRDFF  166



>ref|XP_002891272.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67531.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=479

 Score =   221 bits (562),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQP+V F+Q+AGYVD+D+KAGRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  32   FPIEDLVTKLPGQPEVAFRQFAGYVDIDVKAGRSLFYYFVEAEKQPHSKPLTLWLNGGPG  91

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP G+GRGLRRN KSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  92   CSSIGGGAFTELGPFYPIGNGRGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  151

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM +FM+ W +KFP +K+R+LF
Sbjct  152  DESTAKDMLVFMLRWLEKFPQFKTRNLF  179



>ref|XP_009586680.1| PREDICTED: serine carboxypeptidase-like 42 [Nicotiana tomentosiformis]
Length=470

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV+ LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGGPG
Sbjct  25   HPIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDADKLPLTLWLNGGPG  84

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P GDGRGLRRN+KSWNKASNLLF+ESPAGVGWSYSNTSSDY CG
Sbjct  85   CSSIGGGAFTELGPFFPRGDGRGLRRNTKSWNKASNLLFIESPAGVGWSYSNTSSDYTCG  144

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM  FM+ W+ KF   KS+ LF
Sbjct  145  DDSTAKDMLTFMIRWYAKFSELKSKPLF  172



>ref|XP_006351861.1| PREDICTED: serine carboxypeptidase-like 42-like [Solanum tuberosum]
Length=478

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGGPG
Sbjct  26   YPIEDLVDNLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDAHKLPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P GDG GLRRN+KSWNKASNLLF+ESPAGVGWSYSNTSSDY CG
Sbjct  86   CSSIGGGAFTELGPFFPRGDGHGLRRNTKSWNKASNLLFIESPAGVGWSYSNTSSDYTCG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM  FM++W++KF   KSR LF
Sbjct  146  DESTAKDMLNFMLKWYEKFSELKSRPLF  173



>ref|NP_178937.2| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
 sp|Q84W27.1|SCP43_ARATH RecName: Full=Serine carboxypeptidase-like 43; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAO42304.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC06202.1| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
Length=442

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP VGF+Q+AGYVDVD + GRSLFYY+VEA   P  KPLTLWLNGGPG
Sbjct  26   YPEEDLVARLPGQPNVGFRQFAGYVDVDSENGRSLFYYYVEAVKEPDTKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPTGDGRGLRLNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D ST +DM +F++ WF KFP  KSRDLF
Sbjct  146  DKSTVNDMLVFLLRWFNKFPELKSRDLF  173



>ref|NP_001031351.1| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
 gb|AEC06203.1| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
Length=443

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP VGF+Q+AGYVDVD + GRSLFYY+VEA   P  KPLTLWLNGGPG
Sbjct  26   YPEEDLVARLPGQPNVGFRQFAGYVDVDSENGRSLFYYYVEAVKEPDTKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPTGDGRGLRLNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D ST +DM +F++ WF KFP  KSRDLF
Sbjct  146  DKSTVNDMLVFLLRWFNKFPELKSRDLF  173



>ref|XP_006299245.1| hypothetical protein CARUB_v10015394mg [Capsella rubella]
 gb|EOA32143.1| hypothetical protein CARUB_v10015394mg [Capsella rubella]
Length=459

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPE+DLV  LPGQPKVGF+Q+AGYV+VD + GRSLFYY+VEA   P  KPLTLWLNGGPG
Sbjct  17   YPEDDLVARLPGQPKVGFRQFAGYVNVDSENGRSLFYYYVEAVKEPETKPLTLWLNGGPG  76

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  77   CSSVGGGAFTELGPFYPTGDGRGLRVNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  136

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA+DM +F++ WFK+FP  KSR+LF
Sbjct  137  DKSTANDMLVFLLRWFKRFPELKSRELF  164



>gb|AAD28662.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=468

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQP VGF+Q+AGYVDVD + GRSLFYY+VEA   P  KPLTLWLNGGPG
Sbjct  26   YPEEDLVARLPGQPNVGFRQFAGYVDVDSENGRSLFYYYVEAVKEPDTKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPTGDGRGLRLNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D ST +DM +F++ WF KFP  KSRDLF
Sbjct  146  DKSTVNDMLVFLLRWFNKFPELKSRDLF  173



>ref|XP_004148827.1| PREDICTED: serine carboxypeptidase-like 42 [Cucumis sativus]
Length=480

 Score =   218 bits (556),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P +DLV  LPGQP VGF+Q+AGYVDVD+ AGRSLFYYF EA+ +P L PLTLWLNGGPG
Sbjct  34   FPAQDLVDRLPGQPTVGFRQFAGYVDVDVNAGRSLFYYFAEAQQDPHLLPLTLWLNGGPG  93

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSN +SDY CG
Sbjct  94   CSSVGGGAFTELGPFYPKGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNRTSDYTCG  153

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM  FM++W+ KFP++K R  F
Sbjct  154  DDSTARDMLTFMLKWYDKFPAFKDRSFF  181



>ref|XP_002865553.1| hypothetical protein ARALYDRAFT_494807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41812.1| hypothetical protein ARALYDRAFT_494807 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPE DLV  LPGQ KV F+QYAGYVD+D+ AGRSLFYYFVEAE +P  KPLTLWLNGGPG
Sbjct  27   YPEADLVVRLPGQLKVAFRQYAGYVDLDMNAGRSLFYYFVEAEEHPDTKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS  GGAFTELGPFYPTGDG GLR NS SWNKASNLLFVESP GVGWSYSN SSDY  G
Sbjct  87   CSSGCGGAFTELGPFYPTGDGGGLRVNSMSWNKASNLLFVESPVGVGWSYSNRSSDYNTG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STASDM +F++ WF KFP +KSRD F
Sbjct  147  DKSTASDMLVFLLGWFDKFPEFKSRDFF  174



>ref|XP_003615811.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES98769.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=470

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQPKV F QYAGYVD+D+K GRSLFYYFVEA+  P+ KPLTLWLNGGPG
Sbjct  24   YPIEDLVVSLPGQPKVEFSQYAGYVDIDVKHGRSLFYYFVEADHKPQNKPLTLWLNGGPG  83

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P GDGRGLR NS SWN+ASNLLF+ESPAGVGWSYSNT+SDY  G
Sbjct  84   CSSIGGGAFTELGPFFPAGDGRGLRTNSMSWNRASNLLFIESPAGVGWSYSNTTSDYNIG  143

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA+DM  F ++WF+KFP+YKSR LF
Sbjct  144  DASTANDMLSFFLKWFEKFPTYKSRALF  171



>ref|XP_011027377.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
42 [Populus euphratica]
Length=480

 Score =   218 bits (555),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP +DLV  LPGQPK GF+QYAGYVDVD+K GRSLFYYFVEA+ +P  KPL LWLNGGPG
Sbjct  34   YPAKDLVLNLPGQPKAGFRQYAGYVDVDVKNGRSLFYYFVEADKDPDQKPLALWLNGGPG  93

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTE+ PF+P+ DGRGLRRNS SWN+ASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  94   CSSIGGGAFTEVXPFFPSRDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTTSDYTTG  153

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA TA DMH+F+++W++KFP +KSR+LF
Sbjct  154  DAKTAEDMHMFLLKWYEKFPDFKSRELF  181



>ref|XP_002526159.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF36235.1| serine carboxypeptidase, putative [Ricinus communis]
Length=476

 Score =   218 bits (555),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQPKVGF+QYAGY+DVD+  GRSL+YYFVEA+ +P  KPL LWLNGGPG
Sbjct  30   YPVEDLVVNLPGQPKVGFRQYAGYIDVDVNNGRSLYYYFVEADKDPDNKPLALWLNGGPG  89

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P G+GRGLR NS SWN+ASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  90   CSSIGGGAFTELGPFFPKGNGRGLRINSMSWNRASNLLFVESPAGVGWSYSNTTSDYTTG  149

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA TA DMHIF+++W++KFP  KSR+LF
Sbjct  150  DAKTAKDMHIFLLKWYEKFPELKSRELF  177



>gb|ADE76785.1| unknown [Picea sitchensis]
Length=240

 Score =   211 bits (537),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            EEDLV+ LPGQP+V FKQYAGY++VD +AGR+LFYYFVEAE +    PL LWLNGGPGCS
Sbjct  46   EEDLVERLPGQPEVDFKQYAGYINVDDEAGRALFYYFVEAEKDSHSMPLALWLNGGPGCS  105

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDA  688
            S+GGGAF ELGPFYP GDGRGL  NS+SWNK SNLLFVESPAGVGWSYSNTSSDY CGDA
Sbjct  106  SIGGGAFMELGPFYPRGDGRGLITNSQSWNKVSNLLFVESPAGVGWSYSNTSSDYTCGDA  165

Query  689  STASDMHIFMVEWFKKFPSYKSRDLF  766
            STA+DM +F+ +WF+KFP Y+SR  F
Sbjct  166  STAADMQVFLFKWFEKFPEYRSRGFF  191



>emb|CDY23340.1| BnaA08g12060D [Brassica napus]
Length=469

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEE+LV  LPGQPKV F+QYAGYV+VD K GRSLFYYFVEA   P  KPLTLWLNGGPG
Sbjct  29   YPEEELVVRLPGQPKVLFRQYAGYVEVDSKTGRSLFYYFVEAATQPETKPLTLWLNGGPG  88

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGLR N  SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  89   CSSVGGGAFTELGPFYPTGDGRGLRINPMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  148

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D +TA DM +F++ WF KFP  K+RD F
Sbjct  149  DETTAKDMLVFLIRWFSKFPELKARDFF  176



>ref|XP_009123167.1| PREDICTED: serine carboxypeptidase-like 42 [Brassica rapa]
Length=469

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEE+LV  LPGQPKV F+QYAGYV+VD K GRSLFYYFVEA   P  KPLTLWLNGGPG
Sbjct  29   YPEEELVVRLPGQPKVLFRQYAGYVEVDSKTGRSLFYYFVEAATQPETKPLTLWLNGGPG  88

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGLR N  SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  89   CSSVGGGAFTELGPFYPTGDGRGLRINPMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  148

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D +TA DM +F++ WF KFP  K+RD F
Sbjct  149  DETTAKDMLVFLMRWFSKFPELKARDFF  176



>ref|XP_010425083.1| PREDICTED: serine carboxypeptidase-like 43 [Camelina sativa]
Length=268

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPE+DLV  LPGQPKVGF+Q+AGY++VD + GRSLFYY+VEA   P  KPLTLWLNGGPG
Sbjct  20   YPEDDLVVRLPGQPKVGFRQFAGYINVDSENGRSLFYYYVEAVKEPDTKPLTLWLNGGPG  79

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFV+SPAGVGWSYSN SSDY  G
Sbjct  80   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVKSPAGVGWSYSNRSSDYNTG  139

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D ST +DM +F++ WFK+FP  KSR+LF
Sbjct  140  DKSTTNDMLVFLLRWFKRFPELKSRNLF  167



>ref|XP_009112251.1| PREDICTED: serine carboxypeptidase-like 42 [Brassica rapa]
Length=469

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQPKV F+QYAGYVDVD +  RSLFYYFVEA+  P  KPLTLWLN GPG
Sbjct  29   YPEEDLVVRLPGQPKVLFRQYAGYVDVDSETCRSLFYYFVEADTQPETKPLTLWLNRGPG  88

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGD RGLR NS SWNKASNLLFV+SPAGVGWSYSNTSSDY  G
Sbjct  89   CSSVGGGAFTELGPFYPTGDDRGLRINSMSWNKASNLLFVDSPAGVGWSYSNTSSDYNAG  148

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D +TASDM +F++ WF KFP  K+R LF
Sbjct  149  DETTASDMLVFLLRWFNKFPELKARHLF  176



>ref|NP_199038.1| serine carboxypeptidase-like 41 [Arabidopsis thaliana]
 sp|Q9FH06.1|SCP41_ARATH RecName: Full=Serine carboxypeptidase-like 41; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB10196.1| serine carboxypeptidase-II like [Arabidopsis thaliana]
 gb|AAO22761.1| putative serine carboxypeptidase-II [Arabidopsis thaliana]
 gb|AAO42380.1| putative serine carboxypeptidase-II [Arabidopsis thaliana]
 gb|AED94783.1| serine carboxypeptidase-like 41 [Arabidopsis thaliana]
Length=469

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPE DLV  LPGQPKV F+QYAGYVD+DL AGRSLFYYFVEAE +P  KPLTLWLNGGPG
Sbjct  23   YPETDLVVRLPGQPKVVFRQYAGYVDLDLNAGRSLFYYFVEAEKHPDTKPLTLWLNGGPG  82

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTG GRGLR NS SWNKASNLLFV+SPAGVGWSYSN SSDY  G
Sbjct  83   CSSVGGGAFTELGPFYPTGYGRGLRINSMSWNKASNLLFVDSPAGVGWSYSNRSSDYNAG  142

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D S ASDM +F++ WF KFP  KS DLF
Sbjct  143  DKSAASDMLVFLLRWFDKFPELKSHDLF  170



>ref|XP_009767156.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nicotiana 
sylvestris]
Length=445

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV+ LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGGPG
Sbjct  30   HPIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDADKLPLTLWLNGGPG  89

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P GDGRGLRRN+KSWNKASNLLF+ESPAGVGWSYSNTSSDY CG
Sbjct  90   CSSIGGGAFTELGPFFPRGDGRGLRRNTKSWNKASNLLFIESPAGVGWSYSNTSSDYTCG  149

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA DM  FM+ W++KF   KS+ LF
Sbjct  150  DDPTAKDMLTFMLRWYEKFSELKSKPLF  177



>emb|CDY37202.1| BnaA09g08230D [Brassica napus]
Length=456

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQPKV F+QYAGYVDVD +  RSLFYYFVEA+  P  KPLTLWLN GPG
Sbjct  29   YPEEDLVVRLPGQPKVLFRQYAGYVDVDSETCRSLFYYFVEADTQPETKPLTLWLNRGPG  88

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGD RGLR NS SWNKASNLLFV+SPAGVGWSYSNTSSDY  G
Sbjct  89   CSSVGGGAFTELGPFYPTGDDRGLRINSMSWNKASNLLFVDSPAGVGWSYSNTSSDYNTG  148

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D +TASDM +F++ WF KFP  K+R LF
Sbjct  149  DETTASDMLVFLLRWFNKFPELKARHLF  176



>ref|XP_010496048.1| PREDICTED: serine carboxypeptidase-like 43 [Camelina sativa]
Length=329

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPE+DLV  LPGQPKVGF+ +AGY++VD + GRSLFYY+VEA   P  KPLTLWLNGGPG
Sbjct  21   YPEDDLVVVLPGQPKVGFRPFAGYINVDSENGRSLFYYYVEAVKEPDTKPLTLWLNGGPG  80

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  81   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  140

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM +F++ WFK+FP  KSR+LF
Sbjct  141  DKSTADDMLVFLLRWFKRFPELKSRNLF  168



>ref|XP_009767155.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nicotiana 
sylvestris]
Length=475

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV+ LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGGPG
Sbjct  30   HPIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDADKLPLTLWLNGGPG  89

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P GDGRGLRRN+KSWNKASNLLF+ESPAGVGWSYSNTSSDY CG
Sbjct  90   CSSIGGGAFTELGPFFPRGDGRGLRRNTKSWNKASNLLFIESPAGVGWSYSNTSSDYTCG  149

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA DM  FM+ W++KF   KS+ LF
Sbjct  150  DDPTAKDMLTFMLRWYEKFSELKSKPLF  177



>ref|NP_001183841.1| hypothetical protein precursor [Zea mays]
 gb|ACR38507.1| unknown [Zea mays]
 tpg|DAA38901.1| TPA: hypothetical protein ZEAMMB73_424549 [Zea mays]
Length=473

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQP V F+Q+AGYVDVD+KAGRSLFYYF EA+ N   KPLTLWLNGGPG
Sbjct  26   FPAEDLVTRLPGQPPVTFRQFAGYVDVDVKAGRSLFYYFAEAQENAAAKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLR N KSWNKASNLLFVESPAGVGWSYSNTSSDYI G
Sbjct  86   CSSIGGGAFTELGPFYPRGDGRGLRLNKKSWNKASNLLFVESPAGVGWSYSNTSSDYITG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA TA+DM  F++ W+ KFP Y+SR LF
Sbjct  146  DARTANDMLRFLLGWYAKFPEYRSRALF  173



>ref|XP_010315079.1| PREDICTED: serine carboxypeptidase-like 42 isoform X4 [Solanum 
lycopersicum]
Length=345

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV+ LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGGPG
Sbjct  25   YPIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDAHNLPLTLWLNGGPG  84

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P GDG GLRRN+KSWNK SNLLF+ESP GVGWSYSNTSSDY  G
Sbjct  85   CSSIGGGAFTELGPFFPRGDGHGLRRNTKSWNKVSNLLFIESPVGVGWSYSNTSSDYTSG  144

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM  FM++W++KF   KSR LF
Sbjct  145  DESTAKDMLNFMLKWYEKFSELKSRPLF  172



>ref|XP_010315078.1| PREDICTED: serine carboxypeptidase-like 42 isoform X3 [Solanum 
lycopersicum]
Length=346

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV+ LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGGPG
Sbjct  25   YPIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDAHNLPLTLWLNGGPG  84

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P GDG GLRRN+KSWNK SNLLF+ESP GVGWSYSNTSSDY  G
Sbjct  85   CSSIGGGAFTELGPFFPRGDGHGLRRNTKSWNKVSNLLFIESPVGVGWSYSNTSSDYTSG  144

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM  FM++W++KF   KSR LF
Sbjct  145  DESTAKDMLNFMLKWYEKFSELKSRPLF  172



>ref|XP_010468548.1| PREDICTED: serine carboxypeptidase-like 43 [Camelina sativa]
Length=462

 Score =   215 bits (548),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPE+DLV  LPGQPKVGF+Q+AGY++VD + GRSLFYY+VEA   P  KPLTLWLNGGPG
Sbjct  22   YPEDDLVVRLPGQPKVGFRQFAGYINVDSENGRSLFYYYVEAVKEPDTKPLTLWLNGGPG  81

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  82   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  141

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA+DM +F++ WFK+FP  KSR+LF
Sbjct  142  DKSTANDMLMFLLRWFKRFPELKSRNLF  169



>ref|XP_006279617.1| hypothetical protein CARUB_v10026338mg [Capsella rubella]
 gb|EOA12515.1| hypothetical protein CARUB_v10026338mg [Capsella rubella]
Length=472

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPE DLV  LPGQPKV F+QYAGYV+VDL  GRSLFYY+VEAE +P  KPLTLWLNGGPG
Sbjct  26   YPEADLVVRLPGQPKVTFRQYAGYVEVDLSVGRSLFYYYVEAETHPDTKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGG FTELGPFYPTGDGRGLR N+ SWNKASNLLFVESPAGVGWSYSN +SDY  G
Sbjct  86   CSSVGGGGFTELGPFYPTGDGRGLRINTMSWNKASNLLFVESPAGVGWSYSNRTSDYNAG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D S  SDM +F++ WF KFP+ KS DLF
Sbjct  146  DESATSDMLLFLLRWFDKFPALKSHDLF  173



>ref|XP_002863806.1| hypothetical protein ARALYDRAFT_331179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40065.1| hypothetical protein ARALYDRAFT_331179 [Arabidopsis lyrata subsp. 
lyrata]
Length=472

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPE D V  LPGQP V F+QYAGYVD+D   GRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  26   YPEADFVVKLPGQPMVTFRQYAGYVDIDKVVGRSLFYYFVEAEKRPDTKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFV+SPAGVGWSYSN SSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVDSPAGVGWSYSNRSSDYNAG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D S ASDM +F++ WF KFP  KSRDLF
Sbjct  146  DESAASDMLVFLLRWFDKFPELKSRDLF  173



>gb|EPS60190.1| hypothetical protein M569_14612, partial [Genlisea aurea]
Length=297

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            P  DLV+ LPGQP V F+QYAGYVDVD   GRSLFYYFVEA  +P  KPLTLWLNGGPGC
Sbjct  22   PAGDLVRNLPGQPPVKFRQYAGYVDVDAIKGRSLFYYFVEAAEDPHRKPLTLWLNGGPGC  81

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  685
            SSVGGGAFTELGPF+P GDGRGL  NS SWN+ASNLLFVESPAGVGWSYSNTSSDY  GD
Sbjct  82   SSVGGGAFTELGPFFPRGDGRGLVSNSNSWNRASNLLFVESPAGVGWSYSNTSSDYNTGD  141

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
            A+TA D+ +F+ EW KKFP++++RDLF
Sbjct  142  ANTARDLRVFLTEWLKKFPAFQNRDLF  168



>ref|XP_009406489.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQPKVGF+QYAGYVDVD KAGR+LFYYF EA+ +   KPLTLWLNGGPG
Sbjct  25   YPEEDLVVRLPGQPKVGFRQYAGYVDVDEKAGRTLFYYFAEADGDAHAKPLTLWLNGGPG  84

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPF+P GDGRGLR N  SWNK SNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  85   CSSVGGGAFTELGPFFPRGDGRGLRLNKMSWNKVSNLLFVESPAGVGWSYSNTTSDYNCG  144

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA+DM+ F++ W+ KFP ++ ++LF
Sbjct  145  DESTANDMYKFLLRWYDKFPEFRLKNLF  172



>gb|KEH35413.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=477

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP ED +  LPGQPKV FKQYAGY+D+D++ GRSLFYYFVEA+ +P  KPLTLWLNGGPG
Sbjct  28   YPIEDFIVKLPGQPKVEFKQYAGYIDIDVRHGRSLFYYFVEADHDPHKKPLTLWLNGGPG  87

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-  679
            CSS+GGGAFTELGPFYPTGDGRGLRRN KSWN+ASNLLFVESPAGVGWSYSNT+SDY   
Sbjct  88   CSSIGGGAFTELGPFYPTGDGRGLRRNKKSWNRASNLLFVESPAGVGWSYSNTTSDYNNY  147

Query  680  GDASTASDMHIFMVEWFKKFPSYKSRDLF  766
             D STA+D  +FM++W++KFPSY+SR LF
Sbjct  148  DDTSTANDTLLFMLKWYEKFPSYRSRGLF  176



>ref|XP_004977164.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Setaria 
italica]
Length=476

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRL-KPLTLWLNggp  499
            YPE DLV+GLPGQP V F+Q+AGYVDVD +AGRSLFYY  EA+      KPLTLWLNGGP
Sbjct  30   YPESDLVRGLPGQPPVAFRQFAGYVDVDERAGRSLFYYLAEADGAAAASKPLTLWLNGGP  89

Query  500  gcssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC  679
            GCSSVGGGAFTELGPFYP GDGRGLR N KSWNK SNLLFVESPAGVGWSYSNTSSDY  
Sbjct  90   GCSSVGGGAFTELGPFYPRGDGRGLRINDKSWNKVSNLLFVESPAGVGWSYSNTSSDYKT  149

Query  680  GDASTASDMHIFMVEWFKKFPSYKSRDLF  766
            GDA TASDMHIF+++W++KFP YKSRDLF
Sbjct  150  GDARTASDMHIFLLKWYEKFPEYKSRDLF  178



>ref|XP_003577714.1| PREDICTED: serine carboxypeptidase-like 42 [Brachypodium distachyon]
Length=472

 Score =   213 bits (541),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +PEEDLV+ LPGQP VGF+Q++GYVDVD KAGRSLFYYF EA+     KPLTLWLNGGPG
Sbjct  27   FPEEDLVRRLPGQPVVGFRQFSGYVDVDEKAGRSLFYYFTEAQEGAAGKPLTLWLNGGPG  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLR N KSWNK SNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87   CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGWSYSNTSSDYKTG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA DM+ F++ W+KKFP Y+SR LF
Sbjct  147  DTRTADDMYRFLLGWYKKFPEYRSRSLF  174



>ref|XP_006858474.1| PREDICTED: serine carboxypeptidase-like 42 [Amborella trichopoda]
 gb|ERN19941.1| hypothetical protein AMTR_s00071p00113850 [Amborella trichopoda]
Length=474

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            P EDLV  LPGQPKV FKQYAGYV+VD KAGRSLFYYF EA+ +   KPLTLWLNGGPGC
Sbjct  29   PVEDLVHRLPGQPKVDFKQYAGYVNVDEKAGRSLFYYFAEADGDADKKPLTLWLNGGPGC  88

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  685
            SS+GGGAFTELGPF+P GDGRGL RN KSWN+ SNLLFVESPAGVGWSYSNT++DY CGD
Sbjct  89   SSIGGGAFTELGPFFPRGDGRGLIRNKKSWNRVSNLLFVESPAGVGWSYSNTTADYTCGD  148

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
            ASTA DM  F++ W  KFP YK+RDLF
Sbjct  149  ASTAKDMLRFLLGWIHKFPEYKTRDLF  175



>ref|XP_004230572.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Solanum 
lycopersicum]
Length=477

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV+ LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGGPG
Sbjct  25   YPIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDAHNLPLTLWLNGGPG  84

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P GDG GLRRN+KSWNK SNLLF+ESP GVGWSYSNTSSDY  G
Sbjct  85   CSSIGGGAFTELGPFFPRGDGHGLRRNTKSWNKVSNLLFIESPVGVGWSYSNTSSDYTSG  144

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM  FM++W++KF   KSR LF
Sbjct  145  DESTAKDMLNFMLKWYEKFSELKSRPLF  172



>ref|XP_010315077.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Solanum 
lycopersicum]
Length=478

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV+ LPGQPKVGF+QYAGYVDVD KAGRSLFYYFVEAE +    PLTLWLNGGPG
Sbjct  25   YPIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDAHNLPLTLWLNGGPG  84

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P GDG GLRRN+KSWNK SNLLF+ESP GVGWSYSNTSSDY  G
Sbjct  85   CSSIGGGAFTELGPFFPRGDGHGLRRNTKSWNKVSNLLFIESPVGVGWSYSNTSSDYTSG  144

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM  FM++W++KF   KSR LF
Sbjct  145  DESTAKDMLNFMLKWYEKFSELKSRPLF  172



>ref|XP_006383613.1| hypothetical protein POPTR_0005s21010g [Populus trichocarpa]
 gb|ERP61410.1| hypothetical protein POPTR_0005s21010g [Populus trichocarpa]
Length=348

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQPKVGF+Q+AGYVDVD++  RSLFYYF+EAE +P  KPL LWLNGGP 
Sbjct  27   YPAEDLVLNLPGQPKVGFRQHAGYVDVDVRNVRSLFYYFLEAEKDPDQKPLALWLNGGPS  86

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPF+P GDGR LRRNS SWN+A NLLF+ES AGVGWSYSNTSSDY  G
Sbjct  87   CSSIGGGAFTELGPFFPRGDGRDLRRNSMSWNRAFNLLFIESSAGVGWSYSNTSSDYTIG  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA TA DMH+F ++ + KFP +KSR+LF
Sbjct  147  DAKTAKDMHMFFLKLYDKFPEFKSRELF  174



>ref|XP_004979109.1| PREDICTED: serine carboxypeptidase-like 42-like [Setaria italica]
Length=473

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQP V F+Q+AGYVDVD+KAGRSLFYYF EA+ +   KPLTLWLNGGPG
Sbjct  28   FPAEDLVARLPGQPPVTFRQFAGYVDVDVKAGRSLFYYFAEAQEDAAAKPLTLWLNGGPG  87

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLR N KSWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  88   CSSIGGGAFTELGPFYPRGDGRGLRLNKKSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  147

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA DM+ F++ W+KKFP Y+SR LF
Sbjct  148  DVRTADDMYRFLLGWYKKFPEYRSRALF  175



>ref|XP_009414969.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414970.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414971.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414972.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            PEEDLV  LPGQPKVGF+QYAG+VDVD+KAGRSLFYY  EA+ +   KPLTLWLNGGPGC
Sbjct  26   PEEDLVVRLPGQPKVGFRQYAGHVDVDVKAGRSLFYYLAEADGDAHKKPLTLWLNGGPGC  85

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  685
            SSVGGGAFTELGPFYP GDGRGLR N  SWNK SNLLFVESPAGVGWSYSNT+SDY   D
Sbjct  86   SSVGGGAFTELGPFYPRGDGRGLRINKMSWNKVSNLLFVESPAGVGWSYSNTTSDYNRDD  145

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
             STA+DM+IF++ W+ KFP ++SRDLF
Sbjct  146  ESTANDMYIFLLRWYDKFPEFRSRDLF  172



>ref|XP_002449388.1| hypothetical protein SORBIDRAFT_05g009120 [Sorghum bicolor]
 gb|EES08376.1| hypothetical protein SORBIDRAFT_05g009120 [Sorghum bicolor]
Length=476

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQP V F+Q+AGYVDVD+KAGRSLFYYF EA+ +   KPLTLWLNGGPG
Sbjct  31   FPAEDLVTRLPGQPPVTFRQFAGYVDVDVKAGRSLFYYFAEAQQDAAAKPLTLWLNGGPG  90

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLR N KSWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  91   CSSIGGGAFTELGPFYPRGDGRGLRLNKKSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  150

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA+DM+ F++ W+ KFP Y+SR LF
Sbjct  151  DVQTANDMYQFLLGWYVKFPEYRSRALF  178



>gb|AFW60601.1| hypothetical protein ZEAMMB73_172356 [Zea mays]
Length=382

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQP V F+Q+AGYVDVD KAGRSLFYYF EA  +   KPLTLWLNGGPG
Sbjct  26   FPAEDLVARLPGQPPVTFRQFAGYVDVDAKAGRSLFYYFAEAREDAAAKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLR N KSWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNRASNLLFVESPAGVGWSYSNTSSDYSTG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA DM+ F++ W+ KFP Y+SR LF
Sbjct  146  DVRTAHDMYQFLLGWYAKFPEYRSRALF  173



>gb|KGN47484.1| hypothetical protein Csa_6G338160 [Cucumis sativus]
Length=806

 Score =   216 bits (549),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 118/148 (80%), Gaps = 6/148 (4%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P +DLV  LPGQP VGF+Q+AGYVDVD+ AGRSLFYYF EA+ +P L PLTLWLNG  G
Sbjct  34   FPAQDLVDRLPGQPTVGFRQFAGYVDVDVNAGRSLFYYFAEAQQDPHLLPLTLWLNGVGG  93

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
                   AFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSN +SDY CG
Sbjct  94   G------AFTELGPFYPKGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNRTSDYTCG  147

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA DM  FM++W+ KFP++K R  F
Sbjct  148  DDSTARDMLTFMLKWYDKFPAFKDRSFF  175



>ref|XP_008677381.1| PREDICTED: serine carboxypeptidase F13S12.6 isoform X1 [Zea mays]
Length=490

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQP V F+Q+AGYVDVD KAGRSLFYYF EA  +   KPLTLWLNGGPG
Sbjct  26   FPAEDLVARLPGQPPVTFRQFAGYVDVDAKAGRSLFYYFAEAREDAAAKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLR N KSWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNRASNLLFVESPAGVGWSYSNTSSDYSTG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA DM+ F++ W+ KFP Y+SR LF
Sbjct  146  DVRTAHDMYQFLLGWYAKFPEYRSRALF  173



>ref|XP_002885858.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62117.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=451

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEED+V  LPGQPKVGF+Q+AGYVDVD + GRSLFYY+VEA   P  KPLTLWLNGGPG
Sbjct  35   YPEEDMVVRLPGQPKVGFRQFAGYVDVDSENGRSLFYYYVEAVKEPDTKPLTLWLNGGPG  94

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGG FT+LGPFYPTGDGRGLR NS SWNKASNLLFVESPA VGWSYSN SS+Y  G
Sbjct  95   CSSVGGGDFTKLGPFYPTGDGRGLRLNSMSWNKASNLLFVESPAVVGWSYSNRSSNYNTG  154

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA+DM +F++ WF KF   KSRDLF
Sbjct  155  DKSTANDMLVFLLRWFNKFQELKSRDLF  182



>gb|AFW60600.1| serine carboxypeptidase F13S12.6 [Zea mays]
Length=471

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQP V F+Q+AGYVDVD KAGRSLFYYF EA  +   KPLTLWLNGGPG
Sbjct  26   FPAEDLVARLPGQPPVTFRQFAGYVDVDAKAGRSLFYYFAEAREDAAAKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLR N KSWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNRASNLLFVESPAGVGWSYSNTSSDYSTG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA DM+ F++ W+ KFP Y+SR LF
Sbjct  146  DVRTAHDMYQFLLGWYAKFPEYRSRALF  173



>ref|NP_001067496.1| Os11g0213600 [Oryza sativa Japonica Group]
 gb|ABA92134.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27859.1| Os11g0213600 [Oryza sativa Japonica Group]
Length=465

 Score =   207 bits (528),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +PEEDLV  LPGQP VGF+Q+AGYVDVD KAGRSLFYYF EA      KPLTLWLNGGPG
Sbjct  20   FPEEDLVARLPGQPVVGFRQFAGYVDVDEKAGRSLFYYFAEAAEGAAAKPLTLWLNGGPG  79

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLR N KSWNK SNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  80   CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGWSYSNTSSDYNTG  139

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA TA+DM+ F++ W+KKFP Y+SR L 
Sbjct  140  DAQTANDMYKFLLGWYKKFPEYRSRGLL  167



>gb|ACM17527.1| putative serine carboxy peptidase [Oryza australiensis]
Length=466

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +PEEDLV  LPGQP VGF+Q+AGYVDVD KAGRSLFYYF EA      KPLTLWLNGGPG
Sbjct  26   FPEEDLVARLPGQPVVGFRQFAGYVDVDEKAGRSLFYYFAEAAEGAAAKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLR N KSWNK SNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGWSYSNTSSDYNTG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA TA+DM+ F++ W+KKFP Y+SR L 
Sbjct  146  DARTANDMYKFVLGWYKKFPEYRSRGLL  173



>ref|NP_001151858.1| serine carboxypeptidase F13S12.6 precursor [Zea mays]
 gb|ACG44640.1| serine carboxypeptidase F13S12.6 precursor [Zea mays]
Length=471

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQP V F+Q+AGYVDVD KAGRSLFYYF EA  +   KPLTLWLNGGPG
Sbjct  26   FPAEDLVARLPGQPPVTFRQFAGYVDVDAKAGRSLFYYFAEAREDAAAKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GDGRGLR N KSWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNRASNLLFVESPAGVGWSYSNTSSDYSTG  145

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA DM+ F++ W+ KFP Y+SR LF
Sbjct  146  DVWTAHDMYQFLLGWYAKFPEYRSRALF  173



>gb|ABK25236.1| unknown [Picea sitchensis]
Length=469

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            P EDL+  LPGQPKV FKQYAGY+ VD  AGR+LFYYF EAE +   KP+ LWLNGGPGC
Sbjct  29   PAEDLIDRLPGQPKVNFKQYAGYITVDEHAGRALFYYFAEAEDDSDSKPVALWLNGGPGC  88

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  685
            SSVGGGAFTELGPFYP  DG GLR+N +SWNK SNLLFVESPAGVGWSYSNT+SDY CGD
Sbjct  89   SSVGGGAFTELGPFYPRDDGHGLRKNLQSWNKVSNLLFVESPAGVGWSYSNTTSDYTCGD  148

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
             STA +M +F+ +WFK+FP Y SRDLF
Sbjct  149  ESTARNMLVFLSKWFKRFPEYASRDLF  175



>gb|EEE51848.1| hypothetical protein OsJ_33355 [Oryza sativa Japonica Group]
Length=474

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 117/157 (75%), Gaps = 9/157 (6%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +PEEDLV  LPGQP VGF+Q+AGYVDVD KAGRSLFYYF EA      KPLTLWLNG   
Sbjct  20   FPEEDLVARLPGQPVVGFRQFAGYVDVDEKAGRSLFYYFAEAAEGAAAKPLTLWLNGDGI  79

Query  503  cssvggg---------AFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYS  655
               +  G         AFTELGPFYP GDGRGLR N KSWNK SNLLFVESPAGVGWSYS
Sbjct  80   GVVIVNGPGCSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGWSYS  139

Query  656  NTSSDYICGDASTASDMHIFMVEWFKKFPSYKSRDLF  766
            NTSSDY  GDA TA+DM+ F++ W+KKFP Y+SR L 
Sbjct  140  NTSSDYNTGDAQTANDMYKFLLGWYKKFPEYRSRGLL  176



>ref|XP_006663298.1| PREDICTED: serine carboxypeptidase-like 42-like [Oryza brachyantha]
Length=486

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 122/160 (76%), Gaps = 12/160 (8%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +PEEDLV  LPGQP VGF+Q+AGYVDVD KAGRSLFYYF EA  +   KPLTLWLNGG  
Sbjct  29   FPEEDLVTRLPGQPIVGFRQFAGYVDVDEKAGRSLFYYFAEAAEDAAGKPLTLWLNGGRL  88

Query  503  ------------cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGW  646
                        CSSVGGGAFTELGPFYP GDGRGLR N KSWNK SNLLFVESPAGVGW
Sbjct  89   PPPATGSSPGPGCSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGW  148

Query  647  SYSNTSSDYICGDASTASDMHIFMVEWFKKFPSYKSRDLF  766
            SYSNTSSDY  GD  TA+DM+ F++ W+KKFP Y SR L 
Sbjct  149  SYSNTSSDYNTGDQRTANDMYKFLLGWYKKFPEYSSRGLL  188



>emb|CDY66139.1| BnaAnng21620D [Brassica napus]
Length=486

 Score =   197 bits (501),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 118/158 (75%), Gaps = 10/158 (6%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YPEEDLV  LPGQPKV F+QYAGYVDVD + GRSLFYYFVEA+ +P  KPLTLWLNG   
Sbjct  29   YPEEDLVARLPGQPKVLFRQYAGYVDVDFETGRSLFYYFVEADTHPETKPLTLWLNGILI  88

Query  503  --------cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSN  658
                    CSSVGGGAFTELGPFYPTGDGRGLR NS SWNKASNLLFVESPAGVGWSYSN
Sbjct  89   KLYLAGPGCSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSN  148

Query  659  TSSDYICGDASTA--SDMHIFMVEWFKKFPSYKSRDLF  766
            TSSDY  GD +T    D       WF KFP  K+R  F
Sbjct  149  TSSDYNTGDETTGEIQDPIFNSFVWFSKFPELKARHFF  186



>ref|XP_006596272.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Glycine 
max]
Length=456

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQPKVGFKQ+AGYVDVD K GRSLFYYFVEAE +P  KPLTLWLNGGPG
Sbjct  41   YPAEDLVVKLPGQPKVGFKQFAGYVDVDAKHGRSLFYYFVEAEQDPHKKPLTLWLNGGPG  100

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP GDGRGLRRNS SWNKASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  101  CSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNSG  160

Query  683  DASTA  697
            DAST 
Sbjct  161  DASTG  165



>gb|KJB59377.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
Length=468

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 122/148 (82%), Gaps = 15/148 (10%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            YP EDLV  LPGQP VGFKQYAGYVDVD+KAGRSLFYYFVEA+ NP  +PLTLWLNGGPG
Sbjct  37   YPAEDLVVKLPGQPPVGFKQYAGYVDVDVKAGRSLFYYFVEADKNPEKQPLTLWLNGGPG  96

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP               +ASNLLFVESP GVGWSYSNTSSDYI G
Sbjct  97   CSSVGGGAFTELGPFYP---------------RASNLLFVESPVGVGWSYSNTSSDYIRG  141

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTA DM+IFM++W++KFP +KSR+LF
Sbjct  142  DASTAKDMYIFMMKWYEKFPEFKSRELF  169



>ref|XP_011659130.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Cucumis 
sativus]
Length=441

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQP V FKQYAGYVD+DLK GRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  26   FPSEDLVLRLPGQPPVSFKQYAGYVDIDLKNGRSLFYYFVEAEEQPEKKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP+GDGRGLR+N  SWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  86   CSSIGGGAFTELGPFYPSGDGRGLRKNPMSWNKASNLLFVESPAGVGWSYSNTSSDYNCG  145

Query  683  DASTA  697
            DAST 
Sbjct  146  DASTG  150



>ref|XP_008461496.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Cucumis 
melo]
Length=441

 Score =   194 bits (492),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P EDLV  LPGQP V FKQYAGYVD+D+K GRSLFYYFVEAE +P  KPLTLWLNGGPG
Sbjct  26   FPSEDLVLRLPGQPPVSFKQYAGYVDIDVKNGRSLFYYFVEAEEHPEKKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYP+GDGRGLR+N  SWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  86   CSSIGGGAFTELGPFYPSGDGRGLRKNPMSWNKASNLLFVESPAGVGWSYSNTSSDYNCG  145

Query  683  DASTA  697
            DAST 
Sbjct  146  DASTG  150



>ref|XP_010463193.1| PREDICTED: serine carboxypeptidase-like 44 [Camelina sativa]
Length=422

 Score =   193 bits (490),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +PEEDLV  LPGQP+V F+Q+AGYVD+D+KAGRSLFYYFVEAE  P  KPLTLWLNGGPG
Sbjct  32   FPEEDLVTKLPGQPEVAFRQFAGYVDIDVKAGRSLFYYFVEAEKQPHTKPLTLWLNGGPG  91

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+GGGAFTELGPFYPTG+GRGLRRN KSWNKASNLLFV+SPAGVGWSYSNT+SDY  G
Sbjct  92   CSSIGGGAFTELGPFYPTGNGRGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  151

Query  683  DASTA  697
            D +T 
Sbjct  152  DETTV  156



>ref|XP_002974500.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ24722.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=471

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            PE DLV  LPGQP V FKQYAGYV VD  AGR+LFYYFVEA  +   +PL LWLNGGPGC
Sbjct  29   PEHDLVTNLPGQPAVPFKQYAGYVTVDSHAGRALFYYFVEAHSHASSRPLALWLNGGPGC  88

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+GGGAFTELGPFYP G GRGL +NS SWNKA+N+LF+ESPAGVGWSYSN S DY I  
Sbjct  89   SSIGGGAFTELGPFYPNGTGRGLVKNSNSWNKAANILFLESPAGVGWSYSNRSEDYSIYN  148

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA TA D   FM+ WF  FP YKSR+ +
Sbjct  149  DAKTAKDSVTFMLRWFDAFPEYKSREFY  176



>ref|XP_002990798.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ08071.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=467

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            PE DLV  LPGQP V FKQYAGYV VD  AGR+LFYYFVEA  +   KPL LWLNGGPGC
Sbjct  25   PEHDLVTNLPGQPAVPFKQYAGYVTVDSHAGRALFYYFVEAHSHASSKPLALWLNGGPGC  84

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+GGGAFTELGPFYP G GRGL +NS SWNKA+N+LF+ESPAGVGWSYSN S DY I  
Sbjct  85   SSIGGGAFTELGPFYPNGTGRGLVKNSNSWNKAANILFLESPAGVGWSYSNRSEDYSIYN  144

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA TA D   F++ WF  FP YKSR+ +
Sbjct  145  DAKTAKDSVTFLLRWFDAFPEYKSREFY  172



>emb|CDX81435.1| BnaC09g08460D [Brassica napus]
Length=413

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 114/146 (78%), Gaps = 13/146 (9%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            EEDLV  LPGQPKV F+QYA YVDVD + GRSLFYYFVEA+  P  KPLTLWLNGGPGCS
Sbjct  12   EEDLVVRLPGQPKVLFRQYAVYVDVDSETGRSLFYYFVEADSQPETKPLTLWLNGGPGCS  71

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDA  688
            SVGGGAFTELGPFYPTGDG GLR NS SWNKASNLLFV+SPAGV             GD 
Sbjct  72   SVGGGAFTELGPFYPTGDGHGLRINSMSWNKASNLLFVDSPAGV-------------GDE  118

Query  689  STASDMHIFMVEWFKKFPSYKSRDLF  766
            +TASDM +F++ WF KFP+ K+R LF
Sbjct  119  TTASDMLVFLLRWFNKFPALKARHLF  144



>ref|XP_002972012.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ26929.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=465

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            P  DLVK LPGQP+V FKQYAGYV +D ++G++LFYYFVEAE +P  KPL+LWLNGGPGC
Sbjct  25   PASDLVKDLPGQPEVSFKQYAGYVTIDQRSGKALFYYFVEAEEDPTSKPLSLWLNGGPGC  84

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-G  682
            SS+GGGAFTELGPFYP     GL RNSK+WNKASN+LFV+SP GVGWSYSNTSSDY    
Sbjct  85   SSLGGGAFTELGPFYPDSKSDGLVRNSKAWNKASNVLFVDSPIGVGWSYSNTSSDYQTYN  144

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  T+ D+  F+  WF KFP Y+ R+ +
Sbjct  145  DEKTSRDLVKFLHGWFIKFPEYRHREFY  172



>ref|XP_002972549.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ26635.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=465

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            P  DLVK LPGQP V FKQYAGYV +D ++G++LFYYFVEAE +P  KPL+LWLNGGPGC
Sbjct  25   PASDLVKDLPGQPDVSFKQYAGYVTIDQRSGKALFYYFVEAEEDPTSKPLSLWLNGGPGC  84

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-G  682
            SS+GGGAFTELGPFYP     GL RNSK+WNKASN+LFV+SP GVGWSYSNTSSDY    
Sbjct  85   SSLGGGAFTELGPFYPDSKSDGLVRNSKAWNKASNVLFVDSPIGVGWSYSNTSSDYQTYN  144

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  T+ D+  F+  WF KFP Y+ R+ +
Sbjct  145  DEKTSRDLVKFLHGWFIKFPEYRHREFY  172



>gb|EMT31513.1| Serine carboxypeptidase-like 42 [Aegilops tauschii]
Length=433

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 115/148 (78%), Gaps = 13/148 (9%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +PEEDLV  LPGQP VGF+Q+AGYVDVD KAGRSLFYYF EA+ +   KPLTLWLNGGPG
Sbjct  26   FPEEDLVGRLPGQPIVGFRQFAGYVDVDDKAGRSLFYYFAEAQDHAAGKPLTLWLNGGPG  85

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVGGGAFTELGPFYP GD              SNLLFVESPAGVG SYSNTSSDY  G
Sbjct  86   CSSVGGGAFTELGPFYPRGD-------------VSNLLFVESPAGVGRSYSNTSSDYNTG  132

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA+DM+ F++ W+KKFP Y+SR LF
Sbjct  133  DTRTANDMYKFLLGWYKKFPEYRSRSLF  160



>ref|XP_002967656.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ31003.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            PE +LV  LPGQP V FKQYAGYV VD  AGR+LFYYF EAE     +PLTLWLNGGPGC
Sbjct  23   PESELVSRLPGQPHVSFKQYAGYVTVDKNAGRALFYYFAEAETRASSQPLTLWLNGGPGC  82

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+GGGAFTELGPFYP   G+GL  N ++WNK SN+LF+E+PAGVGWSYSN SSDY    
Sbjct  83   SSIGGGAFTELGPFYPNASGQGLLVNRRAWNKVSNMLFLEAPAGVGWSYSNKSSDYEQVT  142

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA D   F++ W  KFP Y++RD +
Sbjct  143  DRITAVDTLNFLLGWMDKFPEYQTRDFY  170



>ref|XP_002964377.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ34710.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            PE +LV  LPGQP V FKQYAGYV VD  AGR+LFYYF EAE     +PLTLWLNGGPGC
Sbjct  23   PESELVSRLPGQPHVSFKQYAGYVTVDKNAGRALFYYFAEAETRASSQPLTLWLNGGPGC  82

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+GGGAFTELGPFYP   G+GL  N ++WNK SN+LF+E+PAGVGWSYSN SSDY    
Sbjct  83   SSIGGGAFTELGPFYPNASGQGLLVNRQAWNKVSNMLFLEAPAGVGWSYSNKSSDYEQVT  142

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA D   F++ W  KFP Y++RD +
Sbjct  143  DRITAVDTLNFLLGWMDKFPEYQTRDFY  170



>ref|XP_002971138.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ27736.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=475

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 108/159 (68%), Gaps = 12/159 (8%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVN-PRLKPLTLWLNggpg  502
            P  DLV  LPGQP+V F+QYAGYV VD  AGR+LFYYFVE E   P+ KPLTLWLNG   
Sbjct  23   PLSDLVTNLPGQPRVRFRQYAGYVTVDPSAGRALFYYFVEVEGGAPQSKPLTLWLNGEFL  82

Query  503  cssvggg----------AFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSY  652
              +              AFTELGPFYP   G GL RN +SWNK SNLLF++SPAGVGWSY
Sbjct  83   SGTKKKKGPGCSSIGCGAFTELGPFYPNASGTGLLRNPQSWNKVSNLLFLDSPAGVGWSY  142

Query  653  SNTSSDYI-CGDASTASDMHIFMVEWFKKFPSYKSRDLF  766
            SNTSSDY    D  TA D  +F++ WF+KFP ++S DL+
Sbjct  143  SNTSSDYDNVTDEKTAQDTLLFLLGWFRKFPEFRSSDLY  181



>ref|XP_002961948.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ37208.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=480

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 108/164 (66%), Gaps = 17/164 (10%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVN-PRLKPLTLWLNggpg  502
            P  DLV  LPGQP+V F+QYAGYV VD  AGR+LFYYFVE E   P+ KPLTLWLNG   
Sbjct  23   PLSDLVTNLPGQPRVRFRQYAGYVTVDPSAGRALFYYFVEVEGGAPQSKPLTLWLNGVVS  82

Query  503  cssvgggA---------------FTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAG  637
             +     A               FTELGPFYP   G GL RN +SWNK SNLLF++SPAG
Sbjct  83   LTQSSCLAPKKKGPGCSSIGCGAFTELGPFYPNASGTGLLRNPQSWNKVSNLLFLDSPAG  142

Query  638  VGWSYSNTSSDY-ICGDASTASDMHIFMVEWFKKFPSYKSRDLF  766
            VGWSYSNTSSDY    D  TA D  +F++ WF+KFP ++S DL+
Sbjct  143  VGWSYSNTSSDYDNVTDEKTAQDTLLFLLGWFRKFPEFRSSDLY  186



>ref|XP_007021535.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY13060.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=364

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P  DL++ LPGQP V F+Q++GY+DVD K GRSLFYYFVEAE +P  +PLT+WL  G  
Sbjct  21   FPMNDLIEKLPGQPNVTFRQFSGYIDVDGKFGRSLFYYFVEAENDPMNRPLTIWL-TGGP  79

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
                 G  F  +GPF  T +  GL+RN  SW K SNLLF++SP G GWSYSNTSSDY  G
Sbjct  80   GCGSVGDGFLSVGPFITTANAHGLQRNLYSWIKVSNLLFIDSPVGAGWSYSNTSSDYEVG  139

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D ST +D+  F+++WF+K+P++KSRDL+
Sbjct  140  DDSTNNDLLAFILQWFEKYPNFKSRDLY  167



>ref|XP_011620351.1| PREDICTED: serine carboxypeptidase-like 44 [Amborella trichopoda]
Length=385

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            P E L+  LPGQP+V F+QY+GY++VD  AG +LFYYFVEA+ N   +PL LWLNGGPGC
Sbjct  25   PTEHLISSLPGQPQVSFRQYSGYINVDESAGTNLFYYFVEAQSNASSQPLALWLNGGPGC  84

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  685
            SS+GGGAFTELGPFYP G G GLR N  SWNK +N+LF+ESPAGVGWSYS   + Y   D
Sbjct  85   SSIGGGAFTELGPFYPNGKGDGLRINPYSWNKVANVLFLESPAGVGWSYSRIPAGYRYND  144

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
            A  A++  +F++ WF++FP Y  R LF
Sbjct  145  ARVANESLVFLLRWFQRFPEYSERPLF  171



>ref|XP_004977165.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Setaria 
italica]
Length=445

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRL-KPLTLWLNggp  499
            YPE DLV+GLPGQP V F+Q+AGYVDVD +AGRSLFYY  EA+      KPLTLWLNGGP
Sbjct  30   YPESDLVRGLPGQPPVAFRQFAGYVDVDERAGRSLFYYLAEADGAAAASKPLTLWLNGGP  89

Query  500  gcssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC  679
            GCSSVGGGAFTELGPFYP GDGRGLR N KSWNK SNLLFVESPAGVGWSYSNTSSDY  
Sbjct  90   GCSSVGGGAFTELGPFYPRGDGRGLRINDKSWNKVSNLLFVESPAGVGWSYSNTSSDYKT  149

Query  680  GDASTA  697
            GDA T 
Sbjct  150  GDARTG  155



>ref|XP_007021532.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY13057.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=464

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 107/148 (72%), Gaps = 1/148 (1%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P  DL++ LPGQP V FKQ++GY+DVD KAGRSLFYYFVEAE +P  +PLT+WL  G  
Sbjct  21   FPMNDLIEKLPGQPNVTFKQFSGYIDVDGKAGRSLFYYFVEAENDPMKRPLTIWL-TGGP  79

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
                 G  F  +GPF  T +  GL+RN  SW K SNLLF++SP G GWSYSNTSSDY  G
Sbjct  80   GCGSVGDGFLSVGPFITTANAHGLQRNLYSWIKVSNLLFIDSPIGAGWSYSNTSSDYEVG  139

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D ST  D+   +++WF+K+P++KSRDL+
Sbjct  140  DDSTNKDLLTLILQWFEKYPNFKSRDLY  167



>gb|ERM97972.1| hypothetical protein AMTR_s00117p00106310 [Amborella trichopoda]
Length=486

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            P E L+  LPGQP+V F+QY+GY++VD  AG +LFYYFVEA+ N   +PL LWLNGGPGC
Sbjct  25   PTEHLISSLPGQPQVSFRQYSGYINVDESAGTNLFYYFVEAQSNASSQPLALWLNGGPGC  84

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  685
            SS+GGGAFTELGPFYP G G GLR N  SWNK +N+LF+ESPAGVGWSYS   + Y   D
Sbjct  85   SSIGGGAFTELGPFYPNGKGDGLRINPYSWNKVANVLFLESPAGVGWSYSRIPAGYRYND  144

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
            A  A++  +F++ WF++FP Y  R LF
Sbjct  145  ARVANESLVFLLRWFQRFPEYSERPLF  171



>emb|CAN74668.1| hypothetical protein VITISV_005686 [Vitis vinifera]
Length=480

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 98/148 (66%), Gaps = 36/148 (24%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +PEEDLV  LPGQPKVGF+Q+ GYVDVD KAGRSLFYYFVEAE +P+ KPLTLWLN    
Sbjct  29   WPEEDLVVRLPGQPKVGFRQFGGYVDVDEKAGRSLFYYFVEAEEDPQNKPLTLWLN----  84

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
                                              SNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  85   --------------------------------GVSNLLFVESPAGVGWSYSNTSSDYNCG  112

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DASTASDM  FM++WFKKFP YK R LF
Sbjct  113  DASTASDMLTFMLKWFKKFPGYKLRPLF  140



>ref|XP_007021681.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY13206.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=464

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 107/148 (72%), Gaps = 1/148 (1%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P  DL++ LPGQP V F+Q++GY+DVD  AGRSLFYYFVEAE +P  +PLT+WL  G  
Sbjct  21   FPMNDLIEKLPGQPNVTFRQFSGYIDVDENAGRSLFYYFVEAENDPMNRPLTIWL-TGGP  79

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
                 G  F  +GPF  T +  GL+RN  SW KASNLLF++SP G GWSYSNTSSD+  G
Sbjct  80   GCGSVGDGFLSVGPFITTANAHGLQRNLYSWIKASNLLFIDSPIGEGWSYSNTSSDHEVG  139

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D ST  D+  F+++W +K+P++KSRDL+
Sbjct  140  DESTNKDLLTFILQWSEKYPNFKSRDLY  167



>gb|EYU42662.1| hypothetical protein MIMGU_mgv1a022120mg [Erythranthe guttata]
Length=489

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            Y E D +  LPGQP+V F QY+GYV VD  AGR+LFYYF E+E +   KPL LWLNGGPG
Sbjct  67   YKEVDRILSLPGQPEVSFDQYSGYVTVDASAGRALFYYFAESENSSSTKPLVLWLNGGPG  126

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSS+G GA TELGPF    DG+ L  N  SWN  +N++F+ESPAGVG+SYSNTSSDYI G
Sbjct  127  CSSLGAGAMTELGPFRVNPDGKTLWHNKNSWNILANVIFLESPAGVGFSYSNTSSDYITG  186

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA+D + F+V W K+FP YK RD +
Sbjct  187  DRKTAADAYTFLVNWLKRFPDYKHRDFY  214



>ref|XP_007021438.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY12963.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=516

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P  DL++ LPGQP V F+Q++GY+D+D KAGRSLFYYFVEAE +P   PLT+WL  G  
Sbjct  31   FPMNDLIEKLPGQPNVTFRQFSGYIDIDAKAGRSLFYYFVEAEKDPMNLPLTIWL-TGGP  89

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
                 G  F  +GPF  T +  GL+RN  SW K +NLLF++SP G GWSYSNTS DY  G
Sbjct  90   GCGSVGDGFLSVGPFITTANAHGLQRNPYSWIKVTNLLFIDSPIGAGWSYSNTSRDYEVG  149

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D ST  D+  F+++WF+K P++KSRDL+
Sbjct  150  DDSTNKDLLTFILQWFEKHPNFKSRDLY  177



>ref|XP_007021444.1| Serine carboxypeptidase 44 isoform 2 [Theobroma cacao]
 gb|EOY12969.1| Serine carboxypeptidase 44 isoform 2 [Theobroma cacao]
Length=465

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P  DL++ LPGQP V F+Q++GY+D+D KAGRSLFYYFVEAE +P   PLT+WL  G  
Sbjct  21   FPMNDLIEKLPGQPNVTFRQFSGYIDIDGKAGRSLFYYFVEAEKDPMNLPLTIWL-TGGP  79

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
                 G  F  +GPF  T +  GL+RN  SW K +NLLF++SP G GWSYSNTS DY  G
Sbjct  80   GCGSVGDGFLSVGPFITTANAHGLQRNPYSWIKVTNLLFIDSPIGAGWSYSNTSRDYEVG  139

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D ST  D+  F+++WF+K P++KSRDL+
Sbjct  140  DDSTNKDLLTFILQWFEKHPNFKSRDLY  167



>ref|XP_007021448.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY12973.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=465

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P  DL++ LPGQP V F+Q++GY+D+D KAGRSLFYYFVEAE +P   PLT+WL  G  
Sbjct  21   FPMNDLIEKLPGQPNVTFRQFSGYIDIDGKAGRSLFYYFVEAEKDPMNLPLTIWL-TGGP  79

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
                 G  F  +GPF  T +  GL+RN  SW K +NLLF++SP G GWSYSNTS DY  G
Sbjct  80   GCGSVGDGFLSVGPFITTANAHGLQRNPYSWIKVTNLLFIDSPIGAGWSYSNTSRDYEVG  139

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D ST  D+  F+++WF+K P++KSRDL+
Sbjct  140  DDSTNKDLLTFILQWFEKHPNFKSRDLY  167



>ref|XP_007021443.1| Serine carboxypeptidase 44 isoform 1 [Theobroma cacao]
 gb|EOY12968.1| Serine carboxypeptidase 44 isoform 1 [Theobroma cacao]
Length=476

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P  DL++ LPGQP V F+Q++GY+D+D KAGRSLFYYFVEAE +P   PLT+WL  G  
Sbjct  32   FPMNDLIEKLPGQPNVTFRQFSGYIDIDGKAGRSLFYYFVEAEKDPMNLPLTIWL-TGGP  90

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
                 G  F  +GPF  T +  GL+RN  SW K +NLLF++SP G GWSYSNTS DY  G
Sbjct  91   GCGSVGDGFLSVGPFITTANAHGLQRNPYSWIKVTNLLFIDSPIGAGWSYSNTSRDYEVG  150

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D ST  D+  F+++WF+K P++KSRDL+
Sbjct  151  DDSTNKDLLTFILQWFEKHPNFKSRDLY  178



>ref|XP_007160822.1| hypothetical protein PHAVU_001G019500g [Phaseolus vulgaris]
 gb|ESW32816.1| hypothetical protein PHAVU_001G019500g [Phaseolus vulgaris]
Length=486

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E+D VKGLPG+P+ V F QY GYV VD KAGR LFYYFVE+  N   KPL LWLNGGPGC
Sbjct  73   EDDKVKGLPGEPEGVDFDQYGGYVTVDAKAGRRLFYYFVESPHNASNKPLVLWLNGGPGC  132

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  682
            SS+G GA  ELGPF    DGR LR+N  +WN  +N++F+ESPAGVG+SYSNTSSDY   G
Sbjct  133  SSLGYGAMQELGPFRVNSDGRTLRKNEYAWNNVANVIFLESPAGVGFSYSNTSSDYSDSG  192

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA D + F++ W  +FP YKSRDLF
Sbjct  193  DKSTAMDSYTFLINWLNRFPHYKSRDLF  220



>ref|XP_010279511.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Nelumbo 
nucifera]
Length=493

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 113/147 (77%), Gaps = 2/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E+D+++ LPGQP VGFKQY GYV VD  AGR+LFYYFVEA+ +P+ KPL LWLNGGPGCS
Sbjct  70   EKDMIERLPGQPPVGFKQYGGYVTVDESAGRALFYYFVEAQ-DPKSKPLLLWLNGGPGCS  128

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-GD  685
            S+G GA  ELGPF    DG+ L  N  SWN+  N+LF+ESPAGVG+SYSN +SDY   GD
Sbjct  129  SLGYGAMEELGPFRVHSDGKTLYENRYSWNRVVNVLFLESPAGVGFSYSNRTSDYATRGD  188

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
             STA D ++F+V W ++FP YK+RD +
Sbjct  189  QSTAEDNYVFLVNWLERFPEYKTRDFY  215



>ref|XP_007021534.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY13059.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=472

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            +P  DL++ LPGQP V F+Q++ Y+D+D KAGRSLFYYFVEAE +P    LT+WL  G  
Sbjct  29   FPMNDLIEKLPGQPNVTFRQFSDYIDIDEKAGRSLFYYFVEAEKDPMNLSLTIWL-TGGP  87

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
                 G  F  +GPF  T +  GL+RN  SW K +NLLF++SP G GWSYSNTSSDY  G
Sbjct  88   GCGSVGDGFLSVGPFITTANAHGLQRNPYSWIKVTNLLFIDSPIGAGWSYSNTSSDYEVG  147

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D ST  D+  F+++WF+K+P++KSRDL+
Sbjct  148  DDSTNKDLLTFILQWFEKYPNFKSRDLY  175



>gb|KHN46300.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=445

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 109/149 (73%), Gaps = 3/149 (2%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVG--FKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            E D VK LPGQP  G  F QYAGYV VD KAGR+LFYYFVE+  N   KPL LWLNGGPG
Sbjct  25   EGDKVKALPGQPSQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNKPLVLWLNGGPG  84

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-C  679
            CSS G GA  ELGPF    DG+ L RN  +WN  +N++F+ESPAGVG+SYSNTSSDY   
Sbjct  85   CSSFGYGAMQELGPFRVNSDGKTLYRNQYAWNNVANVIFLESPAGVGFSYSNTSSDYTKT  144

Query  680  GDASTASDMHIFMVEWFKKFPSYKSRDLF  766
            GD STA D + F++ W ++FP YK+RDLF
Sbjct  145  GDKSTAMDSYTFLLNWLERFPQYKTRDLF  173



>ref|XP_008813040.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=487

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D +K LPGQP  V F QY+GYV VD K GR+LFYYFVE++ NP  KPL LWLNGGPGC
Sbjct  69   EADRIKSLPGQPTGVEFNQYSGYVTVDTKNGRALFYYFVESQHNPSTKPLILWLNGGPGC  128

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GA  ELGPF    DG+ L+RN  +WN  +N+LF+ESPAGVG+SYSNTSSDY + G
Sbjct  129  SSLGYGAMQELGPFRVHSDGKTLQRNKYAWNNVANVLFLESPAGVGFSYSNTSSDYDMNG  188

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA D + F+V WF++FP YK+ + F
Sbjct  189  DQRTAEDSYTFLVNWFERFPHYKNHEFF  216



>gb|KHN05312.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=484

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D +  LPGQP  V F QY+GYV VD KAGR+LFYYFVE+  NP  KPL LWLNGGPGC
Sbjct  61   EADRIVALPGQPYGVNFDQYSGYVTVDPKAGRALFYYFVESPYNPSTKPLVLWLNGGPGC  120

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GAF ELGPF    DG  L RN  +WN+ +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  121  SSLGYGAFEELGPFRINSDGETLYRNKYAWNEVANVLFLESPAGVGFSYSNTTSDYGHSG  180

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA D ++F++ W ++FP YK+RD +
Sbjct  181  DKSTAKDAYVFLINWLERFPEYKTRDFY  208



>gb|KJB13335.1| hypothetical protein B456_002G069000 [Gossypium raimondii]
Length=464

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            Y   D +  LPGQP V F+Q++GY+DVD  AGRSLFYYFVEAE +P   PLT+WL GGPG
Sbjct  21   YHLSDQIGTLPGQPNVNFRQFSGYIDVDPNAGRSLFYYFVEAENDPLSLPLTIWLTGGPG  80

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICG  682
            CSSVG  +F  +GPF  T + RGL+RN  +W K SN+LF++SP G GWSYSNT+SDY  G
Sbjct  81   CSSVGD-SFVGIGPFTTTNNARGLKRNPYAWTKVSNMLFIDSPIGSGWSYSNTNSDYQAG  139

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D ST  D+ +F+++WF+K+P +K RDL+
Sbjct  140  DVSTNDDLVVFILKWFQKYPIFKFRDLY  167



>gb|KHN12757.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=445

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 108/149 (72%), Gaps = 3/149 (2%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVG--FKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            E D VK LPGQP  G  F QYAGYV VD KAGR+LFYYFVE+  N   KPL LWLNGGPG
Sbjct  25   EGDKVKALPGQPAQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNKPLVLWLNGGPG  84

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-C  679
            CSS G GA  ELGPF    DGR L  N  +WN  +N++F+ESPAGVG+SYSNTSSDY   
Sbjct  85   CSSFGYGAMQELGPFRVNSDGRTLYTNQYAWNNVANVIFLESPAGVGFSYSNTSSDYTKT  144

Query  680  GDASTASDMHIFMVEWFKKFPSYKSRDLF  766
            GD STA D + F++ W ++FP YK+RDLF
Sbjct  145  GDKSTAMDSYTFLLNWLERFPQYKTRDLF  173



>ref|XP_006595329.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max]
Length=489

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D +  LPGQP  V F QY+GYV VD KAGR+LFYYFVE+  NP  KPL LWLNGGPGC
Sbjct  70   EADRIVALPGQPYGVNFDQYSGYVTVDPKAGRALFYYFVESPYNPSTKPLVLWLNGGPGC  129

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GAF ELGPF    DG  L RN  +WN+ +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  130  SSLGYGAFEELGPFRINSDGETLYRNKYAWNEVANVLFLESPAGVGFSYSNTTSDYGHSG  189

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA D ++F++ W ++FP YK+RD +
Sbjct  190  DKSTAKDAYVFLINWLERFPEYKTRDFY  217



>gb|KDO66312.1| hypothetical protein CISIN_1g039871mg [Citrus sinensis]
Length=503

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 110/148 (74%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E+D +  LPGQP  +GF QYAGYV VD +AGR+LFYYFVE+  N    PL LWLNGGPGC
Sbjct  87   EQDKINALPGQPNGIGFNQYAGYVTVDAQAGRALFYYFVESPENSSTNPLVLWLNGGPGC  146

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS G GA TELGPF    DG+ L +N  +WN  +N++F+ESPAGVG+SYSNT+SDY   G
Sbjct  147  SSFGNGAMTELGPFRVNSDGKTLFQNEYAWNNVANVIFLESPAGVGFSYSNTTSDYDHAG  206

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA+D + F+V W ++FP YK+RD F
Sbjct  207  DNSTAADSYTFLVNWLERFPQYKNRDFF  234



>ref|XP_006470494.1| PREDICTED: serine carboxypeptidase-like 40-like [Citrus sinensis]
Length=503

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 110/148 (74%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E+D +  LPGQP  +GF QYAGYV VD +AGR+LFYYFVE+  N    PL LWLNGGPGC
Sbjct  87   EQDKINALPGQPNGIGFNQYAGYVTVDAQAGRALFYYFVESPENSSTNPLVLWLNGGPGC  146

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS G GA TELGPF    DG+ L +N  +WN  +N++F+ESPAGVG+SYSNT+SDY   G
Sbjct  147  SSFGNGAMTELGPFRVNSDGKTLFQNEYAWNNVANVIFLESPAGVGFSYSNTTSDYDHAG  206

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA+D + F+V W ++FP YK+RD F
Sbjct  207  DNSTAADSYTFLVNWLERFPQYKNRDFF  234



>ref|XP_003544446.1| PREDICTED: serine carboxypeptidase II-3-like isoform X1 [Glycine 
max]
Length=495

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 109/149 (73%), Gaps = 3/149 (2%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVG--FKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            E D VK LPGQP  G  F QYAGYV VD KAGR+LFYYFVE+  N   +PL LWLNGGPG
Sbjct  75   EGDKVKALPGQPSQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNRPLVLWLNGGPG  134

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-C  679
            CSS G GA  ELGPF    DG+ L RN  +WN  +N++F+ESPAGVG+SYSNTSSDY   
Sbjct  135  CSSFGYGAMQELGPFRVNSDGKTLYRNQYAWNNVANVIFLESPAGVGFSYSNTSSDYTKT  194

Query  680  GDASTASDMHIFMVEWFKKFPSYKSRDLF  766
            GD STA D + F++ W ++FP YK+RDLF
Sbjct  195  GDKSTAMDSYTFLLNWLERFPQYKTRDLF  223



>ref|NP_001242872.1| uncharacterized protein LOC100820473 precursor [Glycine max]
 gb|ACU18820.1| unknown [Glycine max]
Length=496

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 108/149 (72%), Gaps = 3/149 (2%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVG--FKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            E D VK LPGQP  G  F QYAGYV VD KAGR+LFYYFVE+  N   KPL LWLNGGPG
Sbjct  76   EGDKVKALPGQPAQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNKPLVLWLNGGPG  135

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-C  679
            CSS G GA  ELGPF    DGR L  N  +WN  +N++F+ESPAGVG+SYSNTSSDY   
Sbjct  136  CSSFGYGAMQELGPFRVNSDGRTLYTNQYAWNNVANVIFLESPAGVGFSYSNTSSDYTKT  195

Query  680  GDASTASDMHIFMVEWFKKFPSYKSRDLF  766
            GD STA D + F++ W ++FP YK+RDLF
Sbjct  196  GDKSTAMDSYTFLLNWLERFPQYKTRDLF  224



>ref|XP_006595959.1| PREDICTED: serine carboxypeptidase II-3-like isoform X2 [Glycine 
max]
Length=531

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 109/149 (73%), Gaps = 3/149 (2%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVG--FKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            E D VK LPGQP  G  F QYAGYV VD KAGR+LFYYFVE+  N   +PL LWLNGGPG
Sbjct  75   EGDKVKALPGQPSQGVDFDQYAGYVTVDAKAGRALFYYFVESPHNASNRPLVLWLNGGPG  134

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-C  679
            CSS G GA  ELGPF    DG+ L RN  +WN  +N++F+ESPAGVG+SYSNTSSDY   
Sbjct  135  CSSFGYGAMQELGPFRVNSDGKTLYRNQYAWNNVANVIFLESPAGVGFSYSNTSSDYTKT  194

Query  680  GDASTASDMHIFMVEWFKKFPSYKSRDLF  766
            GD STA D + F++ W ++FP YK+RDLF
Sbjct  195  GDKSTAMDSYTFLLNWLERFPQYKTRDLF  223



>ref|XP_010261659.1| PREDICTED: serine carboxypeptidase-like 40 [Nelumbo nucifera]
Length=484

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 109/147 (74%), Gaps = 2/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E D +  LPGQP V F QY GYV VD  AGR+LFYYFVEA  +   +PL LWLNGGPGCS
Sbjct  67   ESDRISMLPGQPSVNFNQYGGYVTVDGSAGRALFYYFVEAP-DAMSRPLVLWLNGGPGCS  125

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-GD  685
            S+G GA TELGPF    DGR L RN  +WN+ +N+LF+ESPAGVG+SYSNTSSDY   GD
Sbjct  126  SLGDGAMTELGPFRVQSDGRTLYRNPYAWNQVANVLFLESPAGVGFSYSNTSSDYSTRGD  185

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
             STA D ++F+V W ++FP YK+RD +
Sbjct  186  QSTAEDNYVFLVNWLERFPEYKTRDFY  212



>ref|XP_008220190.1| PREDICTED: serine carboxypeptidase II-3-like [Prunus mume]
Length=490

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 108/148 (73%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D ++ LPGQP  V F QYAGYV VD KAGR+LFYYFVE+  N   KPL LWLNGGPGC
Sbjct  76   EADKIEALPGQPAGVNFDQYAGYVTVDPKAGRALFYYFVESPHNSSTKPLVLWLNGGPGC  135

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GA  ELGPF  + D R L RN  +WNK +N++F+ESPAGVG+SYSNTSSDY   G
Sbjct  136  SSLGYGAMEELGPFRVSSDNRTLYRNDYAWNKVANVIFLESPAGVGFSYSNTSSDYESVG  195

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA D + F+V W ++FP YK RD F
Sbjct  196  DKQTAKDSYTFLVNWLERFPQYKPRDFF  223



>ref|XP_006578498.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max]
Length=545

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 110/148 (74%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D +  LPGQP  V F QY+GYV VD +AGR+LFYYFVE+  NP  KPL LWLNGGPGC
Sbjct  125  EADKIVALPGQPYGVNFDQYSGYVTVDPEAGRALFYYFVESSYNPSTKPLVLWLNGGPGC  184

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GAF ELGPF    DG+ L RN  +WN  +N+LF+ESPAGVG+SYSNT SDY   G
Sbjct  185  SSLGYGAFEELGPFRINSDGKTLYRNKYAWNVVANVLFLESPAGVGFSYSNTISDYEHSG  244

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA D ++F++ W ++FP YK+RD +
Sbjct  245  DKSTAKDAYVFLINWLERFPEYKTRDFY  272



>gb|KHN35601.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=495

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 110/148 (74%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D +  LPGQP  V F QY+GYV VD +AGR+LFYYFVE+  NP  KPL LWLNGGPGC
Sbjct  71   EADKIVALPGQPYGVNFDQYSGYVTVDPEAGRALFYYFVESSYNPSTKPLVLWLNGGPGC  130

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GAF ELGPF    DG+ L RN  +WN  +N+LF+ESPAGVG+SYSNT SDY   G
Sbjct  131  SSLGYGAFEELGPFRINSDGKTLYRNKYAWNVVANVLFLESPAGVGFSYSNTISDYEHSG  190

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA D ++F++ W ++FP YK+RD +
Sbjct  191  DKSTAKDAYVFLINWLERFPEYKTRDFY  218



>gb|ERN14540.1| hypothetical protein AMTR_s00038p00085900 [Amborella trichopoda]
Length=494

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 117/148 (79%), Gaps = 3/148 (2%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            ++++V GL GQP+ V FKQYAGYV +D  AGR+LFYYF EA V+P  KPL LWLNGGPGC
Sbjct  71   KDEIVGGLHGQPEGVEFKQYAGYVTLDETAGRALFYYFAEA-VDPLSKPLLLWLNGGPGC  129

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GA  ELGPF    DG+ L +N  +WNKA+N+LF+ESPAGVG+SYSNT+SDY + G
Sbjct  130  SSLGYGAMEELGPFRVQSDGKTLYKNRYAWNKAANVLFLESPAGVGFSYSNTTSDYELSG  189

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D+ TASD + F++ WF++FP YK+RD +
Sbjct  190  DSRTASDAYTFLINWFERFPEYKNRDFY  217



>ref|XP_006593897.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max]
Length=490

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            + D +  LPGQP  V F QY+GYV VD KAGR+LFYYFVE+  NP  KPL LWLNGGPGC
Sbjct  70   QADKIAALPGQPYGVNFDQYSGYVTVDPKAGRALFYYFVESPYNPSTKPLVLWLNGGPGC  129

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GAF ELGPF    DG+ L RN  +WN+ +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  130  SSLGYGAFEELGPFRINSDGKTLYRNKYAWNEVANVLFLESPAGVGFSYSNTTSDYDHSG  189

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA D ++F++ W ++FP YK+R+ +
Sbjct  190  DKPTAKDAYVFLINWLERFPEYKTRNFY  217



>ref|XP_008224993.1| PREDICTED: serine carboxypeptidase-like 31 [Prunus mume]
Length=484

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 109/146 (75%), Gaps = 1/146 (1%)
 Frame = +2

Query  332  EDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcss  511
            +DLV  LPGQP V FK YAGYV V+   GR+LFY+F EA  NP  KPL LWLNGGPGCSS
Sbjct  44   QDLVTNLPGQPAVDFKHYAGYVTVNQTNGRALFYWFYEAATNPDAKPLVLWLNGGPGCSS  103

Query  512  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CGDA  688
            VG GA  E+GPF    DG G+R N+ SWNK +N+LF+ESP GVG+SYSNT+SDY+  GD 
Sbjct  104  VGYGATQEIGPFIVDTDGHGIRFNNYSWNKEANMLFLESPVGVGFSYSNTTSDYVNLGDV  163

Query  689  STASDMHIFMVEWFKKFPSYKSRDLF  766
             TA+D + F+ +WF KFPSY++R  +
Sbjct  164  FTANDAYTFLHKWFLKFPSYRTRTFY  189



>ref|XP_010279514.1| PREDICTED: serine carboxypeptidase-like 40 [Nelumbo nucifera]
Length=491

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 111/147 (76%), Gaps = 2/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E+D+++ LPGQP VGFKQY GYV VD  AGR+LFYYF EA+ + + KPL LWLNGGPGCS
Sbjct  70   EKDMIERLPGQPPVGFKQYGGYVTVDESAGRALFYYFAEAQ-DAKSKPLLLWLNGGPGCS  128

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-GD  685
            S G GA  ELGPF    DG+ L  N  SWN+ +N++F+ESPAGVG+SYSN +SDY   GD
Sbjct  129  SFGYGAMVELGPFRVHSDGKTLYENHYSWNRVANVVFLESPAGVGFSYSNKTSDYNTRGD  188

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
             +TA D ++F+V W ++FP YK+RD +
Sbjct  189  GNTAQDNYVFLVNWLERFPEYKTRDFY  215



>ref|XP_002282331.1| PREDICTED: serine carboxypeptidase II-3-like [Vitis vinifera]
Length=488

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            ++D ++ LPGQP+ V F QYAGYV VD KAGR+LFYYFVE+  +   KPL LWLNGGPGC
Sbjct  74   QDDKIESLPGQPEGVNFDQYAGYVTVDPKAGRALFYYFVESPEDSSTKPLVLWLNGGPGC  133

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  682
            SS+G GA  ELGPF    DG+ L RN  +WN  SN++F+ESPAGVG+SYSNTSSDY+  G
Sbjct  134  SSLGYGAMEELGPFRVNPDGKTLFRNEYAWNNVSNVIFLESPAGVGFSYSNTSSDYVNVG  193

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA D + F++ W ++FP YK+RD F
Sbjct  194  DKKTAEDSYTFLINWLERFPQYKTRDFF  221



>ref|XP_012071699.1| PREDICTED: serine carboxypeptidase II-3-like [Jatropha curcas]
 gb|KDP38391.1| hypothetical protein JCGZ_04316 [Jatropha curcas]
Length=488

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            + D +  LPGQP+ V F QYAGYV VD + GR+LFYYFVE+  N   KPL LWLNGGPGC
Sbjct  68   KADKIGSLPGQPQGVDFDQYAGYVTVDPENGRALFYYFVESPYNSSTKPLVLWLNGGPGC  127

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  685
            SS G GA  ELGPF    DG+ L RN  +WN  +N++F+ESPAGVG+SYSNTSSDYI GD
Sbjct  128  SSFGYGAMEELGPFRVNSDGKTLYRNKYAWNNVANVIFLESPAGVGFSYSNTSSDYITGD  187

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              TA D + F+V W +++P YK+RD +
Sbjct  188  KKTAEDSYTFLVNWLERYPQYKTRDFY  214



>ref|XP_007146042.1| hypothetical protein PHAVU_006G007800g [Phaseolus vulgaris]
 gb|ESW18036.1| hypothetical protein PHAVU_006G007800g [Phaseolus vulgaris]
Length=489

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            + D +  LPGQ   V F QY+GYV VD +AGR+LFYYFVE+  NP  KPL LWLNGGPGC
Sbjct  70   QADKIVALPGQSYGVNFDQYSGYVTVDPEAGRALFYYFVESPYNPSTKPLVLWLNGGPGC  129

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GAF ELGPF    DG+ L RN  +WN+ +N+LF+ESPAGVG+SYSNTSSDY   G
Sbjct  130  SSLGYGAFEELGPFRINSDGKTLYRNKYAWNEVANVLFLESPAGVGFSYSNTSSDYDHAG  189

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA D ++F++ W ++FP YK+RD +
Sbjct  190  DKSTAKDAYVFLINWLERFPQYKTRDFY  217



>ref|XP_004293521.1| PREDICTED: serine carboxypeptidase-like 31 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=475

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 111/146 (76%), Gaps = 1/146 (1%)
 Frame = +2

Query  332  EDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcss  511
            +DLV  LPGQP V F+ YAGYV+V+   GR+LFY+F EA  NP LKPL LWLNGGPGCSS
Sbjct  40   QDLVTNLPGQPAVDFQHYAGYVNVNETNGRALFYWFYEAATNPDLKPLVLWLNGGPGCSS  99

Query  512  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CGDA  688
            VG GA  E+GPF    DG GLR N+ SWN+ +NLLF+ESP GVG+SYSNT++DY   GDA
Sbjct  100  VGYGATQEIGPFIVGTDGHGLRFNNYSWNQEANLLFLESPVGVGFSYSNTTTDYDNLGDA  159

Query  689  STASDMHIFMVEWFKKFPSYKSRDLF  766
             TA+D + F+ +WF KFPSY++R  +
Sbjct  160  FTANDAYAFLHKWFLKFPSYRTRTFY  185



>ref|XP_011626549.1| PREDICTED: serine carboxypeptidase II-3 [Amborella trichopoda]
Length=477

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 117/149 (79%), Gaps = 3/149 (2%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAE-VNPRLKPLTLWLNggpg  502
            ++++V GLPGQP+ V FKQYAGYV VD +A R+LFYY  EA+  +P  KPL LWLNGGPG
Sbjct  54   QDEIVGGLPGQPEGVNFKQYAGYVTVDDQARRALFYYLTEADGADPSTKPLLLWLNGGPG  113

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-IC  679
            CSS+G GA  ELGPF    DG+ L +N  +WN+A+N+LF+ESPAGVG+SYSNT+SDY + 
Sbjct  114  CSSLGYGAMEELGPFRVYSDGKTLYKNRYAWNRAANVLFLESPAGVGFSYSNTTSDYELS  173

Query  680  GDASTASDMHIFMVEWFKKFPSYKSRDLF  766
            GD+ TASD + F++ WF++FP YK+RD +
Sbjct  174  GDSRTASDAYTFLINWFERFPEYKNRDFY  202



>gb|KHN05141.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=490

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            + D +  LPGQP  V F QY+GYV VD KAGR+LFYYFVE+  NP  KPL LWLNGGPGC
Sbjct  70   QADKIAALPGQPYGVNFDQYSGYVTVDPKAGRALFYYFVESPYNPSTKPLVLWLNGGPGC  129

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GAF ELGPF    DG+ L RN  +WN+ +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  130  SSLGYGAFEELGPFRINSDGKTLYRNKYAWNEVANVLFLESPAGVGFSYSNTTSDYDHSG  189

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA D ++F++ W ++FP YK+R+ +
Sbjct  190  DKPTAKDAYVFLINWLERFPEYKTRNFY  217



>emb|CBI29056.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 110/147 (75%), Gaps = 2/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            + D VK LPGQP+VGF+QYAGYV V+   GR+LFY+F EA  NP  KPL LWLNGGPGCS
Sbjct  35   KADRVKKLPGQPEVGFRQYAGYVTVNESHGRALFYWFFEATQNPHQKPLLLWLNGGPGCS  94

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+G GA  ELGPF+P  DG+ L+ N  +WNKA+NLLFVESP GVG+SY+NTSSD    GD
Sbjct  95   SIGFGATEELGPFFPRRDGK-LKFNPHTWNKAANLLFVESPVGVGFSYTNTSSDIDQLGD  153

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              TA D + F++ WFK+FP +K  D +
Sbjct  154  TITAKDSYAFLIHWFKRFPQFKPHDFY  180



>ref|XP_006473369.1| PREDICTED: serine carboxypeptidase II-3-like [Citrus sinensis]
Length=485

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D +K LPGQP+ V F QYAGY+ VD KAGR+LFYYFVE+  +   KPL LWLNGGPGC
Sbjct  73   EADKIKTLPGQPQGVDFDQYAGYLTVDPKAGRALFYYFVESPQSSSTKPLVLWLNGGPGC  132

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-G  682
            SS+G GA  ELGPF    DG+ L RN  +WN  +N+LF+E+PAGVG+SYSNTSSDY   G
Sbjct  133  SSLGYGAMEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPG  192

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D +TA D + F+V WF++FP YK+RD F
Sbjct  193  DNNTAEDSYTFLVNWFERFPQYKNRDFF  220



>ref|XP_010655923.1| PREDICTED: serine carboxypeptidase-like 34 [Vitis vinifera]
Length=504

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 110/147 (75%), Gaps = 2/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            + D VK LPGQP+VGF+QYAGYV V+   GR+LFY+F EA  NP  KPL LWLNGGPGCS
Sbjct  58   KADRVKKLPGQPEVGFRQYAGYVTVNESHGRALFYWFFEATQNPHQKPLLLWLNGGPGCS  117

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+G GA  ELGPF+P  DG+ L+ N  +WNKA+NLLFVESP GVG+SY+NTSSD    GD
Sbjct  118  SIGFGATEELGPFFPRRDGK-LKFNPHTWNKAANLLFVESPVGVGFSYTNTSSDIDQLGD  176

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              TA D + F++ WFK+FP +K  D +
Sbjct  177  TITAKDSYAFLIHWFKRFPQFKPHDFY  203



>ref|XP_009794620.1| PREDICTED: putative serine carboxypeptidase-like 23 [Nicotiana 
sylvestris]
Length=512

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            EED +  LPGQP  V F QY+GYV VD  AGR+LFYYF E+  +P  KPL LWLNGGPGC
Sbjct  95   EEDKISALPGQPSGVNFDQYSGYVTVDADAGRALFYYFTESTQDPSTKPLVLWLNGGPGC  154

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  685
            SS+G GA  ELGPF    DG+ L  N  +WN  +N+LF+ESPAGVG+SYSNTSSDYI GD
Sbjct  155  SSLGAGAMMELGPFRVNKDGKTLWLNPFAWNNVANILFLESPAGVGFSYSNTSSDYITGD  214

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              T  D   F+V W ++FP YK RD +
Sbjct  215  EKTRQDSFTFLVNWMERFPEYKHRDFY  241



>emb|CDP08509.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 107/147 (73%), Gaps = 2/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D +  LPGQP  V F QY+GYV VD KAGR+LFYYF E++ N   KPL LWLNGGPGC
Sbjct  68   EADRITTLPGQPNAVNFDQYSGYVTVDPKAGRALFYYFAESQ-NSSAKPLVLWLNGGPGC  126

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  685
            SS+G GA TELGPF    DG  L  N  +WN  +N+LF+ESPAGVG+SYSNTSSDYI GD
Sbjct  127  SSIGAGAMTELGPFRVNKDGSTLWLNPYAWNTVANVLFLESPAGVGFSYSNTSSDYITGD  186

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              TA+D + F+V W ++FP YK+RD  
Sbjct  187  TKTAADSYTFLVNWLERFPEYKTRDFL  213



>gb|KEH40059.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E+D VK LPGQPK V F QYAGYV VD K GR LFYYFVE+ +N   KPL LWLNGGPGC
Sbjct  86   EDDKVKALPGQPKGVDFDQYAGYVTVDSKGGRELFYYFVESSLNSSTKPLILWLNGGPGC  145

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  682
            SS G GA  ELGPF    DG  L  N  +WNK +N++F+ESPAGVG+SYS  S DY   G
Sbjct  146  SSFGYGAMQELGPFRVNSDGTTLSLNKDAWNKVANIIFLESPAGVGFSYSKNSLDYSNIG  205

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA D +IF++ W ++FP YK+RD F
Sbjct  206  DNSTAKDSYIFLLNWLERFPQYKTRDFF  233



>ref|XP_010042631.1| PREDICTED: serine carboxypeptidase-like 40 [Eucalyptus grandis]
Length=214

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 106/147 (72%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E+D++K LPGQP V F  Y GYV VD  AGR+ +YYFVE   N    PL LWLNGGPG S
Sbjct  9    EKDMIKRLPGQPPVKFDHYGGYVTVDELAGRAFYYYFVEGVRNKESMPLLLWLNGGPGAS  68

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+G GA  ELGPF    DG+ L +N  +WN A+N+LF+ESPAGVG+SYSNT++DY   GD
Sbjct  69   SLGYGAMQELGPFRVHSDGKTLYKNKFAWNNAANVLFLESPAGVGFSYSNTTADYSSSGD  128

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
            + TA+D ++F++ W ++FP YK RD +
Sbjct  129  SKTAADNYVFLLNWLERFPEYKDRDFY  155



>ref|XP_006434836.1| hypothetical protein CICLE_v10000968mg [Citrus clementina]
 gb|ESR48076.1| hypothetical protein CICLE_v10000968mg [Citrus clementina]
Length=485

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D +K LPGQP+ V F QYAGY+ VD KAGR+LFYYFVE+  +   KPL LWLNGGPGC
Sbjct  73   EADKIKTLPGQPEGVDFDQYAGYLTVDPKAGRALFYYFVESPQSSSSKPLVLWLNGGPGC  132

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  682
            SS+G GA  ELGPF    DG+ L RN  +WN  +N+LF+E+PAGVG+SYSNTSSDY   G
Sbjct  133  SSLGYGAMEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNLG  192

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D +TA D + F+V WF++FP YK+RD F
Sbjct  193  DNNTAEDSYTFLVNWFERFPQYKNRDFF  220



>ref|XP_006346455.1| PREDICTED: serine carboxypeptidase-like 26-like [Solanum tuberosum]
Length=505

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 113/151 (75%), Gaps = 5/151 (3%)
 Frame = +2

Query  329  EEDLVK-GLPGQPK--VGFKQYAGYVDVDLKAGRSLFYYFVE-AEVNPRLKPLTLWLNgg  496
            E+DL+K GLPGQPK  V FKQYAGYV+VD K GRSLFYYF E A  N   KPL LWLNGG
Sbjct  83   EDDLIKDGLPGQPKTNVKFKQYAGYVNVDEKNGRSLFYYFAESASGNASSKPLVLWLNGG  142

Query  497  pgcssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI  676
            PGCSS+G GA  ELGPF    DG+ L   + SWNK +N++F+ESPAGVG+SYSNTSSDY 
Sbjct  143  PGCSSLGFGAMLELGPFGVKPDGKTLYSRTFSWNKVANVMFLESPAGVGFSYSNTSSDYA  202

Query  677  -CGDASTASDMHIFMVEWFKKFPSYKSRDLF  766
              GD  TA D + F+V WFK+FP YKSRD +
Sbjct  203  QSGDKRTAQDAYRFLVNWFKRFPHYKSRDFY  233



>ref|XP_011626550.1| PREDICTED: serine carboxypeptidase II-3 [Amborella trichopoda]
Length=564

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 112/147 (76%), Gaps = 3/147 (2%)
 Frame = +2

Query  332  EDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            +++V GLPGQP+ V FKQYAGYV VD KAGR+LFYY  EA VNP  KP+ LWLNGGPGCS
Sbjct  69   DEIVGGLPGQPEGVEFKQYAGYVTVDEKAGRALFYYLAEA-VNPLSKPVLLWLNGGPGCS  127

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+G GA  ELGPF    +G  L RN  +WN  +NLLF+ESPAGVG+SYSNTSSDY + GD
Sbjct  128  SLGYGAMAELGPFRVHSNGTTLYRNKYAWNNVANLLFLESPAGVGFSYSNTSSDYDLSGD  187

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              TASD + F++ WF++FP YK+ D +
Sbjct  188  KRTASDAYTFLINWFERFPEYKNSDFY  214



>ref|XP_007223971.1| hypothetical protein PRUPE_ppa014620mg, partial [Prunus persica]
 gb|EMJ25170.1| hypothetical protein PRUPE_ppa014620mg, partial [Prunus persica]
Length=557

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 109/149 (73%), Gaps = 3/149 (2%)
 Frame = +2

Query  329  EEDLVKGLPGQPK--VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpg  502
            E D ++ LPGQP   V F QYAGYV VD +AGR+LFYYFVE+  N   KPL LWLNGGPG
Sbjct  87   EADKIEALPGQPAEGVNFDQYAGYVTVDPRAGRALFYYFVESPHNSSTKPLVLWLNGGPG  146

Query  503  cssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-IC  679
            CSS+G GA  ELGPF  + D + L RN  +WNK +N++F+ESPAGVG+SYSNTSSDY   
Sbjct  147  CSSLGYGAMEELGPFRVSSDNKTLYRNDYAWNKVANVIFLESPAGVGFSYSNTSSDYESV  206

Query  680  GDASTASDMHIFMVEWFKKFPSYKSRDLF  766
            GD  TA D + F+V W ++FP YK+RD F
Sbjct  207  GDKQTAKDSYTFLVNWLERFPQYKTRDFF  235



>gb|KJB62985.1| hypothetical protein B456_009G446500 [Gossypium raimondii]
Length=469

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 109/149 (73%), Gaps = 2/149 (1%)
 Frame = +2

Query  323  YPEEDLVKGLPGQPKVGFKQYAGYVDVDLKA-GRSLFYYFVEAEVNPRLKPLTLWLNggp  499
            +   DL+  LPGQP V F+Q+AGY+DVD    GRSLFYYFVEAE +P  +PLT+WL GGP
Sbjct  23   FSMNDLISKLPGQPDVNFRQFAGYIDVDENVVGRSLFYYFVEAEKDPLTQPLTVWLTGGP  82

Query  500  gcssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC  679
            GCSSVG  AF  +GPF  T D  GL+ N  SWNK SNLLF++SP G GWSYSNTSSDY  
Sbjct  83   GCSSVGD-AFGSVGPFIVTKDAHGLQTNILSWNKVSNLLFIDSPIGSGWSYSNTSSDYNN  141

Query  680  GDASTASDMHIFMVEWFKKFPSYKSRDLF  766
            GD ST   +  FM +W++K+P +KS+DL+
Sbjct  142  GDDSTNKILLTFMQKWYEKYPVFKSKDLY  170



>ref|XP_011025505.1| PREDICTED: serine carboxypeptidase-like 40 isoform X2 [Populus 
euphratica]
Length=453

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E+D ++ LPGQPKV F QY GYV VD  AGR+L+YYF EA+ +    PL LWLNGGPGCS
Sbjct  72   EKDRIESLPGQPKVEFSQYGGYVTVDESAGRALYYYFAEAQHSKESLPLLLWLNGGPGCS  131

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+  GA  ELGPF    DG+ L +N  SWN A+N+LF+ESPAGVG+SYSNT+SDY   GD
Sbjct  132  SLSYGAMQELGPFRVYSDGQALYKNRHSWNYAANVLFLESPAGVGFSYSNTTSDYKKSGD  191

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              TA D ++F+V W ++FP YK RD +
Sbjct  192  KMTAEDNYVFLVNWLERFPEYKDRDFY  218



>gb|KDP37687.1| hypothetical protein JCGZ_06344 [Jatropha curcas]
Length=463

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 109/147 (74%), Gaps = 2/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E++ +  LPGQP+V F+QYAGY+ VD K  R+LFYYFVEAE NP  KPL LWLNGGPGCS
Sbjct  10   EDNKIVSLPGQPQVSFQQYAGYITVDEKQQRALFYYFVEAETNPASKPLVLWLNGGPGCS  69

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            SVG GAF+E GPF P G G  L RN  SWNK +N+L++ESPAGVG+SYS  +S Y    D
Sbjct  70   SVGAGAFSEHGPFRPAG-GVNLTRNEYSWNKEANILYLESPAGVGFSYSANTSFYDSVND  128

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              TA D  +F+ +WF+KFP YK+RD F
Sbjct  129  TITAQDNLVFLQQWFEKFPDYKNRDFF  155



>gb|KJB62986.1| hypothetical protein B456_009G446600 [Gossypium raimondii]
Length=435

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = +2

Query  335  DLVKGLPGQPKVGFKQYAGYVDVDLKA-GRSLFYYFVEAEVNPRLKPLTLWLNggpgcss  511
            DL+  LPGQP V F+Q+AGY+DVD    GRSLFYYFVEAE +P  +PLT+WL  G    S
Sbjct  3    DLISKLPGQPDVNFRQFAGYIDVDENVVGRSLFYYFVEAEKDPLTQPLTVWL-TGGPGCS  61

Query  512  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDAS  691
              G AF  +GPF  T D  GL+ N  SWNK SNLLF++SP G GWSYSNTSSDY  GD S
Sbjct  62   SVGDAFGSVGPFIVTKDAHGLQTNILSWNKVSNLLFIDSPIGSGWSYSNTSSDYNNGDDS  121

Query  692  TASDMHIFMVEWFKKFPSYKSRDL  763
            T   +  FM +W++K+P +KS+DL
Sbjct  122  TNKILLTFMQKWYEKYPVFKSKDL  145



>ref|XP_012072739.1| PREDICTED: serine carboxypeptidase-like 45 [Jatropha curcas]
Length=449

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 109/147 (74%), Gaps = 2/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E++ +  LPGQP+V F+QYAGY+ VD K  R+LFYYFVEAE NP  KPL LWLNGGPGCS
Sbjct  26   EDNKIVSLPGQPQVSFQQYAGYITVDEKQQRALFYYFVEAETNPASKPLVLWLNGGPGCS  85

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            SVG GAF+E GPF P G G  L RN  SWNK +N+L++ESPAGVG+SYS  +S Y    D
Sbjct  86   SVGAGAFSEHGPFRPAG-GVNLTRNEYSWNKEANILYLESPAGVGFSYSANTSFYDSVND  144

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              TA D  +F+ +WF+KFP YK+RD F
Sbjct  145  TITAQDNLVFLQQWFEKFPDYKNRDFF  171



>ref|XP_003592237.1| Serine carboxypeptidase II-3 [Medicago truncatula]
 ref|XP_003601334.1| Serine carboxypeptidase II-3 [Medicago truncatula]
 gb|AES71585.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=495

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 110/148 (74%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            + D +  LPGQP  V F QY+GYV VD +AGR LFYYFVE+  N   KPL LWLNGGPGC
Sbjct  74   QADKIDTLPGQPYGVNFDQYSGYVTVDPEAGRELFYYFVESPYNSSTKPLVLWLNGGPGC  133

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GAF ELGPF    DG+ L RN  +WN+ +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  134  SSLGYGAFQELGPFRINSDGKTLYRNPYAWNEVANVLFLESPAGVGFSYSNTTSDYDKSG  193

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA D ++F+V W ++FP YK+RD +
Sbjct  194  DKSTAKDTYVFLVNWLERFPQYKTRDFY  221



>ref|XP_009130122.1| PREDICTED: serine carboxypeptidase-like 34 [Brassica rapa]
Length=503

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 108/146 (74%), Gaps = 2/146 (1%)
 Frame = +2

Query  335  DLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcssv  514
            DLVK LPGQP V F+QYAGYV V+   GR+LFY+F EA  NP  KPL LWLNGGPGCSSV
Sbjct  53   DLVKELPGQPPVKFRQYAGYVTVNETHGRALFYWFFEATHNPNKKPLLLWLNGGPGCSSV  112

Query  515  gggAFTELGPFYPTGDGR-GLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGDA  688
            G GA  ELGPF+P    +  LR N  SWNKA+NLLF+ESP GVG+SYSNTS D    GD 
Sbjct  113  GFGASEELGPFFPQNSTQPNLRLNPYSWNKAANLLFLESPVGVGFSYSNTSRDISQLGDT  172

Query  689  STASDMHIFMVEWFKKFPSYKSRDLF  766
             TASD + F+V WFK+FP YKSRD +
Sbjct  173  VTASDSYNFLVNWFKRFPQYKSRDFY  198



>gb|EYU37705.1| hypothetical protein MIMGU_mgv1a005479mg [Erythranthe guttata]
Length=482

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 108/146 (74%), Gaps = 1/146 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E D +  LPGQP+V F QY+GYV VD  AGR+LFYYF E+E +   KPL LWLNGGPGCS
Sbjct  70   EVDKILSLPGQPQVNFSQYSGYVTVDPIAGRALFYYFTESE-DSSTKPLVLWLNGGPGCS  128

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDA  688
            S+G GA TELGPF    DG+ L  N  +WN  +N++F+ESPAGVG+SYSN SSDYI GD 
Sbjct  129  SLGAGAMTELGPFRVNPDGKTLWLNKNAWNNEANVVFLESPAGVGFSYSNRSSDYITGDK  188

Query  689  STASDMHIFMVEWFKKFPSYKSRDLF  766
             TA+D + F+V W ++FP YK+RD +
Sbjct  189  QTAADAYTFVVNWLERFPEYKTRDFY  214



>ref|XP_006853074.2| PREDICTED: serine carboxypeptidase II-3 [Amborella trichopoda]
Length=456

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 116/148 (78%), Gaps = 3/148 (2%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            ++++V GL GQP+ V FKQYAGYV +D  AGR+LFYYF EA V+P  KPL LWLNGGPGC
Sbjct  35   KDEIVGGLHGQPEGVEFKQYAGYVTLDETAGRALFYYFAEA-VDPLSKPLLLWLNGGPGC  93

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GA  ELGPF    DG+ L +N  +WNK +N+LF+ESPAGVG+SYSNT++DY + G
Sbjct  94   SSLGYGAMEELGPFRVQSDGKTLYKNRYAWNKVANVLFLESPAGVGYSYSNTTTDYALSG  153

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TASD +IF++ WF++FP YK+R+ +
Sbjct  154  DQRTASDAYIFLINWFERFPEYKNREFY  181



>gb|ACJ85847.1| unknown [Medicago truncatula]
 gb|AFK43110.1| unknown [Medicago truncatula]
Length=316

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 108/148 (73%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            EED V GLPGQP V FKQYAGY++V+   GR+LFY+F E+   P+ KPL LWLNGGPGCS
Sbjct  31   EEDRVYGLPGQPPVNFKQYAGYINVNETHGRALFYWFFESVDQPQTKPLLLWLNGGPGCS  90

Query  509  svgggAFTELGPFYPTGDGR-GLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  682
            S+G G   ELGPF+P    +  L+ N  SWNK +NLLF+ESPAGVG+SY+NT+SD    G
Sbjct  91   SIGYGEAEELGPFFPQNSSQPKLKLNPYSWNKTANLLFLESPAGVGFSYTNTTSDISELG  150

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA D H F++ WFK+FP +KS D +
Sbjct  151  DTITAKDSHTFLINWFKRFPQFKSHDFY  178



>gb|KJB49314.1| hypothetical protein B456_008G112500 [Gossypium raimondii]
Length=482

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E+D +  LPGQP V F QY GYV VD KAGR+L+YYFVEA+ +    PL LWLNGGPGCS
Sbjct  52   EKDRIPKLPGQPHVRFSQYGGYVTVDKKAGRALYYYFVEAQQSKESLPLLLWLNGGPGCS  111

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+  GA  E+GPF    DG+ L RN  SWN A+N+LF+ESPAGVG+SYSNT+SDY   GD
Sbjct  112  SLAYGAMEEIGPFRVHSDGKTLYRNRYSWNHAANVLFLESPAGVGFSYSNTTSDYDRSGD  171

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
            + T  D ++F++ W ++FP YK RD +
Sbjct  172  SKTVVDNYVFLINWLERFPEYKERDFY  198



>ref|XP_008363303.1| PREDICTED: serine carboxypeptidase-like 40 [Malus domestica]
Length=502

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E+D +  LPGQPKV F QY GYV VD KAGR+LFYY VEAE      PL LWLNGGPGCS
Sbjct  75   EKDRIDKLPGQPKVKFSQYGGYVTVDKKAGRALFYYLVEAEKAKDSSPLLLWLNGGPGCS  134

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+  GA  ELGPF    DG+ L RN  SWN A+N+LF+ESPAGVG+SYSN +SDY   GD
Sbjct  135  SLAYGAMLELGPFRIHSDGKTLYRNRFSWNYAANVLFLESPAGVGFSYSNRTSDYDASGD  194

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
             +TA+D ++F+V W ++FP YK R+ +
Sbjct  195  RNTAADNYVFLVNWLERFPEYKGREFY  221



>ref|XP_010041326.1| PREDICTED: serine carboxypeptidase II-3-like [Eucalyptus grandis]
 gb|KCW44445.1| hypothetical protein EUGRSUZ_L02059 [Eucalyptus grandis]
Length=482

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 108/148 (73%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D +  LPGQP  V F QYAGYV V+ KAGR+LFYYFVE+  N   KPL LWLNGGPGC
Sbjct  68   EADKITALPGQPDGVDFDQYAGYVTVNPKAGRALFYYFVESPQNSSTKPLVLWLNGGPGC  127

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  682
            SS+G GA  ELGPF    DG+ L RN+ +WN  +N++F+ESPAGVG+SYSNTSSDY   G
Sbjct  128  SSLGYGAMEELGPFRVHSDGKTLYRNNYAWNNVANVIFLESPAGVGFSYSNTSSDYAKAG  187

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA D + F+V W  +FP YK+RD +
Sbjct  188  DNSTADDSYTFLVNWLDRFPQYKTRDFY  215



>gb|KCW66184.1| hypothetical protein EUGRSUZ_F00022 [Eucalyptus grandis]
Length=480

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 108/148 (73%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D +  LPGQP  V F QYAGYV V+ KAGR+LFYYFVE+  N   KPL LWLNGGPGC
Sbjct  68   EADKITALPGQPDGVDFDQYAGYVTVNPKAGRALFYYFVESPQNSSTKPLVLWLNGGPGC  127

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  682
            SS+G GA  ELGPF    DG+ L RN+ +WN  +N++F+ESPAGVG+SYSNTSSDY   G
Sbjct  128  SSLGYGAMEELGPFRVHSDGKTLYRNNYAWNNVANVIFLESPAGVGFSYSNTSSDYAKAG  187

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA D + F+V W  +FP YK+RD +
Sbjct  188  DNSTADDSYTFLVNWLDRFPQYKTRDFY  215



>gb|KJB63052.1| hypothetical protein B456_009G451300 [Gossypium raimondii]
Length=342

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 103/146 (71%), Gaps = 2/146 (1%)
 Frame = +2

Query  332  EDLVKGLPGQPKVGFKQYAGYVDVDLKA-GRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
             DL+  LPGQP V F+Q+AGY+DVD    GRSLFYYFVEAE +P ++PLT+WL  G    
Sbjct  2    NDLINKLPGQPDVNFRQFAGYIDVDENVDGRSLFYYFVEAEKDPMIQPLTVWL-TGGPGC  60

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDA  688
            S  G  F  +GPF  T D  GL++N  SWNK SNLLF++SP G GWSYSNTSSDY  GD 
Sbjct  61   SSVGDGFASVGPFIVTKDVHGLQKNLFSWNKVSNLLFIDSPIGSGWSYSNTSSDYDNGDD  120

Query  689  STASDMHIFMVEWFKKFPSYKSRDLF  766
            +T + +  FM +W++K+P +KS+ L+
Sbjct  121  ATNTILLTFMQKWYEKYPVFKSKTLY  146



>ref|XP_011025504.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Populus 
euphratica]
Length=498

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E+D ++ LPGQPKV F QY GYV VD  AGR+L+YYF EA+ +    PL LWLNGGPGCS
Sbjct  72   EKDRIESLPGQPKVEFSQYGGYVTVDESAGRALYYYFAEAQHSKESLPLLLWLNGGPGCS  131

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+  GA  ELGPF    DG+ L +N  SWN A+N+LF+ESPAGVG+SYSNT+SDY   GD
Sbjct  132  SLSYGAMQELGPFRVYSDGQALYKNRHSWNYAANVLFLESPAGVGFSYSNTTSDYKKSGD  191

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              TA D ++F+V W ++FP YK RD +
Sbjct  192  KMTAEDNYVFLVNWLERFPEYKDRDFY  218



>gb|EEC75382.1| hypothetical protein OsI_11848 [Oryza sativa Indica Group]
Length=482

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 107/148 (72%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D V  LPGQP + GF QYAGYV V+  +G++LFYYF EA  +P  KPL LWLNGGPGC
Sbjct  65   EADKVSELPGQPGRAGFDQYAGYVTVNATSGKALFYYFAEATDDPSTKPLVLWLNGGPGC  124

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GA  E+GPF+  GD R L  N  +WN  +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  125  SSLGDGAMLEIGPFFVNGDNRTLSINRYAWNNVANMLFLESPAGVGFSYSNTTSDYDNTG  184

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA+D + F+  W ++FP YK RD F
Sbjct  185  DTSTAADAYTFLTNWLERFPEYKGRDFF  212



>emb|CDP19962.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 109/145 (75%), Gaps = 2/145 (1%)
 Frame = +2

Query  335  DLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcss  511
            D +  LPG+PK V F QY+GYV VD KAGR+LFYYF E++ NP  KPL LWLNGGPGCSS
Sbjct  263  DKITALPGEPKGVNFDQYSGYVTVDPKAGRALFYYFAESQ-NPSTKPLVLWLNGGPGCSS  321

Query  512  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDAS  691
            +G GA  ELGPF  T  G+ L +N  +WN  +N++F+ESPAGVG+SYSNTSSDYI GD  
Sbjct  322  LGAGAMNELGPFRVTKGGKMLWKNPYAWNNVANIIFLESPAGVGFSYSNTSSDYITGDTK  381

Query  692  TASDMHIFMVEWFKKFPSYKSRDLF  766
            +A+D + F+V W ++FP YK+RD  
Sbjct  382  SAADAYTFLVNWLERFPEYKTRDFL  406



>ref|XP_007017344.1| Serine carboxypeptidase II-3 chain B isoform 4 [Theobroma cacao]
 gb|EOY14569.1| Serine carboxypeptidase II-3 chain B isoform 4 [Theobroma cacao]
Length=394

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            + D +  LPGQP+ VGF QYAGYV VD  A R+LFYYFVE+ V+P  KPL LWLNGGPGC
Sbjct  2    QADKINALPGQPEGVGFDQYAGYVTVDPVADRALFYYFVESPVDPSKKPLVLWLNGGPGC  61

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  682
            SS G GA  ELGPF    DG  L RN  +WN  +N++F+ESPAGVG+SYS  SSDY   G
Sbjct  62   SSFGYGAMQELGPFRVNSDGETLYRNEYAWNNVANVIFLESPAGVGFSYSKNSSDYTSVG  121

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA D +IF++ W ++FP YK+RD +
Sbjct  122  DRKTAQDSYIFLINWLERFPQYKTRDFY  149



>ref|XP_009354385.1| PREDICTED: serine carboxypeptidase-like 40 [Pyrus x bretschneideri]
Length=502

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 106/147 (72%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E+D +  LPGQP V F QY GYV VD KAGR+LFYY VEAE      PL LWLNGGPGCS
Sbjct  75   EKDRIDKLPGQPNVKFSQYGGYVTVDKKAGRALFYYLVEAEKAKDSSPLLLWLNGGPGCS  134

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+  GA  ELGPF    DG+ L RN  SWN A+N+LF+ESPAGVG+SYSN +SDY   GD
Sbjct  135  SLAYGAMLELGPFRIHSDGKTLYRNRFSWNHAANVLFLESPAGVGFSYSNRTSDYDASGD  194

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
             +TA+D ++F+V W ++FP YK R+ +
Sbjct  195  RNTAADNYVFLVNWLERFPEYKGREFY  221



>ref|XP_011088748.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase II-3-like 
[Sesamum indicum]
Length=468

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 107/146 (73%), Gaps = 1/146 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E D +  LPGQP+V F QY+GYV VD  AGR+LFY+F   + +P  KPL LWLNGGPGCS
Sbjct  52   EADEITDLPGQPQVSFSQYSGYVTVDPVAGRALFYWFTXCDDSPN-KPLVLWLNGGPGCS  110

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDA  688
            S+G GA TELGPF    DG+ L  N   WN  +N+LF+ESPAGVG+SYSNTSSDY+ GD 
Sbjct  111  SIGSGAMTELGPFRVNPDGKTLWYNKNGWNTVANILFLESPAGVGFSYSNTSSDYVTGDT  170

Query  689  STASDMHIFMVEWFKKFPSYKSRDLF  766
             TA+D + F++ W ++FP YK+RD +
Sbjct  171  RTAADSYTFLLNWLERFPEYKTRDFY  196



>gb|KJB79850.1| hypothetical protein B456_013G069700 [Gossypium raimondii]
Length=491

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 106/147 (72%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E D V  LPGQP VGFKQYAGYV V+ K GR+LFY+F EA   P+ +PL LWLNGGPGCS
Sbjct  48   EADRVTKLPGQPTVGFKQYAGYVTVNEKHGRALFYWFFEATSEPQKRPLLLWLNGGPGCS  107

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CGD  685
            S+G G   ELGPF+P  D + L+ N   WNKA+NLLFVESP GVG+SY+NTS D    GD
Sbjct  108  SIGYGQAEELGPFFPKKDQQTLKLNPHRWNKAANLLFVESPVGVGFSYTNTSRDLKELGD  167

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              TA D + F+V WFK+FP +KS D +
Sbjct  168  EITAKDSYAFLVNWFKRFPQFKSHDFY  194



>ref|XP_011091773.1| PREDICTED: serine carboxypeptidase-like 40 [Sesamum indicum]
Length=499

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E D ++ LPGQP V FKQY GYV VD KAGR+ +YYFVEA+ + +  PL LWLNGGPGCS
Sbjct  73   ESDRIERLPGQPPVKFKQYGGYVTVDRKAGRAFYYYFVEAQRSHKSLPLLLWLNGGPGCS  132

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+  GA  ELGPF    DG+ L +N  +WN A+N+LF+ESPAGVG+SYSNT++D+ I GD
Sbjct  133  SLAYGAMQELGPFRVHSDGKTLYKNRFAWNYAANVLFLESPAGVGFSYSNTTTDFEIGGD  192

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              TA D ++F++ W K+FP YK+RD +
Sbjct  193  RKTAMDNYVFLLNWLKRFPEYKNRDFY  219



>ref|XP_010055750.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Eucalyptus 
grandis]
Length=414

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 107/147 (73%), Gaps = 3/147 (2%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            + D +  LPGQPKV F QYAGY+ VD K  R+LFYYF EAE +P LKPL LWLNGGPGCS
Sbjct  32   DADKIASLPGQPKVSFSQYAGYITVDEKQQRALFYYFTEAEADPALKPLVLWLNGGPGCS  91

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            SVG GAF+E GPF P+GD   L +N  SWNK +N+L++ESPAGVG+SYS  +S Y +  D
Sbjct  92   SVGVGAFSEHGPFKPSGD--VLLKNDYSWNKEANMLYIESPAGVGFSYSVNNSFYNLVDD  149

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              TA D   F+  WF+KFP Y+ RDLF
Sbjct  150  KMTARDNLAFLCNWFEKFPQYRERDLF  176



>gb|EPS67442.1| hypothetical protein M569_07330, partial [Genlisea aurea]
Length=408

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 107/145 (74%), Gaps = 1/145 (1%)
 Frame = +2

Query  335  DLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcssv  514
            DLV GLPGQP V FK YAGYV V+   GR+LFY+F EA   P+ KPL LWLNGGPGCSS+
Sbjct  25   DLVIGLPGQPPVSFKHYAGYVTVNPIHGRALFYWFFEASRTPQRKPLVLWLNGGPGCSSI  84

Query  515  gggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGDAS  691
            G G   ELGPF+P  D   L+ NS SWN  +NLLF+ESP GVG+SYSNTSSDY + GD S
Sbjct  85   GYGEAEELGPFFPQPDIPSLKLNSHSWNNVANLLFLESPIGVGFSYSNTSSDYNLLGDKS  144

Query  692  TASDMHIFMVEWFKKFPSYKSRDLF  766
            TA D + F+V WF++FP +KS + +
Sbjct  145  TADDTYRFLVGWFERFPQFKSHEFY  169



>emb|CDP08504.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 109/147 (74%), Gaps = 2/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D +  LPG+P  V F QY+GYV VD KAGR+LFYYF E++ N   KPL LWLNGGPGC
Sbjct  69   EADKITTLPGEPNGVNFDQYSGYVTVDPKAGRALFYYFAESQ-NSSTKPLVLWLNGGPGC  127

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGD  685
            SS+G GA TELGPF  +  G+ L +N  +WN  +N+LF+ESPAGVG+SYSNTSSDYI GD
Sbjct  128  SSLGAGAMTELGPFRVSKGGKTLWKNPYAWNNVANVLFLESPAGVGFSYSNTSSDYITGD  187

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              TA+D + F+V W ++FP YK+RD  
Sbjct  188  TKTAADSYTFLVNWLERFPEYKTRDFL  214



>emb|CDY46950.1| BnaA02g32960D [Brassica napus]
Length=503

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 108/146 (74%), Gaps = 2/146 (1%)
 Frame = +2

Query  335  DLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcssv  514
            DLVK LPGQP V F+QYAGYV V+   GR+LFY+F EA  NP  KPL LWLNGGPGCSSV
Sbjct  53   DLVKELPGQPPVKFRQYAGYVTVNETHGRALFYWFFEATHNPNKKPLLLWLNGGPGCSSV  112

Query  515  gggAFTELGPFYPTGDGR-GLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGDA  688
            G GA  ELGPF+P    +  L+ N  SWNKA+NLLF+ESP GVG+SYSNTS D    GD 
Sbjct  113  GFGASEELGPFFPQNSTQPNLKLNPYSWNKAANLLFLESPVGVGFSYSNTSRDISQLGDT  172

Query  689  STASDMHIFMVEWFKKFPSYKSRDLF  766
             TASD + F+V WFK+FP YKSRD +
Sbjct  173  VTASDSYNFLVNWFKRFPQYKSRDFY  198



>gb|ABK25202.1| unknown [Picea sitchensis]
Length=462

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 111/148 (75%), Gaps = 3/148 (2%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            PE DLV  LPGQP V FKQYAGYV VD K+GR+LFYYFVEAE +  LKPL +WLNGGPGC
Sbjct  21   PESDLVDRLPGQPAVTFKQYAGYVTVDEKSGRALFYYFVEAETDSNLKPLVVWLNGGPGC  80

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  682
            SS G GA +E GPF+P G G+ L  N  SWNK +N+L++E+PAGVG+SYSN ++ Y+   
Sbjct  81   SSFGVGALSENGPFHPRG-GK-LFGNEYSWNKEANMLYLETPAGVGFSYSNDTTYYLGAN  138

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DA TA D   F+  WF KFP YK+RDL+
Sbjct  139  DAKTAEDNLQFLHGWFDKFPEYKTRDLY  166



>ref|XP_010916829.1| PREDICTED: serine carboxypeptidase II-3-like [Elaeis guineensis]
Length=459

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 109/148 (74%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D +  LPGQP+ V F QYAGYV VD +AGR+LFYYFVE+  +P  KPL LWLNGGPGC
Sbjct  44   EADKIDELPGQPEGVNFDQYAGYVTVDPEAGRALFYYFVESPQDPSTKPLVLWLNGGPGC  103

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GA  ELGPF    DGR L  N  +WN  +N++F+ESPAGVG+SYSNT++DY + G
Sbjct  104  SSLGAGAMVELGPFGVNSDGRTLYANIHAWNIVANVIFLESPAGVGFSYSNTTTDYELSG  163

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA D + F+V W ++FP YK+RD +
Sbjct  164  DKRTAEDSYTFLVNWLERFPQYKTRDFY  191



>ref|XP_007212080.1| hypothetical protein PRUPE_ppa005035mg [Prunus persica]
 gb|EMJ13279.1| hypothetical protein PRUPE_ppa005035mg [Prunus persica]
Length=480

 Score =   157 bits (396),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 108/146 (74%), Gaps = 1/146 (1%)
 Frame = +2

Query  332  EDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcss  511
            +DLV  LPGQP V FK YAGYV V+   GR+LFY+F EA  NP  KPL LWLNGGPGCSS
Sbjct  44   QDLVTNLPGQPAVDFKHYAGYVTVNQTNGRALFYWFYEAATNPDAKPLVLWLNGGPGCSS  103

Query  512  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGDA  688
            VG GA  E+GPF    DG G+R N+ SWNK +N+LF+ESP GVG+SYSNT+SDY   GD 
Sbjct  104  VGYGATQEIGPFIVDTDGHGIRFNNYSWNKEANMLFLESPVGVGFSYSNTTSDYENLGDV  163

Query  689  STASDMHIFMVEWFKKFPSYKSRDLF  766
             TA+D + F+ +WF KFPSY++R  +
Sbjct  164  FTANDAYNFLHKWFLKFPSYRTRTFY  189



>ref|XP_007017343.1| Serine carboxypeptidase II-3 chain B isoform 3, partial [Theobroma 
cacao]
 gb|EOY14568.1| Serine carboxypeptidase II-3 chain B isoform 3, partial [Theobroma 
cacao]
Length=411

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            + D +  LPGQP+ VGF QYAGYV VD  A R+LFYYFVE+ V+P  KPL LWLNGGPGC
Sbjct  69   QADKINALPGQPEGVGFDQYAGYVTVDPVADRALFYYFVESPVDPSKKPLVLWLNGGPGC  128

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  682
            SS G GA  ELGPF    DG  L RN  +WN  +N++F+ESPAGVG+SYS  SSDY   G
Sbjct  129  SSFGYGAMQELGPFRVNSDGETLYRNEYAWNNVANVIFLESPAGVGFSYSKNSSDYTSVG  188

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA D +IF++ W ++FP YK+RD +
Sbjct  189  DRKTAQDSYIFLINWLERFPQYKTRDFY  216



>gb|KDO75846.1| hypothetical protein CISIN_1g0117382mg, partial [Citrus sinensis]
 gb|KDO75847.1| hypothetical protein CISIN_1g0117382mg, partial [Citrus sinensis]
Length=318

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 108/146 (74%), Gaps = 1/146 (1%)
 Frame = +2

Query  332  EDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcss  511
            EDLV  LPGQP V F+ YAGYV V+   GR+LFY+F EA   P+ KPL LWLNGGPGCSS
Sbjct  46   EDLVTNLPGQPNVDFRHYAGYVTVNEHNGRALFYWFYEAMTRPQEKPLVLWLNGGPGCSS  105

Query  512  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGDA  688
            VG GA  E+GPF    DGRGL+ N  +WNK +N+LF+ESP GVG+SYSNT++DY + GD 
Sbjct  106  VGYGATQEIGPFLVDTDGRGLQFNPYAWNKEANMLFLESPIGVGFSYSNTTNDYEMLGDD  165

Query  689  STASDMHIFMVEWFKKFPSYKSRDLF  766
             TA+D + F+ +WF KFPSY+ R  +
Sbjct  166  FTANDSYTFLHKWFLKFPSYRRRTFY  191



>gb|AAQ63884.1| putative serine carboxypeptidase [Medicago truncatula]
Length=495

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = +2

Query  326  PEEDL-----VKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWL  487
            P+E+L     +  LPGQP  V F QY+GYV VD +AGR LFYYFVE+  N   KPL LWL
Sbjct  68   PQEELRLADKIVTLPGQPYGVNFDQYSGYVTVDPEAGRELFYYFVESPHNSYTKPLILWL  127

Query  488  NggpgcssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSS  667
            NGGPGCSS+G GAF ELGPF    DG+ L RN  +WN+ +N+LF+ESPAGVG+SYSNTSS
Sbjct  128  NGGPGCSSLGYGAFEELGPFRVNSDGKTLYRNPYAWNEVANVLFLESPAGVGFSYSNTSS  187

Query  668  DY-ICGDASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DY   GD STA D ++F++ W ++FP YK+RD +
Sbjct  188  DYDNSGDKSTAKDAYVFLINWLERFPQYKTRDFY  221



>ref|XP_003592239.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003601336.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES71587.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=495

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = +2

Query  326  PEEDL-----VKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWL  487
            P+E+L     +  LPGQP  V F QY+GYV VD +AGR LFYYFVE+  N   KPL LWL
Sbjct  68   PQEELRLADKIVTLPGQPYGVNFDQYSGYVTVDPEAGRELFYYFVESPHNSYTKPLILWL  127

Query  488  NggpgcssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSS  667
            NGGPGCSS+G GAF ELGPF    DG+ L RN  +WN+ +N+LF+ESPAGVG+SYSNTSS
Sbjct  128  NGGPGCSSLGYGAFEELGPFRVNSDGKTLYRNPYAWNEVANVLFLESPAGVGFSYSNTSS  187

Query  668  DY-ICGDASTASDMHIFMVEWFKKFPSYKSRDLF  766
            DY   GD STA D ++F++ W ++FP YK+RD +
Sbjct  188  DYDNSGDKSTAKDAYVFLINWLERFPQYKTRDFY  221



>ref|XP_002318164.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
 gb|EEE96384.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
Length=463

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 110/148 (74%), Gaps = 3/148 (2%)
 Frame = +2

Query  326  PEEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            P  D + GLPGQP VGF+Q++GYV VD    R+LFYYFVEAE++P  KPL LWLNGGPGC
Sbjct  29   PHPDKIAGLPGQPHVGFQQFSGYVTVDGNKHRALFYYFVEAEIDPASKPLVLWLNGGPGC  88

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-G  682
            SS+G GAF+E GPF P  +GR L RN  SWN+ +N+L++E+P GVG+SYS  +S Y+   
Sbjct  89   SSLGVGAFSENGPFRP--NGRVLIRNEHSWNREANMLYLETPVGVGFSYSTDNSSYVAVD  146

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D +TA D  +F+  WF KFP Y+++DLF
Sbjct  147  DEATARDNLVFLQGWFHKFPQYRNKDLF  174



>ref|XP_010279510.1| PREDICTED: serine carboxypeptidase-like 40 [Nelumbo nucifera]
Length=493

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 108/147 (73%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E+D +K LPGQP V F QY GYV VD  AGR+L+YYF E+  N + KPL LWLNGGPGCS
Sbjct  67   EKDRIKRLPGQPPVRFSQYGGYVTVDESAGRALYYYFAESHYNKKSKPLLLWLNGGPGCS  126

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-GD  685
            S+G GA  ELGPF    DG+ L  N  +WNK +N+LF+ESPAGVG+SYSN +SDY   GD
Sbjct  127  SLGYGAMEELGPFRVKSDGKTLYENPFAWNKVANVLFLESPAGVGFSYSNRTSDYATRGD  186

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
             +TA D ++F+V W ++FP YK+RD +
Sbjct  187  RNTAEDNYVFLVNWLERFPEYKTRDFY  213



>ref|XP_010454603.1| PREDICTED: serine carboxypeptidase-like 34 [Camelina sativa]
Length=501

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 106/146 (73%), Gaps = 2/146 (1%)
 Frame = +2

Query  335  DLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcssv  514
            D VK LPGQP V F+QYAGYV V+   GR+LFY+F EA  NP  KPL LWLNGGPGCSSV
Sbjct  52   DRVKELPGQPPVKFRQYAGYVTVNETHGRALFYWFFEATHNPSKKPLLLWLNGGPGCSSV  111

Query  515  gggAFTELGPFYPTGDGR-GLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGDA  688
            G GA  ELGPF+P    +  L+ N  SWNKA+NLLF+ESP GVG+SYSNTS D    GD 
Sbjct  112  GFGASEELGPFFPQNSSQPNLKLNPYSWNKAANLLFLESPVGVGFSYSNTSRDISQLGDT  171

Query  689  STASDMHIFMVEWFKKFPSYKSRDLF  766
             TASD H F+V WFK+FP YKS D F
Sbjct  172  VTASDSHNFLVNWFKRFPQYKSHDFF  197



>gb|EEE59169.1| hypothetical protein OsJ_11092 [Oryza sativa Japonica Group]
Length=482

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D V  LPGQP + GF QYAGYV V+  +G++LFYYF EA  +P  KPL LWLNGGPGC
Sbjct  65   EADKVSELPGQPGRAGFDQYAGYVTVNATSGKALFYYFAEATDDPSTKPLVLWLNGGPGC  124

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GA  E+GPF   GD R L  N  +WN  +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  125  SSLGDGAMLEIGPFLVNGDNRTLSINRYAWNNVANMLFLESPAGVGFSYSNTTSDYDNTG  184

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA+D + F+  W ++FP YK RD F
Sbjct  185  DTSTAADAYTFLTNWLERFPEYKGRDFF  212



>ref|XP_003607259.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES89456.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=467

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 109/148 (74%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            EED V GLPGQP V FKQYAGY++V+   GR+LFY+F E+   P+ KPL LWLNGGPGCS
Sbjct  31   EEDRVYGLPGQPPVNFKQYAGYINVNETHGRALFYWFFESVDQPQTKPLLLWLNGGPGCS  90

Query  509  svgggAFTELGPFYPTGDGR-GLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  682
            S+G G   ELGPF+P    +  L+ N  SWNKA+NLLF+ESPAGVG+SY+NT+SD    G
Sbjct  91   SIGYGEAEELGPFFPQNSSQPKLKLNPYSWNKAANLLFLESPAGVGFSYTNTTSDISELG  150

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA D H F++ WFK+FP +KS D +
Sbjct  151  DTITAKDSHTFLINWFKRFPQFKSHDFY  178



>gb|KDO83297.1| hypothetical protein CISIN_1g015244mg [Citrus sinensis]
Length=410

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E D ++ LPGQP+V F QY GYV VD  AGR+++YYFVEA+ +    PL LWLNGGPGCS
Sbjct  71   ENDRIEKLPGQPEVEFSQYGGYVTVDESAGRAMYYYFVEAQKSKDSAPLLLWLNGGPGCS  130

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+  GA  ELGPF    DG+ L RN  SWN A+N+LF+ESPAGVG+SYSN +SDY   GD
Sbjct  131  SLAYGAMQELGPFRVRSDGKSLFRNRYSWNNAANVLFLESPAGVGFSYSNRTSDYDESGD  190

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              TA+D ++F+V W ++FP YK R+ +
Sbjct  191  RKTAADNYMFLVNWLERFPEYKGREFY  217



>ref|XP_010413138.1| PREDICTED: serine carboxypeptidase-like 40 [Camelina sativa]
Length=532

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            + DL++ LPGQP V F QY GYV V+  AGRS FYYFVEA  +    PL LWLNGGPGCS
Sbjct  108  KRDLIRRLPGQPPVDFDQYGGYVTVNESAGRSFFYYFVEASKSKDSSPLLLWLNGGPGCS  167

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+  GA  ELGPF    DG+ L RN  +WN A+N+LF+ESPAGVG+SY+NT+SD    GD
Sbjct  168  SLAYGALQELGPFRVHSDGKTLFRNRDAWNNAANVLFLESPAGVGFSYTNTTSDMEKHGD  227

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
             +TA+D +IF+V+W ++FP+YK RDL+
Sbjct  228  RNTAADNYIFLVKWLERFPAYKGRDLY  254



>ref|XP_006830191.1| PREDICTED: serine carboxypeptidase II-3 [Amborella trichopoda]
 gb|ERM97607.1| hypothetical protein AMTR_s00173p00045470 [Amborella trichopoda]
Length=489

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 110/146 (75%), Gaps = 2/146 (1%)
 Frame = +2

Query  335  DLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcss  511
            D ++ LPGQP+ V F+QY+GYV VD  AGR+LFYYFVE+  +   KPL +WLNGGPGCSS
Sbjct  76   DKIEKLPGQPQGVDFEQYSGYVTVDPTAGRALFYYFVESPADSATKPLVIWLNGGPGCSS  135

Query  512  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGDA  688
            +G GA  ELGPF    DG+ L RN  +WN+ +N+LF+ESPAGVG+SYSNTSSDY + GD 
Sbjct  136  LGYGAMEELGPFRVMSDGKTLFRNPYAWNQVANMLFLESPAGVGFSYSNTSSDYKLSGDK  195

Query  689  STASDMHIFMVEWFKKFPSYKSRDLF  766
             TA D + F+V W ++FP YK+RD F
Sbjct  196  RTARDAYTFLVNWLERFPEYKTRDFF  221



>ref|XP_004230807.1| PREDICTED: serine carboxypeptidase-like 26 [Solanum lycopersicum]
Length=508

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 112/151 (74%), Gaps = 5/151 (3%)
 Frame = +2

Query  329  EEDLVK-GLPGQPK--VGFKQYAGYVDVDLKAGRSLFYYFVE-AEVNPRLKPLTLWLNgg  496
            E+DL+K GLPGQPK  V F QYAGYV+VD K GRSLFYYF E A  N   KPL LWLNGG
Sbjct  85   EDDLIKYGLPGQPKLNVKFNQYAGYVNVDEKNGRSLFYYFAESASGNASSKPLVLWLNGG  144

Query  497  pgcssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI  676
            PGCSS+G GA  ELGPF    DG+ L   + +WNK +N++F+ESPAGVG+SYSNTSSDY 
Sbjct  145  PGCSSLGFGAMLELGPFGVKPDGKTLYSRTFAWNKVANVMFLESPAGVGFSYSNTSSDYA  204

Query  677  -CGDASTASDMHIFMVEWFKKFPSYKSRDLF  766
              GD  TA D + F+V WFK+FP YKSRD +
Sbjct  205  QSGDKRTAQDAYRFLVNWFKRFPHYKSRDFY  235



>gb|AAT78819.1| putative serine carboxypeptidase [Oryza sativa Japonica Group]
Length=486

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQP-KVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D V  LPGQP + GF QYAGYV V+  +G++LFYYF EA  +P  KPL LWLNGGPGC
Sbjct  65   EADKVSELPGQPGRAGFDQYAGYVTVNATSGKALFYYFAEATDDPSTKPLVLWLNGGPGC  124

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS+G GA  E+GPF   GD R L  N  +WN  +N+LF+ESPAGVG+SYSNT+SDY   G
Sbjct  125  SSLGDGAMLEIGPFLVNGDNRTLSINRYAWNNVANMLFLESPAGVGFSYSNTTSDYDNTG  184

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D STA+D + F+  W ++FP YK RD F
Sbjct  185  DTSTAADAYTFLTNWLERFPEYKGRDFF  212



>gb|KEH30582.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=465

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 109/148 (74%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            EED V GLPGQP V FKQYAGY++V+   GR+LFY+F E+   P+ KPL LWLNGGPGCS
Sbjct  31   EEDRVYGLPGQPPVNFKQYAGYINVNETHGRALFYWFFESVDQPQTKPLLLWLNGGPGCS  90

Query  509  svgggAFTELGPFYPTGDGR-GLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  682
            S+G G   ELGPF+P    +  L+ N  SWNKA+NLLF+ESPAGVG+SY+NT+SD    G
Sbjct  91   SIGYGEAEELGPFFPQNSSQPKLKLNPYSWNKAANLLFLESPAGVGFSYTNTTSDISELG  150

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA D H F++ WFK+FP +KS D +
Sbjct  151  DTITAKDSHTFLINWFKRFPQFKSHDFY  178



>gb|KJB63053.1| hypothetical protein B456_009G451300 [Gossypium raimondii]
Length=443

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 103/145 (71%), Gaps = 2/145 (1%)
 Frame = +2

Query  335  DLVKGLPGQPKVGFKQYAGYVDVDLKA-GRSLFYYFVEAEVNPRLKPLTLWLNggpgcss  511
            DL+  LPGQP V F+Q+AGY+DVD    GRSLFYYFVEAE +P ++PLT+WL  G    S
Sbjct  3    DLINKLPGQPDVNFRQFAGYIDVDENVDGRSLFYYFVEAEKDPMIQPLTVWL-TGGPGCS  61

Query  512  vgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYICGDAS  691
              G  F  +GPF  T D  GL++N  SWNK SNLLF++SP G GWSYSNTSSDY  GD +
Sbjct  62   SVGDGFASVGPFIVTKDVHGLQKNLFSWNKVSNLLFIDSPIGSGWSYSNTSSDYDNGDDA  121

Query  692  TASDMHIFMVEWFKKFPSYKSRDLF  766
            T + +  FM +W++K+P +KS+ L+
Sbjct  122  TNTILLTFMQKWYEKYPVFKSKTLY  146



>emb|CBI19568.3| unnamed protein product [Vitis vinifera]
Length=1017

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            ++D ++ LPGQP+ V F QYAGYV VD KAGR+LFYYFVE+  +   KPL LWLNGGPGC
Sbjct  603  QDDKIESLPGQPEGVNFDQYAGYVTVDPKAGRALFYYFVESPEDSSTKPLVLWLNGGPGC  662

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYI-CG  682
            SS+G GA  ELGPF    DG+ L RN  +WN  SN++F+ESPAGVG+SYSNTSSDY+  G
Sbjct  663  SSLGYGAMEELGPFRVNPDGKTLFRNEYAWNNVSNVIFLESPAGVGFSYSNTSSDYVNVG  722

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA D + F++ W ++FP YK+RD F
Sbjct  723  DKKTAEDSYTFLINWLERFPQYKTRDFF  750


 Score =   147 bits (372),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 105/148 (71%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E   ++ LPGQP  V F Q++GYV VD  AGR+LFYYFVE+  N   KPL LWLNGGPGC
Sbjct  84   ESHKIESLPGQPNGVDFDQFSGYVTVDSLAGRALFYYFVESPQNSTTKPLVLWLNGGPGC  143

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICG  682
            SS G GA  ELGPF    DG  L  N  +WNK +N++F+ESPAGVG+SYS+T+SDY   G
Sbjct  144  SSFGIGAMMELGPFRVNKDGETLYLNKHAWNKEANIIFLESPAGVGFSYSDTASDYNSSG  203

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TASD +IF++ W + FP YK+RD F
Sbjct  204  DYRTASDSYIFLLSWLEIFPEYKTRDFF  231



>ref|XP_010512774.1| PREDICTED: serine carboxypeptidase-like 40 isoform X1 [Camelina 
sativa]
 ref|XP_010512775.1| PREDICTED: serine carboxypeptidase-like 40 isoform X2 [Camelina 
sativa]
Length=501

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            + DL++ LPGQP V F QY GYV V+  AGRS FYYFVEA  +    PL LWLNGGPGCS
Sbjct  77   KRDLIRTLPGQPPVDFDQYGGYVTVNESAGRSFFYYFVEASKSKDSSPLLLWLNGGPGCS  136

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+  GA  ELGPF    DG+ L RN  +WN A+N+LF+ESPAGVG+SY+NT+SD    GD
Sbjct  137  SLAYGALQELGPFRVHSDGKTLFRNRYAWNNAANVLFLESPAGVGFSYTNTTSDMEKHGD  196

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
             +TA+D +IF+V+W ++FP+YK RDL+
Sbjct  197  RNTAADNYIFLVKWLERFPAYKGRDLY  223



>ref|XP_008809533.1| PREDICTED: putative serine carboxypeptidase-like 23 [Phoenix 
dactylifera]
Length=735

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPK-VGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgc  505
            E D ++ LPGQP+ V F QYAGYV VD K  R+LFYYFVE+  N   KPL LWLNGGPGC
Sbjct  9    EADKIEALPGQPEGVNFNQYAGYVTVDPKKERALFYYFVESPYNSSTKPLVLWLNGGPGC  68

Query  506  ssvgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYIC-G  682
            SS G GA  ELGPF    DG+ L RN  +WN  +N+LF+ESPAGVG+SYSNTS+DY   G
Sbjct  69   SSFGYGAMQELGPFRVERDGKTLSRNQYAWNNVANVLFLESPAGVGFSYSNTSTDYTSNG  128

Query  683  DASTASDMHIFMVEWFKKFPSYKSRDLF  766
            D  TA D + F+V W ++FP YKSRD F
Sbjct  129  DKRTAKDSYTFLVNWLERFPQYKSRDFF  156



>ref|XP_010468839.1| PREDICTED: serine carboxypeptidase-like 40 [Camelina sativa]
Length=501

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            + DL++ LPGQP V F QY GYV V+  AGRS FYYFVEA  +    PL LWLNGGPGCS
Sbjct  77   KRDLIRRLPGQPPVDFDQYGGYVTVNESAGRSFFYYFVEASKSKDSSPLLLWLNGGPGCS  136

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+  GA  ELGPF    DG+ L RN  +WN A+N+LF+ESPAGVG+SY+NT+SD    GD
Sbjct  137  SLAYGALQELGPFRVHSDGKTLFRNRYAWNNAANVLFLESPAGVGFSYTNTTSDMEKHGD  196

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
             +TA+D +IF+V+W ++FP+YK RDL+
Sbjct  197  RNTAADNYIFLVKWLERFPAYKGRDLY  223



>ref|XP_009592794.1| PREDICTED: serine carboxypeptidase-like 40 [Nicotiana tomentosiformis]
Length=499

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            E D ++ LPGQP+V F+QY GYV VD  AGR+ +YYFVEA+ +    PL LWLNGGPGCS
Sbjct  76   ENDKIQKLPGQPRVRFEQYGGYVTVDESAGRAFYYYFVEAQRSKDSLPLLLWLNGGPGCS  135

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+  GAF ELGPF    DG+ L +N  +WN A+N+LF+ESPAGVG+SYSNTSSD  I GD
Sbjct  136  SLAYGAFQELGPFRVNSDGKTLHKNKFAWNHAANVLFLESPAGVGFSYSNTSSDVKIGGD  195

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
              TA D + F+V W ++FP YK +D +
Sbjct  196  RKTAKDNYQFLVNWLERFPEYKDKDFY  222



>ref|XP_006292523.1| hypothetical protein CARUB_v10018754mg, partial [Capsella rubella]
 gb|EOA25421.1| hypothetical protein CARUB_v10018754mg, partial [Capsella rubella]
Length=450

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 108/147 (73%), Gaps = 1/147 (1%)
 Frame = +2

Query  329  EEDLVKGLPGQPKVGFKQYAGYVDVDLKAGRSLFYYFVEAEVNPRLKPLTLWLNggpgcs  508
            + DL++ LPGQP V F QY GYV V+  AGRS FYYFVEA  +    PL LWLNGGPGCS
Sbjct  28   KRDLIRRLPGQPPVDFDQYGGYVTVNESAGRSFFYYFVEASKSKDSSPLLLWLNGGPGCS  87

Query  509  svgggAFTELGPFYPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDY-ICGD  685
            S+  GA  ELGPF    DG+ L RN  +WN A+N+LF+ESPAGVG+SY+NT+SD    GD
Sbjct  88   SLAYGALQELGPFRVHSDGKTLFRNRYAWNNAANVLFLESPAGVGFSYTNTTSDMEKHGD  147

Query  686  ASTASDMHIFMVEWFKKFPSYKSRDLF  766
             +TA+D +IF+V+W ++FP YK RDL+
Sbjct  148  RNTAADNYIFLVKWLERFPEYKDRDLY  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1524835419250