BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8786

Length=717
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010100044.1|  hypothetical protein L484_013156                 70.9    1e-10   
ref|XP_009359891.1|  PREDICTED: uncharacterized protein LOC103950...  67.0    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_007222390.1|  hypothetical protein PRUPE_ppa004878mg           65.9    4e-09   
ref|XP_008222369.1|  PREDICTED: uncharacterized protein LOC103322249  65.5    6e-09   Prunus mume [ume]
ref|XP_008390187.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  63.2    4e-08   
ref|XP_009378816.1|  PREDICTED: uncharacterized protein LOC103967265  62.0    8e-08   
ref|XP_009359892.1|  PREDICTED: uncharacterized protein LOC103950...  60.1    4e-07   
emb|CAN81746.1|  hypothetical protein VITISV_038195                   58.5    1e-06   Vitis vinifera
ref|XP_002267942.2|  PREDICTED: uncharacterized protein LOC100260846  58.5    1e-06   
ref|XP_004239298.1|  PREDICTED: uncharacterized protein LOC101253187  55.8    1e-05   Solanum lycopersicum
ref|XP_008369644.1|  PREDICTED: uncharacterized protein LOC103433181  55.5    1e-05   
ref|XP_006343189.1|  PREDICTED: uncharacterized protein LOC102581164  54.3    4e-05   Solanum tuberosum [potatoes]
ref|XP_009597749.1|  PREDICTED: uncharacterized protein LOC104093...  54.3    4e-05   Nicotiana tomentosiformis
ref|XP_009597748.1|  PREDICTED: uncharacterized protein LOC104093...  53.9    4e-05   Nicotiana tomentosiformis
ref|XP_008459909.1|  PREDICTED: uncharacterized protein LOC103498889  53.5    6e-05   Cucumis melo [Oriental melon]
ref|XP_011656790.1|  PREDICTED: coiled-coil domain-containing pro...  53.1    7e-05   Cucumis sativus [cucumbers]
ref|XP_012088735.1|  PREDICTED: coiled-coil domain-containing pro...  52.4    2e-04   Jatropha curcas
ref|XP_006286776.1|  hypothetical protein CARUB_v10003326mg           52.0    2e-04   Capsella rubella
ref|XP_007043825.1|  Uncharacterized protein isoform 4                51.6    3e-04   
ref|XP_007043827.1|  Uncharacterized protein isoform 6                51.6    3e-04   
ref|XP_009781778.1|  PREDICTED: uncharacterized protein LOC104230...  51.6    3e-04   Nicotiana sylvestris
ref|XP_009781777.1|  PREDICTED: uncharacterized protein LOC104230...  51.2    4e-04   Nicotiana sylvestris
ref|XP_007043824.1|  Uncharacterized protein isoform 3                51.2    4e-04   
ref|XP_007043823.1|  Uncharacterized protein isoform 2                50.8    5e-04   
ref|XP_007043822.1|  Uncharacterized protein isoform 1                50.4    6e-04   
ref|XP_004310133.1|  PREDICTED: coiled-coil domain-containing pro...  50.4    7e-04   Fragaria vesca subsp. vesca



>ref|XP_010100044.1| hypothetical protein L484_013156 [Morus notabilis]
 gb|EXB81215.1| hypothetical protein L484_013156 [Morus notabilis]
Length=464

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 106/157 (68%), Gaps = 18/157 (11%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESGV---LNppaaassaprpHHGRsssvsgmssIKRTQNvaak  409
            ME RRTDSPVYAR W+SESG     +  + A S  R  H RSSS SG+S+IKRTQN AAK
Sbjct  1    MERRRTDSPVYARQWTSESGTTIPASQSSPAMSPARNRHARSSSSSGISNIKRTQNFAAK  60

Query  410  aaaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkingna  586
            AAAQRLAQVMASQ AA  DEDEDED+ DLGFR+ APPPL LSRT                
Sbjct  61   AAAQRLAQVMASQTAA--DEDEDEDDGDLGFRYSAPPPLSLSRTVKS------------G  106

Query  587  akasassskissrssspsLAQNMVEETPSHRSTSAGR  697
            A   A  S  ++RS SPSLAQN VEETPS RSTS GR
Sbjct  107  ATKPAVPSAKTTRSPSPSLAQNFVEETPSARSTSTGR  143



>ref|XP_009359891.1| PREDICTED: uncharacterized protein LOC103950414 isoform X1 [Pyrus 
x bretschneideri]
Length=563

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 109/162 (67%), Gaps = 18/162 (11%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESG--VLNppaaassaprpHHGRsssvsgmssIKRTQNvaaka  412
            M+ RRTDSPVYAR W+SES   V    + A S  R HH RSSS SG+S+IKRTQN AAKA
Sbjct  1    MDRRRTDSPVYARQWTSESATTVGGATSPAMSPVRGHHARSSSASGISNIKRTQNFAAKA  60

Query  413  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkingnaa  589
            AAQRLAQVMASQ A      +D+++DDLGFR+ APPPL LSR A+ P            A
Sbjct  61   AAQRLAQVMASQTAD----GDDDEDDDLGFRYSAPPPLSLSRNANSP-----------GA  105

Query  590  kasassskissrssspsLAQNMVEETPSHRSTSAGRSLTSTR  715
            K  A S K ++RS SP+LA+N ++ETP  RSTSAGR   S R
Sbjct  106  KPGAPSLKSTTRSPSPALARNSLDETPQVRSTSAGRPAMSLR  147



>ref|XP_007222390.1| hypothetical protein PRUPE_ppa004878mg [Prunus persica]
 gb|EMJ23589.1| hypothetical protein PRUPE_ppa004878mg [Prunus persica]
Length=487

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 100/162 (62%), Gaps = 17/162 (10%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESGVL--NppaaassaprpHHGRsssvsgmssIKRTQNvaaka  412
            M+ RRTDSPVYAR W+SES        + A S  R HH RSSS SG+S+IKRTQN AAKA
Sbjct  1    MDRRRTDSPVYARQWTSESSTTLGGATSPAMSPVRGHHARSSSASGISNIKRTQNFAAKA  60

Query  413  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkingnaa  589
            AAQRLAQVMASQ A      +D++ DDLGFR+ APPPL LSR  + P           A 
Sbjct  61   AAQRLAQVMASQTADD----DDDEEDDLGFRYSAPPPLSLSRNVNSP----------GAK  106

Query  590  kasassskissrssspsLAQNMVEETPSHRSTSAGRSLTSTR  715
              + SS   +   S  +LAQN VEETP  RSTS GR   S R
Sbjct  107  PVAPSSRTTTRSPSPAALAQNPVEETPQVRSTSTGRPSMSLR  148



>ref|XP_008222369.1| PREDICTED: uncharacterized protein LOC103322249 [Prunus mume]
Length=563

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 101/162 (62%), Gaps = 17/162 (10%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESG--VLNppaaassaprpHHGRsssvsgmssIKRTQNvaaka  412
            M+ RRTDSPVYAR W+SES   +    + A S  R HH RSSS SG+S+IKRTQN AAKA
Sbjct  1    MDRRRTDSPVYARQWTSESSSTLGGATSPAMSPVRGHHARSSSASGISNIKRTQNFAAKA  60

Query  413  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkingnaa  589
            AAQRLAQVMASQ A      +D++ DDLGFR+ APPPL LSR  + P           A 
Sbjct  61   AAQRLAQVMASQTADD----DDDEEDDLGFRYSAPPPLSLSRNVNSP----------GAK  106

Query  590  kasassskissrssspsLAQNMVEETPSHRSTSAGRSLTSTR  715
              + SS   +   S  +LAQN VEETP  RSTS GR   S R
Sbjct  107  PVAPSSRTTTRSPSPVALAQNPVEETPQVRSTSTGRPSMSLR  148



>ref|XP_008390187.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103452479 
[Malus domestica]
Length=563

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 109/162 (67%), Gaps = 18/162 (11%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESG--VLNppaaassaprpHHGRsssvsgmssIKRTQNvaaka  412
            M+ RRTDSPVYAR W+SES   V    + A S  R HH RSSS SG+S+IKRTQN AAKA
Sbjct  1    MDRRRTDSPVYARQWTSESATTVGGATSPAMSPVRGHHARSSSASGVSNIKRTQNFAAKA  60

Query  413  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkingnaa  589
            AAQRLAQVMASQ A     D+D+++DDLGFR+ APPPL LSR A+ P            A
Sbjct  61   AAQRLAQVMASQTAD----DDDDEDDDLGFRYSAPPPLSLSRNANSP-----------GA  105

Query  590  kasassskissrssspsLAQNMVEETPSHRSTSAGRSLTSTR  715
            K +A S + ++RS SP+LA+  ++ETP  RSTS GR   S R
Sbjct  106  KPAAPSLRATTRSPSPALARTSLDETPQVRSTSTGRPAMSLR  147



>ref|XP_009378816.1| PREDICTED: uncharacterized protein LOC103967265 [Pyrus x bretschneideri]
Length=562

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 109/162 (67%), Gaps = 18/162 (11%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSES--GVLNppaaassaprpHHGRsssvsgmssIKRTQNvaaka  412
            M+ RRTDSPVYAR W+SES   V    + A S  R HH RSSS SG+S+IKRTQN AAKA
Sbjct  1    MDRRRTDSPVYARQWTSESTATVGGATSPAMSPVRGHHARSSSTSGVSNIKRTQNFAAKA  60

Query  413  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkingnaa  589
            AAQRLAQVMASQ A     D+D+++DDLGFR+ APPPL LSR A+ P            A
Sbjct  61   AAQRLAQVMASQTAD----DDDDEDDDLGFRYSAPPPLSLSRNANSP-----------GA  105

Query  590  kasassskissrssspsLAQNMVEETPSHRSTSAGRSLTSTR  715
            K +A S + ++RS SP+LA+  ++ETP  RSTS GR   S R
Sbjct  106  KPAAPSLRATTRSPSPALARTSLDETPQVRSTSTGRPAMSLR  147



>ref|XP_009359892.1| PREDICTED: uncharacterized protein LOC103950414 isoform X2 [Pyrus 
x bretschneideri]
Length=479

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 79/107 (74%), Gaps = 7/107 (7%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESG--VLNppaaassaprpHHGRsssvsgmssIKRTQNvaaka  412
            M+ RRTDSPVYAR W+SES   V    + A S  R HH RSSS SG+S+IKRTQN AAKA
Sbjct  1    MDRRRTDSPVYARQWTSESATTVGGATSPAMSPVRGHHARSSSASGISNIKRTQNFAAKA  60

Query  413  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGP  550
            AAQRLAQVMASQ A      +D+++DDLGFR+ APPPL LSR A+ P
Sbjct  61   AAQRLAQVMASQTAD----GDDDEDDDLGFRYSAPPPLSLSRNANSP  103



>emb|CAN81746.1| hypothetical protein VITISV_038195 [Vitis vinifera]
Length=516

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 97/155 (63%), Gaps = 20/155 (13%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNvaakaaa  418
            M+  R+DS V  R WSSESG     + A S    HH RS+S +G+S+IKRTQN AAKAAA
Sbjct  1    MDRTRSDSTVIGRQWSSESGATGTSSPAMSPSLYHHSRSASATGISNIKRTQNFAAKAAA  60

Query  419  qrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTA-SGPPNTsnnkingnaak  592
            QRLAQVMASQ A    +DED+++DDLGFR+ APPP   SRT  SG P             
Sbjct  61   QRLAQVMASQTAD---DDEDDEDDDLGFRYSAPPPPAFSRTVNSGKPAV-----------  106

Query  593  asassskissrssspsLAQNMVEETPSHRSTSAGR  697
                 +   +RS SP L +N VEETPS RSTSAGR
Sbjct  107  ----PASRVTRSPSPGLGRNFVEETPSVRSTSAGR  137



>ref|XP_002267942.2| PREDICTED: uncharacterized protein LOC100260846 [Vitis vinifera]
 emb|CBI35662.3| unnamed protein product [Vitis vinifera]
Length=553

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 97/155 (63%), Gaps = 20/155 (13%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNvaakaaa  418
            M+  R+DS V  R WSSESG     + A S    HH RS+S +G+S+IKRTQN AAKAAA
Sbjct  1    MDRTRSDSTVIGRQWSSESGATGTSSPAMSPSLYHHSRSASATGISNIKRTQNFAAKAAA  60

Query  419  qrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTA-SGPPNTsnnkingnaak  592
            QRLAQVMASQ A    +DED+++DDLGFR+ APPP   SRT  SG P             
Sbjct  61   QRLAQVMASQTAD---DDEDDEDDDLGFRYSAPPPPAFSRTVNSGKPAV-----------  106

Query  593  asassskissrssspsLAQNMVEETPSHRSTSAGR  697
                 +   +RS SP L +N VEETPS RSTSAGR
Sbjct  107  ----PASRVTRSPSPGLGRNFVEETPSVRSTSAGR  137



>ref|XP_004239298.1| PREDICTED: uncharacterized protein LOC101253187 [Solanum lycopersicum]
Length=551

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 110/154 (71%), Gaps = 5/154 (3%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNvaakaaa  418
            M+  RT SP   R WSSESG     A    +  P HGRSSS++GMS+IKRTQNVAAKAAA
Sbjct  1    MDRARTASPSQLRKWSSESGA-PMAALTVGSSSPRHGRSSSITGMSNIKRTQNVAAKAAA  59

Query  419  qrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkingnaaka  595
            QRLAQVMASQAA GND+DED D+D LGFRF APPP   SR  S     +N+  + NA   
Sbjct  60   QRLAQVMASQAATGNDDDEDGDDD-LGFRFSAPPPPSFSR--SKVSTAANSSSDSNAINP  116

Query  596  sassskissrssspsLAQNMVEETPSHRSTSAGR  697
               S+K+++RSSSP+LA+N+VEE PS RSTSAGR
Sbjct  117  VIQSAKLNTRSSSPALARNIVEELPSLRSTSAGR  150



>ref|XP_008369644.1| PREDICTED: uncharacterized protein LOC103433181 [Malus domestica]
Length=563

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 107/162 (66%), Gaps = 18/162 (11%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSES--GVLNppaaassaprpHHGRsssvsgmssIKRTQNvaaka  412
            M+ RRTDSPVYAR W+SES   V    + A S  R HH RSSS SG+S+IKRTQN AAKA
Sbjct  1    MDRRRTDSPVYARQWTSESTTTVGGATSPAMSPVRGHHARSSSASGISNIKRTQNFAAKA  60

Query  413  aaqrlaqvmaSQAAAGndededednddLGFRFA-PPPLPLSRTASGPPNTsnnkingnaa  589
            AAQRLAQVMASQ A      +D+++DDLGFR++ PPPL +SR A+              A
Sbjct  61   AAQRLAQVMASQTAD----GDDDEDDDLGFRYSVPPPLSVSRNANS-----------AGA  105

Query  590  kasassskissrssspsLAQNMVEETPSHRSTSAGRSLTSTR  715
            K +A S K ++RS SP+LA+N ++ TP   STSAGR   S R
Sbjct  106  KPAAPSLKSTTRSPSPALARNSLDVTPQVHSTSAGRPAMSLR  147



>ref|XP_006343189.1| PREDICTED: uncharacterized protein LOC102581164 [Solanum tuberosum]
Length=551

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 110/154 (71%), Gaps = 5/154 (3%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNvaakaaa  418
            M+  RT SP   R WSSE+G     A    +  P HGRSSS+SGMS+IKRTQNVAAKAAA
Sbjct  1    MDRARTASPRQLRKWSSETGA-PMAALTVGSSSPRHGRSSSISGMSNIKRTQNVAAKAAA  59

Query  419  qrlaqvmaSQAAAGndededednddLGFRFAPPPLP-LSRTASGPPNTsnnkingnaaka  595
            QRLAQVMASQAA GND+DED D+D LGFRFA PP P  SR  S     +N+  + NA   
Sbjct  60   QRLAQVMASQAATGNDDDEDGDDD-LGFRFAAPPPPTFSR--SKVSTAANSSSDSNAINP  116

Query  596  sassskissrssspsLAQNMVEETPSHRSTSAGR  697
            +  S+K+++RSSSP+LA+N VEE PS RSTSAGR
Sbjct  117  AIQSAKLNTRSSSPALARNFVEELPSLRSTSAGR  150



>ref|XP_009597749.1| PREDICTED: uncharacterized protein LOC104093670 isoform X2 [Nicotiana 
tomentosiformis]
Length=553

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 103/164 (63%), Gaps = 11/164 (7%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESGVLNppaaassaprp--HHGR--sssvsgmssIKRTQNvaa  406
            M+  RT SP   R WSSESG      + SS+P    HHGR  S S   MS+IKRTQNVAA
Sbjct  1    MDRARTASPRQLRKWSSESGAAPTLTSGSSSPGRPHHHGRSSSVSGVMMSNIKRTQNVAA  60

Query  407  kaaaqrlaqvmaSQAAAGndededednddLGFRFAPPPLPLSRTASGPPNTsnnkingna  586
            KAAAQRLAQVMASQAA+      ++D+DDLGFRFAPP    S   S   NT  N      
Sbjct  61   KAAAQRLAQVMASQAASA----GNDDDDDLGFRFAPPSFSRSNGTSATDNT--NATYNTN  114

Query  587  akasassskissrssspsLAQNMVEETPSH-RSTSAGRSLTSTR  715
            A A  S+   ++RSSSP LA+N VEETPS  RSTSAGR+   TR
Sbjct  115  AAAIQSAKLNNNRSSSPLLARNFVEETPSSLRSTSAGRAKVPTR  158



>ref|XP_009597748.1| PREDICTED: uncharacterized protein LOC104093670 isoform X1 [Nicotiana 
tomentosiformis]
Length=571

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 103/164 (63%), Gaps = 11/164 (7%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESGVLNppaaassaprp--HHGR--sssvsgmssIKRTQNvaa  406
            M+  RT SP   R WSSESG      + SS+P    HHGR  S S   MS+IKRTQNVAA
Sbjct  1    MDRARTASPRQLRKWSSESGAAPTLTSGSSSPGRPHHHGRSSSVSGVMMSNIKRTQNVAA  60

Query  407  kaaaqrlaqvmaSQAAAGndededednddLGFRFAPPPLPLSRTASGPPNTsnnkingna  586
            KAAAQRLAQVMASQAA+      ++D+DDLGFRFAPP    S   S   NT  N      
Sbjct  61   KAAAQRLAQVMASQAASA----GNDDDDDLGFRFAPPSFSRSNGTSATDNT--NATYNTN  114

Query  587  akasassskissrssspsLAQNMVEETPSH-RSTSAGRSLTSTR  715
            A A  S+   ++RSSSP LA+N VEETPS  RSTSAGR+   TR
Sbjct  115  AAAIQSAKLNNNRSSSPLLARNFVEETPSSLRSTSAGRAKVPTR  158



>ref|XP_008459909.1| PREDICTED: uncharacterized protein LOC103498889 [Cucumis melo]
Length=541

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 102/159 (64%), Gaps = 18/159 (11%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESGVLNp-paaassaprpHHGRsssvsgmssIKRTQNvaakaa  415
            M+ +RT SP+Y R WSSESG      + A S  R HH RSSSVSG+S+IKRTQN AAKAA
Sbjct  1    MDVKRTQSPIYGRQWSSESGSTGGPASPAMSPARGHHSRSSSVSGISNIKRTQNFAAKAA  60

Query  416  aqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkingnaak  592
            AQRLAQVMASQ A    +D+D+D DDLGFR+ APPP+ L R  +                
Sbjct  61   AQRLAQVMASQTAD---DDDDDDQDDLGFRYSAPPPISLYRNVNN-------------GS  104

Query  593  asassskissrssspsLAQNMVEETPSHRSTSAGRSLTS  709
              A  S  ++RS SP LA+N +E+TPS RSTS GRS  S
Sbjct  105  RLAVPSAKTTRSPSPGLARNFLEDTPSVRSTSTGRSSVS  143



>ref|XP_011656790.1| PREDICTED: coiled-coil domain-containing protein SCD2 [Cucumis 
sativus]
 gb|KGN46417.1| hypothetical protein Csa_6G091900 [Cucumis sativus]
Length=541

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 102/157 (65%), Gaps = 20/157 (13%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESGVLNp--paaassaprpHHGRsssvsgmssIKRTQNvaaka  412
            M+ +RT+SP+Y R WSSESG       + A S  R HH RSSSVSG+S+IKRTQN AAKA
Sbjct  1    MDVKRTESPIYGRQWSSESGTTGGGPASPAMSPARGHHSRSSSVSGISNIKRTQNFAAKA  60

Query  413  aaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkingnaa  589
            AAQRLAQVMASQ A     D+D+D DDLGFR+ APPP+ LSR  +               
Sbjct  61   AAQRLAQVMASQTAD----DDDDDQDDLGFRYSAPPPISLSRNVNN-------------G  103

Query  590  kasassskissrssspsLAQNMVEETPSHRSTSAGRS  700
               A+ S  ++RS SP LA+N +E+T S RSTS GRS
Sbjct  104  SRLAAPSAKTTRSPSPGLARNFLEDTSSVRSTSTGRS  140



>ref|XP_012088735.1| PREDICTED: coiled-coil domain-containing protein SCD2 [Jatropha 
curcas]
 gb|KDP23274.1| hypothetical protein JCGZ_23107 [Jatropha curcas]
Length=572

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 100/163 (61%), Gaps = 14/163 (9%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSES---GVLNppaaassaprpHHGRsssvsgmssIKRTQNvaak  409
            M+  + DS  YARHWSS+S   G      A  S  R HH RSSSV+G+S+IKR QN AAK
Sbjct  1    MDRSKIDSTAYARHWSSDSSNVGTGPSSPATMSPGRHHHARSSSVTGISNIKRNQNFAAK  60

Query  410  aaaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkingna  586
            AAAQRLAQVMASQ A     D++E+++DLGFR+ APPPL LSR  +  P ++ N      
Sbjct  61   AAAQRLAQVMASQTAD----DDEEEDEDLGFRYSAPPPLSLSRNLNSIPTSNRNSKPAVP  116

Query  587  akasassskissrssspsLAQNMVEETPSHRSTSAGRSLTSTR  715
            + +  + S   +      LA+N  EET S RSTSAGR   S R
Sbjct  117  SSSITTRSPSPA------LARNTAEETASVRSTSAGRPSMSLR  153



>ref|XP_006286776.1| hypothetical protein CARUB_v10003326mg [Capsella rubella]
 gb|EOA19674.1| hypothetical protein CARUB_v10003326mg [Capsella rubella]
Length=542

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 74/105 (70%), Gaps = 3/105 (3%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNvaakaaa  418
            ME  RT+SP Y R WS ESG  N   A SS  R HH RSSSV+ MS++KR QNVAAKAAA
Sbjct  1    MERARTESPSYFRQWSGESGATNAAVAPSSPARHHHARSSSVTTMSNVKRAQNVAAKAAA  60

Query  419  qrlaqvmaSQA--AAGndededednddLGFRF-APPPLPLSRTAS  544
            QRLA+VMASQ      +D+D++   DDLGFR+ APPPL  +R AS
Sbjct  61   QRLAKVMASQTNNDDDDDDDDEVGGDDLGFRYGAPPPLSFTRNAS  105



>ref|XP_007043825.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 ref|XP_007043826.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOX99656.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOX99657.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=422

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 105/166 (63%), Gaps = 15/166 (9%)
 Frame = +2

Query  239  MEARRTDSPVYARHW------SSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNv  400
            M+ R T+SPVY R W       S    ++ P  + +  +PHH RSSS +G+SSIKRTQN 
Sbjct  1    MDRRPTESPVYTRRWSSDSGSGSTGAAVDSPTLSPARHQPHHSRSSSATGISSIKRTQNF  60

Query  401  aakaaaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkin  577
            AAKAAAQRLAQVMASQ     D+D++ D DDLGFR+ APPPL LSR      N +     
Sbjct  61   AAKAAAQRLAQVMASQTTD--DDDDENDGDDLGFRYSAPPPLALSR------NVNATATT  112

Query  578  gnaakasassskissrssspsLAQNMVEETPSHRSTSAGRSLTSTR  715
            G A   +A +S    RS SP+LA+N +EE P+ RSTSAGRS  S R
Sbjct  113  GGAGNKAAMNSTRIGRSPSPALARNFLEEAPTVRSTSAGRSPVSLR  158



>ref|XP_007043827.1| Uncharacterized protein isoform 6 [Theobroma cacao]
 ref|XP_007043828.1| Uncharacterized protein isoform 6 [Theobroma cacao]
 gb|EOX99658.1| Uncharacterized protein isoform 6 [Theobroma cacao]
 gb|EOX99659.1| Uncharacterized protein isoform 6 [Theobroma cacao]
Length=464

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 105/166 (63%), Gaps = 15/166 (9%)
 Frame = +2

Query  239  MEARRTDSPVYARHW------SSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNv  400
            M+ R T+SPVY R W       S    ++ P  + +  +PHH RSSS +G+SSIKRTQN 
Sbjct  1    MDRRPTESPVYTRRWSSDSGSGSTGAAVDSPTLSPARHQPHHSRSSSATGISSIKRTQNF  60

Query  401  aakaaaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkin  577
            AAKAAAQRLAQVMASQ     D+D++ D DDLGFR+ APPPL LSR      N +     
Sbjct  61   AAKAAAQRLAQVMASQTTD--DDDDENDGDDLGFRYSAPPPLALSR------NVNATATT  112

Query  578  gnaakasassskissrssspsLAQNMVEETPSHRSTSAGRSLTSTR  715
            G A   +A +S    RS SP+LA+N +EE P+ RSTSAGRS  S R
Sbjct  113  GGAGNKAAMNSTRIGRSPSPALARNFLEEAPTVRSTSAGRSPVSLR  158



>ref|XP_009781778.1| PREDICTED: uncharacterized protein LOC104230617 isoform X2 [Nicotiana 
sylvestris]
Length=551

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 109/164 (66%), Gaps = 7/164 (4%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESGVLNppaaassaprp--HHGRsssvsgms--sIKRTQNvaa  406
            M+  RT SP   R WSSESG      + SS+P    HHGRSSSVSG    +IKRTQNVAA
Sbjct  1    MDRARTASPRQLRKWSSESGAAPTLISGSSSPGRPHHHGRSSSVSGGMMSNIKRTQNVAA  60

Query  407  kaaaqrlaqvmaSQAAAGndededednddLGFRFAPPPLPLSRTASGPPNTsnnkingna  586
            KAAAQRLAQVMASQAA+  ++D+D+DNDDLGFRFAPP    SR+       + N  N   
Sbjct  61   KAAAQRLAQVMASQAASAGNDDDDDDNDDLGFRFAPP--SFSRSNGTSATDNTNATNNTN  118

Query  587  akasassskissrssspsLAQNMVEETPSH-RSTSAGRSLTSTR  715
            A A  S+   +SRSSSP LA+N VEE PS  RSTSAGR+   TR
Sbjct  119  AAAIQSAKLNNSRSSSPLLARNFVEENPSSLRSTSAGRANVPTR  162



>ref|XP_009781777.1| PREDICTED: uncharacterized protein LOC104230617 isoform X1 [Nicotiana 
sylvestris]
Length=557

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 108/164 (66%), Gaps = 7/164 (4%)
 Frame = +2

Query  239  MEARRTDSPVYARHWSSESGVLNppaaassaprp--HHGRsssvsgmss--IKRTQNvaa  406
            M+  RT SP   R WSSESG      + SS+P    HHGRSSSVSG     IKRTQNVAA
Sbjct  1    MDRARTASPRQLRKWSSESGAAPTLISGSSSPGRPHHHGRSSSVSGGMMSNIKRTQNVAA  60

Query  407  kaaaqrlaqvmaSQAAAGndededednddLGFRFAPPPLPLSRTASGPPNTsnnkingna  586
            KAAAQRLAQVMASQAA+  ++D+D+DNDDLGFRFAPP    SR+       + N  N   
Sbjct  61   KAAAQRLAQVMASQAASAGNDDDDDDNDDLGFRFAPP--SFSRSNGTSATDNTNATNNTN  118

Query  587  akasassskissrssspsLAQNMVEETPSH-RSTSAGRSLTSTR  715
            A A  S+   +SRSSSP LA+N VEE PS  RSTSAGR+   TR
Sbjct  119  AAAIQSAKLNNSRSSSPLLARNFVEENPSSLRSTSAGRANVPTR  162



>ref|XP_007043824.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOX99655.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=475

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 105/166 (63%), Gaps = 15/166 (9%)
 Frame = +2

Query  239  MEARRTDSPVYARHW------SSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNv  400
            M+ R T+SPVY R W       S    ++ P  + +  +PHH RSSS +G+SSIKRTQN 
Sbjct  1    MDRRPTESPVYTRRWSSDSGSGSTGAAVDSPTLSPARHQPHHSRSSSATGISSIKRTQNF  60

Query  401  aakaaaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkin  577
            AAKAAAQRLAQVMASQ     D+D++ D DDLGFR+ APPPL LSR      N +     
Sbjct  61   AAKAAAQRLAQVMASQTTD--DDDDENDGDDLGFRYSAPPPLALSR------NVNATATT  112

Query  578  gnaakasassskissrssspsLAQNMVEETPSHRSTSAGRSLTSTR  715
            G A   +A +S    RS SP+LA+N +EE P+ RSTSAGRS  S R
Sbjct  113  GGAGNKAAMNSTRIGRSPSPALARNFLEEAPTVRSTSAGRSPVSLR  158



>ref|XP_007043823.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX99654.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=511

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 105/166 (63%), Gaps = 15/166 (9%)
 Frame = +2

Query  239  MEARRTDSPVYARHW------SSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNv  400
            M+ R T+SPVY R W       S    ++ P  + +  +PHH RSSS +G+SSIKRTQN 
Sbjct  1    MDRRPTESPVYTRRWSSDSGSGSTGAAVDSPTLSPARHQPHHSRSSSATGISSIKRTQNF  60

Query  401  aakaaaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkin  577
            AAKAAAQRLAQVMASQ     D+D++ D DDLGFR+ APPPL LSR      N +     
Sbjct  61   AAKAAAQRLAQVMASQTTD--DDDDENDGDDLGFRYSAPPPLALSR------NVNATATT  112

Query  578  gnaakasassskissrssspsLAQNMVEETPSHRSTSAGRSLTSTR  715
            G A   +A +S    RS SP+LA+N +EE P+ RSTSAGRS  S R
Sbjct  113  GGAGNKAAMNSTRIGRSPSPALARNFLEEAPTVRSTSAGRSPVSLR  158



>ref|XP_007043822.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX99653.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=567

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 105/166 (63%), Gaps = 15/166 (9%)
 Frame = +2

Query  239  MEARRTDSPVYARHW------SSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNv  400
            M+ R T+SPVY R W       S    ++ P  + +  +PHH RSSS +G+SSIKRTQN 
Sbjct  1    MDRRPTESPVYTRRWSSDSGSGSTGAAVDSPTLSPARHQPHHSRSSSATGISSIKRTQNF  60

Query  401  aakaaaqrlaqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkin  577
            AAKAAAQRLAQVMASQ     D+D++ D DDLGFR+ APPPL LSR      N +     
Sbjct  61   AAKAAAQRLAQVMASQTTD--DDDDENDGDDLGFRYSAPPPLALSR------NVNATATT  112

Query  578  gnaakasassskissrssspsLAQNMVEETPSHRSTSAGRSLTSTR  715
            G A   +A +S    RS SP+LA+N +EE P+ RSTSAGRS  S R
Sbjct  113  GGAGNKAAMNSTRIGRSPSPALARNFLEEAPTVRSTSAGRSPVSLR  158



>ref|XP_004310133.1| PREDICTED: coiled-coil domain-containing protein SCD2 [Fragaria 
vesca subsp. vesca]
Length=554

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 103/153 (67%), Gaps = 17/153 (11%)
 Frame = +2

Query  248  RRTDSPVYARHWSSESGVLNppaaassaprpHHGRsssvsgmssIKRTQNvaakaaaqrl  427
            RRTDSPVY R W+++S      + A S  R HH RSSS SG+S+IKRTQN AAKAAAQRL
Sbjct  5    RRTDSPVYTRQWTTDSPT--ATSPAMSPVRGHHARSSSASGISNIKRTQNFAAKAAAQRL  62

Query  428  aqvmaSQAAAGndededednddLGFRF-APPPLPLSRTASGPPNTsnnkingnaakasas  604
            AQVMASQ      +D+DED+DDLGFR+ APPP  LSR A+ P           A  A  S
Sbjct  63   AQVMASQ---NTGDDDDEDDDDLGFRYSAPPPFSLSRNANSP----------GAKPAVPS  109

Query  605  sskissrssspsLAQNMVEETPSHRSTSAGRSL  703
                S+RS+SP+LA+N+ +E  S RSTSAGR+L
Sbjct  110  GRTTSTRSASPALARNL-DEAVSVRSTSAGRAL  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1309179430124