BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8762

Length=908
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248139.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    334   1e-108   Solanum lycopersicum
ref|XP_006361060.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    333   4e-108   Solanum tuberosum [potatoes]
ref|XP_009592217.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    331   2e-107   Nicotiana tomentosiformis
ref|XP_009804859.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    330   7e-107   Nicotiana sylvestris
emb|CDP04687.1|  unnamed protein product                                328   3e-106   Coffea canephora [robusta coffee]
ref|XP_009592218.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    326   2e-105   Nicotiana tomentosiformis
ref|XP_009804860.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    324   8e-105   Nicotiana sylvestris
ref|XP_011096413.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    320   5e-103   Sesamum indicum [beniseed]
sp|O22436.1|CHLI_TOBAC  RecName: Full=Magnesium-chelatase subunit...    318   4e-102   Nicotiana tabacum [American tobacco]
ref|XP_010249286.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    317   8e-102   Nelumbo nucifera [Indian lotus]
ref|XP_002276262.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    315   5e-101   Vitis vinifera
gb|EYU28056.1|  hypothetical protein MIMGU_mgv1a006884mg                315   6e-101   Erythranthe guttata [common monkey flower]
ref|XP_006384056.1|  hypothetical protein POPTR_0004s05270g             313   1e-100   Populus trichocarpa [western balsam poplar]
gb|KHF97570.1|  Magnesium-chelatase subunit chlI, chloroplastic         313   2e-100   Gossypium arboreum [tree cotton]
ref|XP_002305090.1|  Magnesium-chelatase subunit chlI family protein    311   8e-100   
gb|KJB69599.1|  hypothetical protein B456_011G032900                    311   1e-99    Gossypium raimondii
ref|XP_007211734.1|  hypothetical protein PRUPE_ppa006200mg             311   1e-99    Prunus persica
ref|XP_008225200.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    310   3e-99    Prunus mume [ume]
ref|XP_010686345.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    309   6e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010686344.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    309   6e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011027718.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    308   2e-98    Populus euphratica
ref|XP_011086016.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    306   6e-98    Sesamum indicum [beniseed]
ref|XP_011086015.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    306   7e-98    Sesamum indicum [beniseed]
ref|XP_008383653.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    305   3e-97    Malus domestica [apple tree]
ref|XP_002316838.1|  Magnesium-chelatase subunit chlI family protein    304   5e-97    Populus trichocarpa [western balsam poplar]
ref|XP_009352812.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    303   1e-96    Pyrus x bretschneideri [bai li]
ref|XP_007025454.1|  P-loop containing nucleoside triphosphate hy...    303   1e-96    
gb|KCW76166.1|  hypothetical protein EUGRSUZ_D00551                     303   3e-96    Eucalyptus grandis [rose gum]
ref|XP_010052233.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    301   5e-96    Eucalyptus grandis [rose gum]
ref|XP_009347550.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    300   2e-95    Pyrus x bretschneideri [bai li]
ref|XP_010529186.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    299   7e-95    Tarenaya hassleriana [spider flower]
ref|XP_008371445.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    296   6e-94    
ref|XP_002522534.1|  Magnesium-chelatase subunit chlI, chloroplas...    296   8e-94    
ref|XP_004293922.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    294   5e-93    Fragaria vesca subsp. vesca
gb|AFK38677.1|  unknown                                                 294   5e-93    Lotus japonicus
ref|XP_004485870.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    293   1e-92    Cicer arietinum [garbanzo]
ref|XP_010434526.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    291   6e-92    Camelina sativa [gold-of-pleasure]
gb|KJB68386.1|  hypothetical protein B456_010G242400                    291   7e-92    Gossypium raimondii
ref|XP_006283787.1|  hypothetical protein CARUB_v10004877mg             291   8e-92    Capsella rubella
gb|KEH30930.1|  magnesium-chelatase subunit ChlI                        289   3e-91    Medicago truncatula
ref|XP_010439849.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    290   3e-91    Camelina sativa [gold-of-pleasure]
gb|AET86637.1|  chloroplast magnesium chelatase I subunit               289   6e-91    Pisum sativum [garden pea]
ref|XP_003546019.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    288   8e-91    Glycine max [soybeans]
gb|ACU19212.1|  unknown                                                 288   1e-90    Glycine max [soybeans]
ref|XP_010441650.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    288   1e-90    Camelina sativa [gold-of-pleasure]
ref|XP_003543008.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    288   1e-90    
ref|XP_012091733.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    288   1e-90    Jatropha curcas
gb|ACU23498.1|  unknown                                                 287   2e-90    Glycine max [soybeans]
ref|XP_006280536.1|  hypothetical protein CARUB_v10026479mg             287   2e-90    
ref|XP_010496228.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    287   3e-90    Camelina sativa [gold-of-pleasure]
ref|XP_006467679.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    286   3e-90    Citrus sinensis [apfelsine]
ref|XP_006449467.1|  hypothetical protein CICLE_v10015348mg             286   4e-90    Citrus clementina [clementine]
ref|NP_193583.1|  magnesium-chelatase subunit chlI                      286   4e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CDX99465.1|  BnaC01g10870D                                          286   5e-90    
ref|XP_004505124.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    285   9e-90    Cicer arietinum [garbanzo]
ref|XP_010540494.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    286   9e-90    Tarenaya hassleriana [spider flower]
ref|XP_003593716.1|  Magnesium-chelatase subunit chlI                   285   1e-89    Medicago truncatula
ref|XP_002867988.1|  hypothetical protein ARALYDRAFT_914833             285   1e-89    Arabidopsis lyrata subsp. lyrata
ref|XP_004505122.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    285   1e-89    Cicer arietinum [garbanzo]
ref|XP_009131778.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    285   2e-89    Brassica rapa
gb|AFK44500.1|  unknown                                                 285   2e-89    Medicago truncatula
emb|CDX78860.1|  BnaA01g09270D                                          285   2e-89    
ref|XP_007148073.1|  hypothetical protein PHAVU_006G178400g             285   2e-89    Phaseolus vulgaris [French bean]
ref|XP_011620831.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    284   3e-89    
ref|XP_010108425.1|  Magnesium-chelatase subunit chlI                   284   4e-89    Morus notabilis
ref|XP_003542705.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    284   4e-89    Glycine max [soybeans]
ref|XP_006414096.1|  hypothetical protein EUTSA_v10025291mg             284   5e-89    Eutrema salsugineum [saltwater cress]
emb|CDY01542.1|  BnaC07g35320D                                          284   5e-89    
ref|XP_010494748.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    283   6e-89    Camelina sativa [gold-of-pleasure]
ref|XP_010540495.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    283   7e-89    Tarenaya hassleriana [spider flower]
ref|XP_009136933.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    283   8e-89    Brassica rapa
gb|AAM98163.1|  magnesium chelatase subunit of protochlorophyllid...    283   9e-89    Arabidopsis thaliana [mouse-ear cress]
emb|CAI38864.1|  Mg chelatase subunit I                                 283   9e-89    Arabidopsis thaliana [mouse-ear cress]
emb|CDY55641.1|  BnaA03g58320D                                          283   9e-89    Brassica napus [oilseed rape]
ref|XP_006398276.1|  hypothetical protein EUTSA_v10000878mg             284   1e-88    
ref|NP_199405.2|  magnesium chelatase subunit I2                        282   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003528479.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    282   2e-88    Glycine max [soybeans]
dbj|BAB09321.1|  magnesium chelatase subunit of protochlorophylli...    282   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865216.1|  Mg chelatase subunit I                             281   7e-88    Arabidopsis lyrata subsp. lyrata
emb|CBI30656.3|  unnamed protein product                                277   2e-87    Vitis vinifera
gb|KFK28521.1|  magnesium-chelatase subunit chli                        278   6e-87    Arabis alpina [alpine rockcress]
ref|XP_007153702.1|  hypothetical protein PHAVU_003G057600g             278   6e-87    Phaseolus vulgaris [French bean]
ref|XP_008439769.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    278   9e-87    Cucumis melo [Oriental melon]
ref|XP_004134671.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    278   1e-86    Cucumis sativus [cucumbers]
ref|XP_010915593.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    277   2e-86    Elaeis guineensis
ref|XP_010925689.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    276   5e-86    
ref|XP_009128828.1|  PREDICTED: magnesium-chelatase subunit ChlI-...    275   9e-86    Brassica rapa
ref|XP_008783919.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    275   2e-85    Phoenix dactylifera
gb|KFK31505.1|  hypothetical protein AALP_AA6G121400                    274   3e-85    Arabis alpina [alpine rockcress]
ref|XP_006449465.1|  hypothetical protein CICLE_v10015348mg             268   2e-83    
gb|KDO77798.1|  hypothetical protein CISIN_1g014510mg                   268   2e-83    Citrus sinensis [apfelsine]
gb|KJB68387.1|  hypothetical protein B456_010G242400                    267   7e-83    Gossypium raimondii
ref|XP_009383480.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    266   1e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383479.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    265   7e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405672.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    268   1e-81    Musa acuminata subsp. malaccensis [pisang utan]
sp|A2XIK9.1|CHLI_ORYSI  RecName: Full=Magnesium-chelatase subunit...    264   1e-81    Oryza sativa Indica Group [Indian rice]
ref|NP_001050493.1|  Os03g0563300                                       264   1e-81    
ref|XP_002442883.1|  hypothetical protein SORBIDRAFT_08g004300          262   1e-80    Sorghum bicolor [broomcorn]
ref|XP_004977284.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    262   1e-80    Setaria italica
gb|ACN32024.1|  unknown                                                 261   2e-80    Zea mays [maize]
ref|XP_004977283.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    262   3e-80    Setaria italica
ref|XP_006650249.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    261   3e-80    Oryza brachyantha
gb|ACF87583.1|  unknown                                                 261   4e-80    Zea mays [maize]
dbj|BAJ84973.1|  predicted protein                                      261   4e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF83077.1|  unknown                                                 261   8e-80    Zea mays [maize]
ref|XP_008662350.1|  PREDICTED: oil yellow1 isoform X1                  261   1e-79    Zea mays [maize]
gb|EMS53132.1|  Magnesium-chelatase subunit chlI, chloroplastic         259   1e-79    Triticum urartu
gb|AFW56174.1|  oil yellow1                                             259   2e-79    
ref|XP_002989492.1|  hypothetical protein SELMODRAFT_235795             256   6e-79    
gb|ACF85806.1|  unknown                                                 258   7e-79    Zea mays [maize]
gb|EPS68275.1|  hypothetical protein M569_06494                         254   1e-78    Genlisea aurea
ref|XP_001758041.1|  predicted protein                                  253   7e-78    
ref|XP_003557120.1|  PREDICTED: magnesium-chelatase subunit ChlI,...    253   2e-77    Brachypodium distachyon [annual false brome]
ref|NP_001105917.1|  oil yellow1                                        253   3e-77    
ref|YP_009106670.1|  magnesium chelatase subunit of protochloroph...    251   4e-77    Pseudochloris wilhelmii
ref|XP_001761873.1|  predicted protein                                  251   5e-77    
ref|YP_009106384.1|  magnesium chelatase subunit of protochloroph...    248   5e-76    Fusochloris perforata
gb|AIY30226.1|  photochlorophyllide reductase subunit I                 247   9e-76    Lobosphaera incisa
ref|YP_003058322.1|  Mg-protoporyphyrin IX chelatase                    247   1e-75    Parachlorella kessleri
ref|YP_009105570.1|  magnesium chelatase subunit of protochloroph...    247   1e-75    Lobosphaera incisa
ref|YP_009020880.1|  magnesium-chelatase 38 kDa subunit                 246   2e-75    Chlorella sorokiniana
ref|YP_009106625.1|  magnesium chelatase subunit of protochloroph...    246   2e-75    Dicloster acuatus
ref|YP_009106080.1|  magnesium chelatase subunit of protochloroph...    246   3e-75    Choricystis parasitica
ref|YP_004347806.1|  photochlorophyllide reductase subunit L            246   4e-75    Chlorella variabilis
ref|YP_009106568.1|  magnesium chelatase subunit of protochloroph...    246   4e-75    Botryococcus braunii
ref|YP_009105900.1|  magnesium chelatase subunit of protochloroph...    245   5e-75    Microthamnion kuetzingianum
ref|YP_009104898.1|  magnesium chelatase subunit of protochloroph...    245   5e-75    Myrmecia israeliensis
ref|YP_636458.1|  Mg-protoporyphyrin IX chelatase                       245   5e-75    Staurastrum punctulatum
ref|YP_009105483.1|  magnesium chelatase subunit of protochloroph...    245   6e-75    Ettlia pseudoalveolaris
ref|YP_009033686.1|  magnesium chelatase subunit of protochloroph...    245   6e-75    Roya anglica
gb|AGZ19336.1|  magnesium-chelatase subunit chlI (chloroplast)          245   8e-75    Chlorella sp. ArM0029B
gb|AIT94137.1|  magnesium chelatase subunit of protochlorophyllid...    244   1e-74    Marsupiomonas sp. NIES 1824
ref|YP_009106193.1|  magnesium chelatase subunit of protochloroph...    244   2e-74    Planctonema lauterbornii
ref|YP_009105743.1|  magnesium chelatase subunit of protochloroph...    243   3e-74    Neocystis brevis
ref|YP_009106472.1|  magnesium chelatase subunit of protochloroph...    243   3e-74    Geminella minor
ref|YP_009033847.1|  magnesium chelatase subunit of protochloroph...    243   6e-74    Mesotaenium endlicherianum
ref|XP_001691232.1|  magnesium chelatase subunit I                      244   7e-74    Chlamydomonas reinhardtii
ref|YP_009105311.1|  magnesium chelatase subunit of protochloroph...    242   7e-74    Pedinomonas tuberculata
sp|Q94FT3.1|CHLI_CHLRE  RecName: Full=Magnesium-chelatase subunit...    244   8e-74    Chlamydomonas reinhardtii
ref|YP_009105984.1|  magnesium chelatase subunit of protochloroph...    242   8e-74    Gloeotilopsis sterilis
ref|YP_009105211.1|  magnesium chelatase subunit of protochloroph...    242   1e-73    Pseudochlorella signiensis
ref|XP_002947010.1|  hypothetical protein VOLCADRAFT_79418              244   1e-73    Volvox carteri f. nagariensis
ref|YP_009106316.1|  magnesium chelatase subunit of protochloroph...    242   1e-73    Interfilum terricola
ref|YP_009106843.1|  magnesium chelatase subunit of protochloroph...    242   1e-73    Marvania geminata
gb|AIT94561.1|  magnesium chelatase subunit of protochlorophyllid...    241   1e-73    Chlorosarcina brevispinosa
ref|WP_015205904.1|  protoporphyrin IX magnesium-chelatase              242   2e-73    Cylindrospermum stagnale
ref|YP_636198.1|  Mg-protoporyphyrin IX chelatase                       241   2e-73    Tupiella akineta
gb|ACQ90752.1|  magnesium chelatase subunit of protochlorophyllid...    241   3e-73    Neglectella solitaria
ref|YP_009057860.1|  magnesium chelatase subunit of protochloroph...    241   3e-73    Nephroselmis astigmatica
ref|NP_050837.1|  Mg-protoporyphyrin IX chelatase                       241   4e-73    Nephroselmis olivacea
ref|YP_005089911.1|  chlI gene product                                  241   4e-73    Pedinomonas minor
ref|YP_635908.1|  Mg-protoporyphyrin IX chelatase                       240   6e-73    Oltmannsiellopsis viridis
ref|NP_045914.1|  Mg-protoporyphyrin IX chelatase                       240   6e-73    Chlorella vulgaris
ref|WP_009556093.1|  protoporphyrin IX magnesium-chelatase              240   9e-73    Oscillatoriales cyanobacterium JSC-12
ref|YP_009104833.1|  magnesium chelatase subunit of protochloroph...    242   1e-72    Symbiochloris handae
emb|CEO91051.1|  Mg-protoporyphyrin IX chelatase                        239   1e-72    Bryopsis plumosa
ref|NP_038377.1|  Mg-protoporyphyrin IX chelatase                       239   1e-72    Mesostigma viride
ref|YP_009057794.1|  magnesium chelatase subunit of protochloroph...    239   1e-72    Picocystis salinarum
ref|WP_009784802.1|  magnesium chelatase                                239   1e-72    Lyngbya sp. PCC 8106
ref|YP_009105376.1|  magnesium chelatase subunit of protochloroph...    239   1e-72    Koliella longiseta
ref|YP_006666490.1|  photochlorophyllide reductase subunit L            239   2e-72    Trebouxiophyceae sp. MX-AZ01
ref|YP_636541.1|  Mg-protoporyphyrin IX chelatase                       238   3e-72    Zygnema circumcarinatum
ref|YP_009106170.1|  magnesium chelatase subunit of protochloroph...    238   3e-72    Paradoxia multiseta
ref|WP_015141479.1|  magnesium chelatase ATPase subunit I               239   3e-72    Nostoc sp. PCC 7524
ref|WP_023065952.1|  magnesium chelatase ATPase subunit I               238   3e-72    Lyngbya aestuarii
ref|WP_015172950.1|  protoporphyrin IX magnesium-chelatase              238   5e-72    Geitlerinema sp. PCC 7407
ref|YP_004222055.1|  photochlorophyllide reductase subunit L            238   7e-72    Coccomyxa subellipsoidea C-169
ref|WP_006197284.1|  magnesium chelatase                                238   1e-71    Nodularia spumigena
ref|WP_017652974.1|  magnesium chelatase                                238   1e-71    Fortiea contorta
ref|YP_009105582.1|  magnesium chelatase subunit of protochloroph...    237   1e-71    Xylochloris irregularis
gb|AID67829.1|  magnesium chelatase subunit of protochlorophyllid...    236   2e-71    prasinophyte sp. MBIC10622
ref|YP_009057493.1|  magnesium chelatase subunit of protochloroph...    236   2e-71    Prasinoderma coloniale
ref|YP_009105000.1|  magnesium chelatase subunit of protochloroph...    236   2e-71    Watanabea reniformis
ref|WP_015126951.1|  protoporphyrin IX magnesium-chelatase              237   2e-71    Calothrix sp. PCC 7507
ref|WP_010994329.1|  magnesium-chelatase subunit ChlI                   236   2e-71    Nostocaceae
ref|NP_683790.1|  Mg-protoporyphyrin IX chelatase                       236   3e-71    Chaetosphaeridium globosum
ref|WP_035156108.1|  magnesium chelatase                                236   3e-71    Calothrix sp. 336/3
ref|WP_009456321.1|  MULTISPECIES: magnesium chelatase                  236   3e-71    Fischerella
ref|YP_009106822.1|  magnesium chelatase subunit of protochloroph...    235   6e-71    Elliptochloris bilobata
ref|WP_006618358.1|  magnesium chelatase                                235   7e-71    Arthrospira platensis
ref|WP_011318336.1|  magnesium chelatase                                235   9e-71    Trichormus variabilis
ref|YP_009033617.1|  magnesium chelatase subunit of protochloroph...    234   1e-70    Klebsormidium flaccidum
ref|WP_026731287.1|  magnesium chelatase                                235   1e-70    Fischerella sp. PCC 9605
gb|AGN72450.1|  Mg-protoporyphyrin IX chelatase                         234   1e-70    Auxenochlorella protothecoides
ref|WP_013191980.1|  magnesium chelatase                                234   2e-70    Trichormus azollae
ref|XP_006377560.1|  hypothetical protein POPTR_0011s07720g             233   2e-70    
ref|YP_635727.1|  Mg-protoporyphyrin IX chelatase                       234   2e-70    Chara vulgaris
gb|KIJ82690.1|  magnesium chelatase                                     234   2e-70    Scytonema tolypothrichoides VB-61278
ref|WP_016859854.1|  magnesium chelatase                                234   2e-70    Fischerella muscicola
ref|WP_017713506.1|  magnesium chelatase                                234   2e-70    Prochlorothrix hollandica
ref|WP_012412525.1|  magnesium chelatase                                234   2e-70    Nostoc punctiforme
ref|WP_026719454.1|  magnesium chelatase                                234   3e-70    Fischerella sp. PCC 9431
ref|WP_044137744.1|  magnesium chelatase                                234   3e-70    Trichodesmium erythraeum
ref|WP_016868842.1|  magnesium chelatase                                233   3e-70    Fischerella muscicola
ref|WP_015111597.1|  protoporphyrin IX magnesium-chelatase              234   3e-70    Nostoc sp. PCC 7107
ref|WP_016951573.1|  magnesium chelatase                                233   3e-70    Anabaena sp. PCC 7108
ref|WP_006529681.1|  magnesium chelatase ATPase subunit I               233   4e-70    Gloeocapsa sp. PCC 73106
ref|YP_001019148.1|  magnesium chelatase subunit of protochloroph...    233   5e-70    Chlorokybus atmophyticus
ref|YP_002601047.1|  magnesium chelatase subunit of protochloroph...    232   5e-70    Monomastix sp. OKE-1
ref|WP_028083523.1|  magnesium chelatase                                233   6e-70    Dolichospermum circinale
ref|WP_008233259.1|  Protoporphyrin IX Mg-chelatase subunit I           233   6e-70    Richelia intracellularis
gb|ABG52692.1|  protoporphyrin IX magnesium-chelatase                   234   7e-70    Trichodesmium erythraeum IMS101
ref|WP_016873528.1|  magnesium chelatase                                233   7e-70    Chlorogloeopsis fritschii
ref|WP_015165920.1|  magnesium chelatase ATPase subunit I               232   8e-70    Pseudanabaena sp. PCC 7367
ref|WP_039741038.1|  magnesium chelatase                                232   1e-69    
gb|KJB69598.1|  hypothetical protein B456_011G032900                    231   1e-69    Gossypium raimondii
ref|WP_045872636.1|  magnesium chelatase                                232   1e-69    Nostocales
ref|WP_015187653.1|  magnesium chelatase ATPase subunit I               232   1e-69    Gloeocapsa sp. PCC 7428
ref|WP_039933513.1|  magnesium chelatase                                232   1e-69    
emb|CEO91133.1|  magnesium chelatase subunit of protochlorophylli...    232   2e-69    Tydemania expeditionis
ref|WP_029634005.1|  magnesium chelatase [                              232   2e-69    [Scytonema hofmanni] UTEX B 1581
ref|WP_017312410.1|  magnesium chelatase                                231   2e-69    Fischerella sp. PCC 9339
ref|WP_028949018.1|  magnesium chelatase                                231   2e-69    Synechocystis sp. PCC 6714
ref|WP_017659838.1|  magnesium chelatase                                231   2e-69    Geitlerinema sp. PCC 7105
gb|ACM51422.1|  Mg-protoporphyrin IX chelatase                          231   2e-69    Caulerpa filiformis
ref|WP_015214442.1|  protoporphyrin IX magnesium-chelatase              231   2e-69    Anabaena cylindrica
ref|YP_009105764.1|  magnesium chelatase subunit of protochloroph...    231   2e-69    Koliella corcontica
gb|EDZ93252.1|  magnesium chelatase ATPase subunit I                    231   3e-69    Arthrospira maxima CS-328
ref|WP_035759985.1|  magnesium chelatase                                231   3e-69    
ref|WP_030007326.1|  magnesium chelatase                                231   3e-69    Synechococcus sp. NKBG042902
ref|WP_037217496.1|  magnesium chelatase                                231   3e-69    
ref|WP_009343328.1|  magnesium chelatase                                231   3e-69    Aphanizomenonaceae
ref|WP_015148601.1|  protoporphyrin IX magnesium-chelatase              231   3e-69    Oscillatoria acuminata
ref|WP_041032790.1|  magnesium chelatase                                231   4e-69    Tolypothrix campylonemoides
gb|EKD09599.1|  magnesium chelatase ATPase subunit I                    231   5e-69    Arthrospira platensis C1
ref|WP_010871795.1|  magnesium-chelatase subunit ChlI                   230   5e-69    Synechocystis
ref|WP_017745273.1|  magnesium chelatase                                230   6e-69    Scytonema hofmannii
ref|WP_012307853.1|  magnesium chelatase                                230   6e-69    Synechococcus
ref|WP_006276817.1|  magnesium chelatase                                230   7e-69    Cylindrospermopsis raciborskii
ref|WP_017321915.1|  magnesium chelatase                                230   8e-69    cyanobacterium PCC 7702
gb|AAC44138.1|  Mg-Protoporhyrin IX                                     229   1e-68    Synechocystis sp. PCC 6803
ref|WP_039713234.1|  magnesium chelatase                                229   1e-68    
ref|WP_006911628.1|  magnesium chelatase                                229   1e-68    Cyanobium sp. PCC 7001
ref|WP_026796343.1|  MULTISPECIES: magnesium chelatase                  229   1e-68    Planktothrix
ref|WP_019498563.1|  magnesium chelatase                                229   1e-68    Pseudanabaena sp. PCC 6802
ref|WP_015168968.1|  magnesium chelatase ATPase subunit I               229   1e-68    Synechococcus sp. PCC 7502
ref|WP_041236613.1|  magnesium chelatase                                229   2e-68    
ref|WP_027843787.1|  magnesium chelatase                                229   2e-68    Mastigocoleus testarum
ref|WP_036831959.1|  MULTISPECIES: magnesium chelatase                  229   2e-68    
ref|WP_026785444.1|  magnesium chelatase                                229   2e-68    Planktothrix
ref|WP_045053191.1|  magnesium chelatase                                229   2e-68    Aliterella atlantica
gb|ACL43356.1|  magnesium chelatase ATPase subunit I                    229   2e-68    Cyanothece sp. PCC 7425
gb|AEN82484.1|  AT4G18480-like protein                                  223   3e-68    Capsella rubella
ref|WP_002747283.1|  magnesium chelatase ATPase subunit I               228   3e-68    Microcystis aeruginosa
gb|KIE08482.1|  magnesium chelatase                                     228   3e-68    Tolypothrix bouteillei VB521301
ref|WP_015179225.1|  protoporphyrin IX magnesium-chelatase              228   3e-68    Oscillatoria nigro-viridis
ref|WP_006632953.1|  magnesium chelatase                                228   3e-68    Microcoleus vaginatus
gb|AID67423.1|  magnesium chelatase subunit of protochlorophyllid...    228   3e-68    Prasinococcus sp. CCMP1194
ref|WP_002770087.1|  magnesium chelatase                                228   4e-68    Microcystis aeruginosa
gb|EKE99302.1|  magnesium chelatase ATPase subunit I                    228   4e-68    Tolypothrix sp. PCC 7601
ref|WP_002760148.1|  magnesium chelatase                                228   4e-68    Microcystis aeruginosa
ref|WP_027403495.1|  magnesium chelatase                                228   4e-68    Aphanizomenon flos-aquae
ref|WP_002778711.1|  magnesium chelatase                                228   5e-68    Microcystis aeruginosa
ref|WP_006512347.1|  magnesium chelatase ATPase subunit I               228   5e-68    Xenococcus sp. PCC 7305
ref|WP_015079938.1|  magnesium chelatase BchI                           228   5e-68    Anabaena sp. 90
ref|XP_002964653.1|  hypothetical protein SELMODRAFT_230423             226   5e-68    
ref|WP_002754885.1|  magnesium chelatase                                227   6e-68    Microcystis aeruginosa
ref|WP_019507431.1|  magnesium chelatase                                227   6e-68    Pleurocapsa sp. PCC 7319
ref|WP_002780926.1|  magnesium chelatase                                227   6e-68    Microcystis aeruginosa
ref|WP_002738384.1|  magnesium chelatase ATPase subunit I               227   7e-68    Microcystis aeruginosa
ref|WP_024544789.1|  magnesium chelatase                                227   7e-68    Synechococcus
ref|WP_008200597.1|  magnesium chelatase                                227   7e-68    Microcystis
ref|WP_011243252.1|  MULTISPECIES: magnesium chelatase                  227   7e-68    Synechococcus
ref|WP_002791921.1|  magnesium chelatase                                227   8e-68    Microcystis aeruginosa
ref|WP_002797227.1|  magnesium chelatase                                227   8e-68    Microcystis aeruginosa
ref|WP_002803387.1|  magnesium chelatase                                227   8e-68    Microcystis
ref|WP_016516601.1|  magnesium chelatase                                227   9e-68    Microcystis aeruginosa
ref|WP_039202400.1|  magnesium chelatase                                227   1e-67    Aphanizomenon flos-aquae
ref|WP_017314355.1|  magnesium chelatase                                227   1e-67    Mastigocladopsis repens
ref|WP_015153067.1|  protoporphyrin IX magnesium-chelatase              227   1e-67    Cyanobacteria [blue-green bacteria]
ref|WP_015192452.1|  magnesium chelatase ATPase subunit I               226   1e-67    Stanieria cyanosphaera
ref|WP_015230865.1|  magnesium chelatase ATPase subunit I               226   1e-67    Dactylococcopsis salina
ref|WP_015162113.1|  magnesium chelatase ATPase subunit I               226   1e-67    Chamaesiphon minutus
ref|WP_041431092.1|  magnesium chelatase                                226   2e-67    Synechococcus sp. PCC 6312
ref|WP_015197571.1|  protoporphyrin IX magnesium-chelatase              226   2e-67    Calothrix parietina
gb|AAV65388.1|  plastid Mg chelatase subunit I                          221   2e-67    Prototheca wickerhamii
ref|YP_006234199.1|  Mg-protoporyphyrin IX chelatase                    226   2e-67    Eutreptiella gymnastica
gb|EMT16090.1|  Magnesium-chelatase subunit chlI, chloroplastic         225   2e-67    
gb|AFY59990.1|  protoporphyrin IX magnesium-chelatase                   226   2e-67    Synechococcus sp. PCC 6312
ref|WP_017714876.1|  magnesium chelatase                                226   2e-67    
ref|WP_017287156.1|  magnesium chelatase                                226   2e-67    
ref|WP_035832887.1|  magnesium chelatase                                226   3e-67    
ref|WP_015222566.1|  protoporphyrin IX magnesium-chelatase              225   4e-67    
ref|NP_050702.1|  Mg-protoporyphyrin IX chelatase                       225   4e-67    
ref|WP_009633531.1|  magnesium chelatase ATPase subunit I               225   4e-67    
gb|ADG38759.1|  AT4G18480-like protein                                  220   4e-67    
ref|WP_012593827.1|  MULTISPECIES: magnesium chelatase                  225   5e-67    
gb|ADG38753.1|  AT4G18480-like protein                                  219   6e-67    
ref|WP_015226200.1|  protoporphyrin IX magnesium-chelatase              225   7e-67    
ref|WP_007353825.1|  MULTISPECIES: magnesium chelatase                  225   7e-67    
ref|WP_006170340.1|  magnesium chelatase                                224   8e-67    
ref|YP_002049392.1|  Magnesium chelatase ATPase subunit I               224   1e-66    
ref|WP_019500394.1|  hypothetical protein                               224   1e-66    
gb|AIU44593.1|  Mg-protoporyphyrin IX chelatase                         223   1e-66    
dbj|BAQ59836.1|  protoporphyrin IX Mg-chelatase subunit I               224   1e-66    
ref|WP_013320725.1|  magnesium chelatase                                224   2e-66    
ref|WP_041429536.1|  magnesium chelatase                                223   2e-66    
ref|WP_011141713.1|  magnesium chelatase                                223   2e-66    
ref|WP_011057351.1|  magnesium chelatase                                224   2e-66    
emb|CDI27958.1|  magnesium-chelatase subunit chlI                       223   2e-66    
ref|WP_015110789.1|  magnesium chelatase ATPase subunit I               223   3e-66    
ref|WP_009546697.1|  MULTISPECIES: magnesium chelatase                  223   3e-66    
ref|WP_010303690.1|  magnesium chelatase                                223   3e-66    
ref|WP_015134845.1|  protoporphyrin IX magnesium-chelatase              223   3e-66    
ref|WP_012598055.1|  magnesium chelatase                                223   3e-66    
gb|AHB88165.1|  Mg-protoporphyrin IX chelatase ATPase subunit ChlI      223   3e-66    
ref|WP_041244007.1|  magnesium chelatase                                223   4e-66    
ref|WP_015121638.1|  protoporphyrin IX magnesium-chelatase              223   4e-66    
ref|WP_008274324.1|  magnesium chelatase                                223   4e-66    
ref|NP_043214.1|  Mg-protoporyphyrin IX chelatase                       222   6e-66    
ref|WP_019494089.1|  magnesium chelatase                                222   7e-66    
ref|WP_010317938.1|  magnesium chelatase                                222   1e-65    
ref|YP_009032717.1|  chlorophyll biosynthesis                           221   1e-65    
ref|WP_015142889.1|  magnesium chelatase ATPase subunit I               221   1e-65    
ref|WP_036481487.1|  magnesium chelatase                                221   1e-65    
gb|ELS32221.1|  protoporphyrin IX magnesium-chelatase                   221   1e-65    
ref|WP_040688561.1|  magnesium chelatase                                221   1e-65    
ref|WP_040933123.1|  magnesium chelatase                                221   2e-65    
ref|WP_017304271.1|  magnesium chelatase                                221   2e-65    
ref|WP_011935147.1|  magnesium chelatase                                221   2e-65    
ref|WP_007303511.1|  magnesium chelatase                                221   2e-65    
ref|WP_017293979.1|  magnesium chelatase                                220   3e-65    
ref|WP_028951552.1|  magnesium chelatase                                220   3e-65    
ref|WP_041438434.1|  magnesium chelatase                                220   4e-65    
gb|ABD00082.1|  magnesium chelatase, ATPase subunit I                   219   5e-65    
ref|WP_007098271.1|  magnesium chelatase                                220   5e-65    
ref|YP_277379.1|  Mg-protoporyphyrin IX chelatase                       219   5e-65    
ref|YP_002600814.1|  magnesium chelatase subunit of protochloroph...    219   6e-65    
gb|AEQ94253.1|  chlorophyll biosynthesis                                219   7e-65    
ref|WP_038543842.1|  magnesium chelatase                                219   7e-65    
ref|YP_007317165.1|  Mg-protoporyphyrin IX chelatase                    218   1e-64    
ref|WP_041436963.1|  magnesium chelatase                                219   1e-64    
gb|ABD01108.1|  magnesium chelatase, ATPase subunit I                   218   1e-64    
ref|WP_018398578.1|  magnesium chelatase                                218   2e-64    
gb|AAA99720.1|  Mg-chelatase subunit                                    218   2e-64    
ref|WP_015218333.1|  protoporphyrin IX magnesium-chelatase              218   2e-64    
ref|WP_036002315.1|  magnesium chelatase                                218   2e-64    
ref|WP_011364902.1|  magnesium chelatase                                218   2e-64    
dbj|BAQ66172.1|  protoporphyrin IX Mg-chelatase subunit I               218   2e-64    
ref|WP_038556950.1|  magnesium chelatase                                218   2e-64    
ref|XP_007509047.1|  Mg-protoporyphyrin IX chelatase                    219   2e-64    
ref|WP_025362445.1|  magnesium chelatase                                218   3e-64    
ref|XP_002119085.1|  hypothetical protein TRIADDRAFT_9696               213   3e-64    
ref|NP_043645.1|  Mg-protoporyphyrin IX chelatase                       218   3e-64    
ref|WP_007100258.1|  magnesium chelatase                                218   3e-64    
gb|AIA61095.1|  Mg-protoporyphyrin IX chelatase (chloroplast)           217   4e-64    
gb|AHF64388.1|  Magnesium chelatase ATPase subunit I                    218   4e-64    
gb|AII48794.1|  magnesium chelatase                                     218   4e-64    
ref|WP_017325903.1|  magnesium chelatase                                218   4e-64    
ref|WP_036912582.1|  MULTISPECIES: magnesium chelatase                  217   5e-64    
ref|WP_011825553.1|  magnesium chelatase                                217   5e-64    
ref|YP_007476320.1|  Mg chelatase subunit e                             216   6e-64    
ref|WP_006852251.1|  magnesium chelatase                                217   7e-64    
ref|WP_036920303.1|  magnesium chelatase                                217   8e-64    
ref|WP_006041775.1|  magnesium chelatase                                216   9e-64    
ref|NP_848952.1|  Mg-protoporyphyrin IX chelatase                       216   1e-63    
ref|WP_009790265.1|  magnesium chelatase                                216   1e-63    
gb|ADJ57447.1|  Mg-protoporyphyrin IX chelatase                         216   1e-63    
ref|XP_003055999.1|  magnesium-chelatase subunit chlI chloroplast...    218   1e-63    
ref|YP_007627492.1|  Mg-protoporphyrin IX chelatase                     216   1e-63    
ref|WP_011933501.1|  magnesium chelatase                                216   1e-63    
ref|WP_025932535.1|  magnesium chelatase                                211   1e-63    
ref|WP_011127583.1|  magnesium chelatase                                216   2e-63    
ref|WP_011618897.1|  magnesium chelatase                                216   2e-63    
ref|WP_012195688.1|  magnesium chelatase                                216   2e-63    
ref|YP_008965634.1|  magnesium chelatase subunit I                      215   2e-63    
ref|YP_009092935.1|  protochlorophyllide reductase magnesium chel...    215   2e-63    
ref|WP_011130507.1|  magnesium chelatase                                216   2e-63    
ref|YP_009028617.1|  Mg chelatase subunit e                             215   2e-63    
ref|WP_011125298.1|  MULTISPECIES: magnesium chelatase                  216   2e-63    
ref|WP_043692082.1|  magnesium chelatase                                215   2e-63    
ref|YP_009093341.1|  protochlorophyllide reductase magnesium chel...    215   3e-63    
ref|WP_036906635.1|  magnesium chelatase                                215   3e-63    
ref|WP_011294787.1|  magnesium chelatase                                215   3e-63    
ref|WP_038653588.1|  magnesium chelatase                                215   3e-63    
ref|WP_036896834.1|  magnesium chelatase                                215   3e-63    
ref|YP_004072529.1|  magnesium chelatase ATPase subunit ChlI            215   3e-63    
ref|YP_009093449.1|  protochlorophyllide reductase magnesium chel...    215   4e-63    
ref|YP_001293514.1|  protochlorophylide reductase magnesium subunit     215   4e-63    
ref|YP_003734544.1|  Mg-protoporphyrin IX chelatase                     214   5e-63    
ref|WP_032522633.1|  magnesium chelatase                                214   6e-63    
gb|AIR75574.1|  protochlorophyllide reductase magnesium chelatase...    214   7e-63    
ref|YP_009028876.1|  Mg chelatase subunit e                             214   7e-63    
ref|WP_025906602.1|  MULTISPECIES: magnesium chelatase                  214   7e-63    
ref|WP_022608228.1|  magnesium chelatase ATPase subunit I               214   8e-63    
ref|YP_003002236.1|  magnesium chelatase subunit                        214   8e-63    
ref|WP_002806047.1|  magnesium chelatase                                214   9e-63    
ref|YP_009029030.1|  Mg chelatase subunit e                             214   9e-63    
ref|WP_025929401.1|  magnesium chelatase                                214   9e-63    
ref|WP_025973350.1|  magnesium chelatase                                214   1e-62    
ref|YP_005088704.1|  Mg-protoporyphyrin IX chelatase                    213   1e-62    
ref|WP_025894660.1|  MULTISPECIES: magnesium chelatase                  214   1e-62    
ref|YP_003734982.1|  magnesium-chelatase subunit I                      213   1e-62    
ref|YP_004376588.1|  magnesium-chelatase subunit I                      213   1e-62    
gb|AIR75433.1|  protochlorophyllide reductase magnesium chelatase...    213   1e-62    
ref|WP_025893374.1|  MULTISPECIES: magnesium chelatase                  213   1e-62    
ref|WP_011359522.1|  magnesium chelatase                                213   1e-62    
ref|YP_009028745.1|  Mg chelatase subunit e                             213   1e-62    
ref|WP_025934433.1|  magnesium chelatase                                213   1e-62    
ref|WP_036902617.1|  magnesium chelatase                                213   1e-62    
ref|WP_025925370.1|  MULTISPECIES: magnesium chelatase                  213   2e-62    
ref|WP_011824109.1|  magnesium chelatase                                213   2e-62    
ref|WP_025955853.1|  magnesium chelatase                                213   2e-62    
gb|AHJ27963.1|  Protoporphyrin IX Mg-chelatase subunit I                213   2e-62    
ref|WP_015203363.1|  protoporphyrin IX magnesium-chelatase              213   2e-62    
ref|YP_007878331.1|  Mg-protoporphyrin IX chelatase                     213   2e-62    
ref|WP_035985215.1|  magnesium chelatase                                213   3e-62    
ref|WP_025972213.1|  magnesium chelatase                                213   3e-62    
ref|WP_025923328.1|  magnesium chelatase                                213   3e-62    
ref|WP_011863114.1|  magnesium chelatase                                213   3e-62    
ref|WP_025881650.1|  MULTISPECIES: magnesium chelatase                  213   3e-62    
ref|WP_032519077.1|  magnesium chelatase                                213   3e-62    
ref|WP_025963773.1|  magnesium chelatase                                213   3e-62    
ref|WP_025928490.1|  magnesium chelatase                                213   3e-62    
ref|WP_011818593.1|  MULTISPECIES: magnesium chelatase                  213   3e-62    
ref|WP_017297070.1|  magnesium chelatase                                213   3e-62    
ref|WP_032516717.1|  magnesium chelatase                                213   3e-62    
ref|WP_025933665.1|  magnesium chelatase                                213   3e-62    
ref|WP_025944106.1|  magnesium chelatase                                213   4e-62    
ref|WP_012007882.1|  magnesium chelatase                                213   4e-62    
ref|WP_032524621.1|  magnesium chelatase                                213   4e-62    
ref|YP_009029187.1|  Mg chelatase subunit e                             212   4e-62    
ref|YP_005089669.1|  chlI gene product                                  212   4e-62    
ref|WP_042850529.1|  magnesium chelatase                                212   5e-62    
ref|YP_002600945.1|  magnesium chelatase subunit of protochloroph...    211   5e-62    
ref|YP_007516996.1|  chlorophyll biosynthesis                           211   5e-62    
ref|WP_025952895.1|  magnesium chelatase                                212   5e-62    
ref|WP_011376616.1|  magnesium chelatase                                212   5e-62    
ref|WP_025942950.1|  magnesium chelatase                                212   6e-62    
ref|YP_063709.1|  Mg-protoporyphyrin IX chelatase                       211   6e-62    
gb|AFZ16214.1|  protoporphyrin IX magnesium-chelatase                   212   7e-62    
ref|WP_025926642.1|  magnesium chelatase                                212   7e-62    
ref|WP_041780332.1|  magnesium chelatase                                211   8e-62    
ref|YP_003002095.1|  magnesium chelatase subunit                        211   8e-62    
ref|WP_040054435.1|  magnesium chelatase                                211   8e-62    
ref|YP_009059205.1|  Mg chelatase subunit e                             211   8e-62    
ref|YP_009093021.1|  protochlorophyllide reductase magnesium chel...    211   8e-62    
gb|AHF50442.1|  su                                                      203   9e-62    
ref|WP_028836086.1|  magnesium chelatase                                211   9e-62    
ref|NP_041888.1|  Mg-protoporyphyrin IX chelatase                       211   9e-62    
ref|YP_008145482.1|  Mg-protoporyphyrin IX chelatase                    211   1e-61    
ref|WP_032514176.1|  magnesium chelatase                                211   1e-61    
gb|AEW13007.1|  chlorophyll biosynthesis                                211   1e-61    
ref|YP_874532.1|  magnesium-chelatase subunit I                         211   1e-61    
ref|YP_009029443.1|  Mg chelatase subunit e                             211   1e-61    
ref|WP_036917982.1|  MULTISPECIES: magnesium chelatase                  211   1e-61    
ref|YP_009093176.1|  protochlorophyllide reductase magnesium chel...    211   1e-61    
ref|WP_025930483.1|  magnesium chelatase                                211   1e-61    
gb|ABF06656.1|  magnesium chelatas ChlI subunit                         210   1e-61    
ref|WP_032525692.1|  magnesium chelatase                                211   1e-61    
ref|NP_054004.1|  Mg-protoporyphyrin IX chelatase                       211   1e-61    
emb|CAE83575.1|  magnesium chelatase subunit                            202   1e-61    
ref|WP_028827698.1|  magnesium chelatase                                210   2e-61    
gb|AFC40062.1|  g-protoporyphyrin IX chelatase                          210   2e-61    
gb|AFR24772.1|  Mg-protoporyphyrin IX chelatase                         210   2e-61    
gb|AEW12943.2|  chlorophyll biosynthesis                                210   2e-61    
ref|XP_002507634.1|  predicted protein                                  211   2e-61    
gb|EPS73474.1|  hypothetical protein M569_01255                         209   3e-61    
emb|CAE00191.1|  magnesium chelatase subunit                            202   3e-61    
ref|WP_012953433.1|  magnesium chelatase                                209   4e-61    
ref|WP_006518251.1|  protoporphyrin IX magnesium-chelatase              209   5e-61    
ref|WP_023074898.1|  protoporphyrin ix magnesium-chelatase              209   5e-61    
ref|YP_874390.1|  magnesium-chelatase subunit I                         209   5e-61    
ref|YP_008144729.1|  magnesium-chelatase subunit ChlI                   209   6e-61    
gb|AHY04367.1|  Magnesium chelatase subunit                             209   6e-61    
ref|YP_009122268.1|  magnesium-chelatase subunit ChlI                   209   7e-61    
ref|WP_011132688.1|  magnesium chelatase                                209   8e-61    
ref|WP_011820453.1|  magnesium chelatase                                209   9e-61    
ref|YP_009029300.1|  Mg chelatase subunit e                             208   9e-61    
ref|XP_003075047.1|  CHLI_CHLVU Magnesium-chelatase subunit chlI ...    209   1e-60    
emb|CEG01034.1|  Magnesium chelatase, ATPase subunit I                  209   2e-60    
gb|AHB35172.1|  protochlorophyllide reductase magnesium chelatase...    208   2e-60    
ref|YP_007947924.1|  Mg-protoporyphyrin IX chelatase                    207   3e-60    
ref|WP_044205827.1|  magnesium chelatase                                207   3e-60    
ref|XP_001416388.1|  Magnesium-protoporyphyrin IX chelatase subun...    208   3e-60    
emb|CDN11241.1|  Protoporphyrin IX Mg-chelatase subunit I               207   4e-60    
ref|YP_537075.1|  Mg-protoporyphyrin IX chelatase                       206   8e-60    
emb|CDX87756.1|  BnaC02g31930D                                          205   1e-59    
gb|AIA21624.1|  protochlorophyllide reductase magnesium chelatase...    205   2e-59    
ref|YP_778562.1|  Mg-protoporphyrin IX                                  206   2e-59    
ref|YP_009019716.1|  magnesium chelatase subunit                        205   2e-59    
gb|ABZ83868.1|  magnesium chelatase ATPase subunit i                    205   2e-59    
ref|WP_025914723.1|  hypothetical protein                               198   3e-59    
ref|WP_008317866.1|  magnesium chelatase ATPase subunit I               204   4e-59    
ref|XP_005849367.1|  hypothetical protein CHLNCDRAFT_143829             206   4e-59    
emb|CDY50485.1|  BnaA02g24150D                                          204   4e-59    
ref|WP_008189063.1|  magnesium chelatase                                204   5e-59    
ref|WP_039729931.1|  MULTISPECIES: magnesium chelatase                  204   8e-59    
ref|XP_002948171.1|  hypothetical protein VOLCADRAFT_103792             203   2e-58    
gb|EDX87156.1|  magnesium chelatase ATPase subunit I                    202   2e-58    
ref|WP_038015703.1|  magnesium chelatase                                202   3e-58    
gb|KGG20075.1|  Protoporphyrin IX Mg-chelatase subunit I                201   8e-58    
ref|YP_006639012.1|  magnesium-chelatase subunit I                      200   1e-57    
ref|WP_041314840.1|  magnesium chelatase                                199   2e-57    
ref|NP_045141.1|  Mg-protoporyphyrin IX chelatase                       199   3e-57    
gb|KIY97114.1|  magnesium chelatase subunit I                           198   3e-57    
ref|XP_003074621.1|  magnesium-chelatase subunit ChlI (ISS)             199   6e-57    
gb|AEJ72982.1|  magnesium chelatase subunit of protochlorophyllid...    198   9e-57    
ref|YP_003289253.1|  Magnesium chelatase subunit I                      197   1e-56    
emb|CEF96871.1|  Magnesium chelatase, ATPase subunit I                  200   1e-56    



>ref|XP_004248139.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Solanum 
lycopersicum]
Length=427

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            GRKFYGGI LPV KGR QFHV+ISNVATE +PAQE+A+KLA    RPVYPF AIVGQDEM
Sbjct  43   GRKFYGGIRLPVKKGRSQFHVAISNVATEISPAQEQAQKLAEDSQRPVYPFPAIVGQDEM  102

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV++GDPFNSDPDD EVMS 
Sbjct  103  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVISGDPFNSDPDDQEVMSA  162

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+R+K+  GE LPV+LTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  163  EVRDKLRKGEQLPVSLTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  222

Query  833  GILY  844
            GILY
Sbjct  223  GILY  226



>ref|XP_006361060.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Solanum tuberosum]
Length=427

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            GRKFYGGI LPV KGR QFHV+ISNVATE +PAQE+A+KLA    RPVYPF AIVGQDEM
Sbjct  43   GRKFYGGIRLPVKKGRSQFHVAISNVATEISPAQEQAQKLAEDSQRPVYPFPAIVGQDEM  102

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV++GDPFNSDP+D EVMS 
Sbjct  103  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVISGDPFNSDPEDQEVMSA  162

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+R+K+  GE LPV+LTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  163  EVRDKLRKGEQLPVSLTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  222

Query  833  GILY  844
            GILY
Sbjct  223  GILY  226



>ref|XP_009592217.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=427

 Score =   331 bits (849),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            GRKFYGGI +PV KGR QFHV+ISNVATE +PAQE+ +KLA    RPVYPF+AIVGQDEM
Sbjct  43   GRKFYGGIRVPVKKGRSQFHVAISNVATEISPAQEQGQKLAEESQRPVYPFAAIVGQDEM  102

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV++GDPFNSDPDD EVMS 
Sbjct  103  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVISGDPFNSDPDDQEVMSA  162

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+R+K+ +GE LP++ TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  163  EVRDKLRSGEKLPISRTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  222

Query  833  GILY  844
            GILY
Sbjct  223  GILY  226



>ref|XP_009804859.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic isoform 
X1 [Nicotiana sylvestris]
Length=426

 Score =   330 bits (845),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            GRKFYGGI +PV KGR QFHV+ISNVATE  PAQE+ +KLA    RPVYPF+AIVGQDEM
Sbjct  42   GRKFYGGIRVPVKKGRSQFHVAISNVATEINPAQEQGQKLAEESQRPVYPFAAIVGQDEM  101

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV++GDPFNSDPDD EVMS 
Sbjct  102  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVISGDPFNSDPDDQEVMSA  161

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+R+K+ +G+ LP++ TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  162  EVRDKLRSGQQLPISRTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  221

Query  833  GILY  844
            GILY
Sbjct  222  GILY  225



>emb|CDP04687.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 172/185 (93%), Gaps = 1/185 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            GRKFYGGIG+ V K R QF VS+SNVATE  PAQE+AK+L ++ES RPVYPFSAIVGQDE
Sbjct  44   GRKFYGGIGVKVRKRRSQFQVSVSNVATETGPAQEQAKRLVSTESQRPVYPFSAIVGQDE  103

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP+DP++M 
Sbjct  104  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPNDPDLMG  163

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            +E+REKI+ GE+L + LTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  164  IEVREKISNGEELSITLTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  223

Query  830  RGILY  844
            RGILY
Sbjct  224  RGILY  228



>ref|XP_009592218.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=425

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 169/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            GRKFYGGI +PV KGR QFHV+ISNVATE +PAQE  +KLA    RPVYPF+AIVGQDEM
Sbjct  43   GRKFYGGIRVPVKKGRSQFHVAISNVATEISPAQE--QKLAEESQRPVYPFAAIVGQDEM  100

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV++GDPFNSDPDD EVMS 
Sbjct  101  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVISGDPFNSDPDDQEVMSA  160

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+R+K+ +GE LP++ TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  161  EVRDKLRSGEKLPISRTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  220

Query  833  GILY  844
            GILY
Sbjct  221  GILY  224



>ref|XP_009804860.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic isoform 
X2 [Nicotiana sylvestris]
 gb|AAG35472.1|U67064_1 sulfur [Nicotiana tabacum]
Length=424

 Score =   324 bits (831),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 168/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            GRKFYGGI +PV KGR QFHV+ISNVATE  PAQE  +KLA    RPVYPF+AIVGQDEM
Sbjct  42   GRKFYGGIRVPVKKGRSQFHVAISNVATEINPAQE--QKLAEESQRPVYPFAAIVGQDEM  99

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV++GDPFNSDPDD EVMS 
Sbjct  100  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVISGDPFNSDPDDQEVMSA  159

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+R+K+ +G+ LP++ TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  160  EVRDKLRSGQQLPISRTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  219

Query  833  GILY  844
            GILY
Sbjct  220  GILY  223



>ref|XP_011096413.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Sesamum indicum]
Length=426

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 169/186 (91%), Gaps = 2/186 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASE--SRPVYPFSAIVGQD  466
            GRKFYGGIG+P+ KGR QF VSISNVATE +PAQE+ +KLAAS+   RPVYPF+AIVGQD
Sbjct  40   GRKFYGGIGVPLKKGRSQFSVSISNVATEISPAQEQVQKLAASKESQRPVYPFAAIVGQD  99

Query  467  EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVM  646
            EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV+GDPFNSDP+D EV 
Sbjct  100  EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVSGDPFNSDPEDAEVQ  159

Query  647  SVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKA  826
              E+R+K+  G++L V  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKA
Sbjct  160  GPEVRDKLMKGDELAVVFTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKA  219

Query  827  NRGILY  844
            NRGILY
Sbjct  220  NRGILY  225



>sp|O22436.1|CHLI_TOBAC RecName: Full=Magnesium-chelatase subunit ChlI, chloroplastic; 
Short=Mg-chelatase subunit I-1; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlI; Flags: Precursor [Nicotiana 
tabacum]
 gb|AAB97153.1| Mg protoporphyrin chelatase subunit [Nicotiana tabacum]
Length=426

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            GRKFYGGI +PV KGR QFHV+ISNVATE    + R + L     RPVYPF+AIVGQDEM
Sbjct  42   GRKFYGGIRVPVKKGRSQFHVAISNVATEINLLKNRVRNLLEESQRPVYPFAAIVGQDEM  101

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV++GDPFNSDPDD EVMS 
Sbjct  102  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVISGDPFNSDPDDQEVMSA  161

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+R+K+ +G+ LP++ TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  162  EVRDKLRSGQQLPISRTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  221

Query  833  GILY  844
            GILY
Sbjct  222  GILY  225



>ref|XP_010249286.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Nelumbo nucifera]
Length=423

 Score =   317 bits (811),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 191/226 (85%), Gaps = 5/226 (2%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MAAL G TSSS   I AS+  +SH SK S   LS ++G   GRKFY GI +P+ KGR Q 
Sbjct  1    MAALFGATSSS---ISASRLPTSHSSKPSFSCLSSATGQIYGRKFYEGIRIPLKKGRSQV  57

Query  350  HVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  526
            H +++N+ATE + + E+ +KLA+ ES RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI
Sbjct  58   HAAVTNIATEIS-STEQVQKLASKESQRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  116

Query  527  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTK  706
            MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVM++E+REKI  GE LPV  TK
Sbjct  117  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMAMEVREKIFEGEKLPVLTTK  176

Query  707  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            I MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  177  ITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  222



>ref|XP_002276262.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Vitis vinifera]
Length=426

 Score =   315 bits (806),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 186/226 (82%), Gaps = 2/226 (1%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA + G +SSST  + +    S+  S     SL   +  S G+K YGG+G+ + KGR QF
Sbjct  1    MAGIFGTSSSSTAILASRPLSSTSKSSIPSLSLPLCTWRSHGKKLYGGVGVQLKKGRSQF  60

Query  350  HVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  526
            HV++SNVATE  PA E+A+KLAA ES RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMI
Sbjct  61   HVAVSNVATEINPA-EKAQKLAAEESQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMI  119

Query  527  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTK  706
            MGDRGTGKSTTVRSLVDLLPEI+VV+GDPFNSDP+DPE M +E+RE I  GE L + +TK
Sbjct  120  MGDRGTGKSTTVRSLVDLLPEIRVVSGDPFNSDPEDPESMGMEVRESILKGELLSIVMTK  179

Query  707  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  180  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  225



>gb|EYU28056.1| hypothetical protein MIMGU_mgv1a006884mg [Erythranthe guttata]
Length=427

 Score =   315 bits (806),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 167/186 (90%), Gaps = 2/186 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASE--SRPVYPFSAIVGQD  466
            GRKFYGGIG+P+ KGR QFH+SI+NVAT+ +P QE+ KKLAAS+   RPVYPF+AIVGQD
Sbjct  41   GRKFYGGIGVPLKKGRSQFHLSITNVATDISPTQEQVKKLAASKENQRPVYPFAAIVGQD  100

Query  467  EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVM  646
            EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSL DLLPEI+VV+GD FNSDP+D EV 
Sbjct  101  EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLTDLLPEIRVVSGDAFNSDPEDAEVQ  160

Query  647  SVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKA  826
              E+R+KI  GE+LPV   KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKA
Sbjct  161  GPEVRDKIMRGEELPVVSIKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKA  220

Query  827  NRGILY  844
            NRGILY
Sbjct  221  NRGILY  226



>ref|XP_006384056.1| hypothetical protein POPTR_0004s05270g [Populus trichocarpa]
 gb|ABK95697.1| unknown [Populus trichocarpa]
 gb|ERP61853.1| hypothetical protein POPTR_0004s05270g [Populus trichocarpa]
Length=417

 Score =   313 bits (803),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            GRK+YGGIGL   KGRPQFHV++++VAT+    QE  K  A    RPVYPF+AIVGQDEM
Sbjct  33   GRKYYGGIGLVGKKGRPQFHVAVASVATDIGSVQEAQKAAAKESQRPVYPFAAIVGQDEM  92

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRS+VDLLPEIKVVAGDP+NSDP+DPE M +
Sbjct  93   KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSMVDLLPEIKVVAGDPYNSDPEDPESMGI  152

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+RE +  GEDL V LTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  153  EVRESVVKGEDLTVVLTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  212

Query  833  GILY  844
            GILY
Sbjct  213  GILY  216



>gb|KHF97570.1| Magnesium-chelatase subunit chlI, chloroplastic [Gossypium arboreum]
Length=424

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = +2

Query  296  RKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEM  472
            +KFYGGIG+   KG+PQFH++++NVATE    Q+ A+KL A ES RPVYPF+AIVGQDEM
Sbjct  41   KKFYGGIGIQRKKGKPQFHIAVTNVATEINSVQQ-AQKLGAKESQRPVYPFAAIVGQDEM  99

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV GDP+NSDP+DPE M +
Sbjct  100  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVFGDPYNSDPEDPESMGI  159

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+REK+T GE+L + +TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  160  EVREKVTKGEELTITMTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  219

Query  833  GILY  844
            GILY
Sbjct  220  GILY  223



>ref|XP_002305090.1| Magnesium-chelatase subunit chlI family protein [Populus trichocarpa]
 gb|EEE85601.1| Magnesium-chelatase subunit chlI family protein [Populus trichocarpa]
Length=422

 Score =   311 bits (798),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 166/185 (90%), Gaps = 4/185 (2%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            GRK+YGGIGL   KGRPQFHV++++VAT+    QE+A   AA ES RPVYPF+AIVGQDE
Sbjct  40   GRKYYGGIGLVGKKGRPQFHVAVASVATDIGSVQEKA---AAKESQRPVYPFAAIVGQDE  96

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRS+VDLLPEIKVVAGDP+NSDP+DPE M 
Sbjct  97   MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSMVDLLPEIKVVAGDPYNSDPEDPESMG  156

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            +E+RE +  GEDL V LTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  157  IEVRESVVKGEDLTVVLTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  216

Query  830  RGILY  844
            RGILY
Sbjct  217  RGILY  221



>gb|KJB69599.1| hypothetical protein B456_011G032900 [Gossypium raimondii]
Length=422

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 167/185 (90%), Gaps = 2/185 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            GRK YGGIG+   KGRPQFH++++NVATE     E+A+KLAA ES RPV+PF+AIVGQDE
Sbjct  38   GRKLYGGIGIQGRKGRPQFHIAVTNVATEINSV-EQAQKLAAKESQRPVFPFAAIVGQDE  96

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI+VV GDP+NSDP+DPE M 
Sbjct  97   MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIRVVFGDPYNSDPEDPESMG  156

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            +E+REK+  GE+L + +TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  157  IEVREKVVNGEELTITMTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  216

Query  830  RGILY  844
            RGILY
Sbjct  217  RGILY  221



>ref|XP_007211734.1| hypothetical protein PRUPE_ppa006200mg [Prunus persica]
 gb|EMJ12933.1| hypothetical protein PRUPE_ppa006200mg [Prunus persica]
Length=422

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 163/184 (89%), Gaps = 1/184 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            G+KFYGGIG+   K RPQFHV+++NVATE +PA++  +  A    RPVYPF+AIVGQDEM
Sbjct  39   GKKFYGGIGIH-GKKRPQFHVAVTNVATEISPAEQAQRAAAKENQRPVYPFAAIVGQDEM  97

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV GDP+NSDP+DPE M  
Sbjct  98   KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVYGDPYNSDPEDPESMGA  157

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+RE I  GE+LPV +TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  158  EVRESIVKGEELPVTMTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  217

Query  833  GILY  844
            GILY
Sbjct  218  GILY  221



>ref|XP_008225200.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Prunus 
mume]
Length=422

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 162/184 (88%), Gaps = 1/184 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            G+KFYGGIG+   K RPQFHV+++NVATE +PA++  +  A    RPVYPF+AIVGQDEM
Sbjct  39   GKKFYGGIGIH-GKKRPQFHVAVTNVATEISPAEQAQRAAAKENQRPVYPFAAIVGQDEM  97

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV GDP+NSDP+DPE M  
Sbjct  98   KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVYGDPYNSDPEDPESMGA  157

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+RE I  GE LPV +TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  158  EVRESIVKGEQLPVTMTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  217

Query  833  GILY  844
            GILY
Sbjct  218  GILY  221



>ref|XP_010686345.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=424

 Score =   309 bits (792),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 161/183 (88%), Gaps = 1/183 (1%)
 Frame = +2

Query  296  RKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMK  475
            RKFYGGIG+PV K R Q   SISNVATE   A E+A K+A    RPV+PF+AIVGQDEMK
Sbjct  42   RKFYGGIGIPVKKSRSQLQFSISNVATEIN-ATEKAPKVATESQRPVFPFAAIVGQDEMK  100

Query  476  LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVE  655
            LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSL DLLPEIKVVAGDPFNSDP+DPE+M VE
Sbjct  101  LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLTDLLPEIKVVAGDPFNSDPEDPELMGVE  160

Query  656  IREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  835
            +REK   GED+ V +TKINMVDLPLGATEDRVCGTIDIEKALTEG+KAFEPGLLAKANRG
Sbjct  161  VREKALRGEDISVVMTKINMVDLPLGATEDRVCGTIDIEKALTEGIKAFEPGLLAKANRG  220

Query  836  ILY  844
            ILY
Sbjct  221  ILY  223



>ref|XP_010686344.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=425

 Score =   309 bits (792),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 161/183 (88%), Gaps = 1/183 (1%)
 Frame = +2

Query  296  RKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMK  475
            RKFYGGIG+PV K R Q   SISNVATE   A E+A K+A    RPV+PF+AIVGQDEMK
Sbjct  43   RKFYGGIGIPVKKSRSQLQFSISNVATEIN-ATEKAPKVATESQRPVFPFAAIVGQDEMK  101

Query  476  LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVE  655
            LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSL DLLPEIKVVAGDPFNSDP+DPE+M VE
Sbjct  102  LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLTDLLPEIKVVAGDPFNSDPEDPELMGVE  161

Query  656  IREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  835
            +REK   GED+ V +TKINMVDLPLGATEDRVCGTIDIEKALTEG+KAFEPGLLAKANRG
Sbjct  162  VREKALRGEDISVVMTKINMVDLPLGATEDRVCGTIDIEKALTEGIKAFEPGLLAKANRG  221

Query  836  ILY  844
            ILY
Sbjct  222  ILY  224



>ref|XP_011027718.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Populus 
euphratica]
Length=417

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            GRK+YGGIGL   K RPQFHV++++VAT+    +E  K  A    RPVYPF+AIVGQDEM
Sbjct  33   GRKYYGGIGLVGKKRRPQFHVAVASVATDIGSVEEAQKAAAKESQRPVYPFAAIVGQDEM  92

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP+DPE M +
Sbjct  93   KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPEDPESMGI  152

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+RE +  G+DL V LTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  153  EVRESVVKGKDLTVVLTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  212

Query  833  GILY  844
            GILY
Sbjct  213  GILY  216



>ref|XP_011086016.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=424

 Score =   306 bits (785),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 166/186 (89%), Gaps = 4/186 (2%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASE--SRPVYPFSAIVGQD  466
            GRKFYGGIG+ + K R QF VSIS VATE++PAQ  ++KLAAS+   RPVYPF+AIVGQD
Sbjct  40   GRKFYGGIGVALRKERFQFRVSISKVATESSPAQ--SQKLAASKESQRPVYPFAAIVGQD  97

Query  467  EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVM  646
            EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRS+VDLLPEIKVV+GD FNSDP+DPEV 
Sbjct  98   EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSMVDLLPEIKVVSGDAFNSDPEDPEVQ  157

Query  647  SVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKA  826
              E+REK+  GE+L V  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKA
Sbjct  158  GPEVREKLMRGEELSVVFTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKA  217

Query  827  NRGILY  844
            NRGILY
Sbjct  218  NRGILY  223



>ref|XP_011086015.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=428

 Score =   306 bits (785),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 166/188 (88%), Gaps = 4/188 (2%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQER--AKKLAASE--SRPVYPFSAIVG  460
            GRKFYGGIG+ + K R QF VSIS VATE++PAQ +   +KLAAS+   RPVYPF+AIVG
Sbjct  40   GRKFYGGIGVALRKERFQFRVSISKVATESSPAQSQFQVQKLAASKESQRPVYPFAAIVG  99

Query  461  QDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPE  640
            QDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRS+VDLLPEIKVV+GD FNSDP+DPE
Sbjct  100  QDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSMVDLLPEIKVVSGDAFNSDPEDPE  159

Query  641  VMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLA  820
            V   E+REK+  GE+L V  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLA
Sbjct  160  VQGPEVREKLMRGEELSVVFTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLA  219

Query  821  KANRGILY  844
            KANRGILY
Sbjct  220  KANRGILY  227



>ref|XP_008383653.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Malus 
domestica]
Length=421

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 193/226 (85%), Gaps = 7/226 (3%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA++LG  S ST A LAS+PLSS   ++SI SLS + G S GRKFYGGIG+   K R QF
Sbjct  1    MASVLG--SCSTAATLASRPLSSRTYRTSIASLSLTPGKSFGRKFYGGIGIH-GKKRSQF  57

Query  350  HVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  526
            HV+  NVATE +P+ E+AK++AA E+ RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMI
Sbjct  58   HVT--NVATEISPS-EQAKRVAAKENQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMI  114

Query  527  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTK  706
            MGDRGTGKSTTVRSLVDLLPEIKVV+GDP+NSDP+DPE M  E+RE I  GE LPV  TK
Sbjct  115  MGDRGTGKSTTVRSLVDLLPEIKVVSGDPYNSDPEDPESMGAEVRESIVKGEQLPVIKTK  174

Query  707  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  175  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  220



>ref|XP_002316838.1| Magnesium-chelatase subunit chlI family protein [Populus trichocarpa]
 gb|EEE97450.1| Magnesium-chelatase subunit chlI family protein [Populus trichocarpa]
Length=420

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 166/185 (90%), Gaps = 2/185 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            GR+ YGGIGL   KGRPQFHV+++ VAT+    +E A+KLA+ E+ RPVYPF+AIVGQDE
Sbjct  36   GRESYGGIGLVGKKGRPQFHVAVACVATDIGSVEE-AQKLASKENQRPVYPFAAIVGQDE  94

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP+DPE M 
Sbjct  95   MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPEDPESMG  154

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            +E+RE +  GE+L V +TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  155  IEVRESVVKGENLTVVMTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  214

Query  830  RGILY  844
            RGILY
Sbjct  215  RGILY  219



>ref|XP_009352812.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Pyrus x bretschneideri]
Length=421

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 193/226 (85%), Gaps = 7/226 (3%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA++LG  S ST A LAS+PLSS   ++SI SLS + G S GRKFYGGIG+   K R QF
Sbjct  1    MASVLG--SCSTAATLASRPLSSRTYRTSIPSLSLTPGKSFGRKFYGGIGIH-GKKRSQF  57

Query  350  HVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  526
            HV+  NVATE +P+ E+AK++AA E+ RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMI
Sbjct  58   HVT--NVATEISPS-EQAKRVAAKENQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMI  114

Query  527  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTK  706
            MGDRGTGKSTTVRSLVDLLPEIKVV+GDP+NSDP+DPE M  E+RE I  GE LPV  TK
Sbjct  115  MGDRGTGKSTTVRSLVDLLPEIKVVSGDPYNSDPEDPESMGAEVRESIVKGEQLPVIKTK  174

Query  707  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  175  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  220



>ref|XP_007025454.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY28076.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=423

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 165/226 (73%), Positives = 189/226 (84%), Gaps = 5/226 (2%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA++LG   +S+ AILAS+ L +  SK +I S+S   G S GR FYGG G+   KGRP F
Sbjct  1    MASVLG---TSSTAILASRSLVTPSSKPAIPSISIDPGQSYGRNFYGGFGVQGRKGRPPF  57

Query  350  HVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  526
            HV+++NVAT    + E+A+KL A ES RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMI
Sbjct  58   HVAVTNVAT-GIDSVEKAQKLDAKESQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMI  116

Query  527  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTK  706
            MGDRGTGKST VRSLVDLLPEI+VV GDP+NSDP+DPE M +E+REK+T GE+L V + K
Sbjct  117  MGDRGTGKSTAVRSLVDLLPEIRVVFGDPYNSDPEDPESMGIEVREKVTKGEELTVMMAK  176

Query  707  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  177  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  222



>gb|KCW76166.1| hypothetical protein EUGRSUZ_D00551 [Eucalyptus grandis]
Length=452

 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 160/227 (70%), Positives = 180/227 (79%), Gaps = 17/227 (7%)
 Frame = +2

Query  167  AMAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQ  346
            AMA+LLG +S++ LA                  LSP S  + G+K YGGIG    KGR  
Sbjct  41   AMASLLGTSSTAILA---------------SRRLSPLSVQNHGKKCYGGIGFQAKKGRSP  85

Query  347  FHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVM  523
            +H++++NVAT+     E+A+KLA+ ES RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVM
Sbjct  86   WHLAVTNVATDINSV-EQAQKLASKESQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVM  144

Query  524  IMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALT  703
            IMGDRGTGKSTTVRSLVDLLPEI+VVAGDP+NSDP DPE M VE+RE +  GE LPV  T
Sbjct  145  IMGDRGTGKSTTVRSLVDLLPEIQVVAGDPYNSDPQDPESMGVEVRELVIKGEQLPVVST  204

Query  704  KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  205  KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  251



>ref|XP_010052233.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Eucalyptus 
grandis]
Length=411

 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 162/185 (88%), Gaps = 2/185 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            G+K YGGIG    KGR  +H++++NVAT+     E+A+KLA+ ES RPVYPF+AIVGQDE
Sbjct  27   GKKCYGGIGFQAKKGRSPWHLAVTNVATDINSV-EQAQKLASKESQRPVYPFAAIVGQDE  85

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI+VVAGDP+NSDP DPE M 
Sbjct  86   MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIQVVAGDPYNSDPQDPESMG  145

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            VE+RE +  GE LPV  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  146  VEVRELVIKGEQLPVVSTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  205

Query  830  RGILY  844
            RGILY
Sbjct  206  RGILY  210



>ref|XP_009347550.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Pyrus 
x bretschneideri]
Length=421

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 191/226 (85%), Gaps = 7/226 (3%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA++LG  S ST A +A + LSS  S++SI SLS   G S GRKFYGGIG+   K R QF
Sbjct  1    MASVLG--SCSTAATVAPRHLSSRTSRTSIPSLSICPGKSFGRKFYGGIGVH-GKKRSQF  57

Query  350  HVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  526
             V+  NVATE +P+ E+A+++AA E+ RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMI
Sbjct  58   QVT--NVATEISPS-EQAQRVAAKENQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMI  114

Query  527  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTK  706
            MGDRGTGKSTTVRSLVDLLPEIKVV+GDP+NSDP+DPE M VE+RE I  GE LPV  TK
Sbjct  115  MGDRGTGKSTTVRSLVDLLPEIKVVSGDPYNSDPEDPESMGVEVRESIVKGEQLPVIKTK  174

Query  707  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  175  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  220



>ref|XP_010529186.1| PREDICTED: magnesium-chelatase subunit ChlI-1, chloroplastic 
[Tarenaya hassleriana]
Length=426

 Score =   299 bits (765),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 160/185 (86%), Gaps = 3/185 (2%)
 Frame = +2

Query  296  RKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKL--AASESRPVYPFSAIVGQDE  469
            RK YGG+ +   KGR +FHVS+ NVAT+     E+AKKL  A   +RPVYPF+AIVGQDE
Sbjct  42   RKLYGGVAVKPKKGRSRFHVSVMNVATDINSV-EQAKKLDDAKGSARPVYPFAAIVGQDE  100

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP DPE M 
Sbjct  101  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPVDPEFMG  160

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            VE+REK+T GE L V  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  161  VEVREKVTKGEQLLVVSTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  220

Query  830  RGILY  844
            RGILY
Sbjct  221  RGILY  225



>ref|XP_008371445.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Malus domestica]
Length=421

 Score =   296 bits (759),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 189/226 (84%), Gaps = 7/226 (3%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA++LG  S ST A LA + LSS  S++SI SLS   G S G KF GGIG+   K R QF
Sbjct  1    MASVLG--SCSTAATLAPRRLSSRTSRTSIPSLSTCPGKSFGSKFXGGIGIH-GKKRSQF  57

Query  350  HVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  526
            HV+  NVATE +P+ E+A+++AA E+ RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMI
Sbjct  58   HVT--NVATEISPS-EQAQRVAAKENQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMI  114

Query  527  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTK  706
            MGDRGTGKSTTVRSLVDLLPEIKVV+GDP+NSDP+DPE M  E+RE I  GE LPV  TK
Sbjct  115  MGDRGTGKSTTVRSLVDLLPEIKVVSGDPYNSDPEDPESMGAEVRESIVKGEQLPVIKTK  174

Query  707  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  175  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  220



>ref|XP_002522534.1| Magnesium-chelatase subunit chlI, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF39834.1| Magnesium-chelatase subunit chlI, chloroplast precursor, putative 
[Ricinus communis]
Length=419

 Score =   296 bits (757),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 186/226 (82%), Gaps = 9/226 (4%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA+LLG TSSST  + +    SS  +K S  SLS + GL++GRK+  GIG+   KGR QF
Sbjct  1    MASLLG-TSSSTAFLSSRPFSSSSVTKPSFPSLSLTPGLTIGRKYCRGIGIQSKKGRSQF  59

Query  350  HVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  526
            H++++NVAT+A       + +AA ES RPV+PF+AIVGQDEMKLCLLLNVIDPKIGGVMI
Sbjct  60   HLTVTNVATDA-------QNVAAKESQRPVFPFAAIVGQDEMKLCLLLNVIDPKIGGVMI  112

Query  527  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTK  706
            MGDRGTGKSTTVRSLVDLLPEI VV GDP+NSDP+DPE M VE+RE I  GE+L V LTK
Sbjct  113  MGDRGTGKSTTVRSLVDLLPEISVVFGDPYNSDPEDPESMGVEVRESIMKGEELSVVLTK  172

Query  707  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  173  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  218



>ref|XP_004293922.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=421

 Score =   294 bits (752),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 190/226 (84%), Gaps = 7/226 (3%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA++LG  S++TLA   ++PLSS  S++SI SLS + G S G KFYGG+ +   K R +F
Sbjct  1    MASVLGTCSTATLA---ARPLSSPTSRTSIPSLSLTQGQSCGTKFYGGLRIHGKKSRARF  57

Query  350  HVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  526
            HV+  +VATE  P+ E+A++LAA ES RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMI
Sbjct  58   HVA--SVATEVNPS-EQAQRLAAKESQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMI  114

Query  527  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTK  706
            MGDRGTGKSTTVRSL DLLPEIK+VAGDP+NSDP+DPE M  E+RE I  G  LPVA TK
Sbjct  115  MGDRGTGKSTTVRSLTDLLPEIKIVAGDPYNSDPEDPEAMGPEVRESIIKGVQLPVATTK  174

Query  707  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  175  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  220



>gb|AFK38677.1| unknown [Lotus japonicus]
Length=421

 Score =   294 bits (752),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 157/184 (85%), Gaps = 2/184 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            GRKFYGGIG+   KGR QF  S+++VATE     +   K++    RPVYPF+AIVGQDEM
Sbjct  39   GRKFYGGIGIHGLKGRSQF--SVASVATEVNSVGQVLNKVSKESQRPVYPFAAIVGQDEM  96

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTV SLVDLLPEIKVVA DP+NSDP+DPE M V
Sbjct  97   KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVGSLVDLLPEIKVVAADPYNSDPEDPEFMGV  156

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+RE+I  GE L V LTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  157  EVRERIIKGEQLDVVLTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  216

Query  833  GILY  844
            GILY
Sbjct  217  GILY  220



>ref|XP_004485870.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Cicer arietinum]
Length=415

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 157/184 (85%), Gaps = 2/184 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            G+KFYGGIG+   KGR +F V   +VATE    ++    ++    RPVYPFSAIVGQDEM
Sbjct  33   GKKFYGGIGINGTKGRSRFPVV--SVATELNSVEQAVNTISKESQRPVYPFSAIVGQDEM  90

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP+DPEVM +
Sbjct  91   KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPEDPEVMGI  150

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+RE++  GE L +  +KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  151  EVREQVIKGEQLSIVFSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  210

Query  833  GILY  844
            GILY
Sbjct  211  GILY  214



>ref|XP_010434526.1| PREDICTED: magnesium-chelatase subunit ChlI-1, chloroplastic-like 
[Camelina sativa]
Length=430

 Score =   291 bits (746),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 157/185 (85%), Gaps = 1/185 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            G K  GGI +   K R ++HVS+ NVATE    ++  KK  + +S RPVYPF+AIVGQDE
Sbjct  45   GSKLNGGIQIRPKKNRSRYHVSVMNVATEINSTEQVEKKFDSKKSARPVYPFAAIVGQDE  104

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP DPE M 
Sbjct  105  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPIDPEFMG  164

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            VE+RE++  GE +PV  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  165  VEVRERVERGEQVPVVATKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  224

Query  830  RGILY  844
            RGILY
Sbjct  225  RGILY  229



>gb|KJB68386.1| hypothetical protein B456_010G242400 [Gossypium raimondii]
Length=424

 Score =   291 bits (745),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 166/184 (90%), Gaps = 2/184 (1%)
 Frame = +2

Query  296  RKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEM  472
            +KFYGGIG+   KG+PQFH++++NVA+E    Q+ A+KL A ES RPVYPF+AIVGQDEM
Sbjct  41   KKFYGGIGIQGKKGKPQFHIAVTNVASEINSVQQ-AQKLGAKESQRPVYPFAAIVGQDEM  99

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV GDP+NSDP+DPE M +
Sbjct  100  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVFGDPYNSDPEDPESMGI  159

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+REK+T GE+L + + KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  160  EVREKVTKGEELMITMIKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  219

Query  833  GILY  844
            GILY
Sbjct  220  GILY  223



>ref|XP_006283787.1| hypothetical protein CARUB_v10004877mg [Capsella rubella]
 gb|EOA16685.1| hypothetical protein CARUB_v10004877mg [Capsella rubella]
Length=425

 Score =   291 bits (744),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            GR F  GI +   K R ++HVS+ NVATE    ++  K  +   +RPVYPF+AIVGQDEM
Sbjct  41   GRNFNAGIQMRPKKNRSRYHVSVMNVATEINSTEQVEKFDSKKSARPVYPFAAIVGQDEM  100

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP DPE M V
Sbjct  101  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPIDPEFMGV  160

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+RE++  GE +PV  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  161  EVRERVEKGEKVPVIATKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  220

Query  833  GILY  844
            GILY
Sbjct  221  GILY  224



>gb|KEH30930.1| magnesium-chelatase subunit ChlI [Medicago truncatula]
Length=420

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 160/187 (86%), Gaps = 5/187 (3%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQE--RAKKLAASES-RPVYPFSAIVGQ  463
            G KF GGIG    KG+ QF  S+ +VATE    Q+  +A+++A  ES RPVYPFSAIVGQ
Sbjct  35   GCKFCGGIGFHGVKGKSQF--SVLSVATEINATQQDIQAQRIAYKESQRPVYPFSAIVGQ  92

Query  464  DEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEV  643
            DEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP+DPE 
Sbjct  93   DEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPEDPEF  152

Query  644  MSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAK  823
            M +E+RE++  GE L V  +KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAK
Sbjct  153  MGIEVRERVLKGEQLEVVFSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAK  212

Query  824  ANRGILY  844
            ANRGILY
Sbjct  213  ANRGILY  219



>ref|XP_010439849.1| PREDICTED: magnesium-chelatase subunit ChlI-1, chloroplastic-like 
[Camelina sativa]
Length=430

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 156/185 (84%), Gaps = 1/185 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            G K   GI +   K R ++HVS+ NVATE    ++  KK  + +S RPVYPF+AIVGQDE
Sbjct  45   GSKLNAGIKIRPKKNRSRYHVSVMNVATEINSTEQVEKKFDSKKSARPVYPFAAIVGQDE  104

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP DPE M 
Sbjct  105  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPIDPEFMG  164

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            VE+RE++  GE +PV  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  165  VEVRERVERGEQVPVVATKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  224

Query  830  RGILY  844
            RGILY
Sbjct  225  RGILY  229



>gb|AET86637.1| chloroplast magnesium chelatase I subunit [Pisum sativum]
Length=422

 Score =   289 bits (739),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 156/184 (85%), Gaps = 2/184 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            GRKF GGIG+   KG+ +F V   NVATE    ++    +A    RPVYPF+AIVGQDEM
Sbjct  40   GRKFCGGIGINGTKGKSRFPVV--NVATEVNSVEQGLNTIAKESQRPVYPFAAIVGQDEM  97

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV GDP+NSDP+DPEVM +
Sbjct  98   KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVFGDPYNSDPEDPEVMGI  157

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+R+++  GE L + L+KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  158  EVRDRVIKGEQLSIVLSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  217

Query  833  GILY  844
            GILY
Sbjct  218  GILY  221



>ref|XP_003546019.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Glycine max]
 gb|KHN18928.1| Magnesium-chelatase subunit chlI, chloroplastic [Glycine soja]
Length=421

 Score =   288 bits (738),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 191/226 (85%), Gaps = 7/226 (3%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA+ LG   +S++A+L S+ +SS  SK SI +LS +SG S GRKFYGGIG+   KGR Q 
Sbjct  1    MASTLG---TSSIAVLPSRCISSFSSKPSIHTLSLTSGQSYGRKFYGGIGIHGIKGRSQL  57

Query  350  HVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  526
              S++NVATE     E+A+ +A+ ES RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI
Sbjct  58   --SVANVATEVNSV-EQAQSIASKESQRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  114

Query  527  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTK  706
            MGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP DPE M VE+RE++  GE+L V LTK
Sbjct  115  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPQDPEFMGVEVRERVLQGEELSVVLTK  174

Query  707  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  175  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  220



>gb|ACU19212.1| unknown [Glycine max]
Length=421

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 191/226 (85%), Gaps = 7/226 (3%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA+ LG   +S++A+L S+ +SS  SK SI +LS +SG S GRKFYGGIG+   KGR Q 
Sbjct  1    MASTLG---TSSIAVLPSRCISSFSSKPSIHTLSLTSGQSYGRKFYGGIGIHGIKGRSQL  57

Query  350  HVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  526
              S++NVATE     E+A+ +A+ ES RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI
Sbjct  58   --SVANVATEVNSV-EQAQSIASKESQRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  114

Query  527  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTK  706
            MGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP DPE M VE+RE++  GE+L V LTK
Sbjct  115  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPQDPEFMGVEVRERVLQGEELSVVLTK  174

Query  707  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  175  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  220



>ref|XP_010441650.1| PREDICTED: magnesium-chelatase subunit ChlI-2, chloroplastic-like 
[Camelina sativa]
Length=420

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  299  KFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKL  478
            KF G I L   K R ++HVS+ NVATE  P ++  K  +   +RPVYPF+AIVGQDEMKL
Sbjct  38   KFCGRIQLKPKKNRSRYHVSVMNVATEINPIEQEKKFDSKESARPVYPFAAIVGQDEMKL  97

Query  479  CLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEI  658
            CLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI VVAGDP+NSDP DPE M  E+
Sbjct  98   CLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEITVVAGDPYNSDPRDPEFMGKEV  157

Query  659  REKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGI  838
            RE++  GE LPV  TKINMVDLPLGATEDRVCGTIDIEKALTEG+KAFEPGLLAKANRGI
Sbjct  158  RERVQKGEQLPVIETKINMVDLPLGATEDRVCGTIDIEKALTEGIKAFEPGLLAKANRGI  217

Query  839  LY  844
            LY
Sbjct  218  LY  219



>ref|XP_003543008.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Glycine 
max]
 sp|P93162.1|CHLI_SOYBN RecName: Full=Magnesium-chelatase subunit ChlI, chloroplastic; 
Short=Mg-chelatase subunit I-1; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlI; Flags: Precursor [Glycine max]
 dbj|BAA08291.1| Mg chelatase subunit (46 kD) [Glycine max]
 gb|KHN08462.1| Magnesium-chelatase subunit chlI, chloroplastic [Glycine soja]
Length=421

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 163/185 (88%), Gaps = 4/185 (2%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            GRKFYGGIG+   KGR Q   S++NVATE     E+A+ +A+ ES RPVYPFSAIVGQDE
Sbjct  39   GRKFYGGIGIHGIKGRAQL--SVTNVATEVNSV-EQAQSIASKESQRPVYPFSAIVGQDE  95

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP DPE M 
Sbjct  96   MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPQDPEFMG  155

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            VE+RE++  GE+L V LTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  156  VEVRERVLQGEELSVVLTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  215

Query  830  RGILY  844
            RGILY
Sbjct  216  RGILY  220



>ref|XP_012091733.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Jatropha 
curcas]
 gb|KDP21059.1| hypothetical protein JCGZ_21530 [Jatropha curcas]
Length=423

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 163/185 (88%), Gaps = 2/185 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            GRK+YGGIG+   KGR  FH +++NVAT+ +   E+A+K+ A ES RPVYPF+AIVGQDE
Sbjct  39   GRKYYGGIGIQGKKGRSHFHFAVTNVATDVSSV-EQAQKVDAKESQRPVYPFAAIVGQDE  97

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV GDP+NSDP+DPE M 
Sbjct  98   MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVYGDPYNSDPEDPESMG  157

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            VE+RE I  G DL V LTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  158  VEVRESIMKGIDLQVMLTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  217

Query  830  RGILY  844
            RGILY
Sbjct  218  RGILY  222



>gb|ACU23498.1| unknown [Glycine max]
Length=421

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 163/185 (88%), Gaps = 4/185 (2%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            GRKFYGGIG+   KGR Q   S++NVATE     E+A+ +A+ ES RPVYPFSAIVGQDE
Sbjct  39   GRKFYGGIGIHGIKGRAQL--SVTNVATEVNSV-EQAQSIASKESQRPVYPFSAIVGQDE  95

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP DPE M 
Sbjct  96   MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPQDPEFMG  155

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            VE+RE++  GE+L V LTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  156  VEVRERVLQGEELSVVLTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  215

Query  830  RGILY  844
            RGILY
Sbjct  216  RGILY  220



>ref|XP_006280536.1| hypothetical protein CARUB_v10026479mg [Capsella rubella]
 gb|EOA13434.1| hypothetical protein CARUB_v10026479mg [Capsella rubella]
Length=419

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  299  KFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKL  478
            KF G I L   K R ++HVS+ NVATE    ++  K  +   +RPVYPF+AIVGQDEMKL
Sbjct  37   KFCGRIELKPKKNRTRYHVSVMNVATEINSIEQEKKFDSKESARPVYPFAAIVGQDEMKL  96

Query  479  CLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEI  658
            CLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI VVAGDP+NSDP DPE M  E+
Sbjct  97   CLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEITVVAGDPYNSDPRDPEFMGKEV  156

Query  659  REKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGI  838
            REK+  GE LPV  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGI
Sbjct  157  REKVQKGEQLPVIETKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGI  216

Query  839  LY  844
            LY
Sbjct  217  LY  218



>ref|XP_010496228.1| PREDICTED: magnesium-chelatase subunit ChlI-1, chloroplastic 
[Camelina sativa]
Length=423

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            G K   GI +   K R ++HVS+ NVATE    ++  KK  + +S RPVYPF+AIVGQDE
Sbjct  38   GSKLNAGIQIRPKKNRSRYHVSVMNVATEINSTEQVEKKFDSKKSARPVYPFAAIVGQDE  97

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP DPE M 
Sbjct  98   MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPIDPEFMG  157

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            VE+RE++  GE + V  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  158  VEVRERVERGEQVTVVATKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  217

Query  830  RGILY  844
            RGILY
Sbjct  218  RGILY  222



>ref|XP_006467679.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Citrus sinensis]
 gb|KDO77797.1| hypothetical protein CISIN_1g014510mg [Citrus sinensis]
Length=423

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 156/184 (85%), Gaps = 3/184 (2%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            GR+FYGGIG+    GR  F  +++NVATE     E+A+K +    RPVYPF+AIVGQ+EM
Sbjct  42   GRRFYGGIGIEEKMGRALF--AVTNVATEVNSV-EQAQKRSKESQRPVYPFTAIVGQEEM  98

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP IKVV GDP+NSDP+DPE M +
Sbjct  99   KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPVIKVVVGDPYNSDPEDPEAMGI  158

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+RE +  GE+L +  +KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  159  EVRESVVKGEELSITFSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  218

Query  833  GILY  844
            GILY
Sbjct  219  GILY  222



>ref|XP_006449467.1| hypothetical protein CICLE_v10015348mg [Citrus clementina]
 gb|ESR62707.1| hypothetical protein CICLE_v10015348mg [Citrus clementina]
Length=423

 Score =   286 bits (733),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 156/184 (85%), Gaps = 3/184 (2%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            GR+FYGGIG+    GR  F  +++NVATE     E+A+K +    RPVYPF+AIVGQ+EM
Sbjct  42   GRRFYGGIGIEEKMGRALF--AVTNVATEVNSV-EQAQKRSKESQRPVYPFTAIVGQEEM  98

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP IKVV GDP+NSDP+DPE M +
Sbjct  99   KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPVIKVVVGDPYNSDPEDPEAMGI  158

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+RE +  GE+L +  +KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  159  EVRESVVKGEELSITFSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  218

Query  833  GILY  844
            GILY
Sbjct  219  GILY  222



>ref|NP_193583.1| magnesium-chelatase subunit chlI [Arabidopsis thaliana]
 sp|P16127.1|CHLI1_ARATH RecName: Full=Magnesium-chelatase subunit ChlI-1, chloroplastic; 
Short=Mg-chelatase subunit I-1; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlI-1; AltName: Full=Protein CHLORINA 
42; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA62754.1| protoporphyrin-IX Mg-chetalase [Arabidopsis thaliana]
 emb|CAA16728.1| protein ch-42 precursor, chloroplast [Arabidopsis thaliana]
 emb|CAB38561.1| unnamed protein product [Arabidopsis thaliana]
 emb|CAB78850.1| protein ch-42 precursor, chloroplast [Arabidopsis thaliana]
 gb|AAM13191.1| protein ch-42 precursor, chloroplast [Arabidopsis thaliana]
 gb|AAQ22598.1| At4g18480 [Arabidopsis thaliana]
 dbj|BAE99191.1| protein ch-42 precursor [Arabidopsis thaliana]
 gb|ACG24204.1| magnesium-chelatase subunit chlI [Zea mays]
 gb|AEE84051.1| magnesium-chelatase subunit chlI [Arabidopsis thaliana]
 prf||1811226A ccsA gene
Length=424

 Score =   286 bits (733),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 175/226 (77%), Gaps = 4/226 (2%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA+LLG +SS   AI AS  LSS  SK S   +    G   G K   GI +   K R ++
Sbjct  1    MASLLGTSSS---AIWASPSLSSPSSKPSSSPICFRPGKLFGSKLNAGIQIRPKKNRSRY  57

Query  350  HVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  526
            HVS+ NVATE    ++   K  + +S RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMI
Sbjct  58   HVSVMNVATEINSTEQVVGKFDSKKSARPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMI  117

Query  527  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTK  706
            MGDRGTGKSTTVRSLVDLLPEI VVAGDP+NSDP DPE M VE+RE++  GE +PV  TK
Sbjct  118  MGDRGTGKSTTVRSLVDLLPEINVVAGDPYNSDPIDPEFMGVEVRERVEKGEQVPVIATK  177

Query  707  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  178  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  223



>emb|CDX99465.1| BnaC01g10870D [Brassica napus]
Length=423

 Score =   286 bits (732),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 174/225 (77%), Gaps = 3/225 (1%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA+LLG +SS   AI AS  LSS  S  SI  +    G   G K   GI +   K R + 
Sbjct  1    MASLLGTSSS---AICASHSLSSSSSTPSISPICFRPGKICGGKLNAGIQIRPKKNRSRH  57

Query  350  HVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIM  529
            HVS+ NVATE    ++  K  +   +RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMIM
Sbjct  58   HVSVMNVATEINSTEQVGKFDSKKSARPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIM  117

Query  530  GDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKI  709
            GDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP DPE M VE+RE++  GE +PV  TKI
Sbjct  118  GDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPLDPEFMGVEVRERVERGEQVPVVATKI  177

Query  710  NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  178  NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  222



>ref|XP_004505124.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X3 [Cicer arietinum]
 ref|XP_004505125.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X4 [Cicer arietinum]
Length=417

 Score =   285 bits (730),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 159/185 (86%), Gaps = 4/185 (2%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            GRKF GGI     KG  QF  SI  VATE   + E+A+++A+ ES RPVYPFSAIVGQDE
Sbjct  35   GRKFCGGIEFHGVKGSSQF--SILCVATEIN-STEQAQRIASKESQRPVYPFSAIVGQDE  91

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP+IKVV+GDP+NSDP+DPE M 
Sbjct  92   MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPKIKVVSGDPYNSDPEDPEFMG  151

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            +E+RE++  GE L V  +KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  152  IEVRERVLKGEQLEVVFSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  211

Query  830  RGILY  844
            RGILY
Sbjct  212  RGILY  216



>ref|XP_010540494.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=424

 Score =   286 bits (731),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 156/183 (85%), Gaps = 1/183 (1%)
 Frame = +2

Query  299  KFYGGIGLPVNKGR-PQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMK  475
            +FYGGI +     R  +F V++S+ ATE     ++ K  A    RPVYPFSAIVGQ+EMK
Sbjct  41   RFYGGIAINSGIKRMDRFRVAVSSFATEVKRVDQQQKLPAMESQRPVYPFSAIVGQEEMK  100

Query  476  LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVE  655
            LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV+AGDP+NSDPDDPE M +E
Sbjct  101  LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVIAGDPYNSDPDDPESMGME  160

Query  656  IREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  835
            +REK+  GE LP+A+TKINMVDLPLGATEDRVCGTIDIEKA+TEGVKAFEPGLLAKANRG
Sbjct  161  VREKLMRGEKLPMAMTKINMVDLPLGATEDRVCGTIDIEKAMTEGVKAFEPGLLAKANRG  220

Query  836  ILY  844
            ILY
Sbjct  221  ILY  223



>ref|XP_003593716.1| Magnesium-chelatase subunit chlI [Medicago truncatula]
 gb|AES63967.1| magnesium-chelatase subunit ChlI [Medicago truncatula]
Length=422

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 155/183 (85%), Gaps = 2/183 (1%)
 Frame = +2

Query  296  RKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMK  475
            +K YGGIG+   KG+ +  V   NVATE    ++    ++   +RPVYPF+AIVGQDEMK
Sbjct  41   KKLYGGIGISSTKGKSRLPVV--NVATEVNSVEQSLNTISKESARPVYPFAAIVGQDEMK  98

Query  476  LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVE  655
            LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV GDP+NSDP+DPEVM VE
Sbjct  99   LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVFGDPYNSDPEDPEVMGVE  158

Query  656  IREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  835
            +R+++  GE L + L+KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG
Sbjct  159  VRDRVIKGEQLSIVLSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  218

Query  836  ILY  844
            ILY
Sbjct  219  ILY  221



>ref|XP_002867988.1| hypothetical protein ARALYDRAFT_914833 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44247.1| hypothetical protein ARALYDRAFT_914833 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 172/225 (76%), Gaps = 3/225 (1%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA+LLG +SS   AI AS  LSS  S  S   +    G   G K   GI +   K R  +
Sbjct  1    MASLLGTSSS---AIWASPSLSSSSSTPSTSPICFRPGKLFGSKLNAGIQIRPKKNRSPY  57

Query  350  HVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIM  529
            HVS+ NVATE    ++  K  +   +RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMIM
Sbjct  58   HVSVVNVATEINSTEQVGKFDSKKSARPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIM  117

Query  530  GDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKI  709
            GDRGTGKSTTVRSLVDLLPEI VVAGDP+NSDP DPE M VE+RE++  GE +PV  TKI
Sbjct  118  GDRGTGKSTTVRSLVDLLPEINVVAGDPYNSDPIDPEFMGVEVRERVEKGEKVPVIATKI  177

Query  710  NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  178  NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  222



>ref|XP_004505122.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X1 [Cicer arietinum]
 ref|XP_004505123.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=420

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 159/187 (85%), Gaps = 5/187 (3%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATE--ATPAQERAKKLAASES-RPVYPFSAIVGQ  463
            GRKF GGI     KG  QF  SI  VATE  +T    +A+++A+ ES RPVYPFSAIVGQ
Sbjct  35   GRKFCGGIEFHGVKGSSQF--SILCVATEINSTEQHIQAQRIASKESQRPVYPFSAIVGQ  92

Query  464  DEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEV  643
            DEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP+IKVV+GDP+NSDP+DPE 
Sbjct  93   DEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPKIKVVSGDPYNSDPEDPEF  152

Query  644  MSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAK  823
            M +E+RE++  GE L V  +KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAK
Sbjct  153  MGIEVRERVLKGEQLEVVFSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAK  212

Query  824  ANRGILY  844
            ANRGILY
Sbjct  213  ANRGILY  219



>ref|XP_009131778.1| PREDICTED: magnesium-chelatase subunit ChlI-1, chloroplastic 
[Brassica rapa]
Length=423

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 174/225 (77%), Gaps = 3/225 (1%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA+LLG +SS   AI AS  LSS  S  SI  +    G   G K   GI +   K R + 
Sbjct  1    MASLLGTSSS---AICASHSLSSSSSTPSISPICFKPGKICGGKLNAGIQIRPKKNRSRH  57

Query  350  HVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIM  529
            H+S+ NVATE    ++  K  +   +RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMIM
Sbjct  58   HLSVVNVATEINSTEQVGKFDSKKSARPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIM  117

Query  530  GDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKI  709
            GDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP DPE M VE+RE++  GE +PV  TKI
Sbjct  118  GDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPLDPEFMGVEVRERVERGEQVPVVATKI  177

Query  710  NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  178  NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  222



>gb|AFK44500.1| unknown [Medicago truncatula]
Length=418

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 155/183 (85%), Gaps = 2/183 (1%)
 Frame = +2

Query  296  RKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMK  475
            +K YGGIG+   KG+ +  V   NVATE    ++    ++   +RPVYPF+AIVGQDEMK
Sbjct  41   KKLYGGIGISSTKGKSRLPVV--NVATEVNSVEQSLNTISKESARPVYPFAAIVGQDEMK  98

Query  476  LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVE  655
            LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV GDP+NSDP+DPEVM VE
Sbjct  99   LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVFGDPYNSDPEDPEVMGVE  158

Query  656  IREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  835
            +R+++  GE L + L+KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG
Sbjct  159  VRDRVIKGEQLSIVLSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  218

Query  836  ILY  844
            ILY
Sbjct  219  ILY  221



>emb|CDX78860.1| BnaA01g09270D [Brassica napus]
Length=423

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 174/225 (77%), Gaps = 3/225 (1%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA+LLG +SS   AI AS  LSS  S  SI  +    G   G K   GI +   K R + 
Sbjct  1    MASLLGTSSS---AICASHSLSSSSSTPSISPICFKPGKICGGKLNAGIQIRPKKNRSRH  57

Query  350  HVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIM  529
            H+S+ NVATE    ++  K  +   +RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMIM
Sbjct  58   HLSVVNVATEINSTEQVGKFDSKKSARPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIM  117

Query  530  GDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKI  709
            GDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP DPE M VE+RE++  GE +PV  TKI
Sbjct  118  GDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPLDPEFMGVEVRERVERGEQVPVVATKI  177

Query  710  NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  178  NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  222



>ref|XP_007148073.1| hypothetical protein PHAVU_006G178400g [Phaseolus vulgaris]
 gb|ESW20067.1| hypothetical protein PHAVU_006G178400g [Phaseolus vulgaris]
Length=417

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 159/184 (86%), Gaps = 2/184 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            GRKFYGGIG+   KGR QF  S+S+VATE    ++  +  A    RPVYPF+AIVGQDEM
Sbjct  35   GRKFYGGIGIHGIKGRSQF--SVSSVATEVNSVEQNPRVAAKESQRPVYPFAAIVGQDEM  92

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV+GDP+NSDP DPE M V
Sbjct  93   KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVSGDPYNSDPVDPEFMGV  152

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+RE++  GE+L V LTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  153  EVRERVLQGEELSVVLTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  212

Query  833  GILY  844
            GILY
Sbjct  213  GILY  216



>ref|XP_011620831.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Amborella 
trichopoda]
Length=400

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 156/185 (84%), Gaps = 3/185 (2%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            G  F  G+ L V +GR Q  + ++NVATE +  +  A+KLAA E+ RPV+PFSAIVGQDE
Sbjct  17   GGNFNRGLELRVREGRSQLRLLVNNVATEVSSTE--AQKLAAKENQRPVFPFSAIVGQDE  74

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKST VRSLVDLLPEI+VVAGDPFNSDP DPE M 
Sbjct  75   MKLCLLLNVIDPKIGGVMIMGDRGTGKSTAVRSLVDLLPEIEVVAGDPFNSDPHDPESMG  134

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            +E+RE +  GE L V  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  135  IEVRESVMKGEKLQVVTTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  194

Query  830  RGILY  844
            RGILY
Sbjct  195  RGILY  199



>ref|XP_010108425.1| Magnesium-chelatase subunit chlI [Morus notabilis]
 gb|EXC19453.1| Magnesium-chelatase subunit chlI [Morus notabilis]
Length=418

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 162/184 (88%), Gaps = 2/184 (1%)
 Frame = +2

Query  296  RKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEM  472
            ++ YGG+G+   KGR  FHV++SNVATE   A E+ +K+AA ES RPVYPF+AIVGQDEM
Sbjct  35   KRLYGGVGVHGKKGRSPFHVTVSNVATEIN-AVEQDQKIAAKESQRPVYPFAAIVGQDEM  93

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI  VAGDP+NSDP+DPE M V
Sbjct  94   KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIMAVAGDPYNSDPEDPESMGV  153

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+RE +  GE+L V +TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  154  EVRESVLKGEELSVVMTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  213

Query  833  GILY  844
            GILY
Sbjct  214  GILY  217



>ref|XP_003542705.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Glycine max]
Length=421

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 160/186 (86%), Gaps = 4/186 (2%)
 Frame = +2

Query  293  GRKFYGG-IGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQD  466
            GRKF GG  G    KGR  F V+ S +AT+   AQ+ A+K+A +ES RPVYPFSAIVGQD
Sbjct  37   GRKFCGGGNGFHSVKGRSLFPVA-SVLATQLNSAQQ-AQKIAFTESQRPVYPFSAIVGQD  94

Query  467  EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVM  646
            EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP+DPE M
Sbjct  95   EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPEDPEFM  154

Query  647  SVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKA  826
             VE+RE++  GE L V  +KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKA
Sbjct  155  GVEVRERVIKGEQLQVVSSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKA  214

Query  827  NRGILY  844
            NRGILY
Sbjct  215  NRGILY  220



>ref|XP_006414096.1| hypothetical protein EUTSA_v10025291mg [Eutrema salsugineum]
 gb|ESQ55549.1| hypothetical protein EUTSA_v10025291mg [Eutrema salsugineum]
Length=423

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 174/225 (77%), Gaps = 3/225 (1%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA+LLG +SS   AI AS  LSS  S  S+  +    G   G K   GI +   K + + 
Sbjct  1    MASLLGTSSS---AIWASPSLSSSSSTPSLSPICFRPGKICGAKLNAGIQIRPKKNKSRR  57

Query  350  HVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIM  529
            HVS+ NVATE    ++  K  +   +RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMIM
Sbjct  58   HVSVMNVATEINSTEQVGKFDSKKSARPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIM  117

Query  530  GDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKI  709
            GDRGTGKSTTVRSLVDLLPEI+VVAGDP+NSDP DPE M VE+RE++  GE +PV  TKI
Sbjct  118  GDRGTGKSTTVRSLVDLLPEIEVVAGDPYNSDPLDPEFMGVEVRERVERGEQVPVVATKI  177

Query  710  NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  178  NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  222



>emb|CDY01542.1| BnaC07g35320D [Brassica napus]
Length=427

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            GR    GI +   K R + HVS+ NVATE    +++  K  + +S RPVYPF+AIVGQDE
Sbjct  42   GRVLNAGIQIRPKKNRSRHHVSVMNVATEINSTEQQVGKFDSKKSARPVYPFAAIVGQDE  101

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI VVAGDP+NSDP DPE M 
Sbjct  102  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEITVVAGDPYNSDPLDPEFMG  161

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            VE+RE++  GE +PV  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  162  VEVRERVERGEQVPVIATKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  221

Query  830  RGILY  844
            RGILY
Sbjct  222  RGILY  226



>ref|XP_010494748.1| PREDICTED: magnesium-chelatase subunit ChlI-2, chloroplastic 
[Camelina sativa]
Length=420

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  299  KFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKL  478
            KF G I L   K R ++HVS+ NV TE    ++  K  +   +RPVYPF+AIVGQDEMKL
Sbjct  38   KFCGRIQLKPKKNRSRYHVSVMNVTTEINSIEQEKKFDSKESARPVYPFAAIVGQDEMKL  97

Query  479  CLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEI  658
            CLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI VVAGDP+NSDP DPE M  E+
Sbjct  98   CLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEITVVAGDPYNSDPRDPEFMGKEV  157

Query  659  REKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGI  838
            RE++  GE LP+  TKINMVDLPLGATEDRVCGTIDIEKALTEG+KAFEPGLLAKANRGI
Sbjct  158  RERVQKGEQLPLIETKINMVDLPLGATEDRVCGTIDIEKALTEGIKAFEPGLLAKANRGI  217

Query  839  LY  844
            LY
Sbjct  218  LY  219



>ref|XP_010540495.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=423

 Score =   283 bits (725),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 159/184 (86%), Gaps = 4/184 (2%)
 Frame = +2

Query  299  KFYGGIGLPVNKGR-PQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEM  472
            +FYGGI +     R  +F V++S+ ATE     +  +KL A ES RPVYPFSAIVGQ+EM
Sbjct  41   RFYGGIAINSGIKRMDRFRVAVSSFATEVKRVDQ--QKLPAMESQRPVYPFSAIVGQEEM  98

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV+AGDP+NSDPDDPE M +
Sbjct  99   KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVIAGDPYNSDPDDPESMGM  158

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+REK+  GE LP+A+TKINMVDLPLGATEDRVCGTIDIEKA+TEGVKAFEPGLLAKANR
Sbjct  159  EVREKLMRGEKLPMAMTKINMVDLPLGATEDRVCGTIDIEKAMTEGVKAFEPGLLAKANR  218

Query  833  GILY  844
            GILY
Sbjct  219  GILY  222



>ref|XP_009136933.1| PREDICTED: magnesium-chelatase subunit ChlI-1, chloroplastic-like 
[Brassica rapa]
Length=423

 Score =   283 bits (724),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            GR    GI +   K R + HVS+ NVATE    +++  K  + +S RPVYPF+AIVGQDE
Sbjct  38   GRASNAGIQIRPKKNRSRHHVSVMNVATEINSTEQQVGKFDSKKSARPVYPFAAIVGQDE  97

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI VVAGDP+NSDP DPE M 
Sbjct  98   MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEITVVAGDPYNSDPLDPEFMG  157

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            VE+RE++  GE +PV  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  158  VEVRERVERGEQVPVIATKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  217

Query  830  RGILY  844
            RGILY
Sbjct  218  RGILY  222



>gb|AAM98163.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Arabidopsis thaliana]
Length=418

 Score =   283 bits (724),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 154/183 (84%), Gaps = 2/183 (1%)
 Frame = +2

Query  299  KFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMK  475
            K  G I     K R ++HVS+ NVATE     E+AKK+ + ES RPVYPF+AIVGQDEMK
Sbjct  36   KLSGRIQFNPKKNRSRYHVSVMNVATEINSV-EQAKKIDSKESARPVYPFAAIVGQDEMK  94

Query  476  LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVE  655
            LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI VV+GDP+NSDP DPE M  E
Sbjct  95   LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEITVVSGDPYNSDPRDPECMGKE  154

Query  656  IREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  835
            +REK+  GE+L V  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG
Sbjct  155  VREKVQKGEELSVIETKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  214

Query  836  ILY  844
            ILY
Sbjct  215  ILY  217



>emb|CAI38864.1| Mg chelatase subunit I [Arabidopsis thaliana]
Length=418

 Score =   283 bits (724),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 153/183 (84%), Gaps = 2/183 (1%)
 Frame = +2

Query  299  KFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMK  475
            K  G I     K R ++HVS+ NVATE     E+AKK+ + ES RPVYPF+AIVGQDEMK
Sbjct  36   KLSGRIQFNPKKNRSRYHVSVMNVATEINSV-EQAKKIDSKESARPVYPFAAIVGQDEMK  94

Query  476  LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVE  655
            LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI VVAGDP+NSDP DPE M  E
Sbjct  95   LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEITVVAGDPYNSDPRDPECMGKE  154

Query  656  IREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  835
            +REK+  GE L V  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG
Sbjct  155  VREKVQKGEQLSVIETKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  214

Query  836  ILY  844
            ILY
Sbjct  215  ILY  217



>emb|CDY55641.1| BnaA03g58320D [Brassica napus]
Length=423

 Score =   283 bits (724),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            GR    GI +   K R + HVS+ NVATE    +++  K  + +S RPVYPF+AIVGQDE
Sbjct  38   GRASNAGIQIRPKKNRSRHHVSVMNVATEINSTEQQVGKFDSKKSARPVYPFAAIVGQDE  97

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI VVAGDP+NSDP DPE M 
Sbjct  98   MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEITVVAGDPYNSDPLDPEFMG  157

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            VE+RE++  GE +PV  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  158  VEVRERVERGEQVPVIATKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  217

Query  830  RGILY  844
            RGILY
Sbjct  218  RGILY  222



>ref|XP_006398276.1| hypothetical protein EUTSA_v10000878mg [Eutrema salsugineum]
 ref|XP_006398277.1| hypothetical protein EUTSA_v10000878mg [Eutrema salsugineum]
 gb|ESQ39729.1| hypothetical protein EUTSA_v10000878mg [Eutrema salsugineum]
 gb|ESQ39730.1| hypothetical protein EUTSA_v10000878mg [Eutrema salsugineum]
Length=466

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 163/230 (71%), Positives = 180/230 (78%), Gaps = 6/230 (3%)
 Frame = +2

Query  161  SLAMAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGR  340
            SL MA+LLG TS+ST  IL     SS  S +S+  +    G   G+K  G I L   K R
Sbjct  40   SLTMASLLG-TSAST--ILTCPRFSSPSSTTSVSPVCFGPGKICGKKLCGRIQLEPKKNR  96

Query  341  PQFHVSI-SNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIG  514
             ++ VS+  NVATE   + E+AKK+ + ES RPVYPF+AIVGQDEMKLCLLLNVIDPKIG
Sbjct  97   SRYRVSVVMNVATEIN-SIEQAKKIDSKESARPVYPFAAIVGQDEMKLCLLLNVIDPKIG  155

Query  515  GVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPV  694
            GVMIMGDRGTGKSTTVRSLVDLLPEI VVAGDP+NSDP DPE M  E+REK+  GE LPV
Sbjct  156  GVMIMGDRGTGKSTTVRSLVDLLPEITVVAGDPYNSDPRDPEFMGKEVREKVEKGEKLPV  215

Query  695  ALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
              TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  216  IETKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  265



>ref|NP_199405.2| magnesium chelatase subunit I2 [Arabidopsis thaliana]
 sp|Q5XF33.1|CHLI2_ARATH RecName: Full=Magnesium-chelatase subunit ChlI-2, chloroplastic; 
Short=Mg-chelatase subunit I-2; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlI-2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAU90073.1| At5g45930 [Arabidopsis thaliana]
 gb|AED95316.1| magnesium chelatase subunit I2 [Arabidopsis thaliana]
Length=418

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 154/183 (84%), Gaps = 2/183 (1%)
 Frame = +2

Query  299  KFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMK  475
            K  G I     K R ++HVS+ NVATE     E+AKK+ + ES RPVYPF+AIVGQDEMK
Sbjct  36   KLSGRIQFNPKKNRSRYHVSVMNVATEINSV-EQAKKIDSKESARPVYPFAAIVGQDEMK  94

Query  476  LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVE  655
            LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI VV+GDP+NSDP DPE M  E
Sbjct  95   LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEITVVSGDPYNSDPRDPECMGKE  154

Query  656  IREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  835
            +REK+  GE+L V  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG
Sbjct  155  VREKVQKGEELSVIETKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  214

Query  836  ILY  844
            ILY
Sbjct  215  ILY  217



>ref|XP_003528479.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Glycine max]
 gb|KHN30997.1| Magnesium-chelatase subunit chlI, chloroplastic [Glycine soja]
Length=414

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 156/186 (84%), Gaps = 11/186 (6%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFH-VSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQD  466
            GRKF GG G         FH V +++V      + ++A+K+A +ES RPVYPFSAIVGQD
Sbjct  37   GRKFCGGNG---------FHGVKVTSVVATQLNSAQQAQKIAFNESQRPVYPFSAIVGQD  87

Query  467  EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVM  646
            EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP+DPE M
Sbjct  88   EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPEDPEFM  147

Query  647  SVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKA  826
             VE+RE++  GE L V  +KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKA
Sbjct  148  GVEVRERVIKGEQLQVVFSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKA  207

Query  827  NRGILY  844
            NRGILY
Sbjct  208  NRGILY  213



>dbj|BAB09321.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Arabidopsis thaliana]
Length=423

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 154/183 (84%), Gaps = 2/183 (1%)
 Frame = +2

Query  299  KFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMK  475
            K  G I     K R ++HVS+ NVATE     E+AKK+ + ES RPVYPF+AIVGQDEMK
Sbjct  41   KLSGRIQFNPKKNRSRYHVSVMNVATEINSV-EQAKKIDSKESARPVYPFAAIVGQDEMK  99

Query  476  LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVE  655
            LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI VV+GDP+NSDP DPE M  E
Sbjct  100  LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEITVVSGDPYNSDPRDPECMGKE  159

Query  656  IREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  835
            +REK+  GE+L V  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG
Sbjct  160  VREKVQKGEELSVIETKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  219

Query  836  ILY  844
            ILY
Sbjct  220  ILY  222



>ref|XP_002865216.1| Mg chelatase subunit I [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41475.1| Mg chelatase subunit I [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score =   281 bits (718),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 152/183 (83%), Gaps = 2/183 (1%)
 Frame = +2

Query  299  KFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMK  475
            K  G I     K + ++HVS+ NVATE     E+ KK  + ES RPVYPF+AIVGQDEMK
Sbjct  36   KICGRIQFNPKKNKSRYHVSVMNVATEINYV-EQGKKFDSKESARPVYPFAAIVGQDEMK  94

Query  476  LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVE  655
            LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI VVAGDP+NSDP DPE M  E
Sbjct  95   LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIMVVAGDPYNSDPRDPECMGKE  154

Query  656  IREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  835
            +REK+  GE LPV  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG
Sbjct  155  VREKVQKGEQLPVIETKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRG  214

Query  836  ILY  844
            ILY
Sbjct  215  ILY  217



>emb|CBI30656.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 169/210 (80%), Gaps = 2/210 (1%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA + G +SSST  + +    S+  S     SL   +  S G+K YGG+G+ + KGR QF
Sbjct  1    MAGIFGTSSSSTAILASRPLSSTSKSSIPSLSLPLCTWRSHGKKLYGGVGVQLKKGRSQF  60

Query  350  HVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  526
            HV++SNVATE  PA E+A+KLAA ES RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMI
Sbjct  61   HVAVSNVATEINPA-EKAQKLAAEESQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMI  119

Query  527  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTK  706
            MGDRGTGKSTTVRSLVDLLPEI+VV+GDPFNSDP+DPE M +E+RE I  GE L + +TK
Sbjct  120  MGDRGTGKSTTVRSLVDLLPEIRVVSGDPFNSDPEDPESMGMEVRESILKGELLSIVMTK  179

Query  707  INMVDLPLGATEDRVCGTIDIEKALTEGVK  796
            INMVDLPLGATEDRVCGTIDIEKALTE ++
Sbjct  180  INMVDLPLGATEDRVCGTIDIEKALTEELR  209



>gb|KFK28521.1| magnesium-chelatase subunit chli [Arabis alpina]
Length=421

 Score =   278 bits (712),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 174/225 (77%), Gaps = 5/225 (2%)
 Frame = +2

Query  170  MAALLGGTSSSTLAILAskplsshpskssifslspssglsVGRKFYGGIGLPVNKGRPQF  349
            MA+LLG +SSS  AI AS  LSS  S  +I  +    G   G+KF  GI +   K + + 
Sbjct  1    MASLLGTSSSS--AIWASPSLSSSSSTPTISPICFKPGTLCGKKFNSGIQIRPKKNKSRL  58

Query  350  HVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIM  529
               + NVATE    ++  K  +   +RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMIM
Sbjct  59   ---VMNVATEINSVEQAGKFDSKKSARPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIM  115

Query  530  GDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKI  709
            GDRGTGKSTTVRSLVDLLPEI+VVAGDP+NSDP DPE M VE+RE++  GE +PV  TKI
Sbjct  116  GDRGTGKSTTVRSLVDLLPEIEVVAGDPYNSDPLDPEFMGVEVRERVERGETVPVIATKI  175

Query  710  NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  176  NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  220



>ref|XP_007153702.1| hypothetical protein PHAVU_003G057600g [Phaseolus vulgaris]
 gb|ESW25696.1| hypothetical protein PHAVU_003G057600g [Phaseolus vulgaris]
Length=418

 Score =   278 bits (711),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 157/185 (85%), Gaps = 6/185 (3%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            G KF GG  +   KGR  F V+ S VA +     E+A+K+A +ES RPVYPFSAIVGQDE
Sbjct  37   GPKFCGGTAV---KGRSPFPVA-SAVAAQVN-GSEQAQKIAFTESQRPVYPFSAIVGQDE  91

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP+DPE MS
Sbjct  92   MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPEDPEFMS  151

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            VE+R ++  GE L V  +KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  152  VEVRARVLKGEQLRVVFSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  211

Query  830  RGILY  844
            RGILY
Sbjct  212  RGILY  216



>ref|XP_008439769.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Cucumis melo]
Length=420

 Score =   278 bits (710),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 152/184 (83%), Gaps = 4/184 (2%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            G+K +G I +   KGRPQ      NVATE     E+A  ++    RPVYPF+AIVGQDEM
Sbjct  40   GKKSFGSIRIQGKKGRPQVKC---NVATEINTV-EQAVNISKESQRPVYPFAAIVGQDEM  95

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI+VV GDP+NSDP+DPE M +
Sbjct  96   KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIRVVFGDPYNSDPEDPESMGI  155

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+RE +  GE L V +TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  156  EVRESLGKGEQLSVVMTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  215

Query  833  GILY  844
            GILY
Sbjct  216  GILY  219



>ref|XP_004134671.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Cucumis sativus]
 gb|KGN49283.1| hypothetical protein Csa_6G518380 [Cucumis sativus]
Length=420

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 152/184 (83%), Gaps = 4/184 (2%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEM  472
            G+K  G I +   KGRPQ      NVATE   A E+A  ++    RPVYPF+AIVGQDEM
Sbjct  40   GKKSIGSIRIQGKKGRPQVQC---NVATEINTA-EQAVNISKESQRPVYPFAAIVGQDEM  95

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI+VV GDP+NSDP+DPE M +
Sbjct  96   KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIRVVFGDPYNSDPEDPESMGI  155

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+RE +  GE L V +TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  156  EVRESLGKGEQLSVVMTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  215

Query  833  GILY  844
            GILY
Sbjct  216  GILY  219



>ref|XP_010915593.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Elaeis 
guineensis]
Length=427

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 152/184 (83%), Gaps = 3/184 (2%)
 Frame = +2

Query  296  RKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEM  472
            R F+GGIG    +        ISNVA       E AKKL   ES RPVYPFSAIVGQDEM
Sbjct  45   RNFHGGIGTGFRRR--ARRSIISNVAAPDISPTEAAKKLTDKESQRPVYPFSAIVGQDEM  102

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI+VV GDPFNSDP+DPE M +
Sbjct  103  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIRVVVGDPFNSDPEDPESMGM  162

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+RE++T GE+LP+  TKI MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  163  EVRERVTKGEELPITTTKITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  222

Query  833  GILY  844
            GILY
Sbjct  223  GILY  226



>ref|XP_010925689.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Elaeis guineensis]
Length=427

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 152/182 (84%), Gaps = 3/182 (2%)
 Frame = +2

Query  302  FYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKL  478
            F+  IG    +G  +    ISNVA   T   E AKKL A ES RPVYPFSAIVGQ+EMKL
Sbjct  47   FHRRIGTGFRRGARR--SIISNVAVPDTSFSEAAKKLVAKESQRPVYPFSAIVGQEEMKL  104

Query  479  CLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEI  658
            CLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV GDPFNSDP+DPE M +E+
Sbjct  105  CLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVVGDPFNSDPEDPESMGMEV  164

Query  659  REKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGI  838
            RE++T GE+LP+   KI MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGI
Sbjct  165  RERVTKGEELPITTAKITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGI  224

Query  839  LY  844
            LY
Sbjct  225  LY  226



>ref|XP_009128828.1| PREDICTED: magnesium-chelatase subunit ChlI-2, chloroplastic 
[Brassica rapa]
Length=420

 Score =   275 bits (704),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 152/185 (82%), Gaps = 2/185 (1%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            G K Y  I     K R + HV ++NVAT    + E+AKK+   ES RPVYPF+AIVGQDE
Sbjct  36   GGKLYRRIQSETKKSRSRHHVLVTNVAT-GINSIEQAKKIDTKESARPVYPFAAIVGQDE  94

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            M LCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI VVAGDP+NSDP DPE M 
Sbjct  95   MNLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEITVVAGDPYNSDPRDPEFMG  154

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
             E+RE++  GE+L V  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  155  KEVRERVQKGEELDVMETKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  214

Query  830  RGILY  844
            RGILY
Sbjct  215  RGILY  219



>ref|XP_008783919.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Phoenix 
dactylifera]
Length=427

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 149/184 (81%), Gaps = 3/184 (2%)
 Frame = +2

Query  296  RKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEM  472
            R F GGIG    +G       ISNVA       E AKKLAA ES RPVYPFSAIVGQDEM
Sbjct  45   RTFRGGIGTGFRRG--ARRSIISNVAAPDISPTEAAKKLAAKESQRPVYPFSAIVGQDEM  102

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKST VRSLVDLLPEI VV GDPFNSDP+DPE M +
Sbjct  103  KLCLLLNVIDPKIGGVMIMGDRGTGKSTAVRSLVDLLPEISVVVGDPFNSDPEDPESMGM  162

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  832
            E+RE++  G++LP    KI MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR
Sbjct  163  EVRERVMKGQELPATTAKITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR  222

Query  833  GILY  844
            GILY
Sbjct  223  GILY  226



>gb|KFK31505.1| hypothetical protein AALP_AA6G121400 [Arabis alpina]
Length=417

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 150/185 (81%), Gaps = 6/185 (3%)
 Frame = +2

Query  293  GRKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDE  469
            GRK Y  I L   K R      + NVATE     E+ KK+ + ES RPVYPF+AIVGQDE
Sbjct  37   GRKLYERIQLKRKKNRS----VVMNVATEVNSI-EQGKKIDSKESARPVYPFAAIVGQDE  91

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI VVAGDP+NSDP DPE M 
Sbjct  92   MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEITVVAGDPYNSDPKDPEFMG  151

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
             E+REK+  GE L V  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  152  KEVREKVQKGEQLLVVETKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  211

Query  830  RGILY  844
            RGILY
Sbjct  212  RGILY  216



>ref|XP_006449465.1| hypothetical protein CICLE_v10015348mg [Citrus clementina]
 ref|XP_006449466.1| hypothetical protein CICLE_v10015348mg [Citrus clementina]
 gb|ESR62705.1| hypothetical protein CICLE_v10015348mg [Citrus clementina]
 gb|ESR62706.1| hypothetical protein CICLE_v10015348mg [Citrus clementina]
Length=369

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 146/170 (86%), Gaps = 3/170 (2%)
 Frame = +2

Query  335  GRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIG  514
            GR  F  +++NVATE     E+A+K +    RPVYPF+AIVGQ+EMKLCLLLNVIDPKIG
Sbjct  2    GRALF--AVTNVATEVNSV-EQAQKRSKESQRPVYPFTAIVGQEEMKLCLLLNVIDPKIG  58

Query  515  GVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPV  694
            GVMIMGDRGTGKSTTVRSLVDLLP IKVV GDP+NSDP+DPE M +E+RE +  GE+L +
Sbjct  59   GVMIMGDRGTGKSTTVRSLVDLLPVIKVVVGDPYNSDPEDPEAMGIEVRESVVKGEELSI  118

Query  695  ALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
              +KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  119  TFSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  168



>gb|KDO77798.1| hypothetical protein CISIN_1g014510mg [Citrus sinensis]
Length=369

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 146/170 (86%), Gaps = 3/170 (2%)
 Frame = +2

Query  335  GRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIG  514
            GR  F  +++NVATE     E+A+K +    RPVYPF+AIVGQ+EMKLCLLLNVIDPKIG
Sbjct  2    GRALF--AVTNVATEVNSV-EQAQKRSKESQRPVYPFTAIVGQEEMKLCLLLNVIDPKIG  58

Query  515  GVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPV  694
            GVMIMGDRGTGKSTTVRSLVDLLP IKVV GDP+NSDP+DPE M +E+RE +  GE+L +
Sbjct  59   GVMIMGDRGTGKSTTVRSLVDLLPVIKVVVGDPYNSDPEDPEAMGIEVRESVVKGEELSI  118

Query  695  ALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
              +KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  119  TFSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  168



>gb|KJB68387.1| hypothetical protein B456_010G242400 [Gossypium raimondii]
Length=396

 Score =   267 bits (683),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 154/172 (90%), Gaps = 2/172 (1%)
 Frame = +2

Query  296  RKFYGGIGLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEM  472
            +KFYGGIG+   KG+PQFH++++NVA+E    Q+ A+KL A ES RPVYPF+AIVGQDEM
Sbjct  41   KKFYGGIGIQGKKGKPQFHIAVTNVASEINSVQQ-AQKLGAKESQRPVYPFAAIVGQDEM  99

Query  473  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSV  652
            KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV GDP+NSDP+DPE M +
Sbjct  100  KLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVFGDPYNSDPEDPESMGI  159

Query  653  EIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEP  808
            E+REK+T GE+L + + KINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEP
Sbjct  160  EVREKVTKGEELMITMIKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEP  211



>ref|XP_009383480.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 151/175 (86%), Gaps = 6/175 (3%)
 Frame = +2

Query  332  KGRPQFHVSISNVA---TEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVI  499
            + RP+ H+ +S  A   TE + A E  KKL +SES RPV+PFSAIVGQDEMKLCLLLNVI
Sbjct  34   RHRPR-HLLVSGAAAATTELSSADE-GKKLMSSESQRPVFPFSAIVGQDEMKLCLLLNVI  91

Query  500  DPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTG  679
            DPKIGGVMIMGDRGTGKST VRSLVDLLPEIKVV GDPFNSDP+DPE MS+++R++   G
Sbjct  92   DPKIGGVMIMGDRGTGKSTVVRSLVDLLPEIKVVVGDPFNSDPEDPESMSMDVRDRAARG  151

Query  680  EDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            E LPVA T+I MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  152  EPLPVAATRITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  206



>ref|XP_009383479.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=424

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 151/175 (86%), Gaps = 6/175 (3%)
 Frame = +2

Query  332  KGRPQFHVSISNVA---TEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVI  499
            + RP+ H+ +S  A   TE + A E  KKL +SES RPV+PFSAIVGQDEMKLCLLLNVI
Sbjct  51   RHRPR-HLLVSGAAAATTELSSADE-GKKLMSSESQRPVFPFSAIVGQDEMKLCLLLNVI  108

Query  500  DPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTG  679
            DPKIGGVMIMGDRGTGKST VRSLVDLLPEIKVV GDPFNSDP+DPE MS+++R++   G
Sbjct  109  DPKIGGVMIMGDRGTGKSTVVRSLVDLLPEIKVVVGDPFNSDPEDPESMSMDVRDRAARG  168

Query  680  EDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            E LPVA T+I MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  169  EPLPVAATRITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  223



>ref|XP_009405672.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=529

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 143/159 (90%), Gaps = 2/159 (1%)
 Frame = +2

Query  371  ATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTG  547
            ATE T A+E  KKL   ES RPV+PFS+IVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTG
Sbjct  171  ATELTTAEE-GKKLTIGESQRPVFPFSSIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTG  229

Query  548  KSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLP  727
            KSTTVRSLVDLLPEIKVV GDPFNSDP+DPE MS+++RE+   GE LPVA TKI MVDLP
Sbjct  230  KSTTVRSLVDLLPEIKVVVGDPFNSDPEDPESMSMDVRERAARGEPLPVAATKITMVDLP  289

Query  728  LGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            LGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  290  LGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  328



>sp|A2XIK9.1|CHLI_ORYSI RecName: Full=Magnesium-chelatase subunit ChlI, chloroplastic; 
Short=Mg-chelatase subunit I; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlI; AltName: Full=Protein CHLORINA 
9; Flags: Precursor [Oryza sativa Indica Group]
 gb|EAY90669.1| hypothetical protein OsI_12270 [Oryza sativa Indica Group]
Length=415

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = +2

Query  356  SISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMG  532
            ++ NVA  +   QE AK   A ES RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMIMG
Sbjct  52   TVCNVAAPSATQQE-AKAAGAKESLRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMG  110

Query  533  DRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKIN  712
            DRGTGKSTTVRSLVDLLP+I+VV GDPFNSDPDDPEVM  E+RE++  GE LPV   KI 
Sbjct  111  DRGTGKSTTVRSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRERVLEGEKLPVVTAKIT  170

Query  713  MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            MVDLPLGATEDRVCGTIDIEKALT+GVKAFEPGLLAKANRGILY
Sbjct  171  MVDLPLGATEDRVCGTIDIEKALTDGVKAFEPGLLAKANRGILY  214



>ref|NP_001050493.1| Os03g0563300 [Oryza sativa Japonica Group]
 sp|Q53RM0.1|CHLI_ORYSJ RecName: Full=Magnesium-chelatase subunit ChlI, chloroplastic; 
Short=Mg-chelatase subunit I; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlI; AltName: Full=Protein CHLORINA 
9; Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAX95610.1| magnesium chelatase ATPase subunit I [Oryza sativa Japonica Group]
 gb|ABF97128.1| Magnesium-chelatase subunit chlI, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF12407.1| Os03g0563300 [Oryza sativa Japonica Group]
 gb|ABK58608.1| magnesium chelatase subunit I [Oryza sativa Japonica Group]
 gb|ABK58609.1| magnesium chelatase subunit I [Oryza sativa Japonica Group]
 gb|EAZ27502.1| hypothetical protein OsJ_11451 [Oryza sativa Japonica Group]
 dbj|BAG92109.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96680.1| unnamed protein product [Oryza sativa Japonica Group]
Length=415

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = +2

Query  356  SISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMG  532
            ++ NVA  +   QE AK   A ES RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMIMG
Sbjct  52   TVCNVAAPSATQQE-AKAAGAKESQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMG  110

Query  533  DRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKIN  712
            DRGTGKSTTVRSLVDLLP+I+VV GDPFNSDPDDPEVM  E+RE++  GE LPV   KI 
Sbjct  111  DRGTGKSTTVRSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRERVLEGEKLPVVTAKIT  170

Query  713  MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            MVDLPLGATEDRVCGTIDIEKALT+GVKAFEPGLLAKANRGILY
Sbjct  171  MVDLPLGATEDRVCGTIDIEKALTDGVKAFEPGLLAKANRGILY  214



>ref|XP_002442883.1| hypothetical protein SORBIDRAFT_08g004300 [Sorghum bicolor]
 gb|EES16721.1| hypothetical protein SORBIDRAFT_08g004300 [Sorghum bicolor]
Length=422

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 145/178 (81%), Gaps = 6/178 (3%)
 Frame = +2

Query  317  GLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLN  493
            GL   +GR     ++ NVA      QE     AA ES RPVYPF+AIVGQDEMKLCLLLN
Sbjct  48   GLDFRRGR----FTVCNVAAPTAAEQEATASSAAKESQRPVYPFAAIVGQDEMKLCLLLN  103

Query  494  VIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKIT  673
            VIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP+I+VV GDPFNSDPDDPEVM  E+RE++ 
Sbjct  104  VIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRERVL  163

Query  674  TGE-DLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
             G+  LPV   KI MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  164  RGDAGLPVTTAKITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  221



>ref|XP_004977284.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X2 [Setaria italica]
Length=418

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 148/178 (83%), Gaps = 7/178 (4%)
 Frame = +2

Query  317  GLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLN  493
            GL   +GR     ++ NVA   T A++ AK  +A ES RPVYPF+AIVGQDEMKLCLLLN
Sbjct  45   GLGFRRGR----FTVCNVAA-PTAAEQEAKASSAKESQRPVYPFAAIVGQDEMKLCLLLN  99

Query  494  VIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKIT  673
            VIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP I+VV GDPFNSDPDDPEVM  E+RE++ 
Sbjct  100  VIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPNIRVVVGDPFNSDPDDPEVMGPEVRERVL  159

Query  674  TGED-LPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
             G+  LPV   KI MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  160  QGDTGLPVTTAKITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  217



>gb|ACN32024.1| unknown [Zea mays]
Length=413

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 142/177 (80%), Gaps = 5/177 (3%)
 Frame = +2

Query  317  GLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNV  496
            GL   +GR     ++ NVA      QE     A    RPVYPF+AIVGQDEMKLCLLLNV
Sbjct  40   GLDFRRGR----FTVCNVAAPTAAEQEATASAAKETQRPVYPFAAIVGQDEMKLCLLLNV  95

Query  497  IDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITT  676
            IDPKIGGVMIMGDRGTGKSTTVRSLVDLLP+I+VV GDPFNSDPDDPEVM  E+R+++  
Sbjct  96   IDPKIGGVMIMGDRGTGKSTTVRSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRQRVLQ  155

Query  677  GED-LPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            G+  LPV   KI MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  156  GDTGLPVTTAKITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  212



>ref|XP_004977283.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
isoform X1 [Setaria italica]
Length=447

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 148/178 (83%), Gaps = 7/178 (4%)
 Frame = +2

Query  317  GLPVNKGRPQFHVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLN  493
            GL   +GR     ++ NVA   T A++ AK  +A ES RPVYPF+AIVGQDEMKLCLLLN
Sbjct  74   GLGFRRGR----FTVCNVAA-PTAAEQEAKASSAKESQRPVYPFAAIVGQDEMKLCLLLN  128

Query  494  VIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKIT  673
            VIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP I+VV GDPFNSDPDDPEVM  E+RE++ 
Sbjct  129  VIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPNIRVVVGDPFNSDPDDPEVMGPEVRERVL  188

Query  674  TGED-LPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
             G+  LPV   KI MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  189  QGDTGLPVTTAKITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  246



>ref|XP_006650249.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic-like 
[Oryza brachyantha]
Length=417

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 143/164 (87%), Gaps = 2/164 (1%)
 Frame = +2

Query  356  SISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMG  532
            ++ NVA  +   QE AK   A ES RPVYPF+AIVGQDEMKLCLLLNVIDPKIGGVMIMG
Sbjct  54   AVCNVAAPSATEQE-AKAAGAKESQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMG  112

Query  533  DRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKIN  712
            DRGTGKSTTVRSLVDLLP+I+VV GDPFNSDP+DPEVM  E+RE++  G++LPV   KI 
Sbjct  113  DRGTGKSTTVRSLVDLLPDIRVVVGDPFNSDPEDPEVMGPEVRERVLEGDNLPVVTAKIT  172

Query  713  MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            MVDLPLGATEDRVCGTIDIEKALT+GVKAFEPGLLAKANRGILY
Sbjct  173  MVDLPLGATEDRVCGTIDIEKALTDGVKAFEPGLLAKANRGILY  216



>gb|ACF87583.1| unknown [Zea mays]
 gb|ACG34535.1| magnesium-chelatase subunit chlI [Zea mays]
 gb|AFW56173.1| oil yellow1 [Zea mays]
Length=422

 Score =   261 bits (666),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 142/177 (80%), Gaps = 5/177 (3%)
 Frame = +2

Query  317  GLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNV  496
            GL   +GR     ++ NVA      QE     A    RPVYPF+AIVGQDEMKLCLLLNV
Sbjct  49   GLDFRRGR----FTVCNVAAPTAAEQEATASAAKETQRPVYPFAAIVGQDEMKLCLLLNV  104

Query  497  IDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITT  676
            IDPKIGGVMIMGDRGTGKSTTVRSLVDLLP+I+VV GDPFNSDPDDPEVM  E+R+++  
Sbjct  105  IDPKIGGVMIMGDRGTGKSTTVRSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRQRVLQ  164

Query  677  GED-LPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            G+  LPV   KI MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  165  GDTGLPVTTAKITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  221



>dbj|BAJ84973.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|ABF72535.3| magnesium chelatase 40-kDa subunit [Hordeum vulgare subsp. vulgare]
Length=420

 Score =   261 bits (666),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = +2

Query  350  HVSISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMI  526
              ++ NVA  +   QE     AA ES RPVYPF AIVGQDEMKLCLLLNVIDPKIGGVMI
Sbjct  54   RFAVCNVAAPSAAEQETKPAAAAKESQRPVYPFPAIVGQDEMKLCLLLNVIDPKIGGVMI  113

Query  527  MGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTK  706
            MGDRGTGKSTTVRSLVDLLP+I VV GDPFNSDP DPEVM  E+R+++  GE LPV  TK
Sbjct  114  MGDRGTGKSTTVRSLVDLLPDISVVVGDPFNSDPYDPEVMGPEVRDRLLKGESLPVTTTK  173

Query  707  INMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            I MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  174  ITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  219



>gb|ACF83077.1| unknown [Zea mays]
Length=450

 Score =   261 bits (666),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 142/177 (80%), Gaps = 5/177 (3%)
 Frame = +2

Query  317  GLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNV  496
            GL   +GR     ++ NVA      QE     A    RPVYPF+AIVGQDEMKLCLLLNV
Sbjct  77   GLDFRRGR----FTVCNVAAPTAAEQEATASAAKETQRPVYPFAAIVGQDEMKLCLLLNV  132

Query  497  IDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITT  676
            IDPKIGGVMIMGDRGTGKSTTVRSLVDLLP+I+VV GDPFNSDPDDPEVM  E+R+++  
Sbjct  133  IDPKIGGVMIMGDRGTGKSTTVRSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRQRVLQ  192

Query  677  GED-LPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            G+  LPV   KI MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  193  GDTGLPVTTAKITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  249



>ref|XP_008662350.1| PREDICTED: oil yellow1 isoform X1 [Zea mays]
 gb|AFW56172.1| oil yellow1 [Zea mays]
Length=459

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 142/177 (80%), Gaps = 5/177 (3%)
 Frame = +2

Query  317  GLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNV  496
            GL   +GR     ++ NVA      QE     A    RPVYPF+AIVGQDEMKLCLLLNV
Sbjct  86   GLDFRRGR----FTVCNVAAPTAAEQEATASAAKETQRPVYPFAAIVGQDEMKLCLLLNV  141

Query  497  IDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITT  676
            IDPKIGGVMIMGDRGTGKSTTVRSLVDLLP+I+VV GDPFNSDPDDPEVM  E+R+++  
Sbjct  142  IDPKIGGVMIMGDRGTGKSTTVRSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRQRVLQ  201

Query  677  GED-LPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            G+  LPV   KI MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  202  GDTGLPVTTAKITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  258



>gb|EMS53132.1| Magnesium-chelatase subunit chlI, chloroplastic [Triticum urartu]
Length=419

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  356  SISNVATEATPAQERAKKLAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMG  532
            ++ NVA  +    E     AA ES RPVYPF AIVGQDEMKLCLLLNVIDPKIGGVMIMG
Sbjct  55   AVCNVAAPSAAELETKPAAAAKESQRPVYPFPAIVGQDEMKLCLLLNVIDPKIGGVMIMG  114

Query  533  DRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKIN  712
            DRGTGKSTTVRSLVDLLP+I VV GDPFNSDP DPEVM  E+R+++  GEDLPV  TKI 
Sbjct  115  DRGTGKSTTVRSLVDLLPDISVVVGDPFNSDPFDPEVMGPEVRDRLLKGEDLPVTTTKIT  174

Query  713  MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  175  MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  218



>gb|AFW56174.1| oil yellow1 [Zea mays]
Length=443

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 142/177 (80%), Gaps = 5/177 (3%)
 Frame = +2

Query  317  GLPVNKGRPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNV  496
            GL   +GR     ++ NVA      QE     A    RPVYPF+AIVGQDEMKLCLLLNV
Sbjct  70   GLDFRRGR----FTVCNVAAPTAAEQEATASAAKETQRPVYPFAAIVGQDEMKLCLLLNV  125

Query  497  IDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITT  676
            IDPKIGGVMIMGDRGTGKSTTVRSLVDLLP+I+VV GDPFNSDPDDPEVM  E+R+++  
Sbjct  126  IDPKIGGVMIMGDRGTGKSTTVRSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRQRVLQ  185

Query  677  GED-LPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            G+  LPV   KI MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  186  GDTGLPVTTAKITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  242



>ref|XP_002989492.1| hypothetical protein SELMODRAFT_235795 [Selaginella moellendorffii]
 gb|EFJ09368.1| hypothetical protein SELMODRAFT_235795 [Selaginella moellendorffii]
Length=365

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 136/150 (91%), Gaps = 2/150 (1%)
 Frame = +2

Query  401  AKKLAASE--SRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLV  574
            AKK A S+   RPV+PF+AIVGQ+EMKLCL+LNVIDPKIGGVMIMGDRGTGKSTTVRSLV
Sbjct  12   AKKAAFSKESQRPVFPFTAIVGQEEMKLCLILNVIDPKIGGVMIMGDRGTGKSTTVRSLV  71

Query  575  DLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVC  754
            DLLPEI VVAGDPFNSDPDDPE+MS E+R K+   + LP AL KINMVDLPLGATEDRVC
Sbjct  72   DLLPEITVVAGDPFNSDPDDPELMSEEVRLKVQQDQPLPSALVKINMVDLPLGATEDRVC  131

Query  755  GTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            GTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  132  GTIDIEKALTEGVKAFEPGLLAKANRGILY  161



>gb|ACF85806.1| unknown [Zea mays]
Length=424

 Score =   258 bits (658),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 145/179 (81%), Gaps = 7/179 (4%)
 Frame = +2

Query  317  GLPVNKGRPQFHVSISNVATEATPAQERAKKLAASE--SRPVYPFSAIVGQDEMKLCLLL  490
            GL   +GR     ++ NVA      QE     +A++   RPVYPF+AIVGQDEMKLCLLL
Sbjct  49   GLDFRRGR----FTVCNVAAPTAAEQEATASASAAKETQRPVYPFAAIVGQDEMKLCLLL  104

Query  491  NVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKI  670
            NVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP+I+VV GDPFNSDPDDPEVM  E+R+++
Sbjct  105  NVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRQRV  164

Query  671  TTGED-LPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
              G+  LPV   KI MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  165  LQGDTGLPVTTAKITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  223



>gb|EPS68275.1| hypothetical protein M569_06494, partial [Genlisea aurea]
Length=344

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +2

Query  425  SRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVA  604
             RPVYPF+AIVGQ+EMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI VVA
Sbjct  5    QRPVYPFAAIVGQEEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEILVVA  64

Query  605  GDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALT  784
            GD FNSDPDD E+   E+RE++  GE +PVALTKINMVDLPLGATEDRVCGTIDIEKALT
Sbjct  65   GDAFNSDPDDAELQGPEVRERVLKGEKVPVALTKINMVDLPLGATEDRVCGTIDIEKALT  124

Query  785  EGVKAFEPGLLAKANRGILY  844
            EGVKAFEPGLLAKANRGILY
Sbjct  125  EGVKAFEPGLLAKANRGILY  144



>ref|XP_001758041.1| predicted protein [Physcomitrella patens]
 gb|EDQ77283.1| predicted protein [Physcomitrella patens]
Length=354

 Score =   253 bits (645),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = +2

Query  422  ESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV  601
            E+RPV+PF+AIVGQ+EMK+CL+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI+VV
Sbjct  10   EARPVFPFTAIVGQEEMKMCLILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIEVV  69

Query  602  AGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKAL  781
            AGDPFNS P DPE+MS E+R+++   E+LPVA ++INMVDLPLGATEDRVCGTIDIEKAL
Sbjct  70   AGDPFNSSPQDPELMSEEVRKRVQANEELPVATSRINMVDLPLGATEDRVCGTIDIEKAL  129

Query  782  TEGVKAFEPGLLAKANRGILY  844
            TEGVKAFEPGLLA+ANRGILY
Sbjct  130  TEGVKAFEPGLLARANRGILY  150



>ref|XP_003557120.1| PREDICTED: magnesium-chelatase subunit ChlI, chloroplastic [Brachypodium 
distachyon]
Length=417

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  353  VSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMG  532
            +++ NVA        +A   A    RPVYPF AIVGQDEMKLCLLLNVIDPKIGGVMIMG
Sbjct  53   LTVRNVAAPEASTATKAAGGAKESQRPVYPFPAIVGQDEMKLCLLLNVIDPKIGGVMIMG  112

Query  533  DRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKIN  712
            DRGTGKSTTVRSLVDLLP+I VV GDPFNSDP DPEVM  E+R+++  G+ LPV   KI 
Sbjct  113  DRGTGKSTTVRSLVDLLPDISVVVGDPFNSDPYDPEVMGPEVRDRVLKGDSLPVTTAKIT  172

Query  713  MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  173  MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  216



>ref|NP_001105917.1| oil yellow1 [Zea mays]
 gb|AAZ14052.1| magnesium chelatase subunit I precursor [Zea mays]
 gb|AAZ14053.1| magnesium chelatase subunit I precursor [Zea mays]
 gb|ACG35191.1| magnesium-chelatase subunit chlI [Zea mays]
Length=415

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 145/179 (81%), Gaps = 7/179 (4%)
 Frame = +2

Query  317  GLPVNKGRPQFHVSISNVATEATPAQERAKKLAASE--SRPVYPFSAIVGQDEMKLCLLL  490
            GL   +GR     ++ NVA      QE     +A++   RPVYPF+AIVGQDEMKLCLLL
Sbjct  40   GLDFRRGR----FTVCNVAAPTAAEQEATATASAAKETQRPVYPFAAIVGQDEMKLCLLL  95

Query  491  NVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKI  670
            NVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP+I+VV GDPFNSDPDDPEVM  E+R+++
Sbjct  96   NVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRQRV  155

Query  671  TTGED-LPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
              G+  LPV   KI MVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  156  LQGDTGLPVTTAKITMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  214



>ref|YP_009106670.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Pseudochloris wilhelmii]
 gb|AIT95482.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Pseudochloris wilhelmii]
Length=362

 Score =   251 bits (641),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  374  TEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKS  553
            T++   +++ + +   ++RPV+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKS
Sbjct  2    TQSAITKQKNQTVDTDQARPVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKS  61

Query  554  TTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLG  733
            TTVR+LVDLLPEI VV GDPFNSDP DPE+MS EIRE++   E+LP+A  KI+MVDLPLG
Sbjct  62   TTVRALVDLLPEIDVVDGDPFNSDPKDPELMSQEIRERVQRNEELPIAQKKISMVDLPLG  121

Query  734  ATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            ATEDRVCGTIDIEKALTEGVKAFEPGLLAKA+RGILY
Sbjct  122  ATEDRVCGTIDIEKALTEGVKAFEPGLLAKAHRGILY  158



>ref|XP_001761873.1| predicted protein [Physcomitrella patens]
 gb|EDQ73314.1| predicted protein [Physcomitrella patens]
Length=358

 Score =   251 bits (640),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = +2

Query  422  ESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV  601
            ++RPV+PF+AIVGQ+EMK+CL+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI+VV
Sbjct  14   DARPVFPFTAIVGQEEMKMCLILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIQVV  73

Query  602  AGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKAL  781
            AGDPFNS P+DPE+MS E+R+++   E LPV  ++INMVDLPLGATEDRVCGTIDIEKAL
Sbjct  74   AGDPFNSSPEDPELMSEEVRKRVQANESLPVTTSRINMVDLPLGATEDRVCGTIDIEKAL  133

Query  782  TEGVKAFEPGLLAKANRGILY  844
            TEGVKAFEPGLLAKANRGILY
Sbjct  134  TEGVKAFEPGLLAKANRGILY  154



>ref|YP_009106384.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Fusochloris perforata]
 gb|AIT95159.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Fusochloris perforata]
Length=353

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             +SRP++PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEIKV
Sbjct  8    EQSRPIFPFAAIVGQEEMKLSLILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIKV  67

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            V  DPFNSDPDDPE+MS ++REKI   E L +A+ +I MVDLPLGATEDRVCGTIDIEKA
Sbjct  68   VVNDPFNSDPDDPELMSEDVREKIKKKEQLDIAMRRITMVDLPLGATEDRVCGTIDIEKA  127

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  128  LTEGVKAFEPGLLAKANRGILY  149



>gb|AIY30226.1| photochlorophyllide reductase subunit I (chloroplast) [Lobosphaera 
incisa]
Length=353

 Score =   247 bits (631),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  422  ESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV  601
            +SRP++PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEIKVV
Sbjct  9    QSRPIFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIKVV  68

Query  602  AGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKAL  781
              DPFNSDPDDPE+MS E+REK+   E+L   + KI MVDLPLGATEDRVCGTIDIEKAL
Sbjct  69   KNDPFNSDPDDPELMSEEVREKLQKNEELETTIRKICMVDLPLGATEDRVCGTIDIEKAL  128

Query  782  TEGVKAFEPGLLAKANRGILY  844
            TEGVKAFEPGLLAKANRGILY
Sbjct  129  TEGVKAFEPGLLAKANRGILY  149



>ref|YP_003058322.1| Mg-protoporyphyrin IX chelatase [Parachlorella kessleri]
 gb|ACQ90917.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Parachlorella kessleri]
Length=356

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  407  KLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP  586
            K +  ++RPV+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLP
Sbjct  6    KNSLEQARPVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLP  65

Query  587  EIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTID  766
            EI+VVA DPFNSDP DPE+MS E+RE++   E LPV   KI MVDLPLGATEDRVCGTID
Sbjct  66   EIQVVADDPFNSDPQDPELMSQEVRERLQANEKLPVTTKKITMVDLPLGATEDRVCGTID  125

Query  767  IEKALTEGVKAFEPGLLAKANRGILY  844
            IEKALTEGVKAFEPGLLAKANRGILY
Sbjct  126  IEKALTEGVKAFEPGLLAKANRGILY  151



>ref|YP_009105570.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Lobosphaera incisa]
 gb|AIT94215.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Lobosphaera incisa]
Length=353

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  422  ESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV  601
            +SRP++PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEIKVV
Sbjct  9    QSRPIFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIKVV  68

Query  602  AGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKAL  781
              DPFNSDPDDPE+MS E+REK+   E L   + KI MVDLPLGATEDRVCGTIDIEKAL
Sbjct  69   KNDPFNSDPDDPELMSEEVREKLQKNEQLETTIRKICMVDLPLGATEDRVCGTIDIEKAL  128

Query  782  TEGVKAFEPGLLAKANRGILY  844
            TEGVKAFEPGLLAKANRGILY
Sbjct  129  TEGVKAFEPGLLAKANRGILY  149



>ref|YP_009020880.1| magnesium-chelatase 38 kDa subunit (chloroplast) [Chlorella sorokiniana]
 gb|AHM23754.1| magnesium-chelatase 38 kDa subunit (chloroplast) [Chlorella sorokiniana]
 gb|AII02048.1| protochlorophyllide reductase magnesium chelatase subunit (chloroplast) 
[Chlorella sorokiniana]
Length=354

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             ++RPV+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI+V
Sbjct  10   EQARPVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIQV  69

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPFNSDP DPE+MS E+RE++   E LPV   KI+MVDLPLGATEDRVCGTIDIEKA
Sbjct  70   VADDPFNSDPQDPELMSQEVRERLQRNETLPVTTKKISMVDLPLGATEDRVCGTIDIEKA  129

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  130  LTEGVKAFEPGLLAKANRGILY  151



>ref|YP_009106625.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Dicloster acuatus]
 gb|AIT95395.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Dicloster acuatus]
Length=356

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  407  KLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP  586
            K +  ++RPV+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLP
Sbjct  6    KNSLDQARPVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLP  65

Query  587  EIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTID  766
            EI+VVA DPFNSDP DPE+MS E+RE++   E LPV   KI MVDLPLGATEDRVCGTID
Sbjct  66   EIQVVADDPFNSDPQDPELMSQEVRERLQANEKLPVITKKITMVDLPLGATEDRVCGTID  125

Query  767  IEKALTEGVKAFEPGLLAKANRGILY  844
            IEKALTEGVKAFEPGLLAKANRGILY
Sbjct  126  IEKALTEGVKAFEPGLLAKANRGILY  151



>ref|YP_009106080.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Choricystis parasitica]
 gb|AIT94827.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Choricystis parasitica]
Length=354

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  422  ESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV  601
            +SRPV+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI+VV
Sbjct  10   QSRPVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIQVV  69

Query  602  AGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKAL  781
            A DPFNSDP DPE+MS ++RE++   E L VA  KI MVDLPLGATEDRVCGTIDIEKAL
Sbjct  70   ANDPFNSDPQDPELMSQDVRERVQANETLEVASRKITMVDLPLGATEDRVCGTIDIEKAL  129

Query  782  TEGVKAFEPGLLAKANRGILY  844
            TEGVKAFEPGLLAKANRGILY
Sbjct  130  TEGVKAFEPGLLAKANRGILY  150



>ref|YP_004347806.1| photochlorophyllide reductase subunit L [Chlorella variabilis]
 gb|ADZ05054.1| photochlorophyllide reductase subunit L [Chlorella variabilis]
 gb|AIH00140.1| protochlorophyllide reductase magnesium chelatase subunit (chloroplast) 
[Chlorella variabilis]
 gb|AJP09470.1| protochlorophyllide reductase magnesium chelatase subunit (chloroplast) 
[Chlorella variabilis]
Length=354

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             ++RPV+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI+V
Sbjct  10   EQARPVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIQV  69

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPFNSDP DPE+MS E+RE++   E LPV   KI+MVDLPLGATEDRVCGTIDIEKA
Sbjct  70   VADDPFNSDPKDPELMSQEVRERLQRNETLPVTTKKISMVDLPLGATEDRVCGTIDIEKA  129

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  130  LTEGVKAFEPGLLAKANRGILY  151



>ref|YP_009106568.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Botryococcus braunii]
 gb|AIT95315.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Botryococcus braunii]
Length=355

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             +SRPV+PF+AIVGQDEMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI V
Sbjct  8    EQSRPVFPFTAIVGQDEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIDV  67

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            +A DPFNSDP DPE+MS E+REKI   E L  A  KI+MVDLPLGATEDRVCGTIDIEKA
Sbjct  68   IANDPFNSDPKDPELMSQEVREKIQKNEPLETAKRKISMVDLPLGATEDRVCGTIDIEKA  127

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  128  LTEGVKAFEPGLLAKANRGILY  149



>ref|YP_009105900.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Microthamnion kuetzingianum]
 gb|AIT94671.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Microthamnion kuetzingianum]
Length=353

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             +SRP++PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEIKV
Sbjct  8    EQSRPIFPFAAIVGQEEMKLSLILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIKV  67

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            V  DPFNSDPDDPE+MS E+RE++   E L V + +I MVDLPLGATEDRVCGTIDIEKA
Sbjct  68   VVNDPFNSDPDDPELMSEEVRERLQKKEQLDVTMRRITMVDLPLGATEDRVCGTIDIEKA  127

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  128  LTEGVKAFEPGLLAKANRGILY  149



>ref|YP_009104898.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Myrmecia israelensis]
 gb|AIT93395.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Myrmecia israelensis]
Length=347

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             ESRP++PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+L+DLLPEI+V
Sbjct  5    EESRPIFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALIDLLPEIEV  64

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            V  DPFNSDP+DPE+MS EIREK+   E L V   KI+MVDLPLGATEDRVCGTIDIEKA
Sbjct  65   VENDPFNSDPNDPELMSEEIREKLQRNEKLSVVRKKISMVDLPLGATEDRVCGTIDIEKA  124

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  125  LTEGVKAFEPGLLAKANRGILY  146



>ref|YP_636458.1| Mg-protoporyphyrin IX chelatase (chloroplast) [Staurastrum punctulatum]
 gb|AAX45691.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Staurastrum punctulatum]
Length=357

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  407  KLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP  586
            +L     RPV+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLP
Sbjct  4    QLVEQTQRPVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLP  63

Query  587  EIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTID  766
            EI+VV  DPFNSDP DPE+MS E+R++I + E+LP   TKI+MVDLPLGATEDRVCGTID
Sbjct  64   EIEVVLDDPFNSDPKDPELMSEEVRDRIRSKENLPTGKTKISMVDLPLGATEDRVCGTID  123

Query  767  IEKALTEGVKAFEPGLLAKANRGILY  844
            IEKALTEGVKAFEPGLLAKANRGILY
Sbjct  124  IEKALTEGVKAFEPGLLAKANRGILY  149



>ref|YP_009105483.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Ettlia pseudoalveolaris]
 gb|AIT94110.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Ettlia pseudoalveolaris]
Length=353

 Score =   245 bits (626),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +2

Query  422  ESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV  601
            +SRP++PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEIKVV
Sbjct  9    QSRPIFPFTAIVGQEEMKLSLILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIKVV  68

Query  602  AGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKAL  781
            A DPFNSDP+DPE+MS E+REKI   + L +   KI+MVDLPLGATEDRVCGTIDIEKAL
Sbjct  69   ANDPFNSDPNDPELMSEEVREKIQQNQPLEITTKKISMVDLPLGATEDRVCGTIDIEKAL  128

Query  782  TEGVKAFEPGLLAKANRGILY  844
            TEG+KAFEPGLLAKANRGILY
Sbjct  129  TEGIKAFEPGLLAKANRGILY  149



>ref|YP_009033686.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) (chloroplast) [Roya anglica]
 gb|AHZ11069.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) (chloroplast) [Roya anglica]
Length=357

 Score =   245 bits (626),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  404  KKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLL  583
            K+L     RP++PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLL
Sbjct  3    KELIEENQRPIFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTVRALVDLL  62

Query  584  PEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTI  763
            P+I+VVA DPFNSDP DPE+MS E+R++I   E+L +  TKI+MVDLPLGATEDRVCGTI
Sbjct  63   PDIQVVADDPFNSDPSDPELMSEEVRQRIRNKEELSIVNTKISMVDLPLGATEDRVCGTI  122

Query  764  DIEKALTEGVKAFEPGLLAKANRGILY  844
            DIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  123  DIEKALTEGVKAFEPGLLAKANRGILY  149



>gb|AGZ19336.1| magnesium-chelatase subunit chlI (chloroplast) (chloroplast) 
[Chlorella sp. ArM0029B]
Length=354

 Score =   245 bits (625),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             ++RPV+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI++
Sbjct  10   EQARPVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIQI  69

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPFNSDP DPE+MS E+RE++   E LPV   KI+MVDLPLGATEDRVCGTIDIEKA
Sbjct  70   VADDPFNSDPTDPELMSQEVRERLQRNETLPVTTKKISMVDLPLGATEDRVCGTIDIEKA  129

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  130  LTEGVKAFEPGLLAKANRGILY  151



>gb|AIT94137.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Marsupiomonas sp. NIES 1824]
Length=353

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
            +E+RPV+PF+AIVGQ+EMKL LLLNVIDPKIGGVM+MGDRGTGKSTTVR+LVDLLPEI +
Sbjct  8    TEARPVFPFTAIVGQEEMKLALLLNVIDPKIGGVMVMGDRGTGKSTTVRALVDLLPEIDI  67

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            V  DPFNSDP+DPE+MS E+R+K+   E++ V+  KINMVDLPLGATEDRVCGTIDIEKA
Sbjct  68   VENDPFNSDPNDPELMSDEVRQKVRLNEEISVSKKKINMVDLPLGATEDRVCGTIDIEKA  127

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  128  LTEGVKAFEPGLLAKANRGILY  149



>ref|YP_009106193.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Planctonema lauterbornii]
 gb|AIT94996.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Planctonema lauterbornii]
Length=351

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             +SRP++PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEIKV
Sbjct  8    EQSRPIFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIKV  67

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            +A DPFNSDPDDPE+MS E+REK+   E L V   KI M+DLPLGATEDRVCGTIDIEKA
Sbjct  68   IANDPFNSDPDDPELMSEEVREKLKQKEILEVINKKIPMIDLPLGATEDRVCGTIDIEKA  127

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            L+EGVKAFEPGLLAKANRGILY
Sbjct  128  LSEGVKAFEPGLLAKANRGILY  149



>ref|YP_009105743.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Neocystis brevis]
 gb|AIT94389.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Neocystis brevis]
Length=352

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             ++RP++PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLP IKV
Sbjct  8    DQNRPIFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPLIKV  67

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPFNSDPDDPE+MS E+REK+   E L V   KI MVDLPLGATEDRVCGTIDIEKA
Sbjct  68   VANDPFNSDPDDPELMSEEVREKLQKNEKLEVTTRKIAMVDLPLGATEDRVCGTIDIEKA  127

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  128  LTEGVKAFEPGLLAKANRGILY  149



>ref|YP_009106472.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Geminella minor]
 gb|AIT95234.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Geminella minor]
Length=352

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             ++RP++PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEIKV
Sbjct  8    EQNRPIFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIKV  67

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            V  D FNSDPDDPE+MS EIREK+   E + V   KI+MVDLPLGATEDRVCGTIDIEKA
Sbjct  68   VENDLFNSDPDDPELMSQEIREKLQNNEKIQVTTKKISMVDLPLGATEDRVCGTIDIEKA  127

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEG+KAFEPGLLAKANRGILY
Sbjct  128  LTEGIKAFEPGLLAKANRGILY  149



>ref|YP_009033847.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Mesotaenium endlicherianum]
 gb|AHZ11230.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Mesotaenium endlicherianum]
Length=354

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  425  SRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVA  604
             RPV+PF+AIVGQ+EMKL LLLNV+DPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI+VVA
Sbjct  11   QRPVFPFTAIVGQEEMKLALLLNVVDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIEVVA  70

Query  605  GDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALT  784
             DPFNSDP DPE+MS E+RE+IT  + L V  TKI+MVDLPLGATEDRVCGTIDIEKALT
Sbjct  71   DDPFNSDPRDPELMSEEVRERITADQPLSVISTKISMVDLPLGATEDRVCGTIDIEKALT  130

Query  785  EGVKAFEPGLLAKANRGILY  844
            EG+KAFEPGLLAKANRGILY
Sbjct  131  EGIKAFEPGLLAKANRGILY  150



>ref|XP_001691232.1| magnesium chelatase subunit I [Chlamydomonas reinhardtii]
 gb|EDP04965.1| magnesium chelatase subunit I [Chlamydomonas reinhardtii]
Length=417

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  422  ESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV  601
            ++RP++PF+AIVGQDEMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPE++VV
Sbjct  74   QARPIFPFTAIVGQDEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEMQVV  133

Query  602  AGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKAL  781
            A DPFNSDP DPE+MS E+R ++  GE LPV+  KI MVDLPLGATEDRVCGTIDIEKAL
Sbjct  134  ANDPFNSDPTDPELMSEEVRNRVKAGEQLPVSSKKIPMVDLPLGATEDRVCGTIDIEKAL  193

Query  782  TEGVKAFEPGLLAKANRGILY  844
            TEGVKAFEPGLLAKANRGILY
Sbjct  194  TEGVKAFEPGLLAKANRGILY  214



>ref|YP_009105311.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Pedinomonas tuberculata]
 gb|AIT93885.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Pedinomonas tuberculata]
Length=349

 Score =   242 bits (618),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             +SRPV+PF+AIVGQ+EMKL LLLNVIDPKIGGVM+MGDRGTGKSTTVR+LVDLLPEIKV
Sbjct  5    EQSRPVFPFTAIVGQEEMKLALLLNVIDPKIGGVMVMGDRGTGKSTTVRALVDLLPEIKV  64

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            V  DPF SDP+DPE+MS E+R+K+   E L V   KI+MVDLPLGATEDRVCGTIDIEKA
Sbjct  65   VDNDPFQSDPEDPELMSEEVRQKVRNNEKLSVVNKKISMVDLPLGATEDRVCGTIDIEKA  124

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  125  LTEGVKAFEPGLLAKANRGILY  146



>sp|Q94FT3.1|CHLI_CHLRE RecName: Full=Magnesium-chelatase subunit ChlI, chloroplastic; 
Short=Mg-chelatase subunit I-1; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlI; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAK69657.1|AF343974_1 magnesium-chelatase subunit I [Chlamydomonas reinhardtii]
Length=417

 Score =   244 bits (623),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  422  ESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV  601
            ++RP++PF+AIVGQDEMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPE++VV
Sbjct  74   QARPIFPFTAIVGQDEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEMQVV  133

Query  602  AGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKAL  781
            A DPFNSDP DPE+MS E+R ++  GE LPV+  KI MVDLPLGATEDRVCGTIDIEKAL
Sbjct  134  ANDPFNSDPTDPELMSEEVRNRVKAGEQLPVSSKKIPMVDLPLGATEDRVCGTIDIEKAL  193

Query  782  TEGVKAFEPGLLAKANRGILY  844
            TEGVKAFEPGLLAKANRGILY
Sbjct  194  TEGVKAFEPGLLAKANRGILY  214



>ref|YP_009105984.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Gloeotilopsis sterilis]
 gb|AIT94746.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Gloeotilopsis sterilis]
Length=352

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             ++RP++PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEIKV
Sbjct  8    EQNRPIFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIKV  67

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            V  D FNSDPDDPE+MS EIREK+   E + +   KI+MVDLPLGATEDRVCGTIDIEKA
Sbjct  68   VENDLFNSDPDDPELMSQEIREKLQNNEKIEITTKKISMVDLPLGATEDRVCGTIDIEKA  127

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEG+KAFEPGLLAKANRGILY
Sbjct  128  LTEGIKAFEPGLLAKANRGILY  149



>ref|YP_009105211.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Pabia signiensis]
 gb|AIT93806.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Pabia signiensis]
Length=352

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  410  LAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPE  589
            +   +SRP++PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPE
Sbjct  5    ITLDQSRPIFPFTAIVGQEEMKLSLILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPE  64

Query  590  IKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDI  769
            IKVV  DPFNSDP+DPE+MS E+REK+   E + V   KI MVDLPLGATEDRVCGTIDI
Sbjct  65   IKVVLNDPFNSDPEDPELMSEEVREKLKKNEKIEVTNRKILMVDLPLGATEDRVCGTIDI  124

Query  770  EKALTEGVKAFEPGLLAKANRGILY  844
            EKALTEGVKAFEPGLLAKANRGILY
Sbjct  125  EKALTEGVKAFEPGLLAKANRGILY  149



>ref|XP_002947010.1| hypothetical protein VOLCADRAFT_79418 [Volvox carteri f. nagariensis]
 gb|EFJ52236.1| hypothetical protein VOLCADRAFT_79418 [Volvox carteri f. nagariensis]
Length=414

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 133/157 (85%), Gaps = 6/157 (4%)
 Frame = +2

Query  374  TEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKS  553
            TE  P +E        ++RP++PF+AIVGQDEMKL L+LNVIDPKIGGVMIMGDRGTGKS
Sbjct  61   TEVKPEKE------LGQARPIFPFTAIVGQDEMKLALILNVIDPKIGGVMIMGDRGTGKS  114

Query  554  TTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLG  733
            TT+R+L DLLPE+KVVA DPFNSDP DPE+MS E+R ++  GE + VA  KI MVDLPLG
Sbjct  115  TTIRALADLLPEMKVVASDPFNSDPSDPELMSEEVRNRVKAGEQMSVASKKIPMVDLPLG  174

Query  734  ATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            ATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  175  ATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  211



>ref|YP_009106316.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Interfilum terricola]
 gb|AIT95078.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Interfilum terricola]
Length=352

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             +SRP++PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEIKV
Sbjct  8    EQSRPIFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIKV  67

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            V  D FNSDPDD E+MS EIREK+   E L +   KI+MVDLPLGATEDRVCGTIDIEKA
Sbjct  68   VENDLFNSDPDDAELMSQEIREKLQNNEKLEITTKKISMVDLPLGATEDRVCGTIDIEKA  127

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEG+KAFEPGLLAKANRGILY
Sbjct  128  LTEGIKAFEPGLLAKANRGILY  149



>ref|YP_009106843.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Marvania geminata]
 gb|AIT95648.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Marvania geminata]
Length=355

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             ++RPV+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI+V
Sbjct  10   EQARPVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIEV  69

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPFNSDP DPE+MS E+R+++   E LP+   KI MVDLPLGATEDRVCGTIDIEKA
Sbjct  70   VADDPFNSDPKDPELMSQEVRQRLQKQEALPIVNKKITMVDLPLGATEDRVCGTIDIEKA  129

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  130  LTEGVKAFEPGLLAKANRGILY  151



>gb|AIT94561.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Chlorosarcina brevispinosa]
Length=352

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  410  LAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPE  589
            +   +SRP++PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPE
Sbjct  5    ITLEQSRPIFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPE  64

Query  590  IKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDI  769
            I+VV  DPFNSDP DPE+MS EIREK+   E L     KI+MVDLPLGATEDRVCGTIDI
Sbjct  65   IQVVENDPFNSDPFDPEMMSEEIREKLQRNEKLSTTTRKISMVDLPLGATEDRVCGTIDI  124

Query  770  EKALTEGVKAFEPGLLAKANRGILY  844
            EKALTEGVKAFEPGLLAKANRGILY
Sbjct  125  EKALTEGVKAFEPGLLAKANRGILY  149



>ref|WP_015205904.1| protoporphyrin IX magnesium-chelatase [Cylindrospermum stagnale]
 gb|AFZ22646.1| protoporphyrin IX magnesium-chelatase [Cylindrospermum stagnale 
PCC 7417]
Length=371

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            AS  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    ASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNSDP DP++MS EIR+K+  GE++P+A  K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFNSDPSDPDLMSDEIRQKLQQGEEIPIAHKKVQMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|YP_636198.1| Mg-protoporyphyrin IX chelatase [Pseudendoclonium akinetum]
 gb|AAV80622.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Pseudendoclonium akinetum]
Length=349

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +2

Query  422  ESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV  601
            ESRPV+PF+AIVGQDEMKL L+LNVIDPKIGGV+IMGDRGTGKSTTVR+LVDLLPEI VV
Sbjct  8    ESRPVFPFTAIVGQDEMKLSLILNVIDPKIGGVLIMGDRGTGKSTTVRALVDLLPEINVV  67

Query  602  AGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKAL  781
            A DPFNSDP DPE+MS ++R+K   GE L V   KI M+DLPLGATEDRVCGTIDIEKAL
Sbjct  68   ANDPFNSDPLDPELMSEQVRQKFQKGETLEVKKKKITMIDLPLGATEDRVCGTIDIEKAL  127

Query  782  TEGVKAFEPGLLAKANRGILY  844
            TEGVKAFEPGLLA ANRGILY
Sbjct  128  TEGVKAFEPGLLASANRGILY  148



>gb|ACQ90752.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Oocystis solitaria]
Length=352

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             ++RPV+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI V
Sbjct  8    DQNRPVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEINV  67

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPFNSDP DPE+MS EIREK+   E L +   KI M+DLPLGATEDRVCGTIDIEKA
Sbjct  68   VANDPFNSDPSDPELMSEEIREKLQKNEKLEITTKKIPMIDLPLGATEDRVCGTIDIEKA  127

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            L EG+KAFEPGLLAKANRGILY
Sbjct  128  LNEGIKAFEPGLLAKANRGILY  149



>ref|YP_009057860.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Nephroselmis astigmatica]
 gb|AID67666.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Nephroselmis astigmatica]
Length=353

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             ++RPV+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI+V
Sbjct  8    EQARPVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIQV  67

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            V  DPFNSDP DPE+MS E+REK   G+ L V  +KI MVDLPLGATEDRVCGTIDIEKA
Sbjct  68   VENDPFNSDPYDPELMSDEVREKAQQGQTLSVTASKIPMVDLPLGATEDRVCGTIDIEKA  127

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  128  LTEGVKAFEPGLLAKANRGILY  149



>ref|NP_050837.1| Mg-protoporyphyrin IX chelatase (chloroplast) [Nephroselmis olivacea]
 sp|Q9TL08.1|CHLI_NEPOL RecName: Full=Magnesium-chelatase subunit ChlI; Short=Mg-chelatase 
subunit I-1; AltName: Full=Mg-protoporphyrin IX chelatase 
subunit ChlI (chloroplast) [Nephroselmis olivacea]
 gb|AAD54808.1|AF137379_31 magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Nephroselmis olivacea]
Length=355

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            + ++RPV+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI+
Sbjct  8    SEQARPVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIE  67

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VV  DPFNS P DPE+MS E+REK+  GE +    TKI MVDLPLGATEDRVCGTIDIEK
Sbjct  68   VVENDPFNSHPYDPELMSDEVREKVHRGESIRTTTTKIPMVDLPLGATEDRVCGTIDIEK  127

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            ALTEGVKAFEPGLLAKANRGILY
Sbjct  128  ALTEGVKAFEPGLLAKANRGILY  150



>ref|YP_005089911.1| chlI gene product (chloroplast) [Pedinomonas minor]
 gb|ACQ90834.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Pedinomonas minor]
Length=368

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            A+E+RPV+PF+AIVGQ+EMKL LLLNVIDPKIGGVM+MGDRGTGKSTTVR+LVDLLPEIK
Sbjct  23   ATEARPVFPFTAIVGQEEMKLALLLNVIDPKIGGVMVMGDRGTGKSTTVRALVDLLPEIK  82

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VV  D F SDP+DPE+MS E+R+K+   E+L V   KI MVDLPLGATEDRVCGTIDIEK
Sbjct  83   VVENDSFQSDPEDPELMSEEVRQKVRNKEELKVVNKKIPMVDLPLGATEDRVCGTIDIEK  142

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            ALTEGVKAFEPGLLAKANRGILY
Sbjct  143  ALTEGVKAFEPGLLAKANRGILY  165



>ref|YP_635908.1| Mg-protoporyphyrin IX chelatase [Oltmannsiellopsis viridis]
 ref|YP_635854.1| Mg-protoporyphyrin IX chelatase [Oltmannsiellopsis viridis]
 gb|ABB81976.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Oltmannsiellopsis viridis]
 gb|ABB82015.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Oltmannsiellopsis viridis]
Length=357

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 131/154 (85%), Gaps = 4/154 (3%)
 Frame = +2

Query  383  TPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTV  562
            TP++   +K    E+RPV+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTV
Sbjct  7    TPSEATQEK----EARPVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTV  62

Query  563  RSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATE  742
            R+LVDLLPEI VVA DPFNSDP DPE+MS E+RE      +L V   KI MVDLPLGATE
Sbjct  63   RALVDLLPEIDVVANDPFNSDPYDPELMSTEVREATQNNSELDVVKAKITMVDLPLGATE  122

Query  743  DRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            DRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY
Sbjct  123  DRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  156



>ref|NP_045914.1| Mg-protoporyphyrin IX chelatase [Chlorella vulgaris]
 sp|P56304.1|CHLI_CHLVU RecName: Full=Magnesium-chelatase subunit ChlI; Short=Mg-chelatase 
subunit I-1; AltName: Full=Mg-protoporphyrin IX chelatase 
subunit ChlI (chloroplast) [Chlorella vulgaris]
 dbj|BAA57990.1| Mg-protoporhyrin IX [Chlorella vulgaris]
Length=354

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             ++RPV+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI+V
Sbjct  10   EQARPVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIQV  69

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPFNSDP DPE+MS E+R ++   E +P+   KI+MVDLPLGATEDRVCGTIDIEKA
Sbjct  70   VADDPFNSDPKDPELMSQEVRGRLQRKETVPITTKKISMVDLPLGATEDRVCGTIDIEKA  129

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  130  LTEGVKAFEPGLLAKANRGILY  151



>ref|WP_009556093.1| protoporphyrin IX magnesium-chelatase [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ69181.1| protoporphyrin IX magnesium-chelatase [Oscillatoriales cyanobacterium 
JSC-12]
Length=366

 Score =   240 bits (612),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = +2

Query  374  TEATPAQERAKKL-AASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGK  550
            T   P  E  + + +A+  RPV+PF+AIVGQDEMKL LLLNVIDPKIGGVMIMGDRGTGK
Sbjct  4    TANAPTTENGRSVQSAARRRPVFPFTAIVGQDEMKLALLLNVIDPKIGGVMIMGDRGTGK  63

Query  551  STTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPL  730
            +TT+R+L DLLPEI+VV+ DPFNS P DPE+M  ++R+++  G DLPV L K+ MVDLPL
Sbjct  64   TTTIRALADLLPEIEVVSDDPFNSSPTDPELMGDDVRQRVEQGLDLPVTLKKVQMVDLPL  123

Query  731  GATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            GATEDRVCGTIDIE+AL+EGVKAFEPGLLAKANRGILY
Sbjct  124  GATEDRVCGTIDIERALSEGVKAFEPGLLAKANRGILY  161



>ref|YP_009104833.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Dictyochloropsis reticulata]
 gb|AIT93313.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Dictyochloropsis reticulata]
Length=449

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +2

Query  338  RPQFHVSISNVATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGG  517
            R  F VS SNVA     A + A+       RP++PF+AIVGQ+EMKL LLLNVIDPKIGG
Sbjct  76   RDNFKVSFSNVAANPELAVDNAEHRQQDNKRPIFPFTAIVGQEEMKLALLLNVIDPKIGG  135

Query  518  VMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVA  697
            VMIMGDRGTGKSTTVR+LVDLLP I+VV  DPFNS P D E+MS  +RE++  G+ L V 
Sbjct  136  VMIMGDRGTGKSTTVRALVDLLPNIEVVDNDPFNSHPSDAELMSQNVREQVLQGKSLKVL  195

Query  698  LTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
              K  MVDLPLGATEDRVCGTIDIEKAL+EG+KAFEPGLLAKANRGILY
Sbjct  196  CKKTTMVDLPLGATEDRVCGTIDIEKALSEGIKAFEPGLLAKANRGILY  244



>emb|CEO91051.1| Mg-protoporyphyrin IX chelatase (chloroplast) [Bryopsis plumosa]
Length=365

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             + RP++PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEIKV
Sbjct  19   QQERPIFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIKV  78

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPFNSDP DPE+MS E+R+K+   E + +   KI M+DLPLGATEDRVCGTIDIEKA
Sbjct  79   VAEDPFNSDPMDPELMSEEVRQKLKNNEKIEIISKKIEMIDLPLGATEDRVCGTIDIEKA  138

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  139  LTEGVKAFEPGLLAKANRGILY  160



>ref|NP_038377.1| Mg-protoporyphyrin IX chelatase [Mesostigma viride]
 sp|Q9MUT3.1|CHLI_MESVI RecName: Full=Magnesium-chelatase subunit ChlI; Short=Mg-chelatase 
subunit I-1; AltName: Full=Mg-protoporphyrin IX chelatase 
subunit ChlI (chloroplast) [Mesostigma viride]
 gb|AAF43818.1|AF166114_30 magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Mesostigma viride]
Length=360

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  404  KKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLL  583
            K +   E RPVYPF+AIVGQ+EMKL L+LNVIDP IGGVMIMGDRGTGKSTT+R+LVDLL
Sbjct  8    KNVTKREERPVYPFTAIVGQEEMKLALILNVIDPDIGGVMIMGDRGTGKSTTIRALVDLL  67

Query  584  PEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTI  763
            PEI+VV  DPFNSDP DP++MS E+REKI   +++P   TKI +VDLPLGATEDRVCGTI
Sbjct  68   PEIEVVTNDPFNSDPRDPDLMSDEVREKINNKQEVPTIKTKIKIVDLPLGATEDRVCGTI  127

Query  764  DIEKALTEGVKAFEPGLLAKANRGILY  844
            DIE+AL EGVKAFEPGLLAKANRGILY
Sbjct  128  DIERALNEGVKAFEPGLLAKANRGILY  154



>ref|YP_009057794.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Picocystis salinarum]
 gb|AID67586.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Picocystis salinarum]
Length=349

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  413  AASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI  592
            +  + RP++PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI
Sbjct  3    STQQDRPIFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEI  62

Query  593  KVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIE  772
            +VVA DPFNSDP D E MS E+R++IT+G+ L  A  KI MVDLPLGATEDRVCGTIDIE
Sbjct  63   EVVANDPFNSDPKDTESMSEEVRQQITSGQTLETAQIKIPMVDLPLGATEDRVCGTIDIE  122

Query  773  KALTEGVKAFEPGLLAKANRGILY  844
            KALT+GVKAFEPGLLAKANRGILY
Sbjct  123  KALTDGVKAFEPGLLAKANRGILY  146



>ref|WP_009784802.1| magnesium chelatase [Lyngbya sp. PCC 8106]
 gb|EAW36589.1| protoporphyrin IX magnesium chelatase chain [Lyngbya sp. PCC 
8106]
Length=367

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +2

Query  395  ERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLV  574
            E AK  A+   R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L 
Sbjct  9    ENAKSTASLARRAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALA  68

Query  575  DLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVC  754
            DLLPEI++VA DPFNS PDDPE+MS E+R+++   + +PVA  K++MVDLPLGATEDRVC
Sbjct  69   DLLPEIEIVADDPFNSHPDDPELMSDEVRQRVFDQQSVPVARKKVSMVDLPLGATEDRVC  128

Query  755  GTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            GTIDIEKAL EGVKAFEPGLLAKANRGILY
Sbjct  129  GTIDIEKALAEGVKAFEPGLLAKANRGILY  158



>ref|YP_009105376.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Koliella longiseta]
 gb|AIT93969.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Koliella longiseta]
Length=352

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  410  LAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPE  589
            +   +SRP++PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPE
Sbjct  5    ITLDQSRPIFPFTAIVGQEEMKLSLILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPE  64

Query  590  IKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDI  769
            I+VV  DPFNSDP DPE+MS E+REK+   E + V   KI MVDLPLGATEDRVCGTIDI
Sbjct  65   IEVVLNDPFNSDPQDPELMSEEVREKLKRNEKIEVTNRKILMVDLPLGATEDRVCGTIDI  124

Query  770  EKALTEGVKAFEPGLLAKANRGILY  844
            EKALTEGVKAFEPGLLAKANRGILY
Sbjct  125  EKALTEGVKAFEPGLLAKANRGILY  149



>ref|YP_006666490.1| photochlorophyllide reductase subunit L (chloroplast) [Trebouxiophyceae 
sp. MX-AZ01]
 gb|AFQ93845.1| photochlorophyllide reductase subunit L (chloroplast) [Trebouxiophyceae 
sp. MX-AZ01]
Length=351

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  413  AASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI  592
            A  ++RPV+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI
Sbjct  6    ALDQARPVFPFTAIVGQEEMKLSLILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEI  65

Query  593  KVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIE  772
            +VVA DPFNSDP DPE+MS E RE++   E L     KI MVDLPLGATEDRVCGTIDIE
Sbjct  66   EVVANDPFNSDPKDPELMSQETRERLERDEILETTTRKITMVDLPLGATEDRVCGTIDIE  125

Query  773  KALTEGVKAFEPGLLAKANRGILY  844
            KALTEGVKAFEPGLLAKANRGILY
Sbjct  126  KALTEGVKAFEPGLLAKANRGILY  149



>ref|YP_636541.1| Mg-protoporyphyrin IX chelatase (chloroplast) [Zygnema circumcarinatum]
 gb|AAX45804.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Zygnema circumcarinatum]
Length=357

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  410  LAASES-RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP  586
            LA+ E+ RP++PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLP
Sbjct  4    LASEETQRPIFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLP  63

Query  587  EIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTID  766
            +I+VVA DPFNSDP DPE+MS ++R KI   E L +  TKI+MVDLPLGATEDRVCG+ID
Sbjct  64   DIQVVADDPFNSDPYDPELMSEDVRSKIRHKEQLSIINTKISMVDLPLGATEDRVCGSID  123

Query  767  IEKALTEGVKAFEPGLLAKANRGILY  844
            IEKALTEGVKAFEPGLLAKANRGILY
Sbjct  124  IEKALTEGVKAFEPGLLAKANRGILY  149



>ref|YP_009106170.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Paradoxia multiseta]
 gb|AIT94906.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Paradoxia multiseta]
Length=351

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  413  AASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI  592
            A  ++RPV+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI
Sbjct  6    APDQARPVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEI  65

Query  593  KVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIE  772
            +VVA DPFNSDP DPE+MS E RE+   G+ L     KI MVDLPLGATEDRVCGTIDIE
Sbjct  66   EVVADDPFNSDPADPELMSQETRERAERGDQLTTTTRKIAMVDLPLGATEDRVCGTIDIE  125

Query  773  KALTEGVKAFEPGLLAKANRGILY  844
            KALTEGVKAFEPGLLAKANRGILY
Sbjct  126  KALTEGVKAFEPGLLAKANRGILY  149



>ref|WP_015141479.1| magnesium chelatase ATPase subunit I [Nostoc sp. PCC 7524]
 gb|AFY51078.1| magnesium chelatase ATPase subunit I [Nostoc sp. PCC 7524]
Length=374

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            AS  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    ASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPF+SDP DP++MS E+R+K+  G D+PV L K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFSSDPSDPDLMSDEVRQKVDQGADIPVELKKVQMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|WP_023065952.1| magnesium chelatase ATPase subunit I [Lyngbya aestuarii]
 gb|ERT07796.1| magnesium chelatase ATPase subunit I [Lyngbya aestuarii BL J]
Length=367

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +2

Query  395  ERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLV  574
            E +K  A+   R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L 
Sbjct  9    ENSKSTASLARRAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALA  68

Query  575  DLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVC  754
            DLLPEI++VA DPFNS PDDPE+MS E+R+++   + +PVA  K++MVDLPLGATEDRVC
Sbjct  69   DLLPEIEIVADDPFNSHPDDPELMSDEVRQRVFEQQSVPVARKKVSMVDLPLGATEDRVC  128

Query  755  GTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            GTIDIEKAL EGVKAFEPGLLAKANRGILY
Sbjct  129  GTIDIEKALAEGVKAFEPGLLAKANRGILY  158



>ref|WP_015172950.1| protoporphyrin IX magnesium-chelatase [Geitlerinema sp. PCC 7407]
 gb|AFY67386.1| protoporphyrin IX magnesium-chelatase [Geitlerinema sp. PCC 7407]
Length=375

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  413  AASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI  592
            A +  RP++PFSAIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI
Sbjct  11   AKATRRPIFPFSAIVGQEEMKLALMLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEI  70

Query  593  KVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIE  772
            +VVA DPFNSDP DPE+MS ++R ++  G +LPVA  K+ MVDLPLGATEDRVCGTIDIE
Sbjct  71   EVVADDPFNSDPRDPELMSDDVRARVENGTELPVARKKVLMVDLPLGATEDRVCGTIDIE  130

Query  773  KALTEGVKAFEPGLLAKANRGILY  844
            KAL EGVKAFEPGLLAKANRGILY
Sbjct  131  KALAEGVKAFEPGLLAKANRGILY  154



>ref|YP_004222055.1| photochlorophyllide reductase subunit L [Coccomyxa subellipsoidea 
C-169]
 gb|ADV29903.1| photochlorophyllide reductase subunit L [Coccomyxa subellipsoidea 
C-169]
Length=365

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  413  AASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI  592
            A  ++RPV+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI
Sbjct  20   APEQARPVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEI  79

Query  593  KVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIE  772
            +VVA DPFNSDP D E+MS E REK   GE L     KI MVDLPLGATEDRVCGTIDIE
Sbjct  80   QVVADDPFNSDPADRELMSQETREKAERGEPLKTTTRKIAMVDLPLGATEDRVCGTIDIE  139

Query  773  KALTEGVKAFEPGLLAKANRGILY  844
            KALTEGVKAFEPGLLAKANRGILY
Sbjct  140  KALTEGVKAFEPGLLAKANRGILY  163



>ref|WP_006197284.1| magnesium chelatase [Nodularia spumigena]
 gb|EAW44576.1| Magnesium chelatase ATPase subunit I [Nodularia spumigena CCY9414]
Length=374

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            AS  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    ASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNSDP+DP+VMS E+R+ +  G ++P+A  K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFNSDPNDPDVMSDEVRQMVEQGAEIPIAHKKVQMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|WP_017652974.1| magnesium chelatase [Microchaete sp. PCC 7126]
Length=374

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            AS  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    ASRRRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNSDP DP+VMS E+R+ +  G ++P+A  K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFNSDPSDPDVMSDEVRQLLEQGAEIPIAHKKVQMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|YP_009105582.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Xylochloris irregularis]
 gb|AIT94293.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Xylochloris irregularis]
Length=355

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             +SRPV+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLP I+ 
Sbjct  12   EQSRPVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPTIQA  71

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPFNSDP DPE MS EI+E++   E L +   KI MVDLPLGATEDRVCGTIDIEKA
Sbjct  72   VANDPFNSDPFDPESMSPEIQERLEKNEKLEIVTKKIAMVDLPLGATEDRVCGTIDIEKA  131

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  132  LTEGVKAFEPGLLAKANRGILY  153



>gb|AID67829.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Prasinophyceae sp. MBIC10622]
Length=350

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
            +  RP++PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTTVR+L+DLLP+I++
Sbjct  6    TNQRPIFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTVRALIDLLPDIEI  65

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPFNSDP +PE+MS E+RE I  G+ L    TK++M+DLPLGATEDRVCGTIDIEKA
Sbjct  66   VANDPFNSDPSNPELMSDEVREAILEGKSLETTTTKVSMIDLPLGATEDRVCGTIDIEKA  125

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LT+GVKAFEPGLLAKANRGILY
Sbjct  126  LTDGVKAFEPGLLAKANRGILY  147



>ref|YP_009057493.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Prasinoderma coloniale]
 gb|AID67510.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Prasinoderma coloniale]
Length=352

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +2

Query  425  SRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVA  604
             RPV+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTTVR+L+DLLPEI+VV 
Sbjct  9    QRPVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTVRALIDLLPEIQVVK  68

Query  605  GDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALT  784
             DPFNSDP +PE+MS E+R ++  G++LP    K++MVDLPLGATEDRVCGTIDIEKALT
Sbjct  69   NDPFNSDPKNPELMSDEVRSQVLEGKELPTDTVKVSMVDLPLGATEDRVCGTIDIEKALT  128

Query  785  EGVKAFEPGLLAKANRGILY  844
            +GVKAFEPGLLAKANRGILY
Sbjct  129  DGVKAFEPGLLAKANRGILY  148



>ref|YP_009105000.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Watanabea reniformis]
 gb|AIT93557.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Watanabea reniformis]
Length=358

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +2

Query  422  ESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV  601
            ++R V+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI+VV
Sbjct  15   QARHVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIEVV  74

Query  602  AGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKAL  781
              DPFNSDP+DPE+MS E+R +I   + L   + KI MVDLPLGATEDRVCGTIDIEKAL
Sbjct  75   VNDPFNSDPEDPELMSKEVRARIQQNQKLETTVRKIAMVDLPLGATEDRVCGTIDIEKAL  134

Query  782  TEGVKAFEPGLLAKANRGILY  844
            TEGVKAFEPGLLAKANRGILY
Sbjct  135  TEGVKAFEPGLLAKANRGILY  155



>ref|WP_015126951.1| protoporphyrin IX magnesium-chelatase [Calothrix sp. PCC 7507]
 gb|AFY31126.1| protoporphyrin IX magnesium-chelatase [Calothrix sp. PCC 7507]
Length=374

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            AS  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    ASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNSDP DP+VMS E+R+ +  G ++PVA  K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFNSDPSDPDVMSDEVRQLLEQGAEIPVAHKKVQMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|WP_010994329.1| magnesium-chelatase subunit ChlI [Nostoc sp. PCC 7120]
 sp|P58571.1|CHLI_NOSS1 RecName: Full=Magnesium-chelatase subunit ChlI; AltName: Full=Mg-protoporphyrin 
IX chelatase [Nostoc sp. PCC 7120]
 dbj|BAB77676.1| protoporphyrin IX magnesium chelatase chain [Nostoc sp. PCC 7120]
Length=374

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            AS  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    ASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNSDP DP++MS E+R+K  TG ++P+   K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFNSDPSDPDLMSDEVRQKSGTGAEIPIEFKKVQMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|NP_683790.1| Mg-protoporyphyrin IX chelatase [Chaetosphaeridium globosum]
 gb|AAM96508.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Chaetosphaeridium globosum]
Length=354

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            RPV+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI+VV  
Sbjct  11   RPVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIEVVED  70

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            D FNSDP DPE+MS  +R K+   E +    TKINMVDLPLGATEDRVCGTIDIEKALTE
Sbjct  71   DAFNSDPRDPELMSEYVRNKVKNNEKISTIRTKINMVDLPLGATEDRVCGTIDIEKALTE  130

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFEPGLLAKANRGILY
Sbjct  131  GVKAFEPGLLAKANRGILY  149



>ref|WP_035156108.1| magnesium chelatase [Calothrix sp. 336/3]
 gb|KFB85147.1| magnesium chelatase [Calothrix sp. 336/3]
Length=372

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  413  AASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI  592
            AA+  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI
Sbjct  7    AATARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEI  66

Query  593  KVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIE  772
             VVA DPFNS P DPE+MS E+R     GE++P+A  K+ MVDLPLGATEDRVCGTIDIE
Sbjct  67   PVVANDPFNSHPSDPELMSDEVRTAFLNGENIPLAQQKVQMVDLPLGATEDRVCGTIDIE  126

Query  773  KALTEGVKAFEPGLLAKANRGILY  844
            KAL+EGVKAFEPGLLAKANRGILY
Sbjct  127  KALSEGVKAFEPGLLAKANRGILY  150



>ref|WP_009456321.1| MULTISPECIES: magnesium chelatase [Fischerella]
 gb|EHC14814.1| magnesium chelatase ATPase subunit I [Fischerella sp. JSC-11]
Length=369

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            A   R V+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  5    AVARRVVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  64

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNS P DP++MS EIR+K+ +GED+PV   K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  65   VVANDPFNSHPSDPDLMSDEIRQKLESGEDIPVIQKKVQMVDLPLGATEDRVCGTIDIEK  124

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  125  ALSEGVKAFEPGLLAKANRGILY  147



>ref|YP_009106822.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Elliptochloris bilobata]
 gb|AIT95566.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Elliptochloris bilobata]
Length=362

 Score =   235 bits (600),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             ++RP++PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLP I+V
Sbjct  12   EQTRPIFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPNIQV  71

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPFNSDP+DPE+MS E+REK    + L +   KI MVDLPLGATEDRVCGTIDIE+A
Sbjct  72   VANDPFNSDPEDPELMSQEVREKKALNQPLEIINRKITMVDLPLGATEDRVCGTIDIERA  131

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LT+GVKAFEPGLLA+ANRGILY
Sbjct  132  LTDGVKAFEPGLLARANRGILY  153



>ref|WP_006618358.1| magnesium chelatase [Arthrospira platensis]
 dbj|BAI87956.1| magnesium chelatase ChlI subunit [Arthrospira platensis NIES-39]
 gb|KDR56317.1| magnesium chelatase [Arthrospira platensis str. Paraca]
Length=365

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +2

Query  407  KLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP  586
            K + +  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLP
Sbjct  12   KTSQTSRRAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLP  71

Query  587  EIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTID  766
            EI+V+A DPFNS P DPE+MS  +RE+I+  E LPVA  K+ M+DLPLGATEDRVCGTID
Sbjct  72   EIEVIADDPFNSHPSDPEMMSDVVRERISLSESLPVARRKVQMIDLPLGATEDRVCGTID  131

Query  767  IEKALTEGVKAFEPGLLAKANRGILY  844
            IEKAL EGVKAFEPGLLAKANRGILY
Sbjct  132  IEKALAEGVKAFEPGLLAKANRGILY  157



>ref|WP_011318336.1| magnesium chelatase [Anabaena variabilis]
 gb|ABA21142.1| protoporphyrin IX magnesium-chelatase [Anabaena variabilis ATCC 
29413]
Length=374

 Score =   235 bits (599),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            AS  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    ASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNSDP DP++MS E+R+K   G ++P+   K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFNSDPSDPDLMSDEVRQKSGAGAEIPIEFKKVQMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|YP_009033617.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) (chloroplast) [Klebsormidium flaccidum]
 gb|AHZ10999.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) (chloroplast) [Klebsormidium flaccidum]
Length=355

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
            +  R V+PF+AIVGQ EMKL LLLNV+DPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI+V
Sbjct  8    NNERSVFPFTAIVGQKEMKLALLLNVVDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIEV  67

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            V  DPFNSDP DP++MS E+R+K+   +++P+  T+I MVDLPLGATEDRVCGTID+E+A
Sbjct  68   VENDPFNSDPRDPQLMSHEVRKKVINNQEIPITKTRIAMVDLPLGATEDRVCGTIDLERA  127

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEG+KAFEPGLLAKANRGILY
Sbjct  128  LTEGIKAFEPGLLAKANRGILY  149



>ref|WP_026731287.1| magnesium chelatase [Fischerella sp. PCC 9605]
Length=373

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  434  VYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP  613
            V+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI VVA DP
Sbjct  15   VFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIPVVANDP  74

Query  614  FNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGV  793
            FNS P DP++MS EIR+K+ +GED+PV   K+ MVDLPLGATEDRVCGTIDIEKAL+EGV
Sbjct  75   FNSHPSDPDLMSDEIRQKLESGEDIPVIQKKVQMVDLPLGATEDRVCGTIDIEKALSEGV  134

Query  794  KAFEPGLLAKANRGILY  844
            KAFEPGLLAKANRGILY
Sbjct  135  KAFEPGLLAKANRGILY  151



>gb|AGN72450.1| Mg-protoporyphyrin IX chelatase (chloroplast) [Auxenochlorella 
protothecoides]
Length=356

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            RPV+PF+AIVGQDEMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLPEI+ +  
Sbjct  15   RPVFPFTAIVGQDEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIESIED  74

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPFNSDP D E+MS E+REKI   E L +   KI+MVDLPLGATEDRVCGTIDIEKALT+
Sbjct  75   DPFNSDPHDLELMSKEVREKIQKKESLSIIKKKISMVDLPLGATEDRVCGTIDIEKALTQ  134

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFEPGLLAKANRGILY
Sbjct  135  GVKAFEPGLLAKANRGILY  153



>ref|WP_013191980.1| magnesium chelatase [Trichormus azollae]
 gb|ADI64965.1| magnesium chelatase ATPase subunit I ['Nostoc azollae' 0708]
Length=373

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            AS  R ++PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    ASARRVIFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIS  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPF+SDP DP++MS E+R+ ++ G ++P+A  K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFSSDPSDPDLMSDEVRQLVSQGAEIPIAHKKVQMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|XP_006377560.1| hypothetical protein POPTR_0011s07720g [Populus trichocarpa]
 ref|XP_006377561.1| hypothetical protein POPTR_0011s07720g [Populus trichocarpa]
 gb|ERP55357.1| hypothetical protein POPTR_0011s07720g [Populus trichocarpa]
 gb|ERP55358.1| hypothetical protein POPTR_0011s07720g [Populus trichocarpa]
Length=326

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP+DPE M 
Sbjct  1    MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPEDPESMG  60

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            +E+RE +  GE+L V +TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  61   IEVRESVVKGENLTVVMTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  120

Query  830  RGILY  844
            RGILY
Sbjct  121  RGILY  125



>ref|YP_635727.1| Mg-protoporyphyrin IX chelatase [Chara vulgaris]
 gb|ABA61906.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Chara vulgaris]
Length=358

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
             + RP++PF+AIVGQ+EMKL LLLNVIDPKIGGVM+MGDRGTGKSTTVR+LVDLLPEI V
Sbjct  8    QKERPIFPFTAIVGQEEMKLALLLNVIDPKIGGVMVMGDRGTGKSTTVRALVDLLPEISV  67

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPFNSDP D ++MS E+R  I  G+DL ++  KI M+DLPLGATEDRVCGTIDIEKA
Sbjct  68   VANDPFNSDPYDFDLMSEEVRNMIKKGQDLLISTMKIPMIDLPLGATEDRVCGTIDIEKA  127

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEG+KAFEPGLLAKANRGILY
Sbjct  128  LTEGIKAFEPGLLAKANRGILY  149



>gb|KIJ82690.1| magnesium chelatase [Scytonema tolypothrichoides VB-61278]
Length=373

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +2

Query  434  VYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP  613
            V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI VVA DP
Sbjct  15   VFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIPVVANDP  74

Query  614  FNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGV  793
            FNSDP DP++MS E+R+++  G D+PV   K+ MVDLPLGATEDRVCGTIDIEKAL+EGV
Sbjct  75   FNSDPSDPDLMSDEVRQQLQQGADIPVVQKKVQMVDLPLGATEDRVCGTIDIEKALSEGV  134

Query  794  KAFEPGLLAKANRGILY  844
            KAFEPGLLAKANRGILY
Sbjct  135  KAFEPGLLAKANRGILY  151



>ref|WP_016859854.1| magnesium chelatase [Fischerella muscicola]
Length=369

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            A   R V+PF+AIVGQ+EMKL L+LNVIDPK+GGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  5    AVARRVVFPFTAIVGQEEMKLALILNVIDPKVGGVMIMGDRGTGKSTTIRALADLLPEIP  64

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNS P DP++MS EIR+K+ TG+D+PV   K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  65   VVANDPFNSHPSDPDLMSDEIRQKLETGDDIPVDHKKVQMVDLPLGATEDRVCGTIDIEK  124

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRG+LY
Sbjct  125  ALSEGVKAFEPGLLAKANRGLLY  147



>ref|WP_017713506.1| magnesium chelatase [Prochlorothrix hollandica]
Length=356

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            R V+PF+AIVGQDEMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI+VVA 
Sbjct  8    RSVFPFTAIVGQDEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIEVVAD  67

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPF+S P DPE+MS ++RE++T GE LPVA  K+ MVDLPLGATEDRVCGTIDIEKAL+E
Sbjct  68   DPFSSHPSDPEMMSNDVRERLTQGETLPVAKRKVIMVDLPLGATEDRVCGTIDIEKALSE  127

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFE GLLAKANRGILY
Sbjct  128  GVKAFESGLLAKANRGILY  146



>ref|WP_012412525.1| magnesium chelatase [Nostoc punctiforme]
 gb|ACC84586.1| magnesium chelatase ATPase subunit I [Nostoc punctiforme PCC 
73102]
Length=374

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            AS  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    ASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIS  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPF+SDP DP++MS E+R+ +  G ++PVA  K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFSSDPSDPDLMSDEVRQLLEQGAEIPVAHKKVQMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|WP_026719454.1| magnesium chelatase [Fischerella sp. PCC 9431]
Length=369

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            A   R V+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  5    AVARRVVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  64

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNS P DP++MS EIR+K+ TG D+PV   K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  65   VVANDPFNSHPSDPDLMSDEIRQKLETGGDIPVDHKKVQMVDLPLGATEDRVCGTIDIEK  124

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  125  ALSEGVKAFEPGLLAKANRGILY  147



>ref|WP_044137744.1| magnesium chelatase [Trichodesmium erythraeum]
Length=379

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +2

Query  407  KLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP  586
            K A   SR V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLP
Sbjct  27   KSAVPRSRAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLP  86

Query  587  EIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTID  766
            EIK+V  DPFNSDP DP++MS  +R+++   E++P+   K+ MVDLPLGATEDRVCGTID
Sbjct  87   EIKIVVDDPFNSDPYDPDLMSDSVRDRLVKQEEIPIFTRKVQMVDLPLGATEDRVCGTID  146

Query  767  IEKALTEGVKAFEPGLLAKANRGILY  844
            IEKAL+EGVKAFEPGLLAKANRGILY
Sbjct  147  IEKALSEGVKAFEPGLLAKANRGILY  172



>ref|WP_016868842.1| magnesium chelatase [Fischerella muscicola]
Length=369

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            A   R V+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  5    AVARRVVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  64

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNS P DP++MS EIR+K+ TG+++P+   K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  65   VVANDPFNSHPSDPDLMSDEIRQKLETGDEIPIEHKKVQMVDLPLGATEDRVCGTIDIEK  124

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  125  ALSEGVKAFEPGLLAKANRGILY  147



>ref|WP_015111597.1| protoporphyrin IX magnesium-chelatase [Nostoc sp. PCC 7107]
 gb|AFY41357.1| protoporphyrin IX magnesium-chelatase [Nostoc sp. PCC 7107]
Length=374

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            AS  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGK+TT+R+L DLLPEI 
Sbjct  9    ASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKTTTIRALADLLPEIP  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNS P DP++MS E+R+++  G D+PV   K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFNSHPSDPDLMSDEVRQQLQQGADIPVDHRKVQMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|WP_016951573.1| magnesium chelatase [Anabaena sp. PCC 7108]
Length=372

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            AS  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    ASARRAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNSDP+DP++MS E+R+ +  G ++P+A  K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFNSDPNDPDLMSDEVRQILAEGGEIPIAHKKVIMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|WP_006529681.1| magnesium chelatase ATPase subunit I [Gloeocapsa sp. PCC 73106]
 gb|ELR97497.1| magnesium chelatase ATPase subunit I [Gloeocapsa sp. PCC 73106]
Length=355

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 133/160 (83%), Gaps = 13/160 (8%)
 Frame = +2

Query  371  ATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGK  550
            AT A P + R         R V+PF+AIVGQ EMKL LLLNVIDPKIGGVMIMGDRGTGK
Sbjct  3    ATVAAPDKTR---------RLVFPFTAIVGQAEMKLALLLNVIDPKIGGVMIMGDRGTGK  53

Query  551  STTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALT--KINMVDL  724
            STT+R+L DLLPEI VVAGDPFNSDP DPE+MS EIRE+I   +DLP+ +T  K+ MVDL
Sbjct  54   STTIRALADLLPEIDVVAGDPFNSDPQDPELMSDEIREQI--AQDLPITITQKKVPMVDL  111

Query  725  PLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            PLGATEDRVCGTIDIEKAL+EGVKAFEPGLLAKANRGILY
Sbjct  112  PLGATEDRVCGTIDIEKALSEGVKAFEPGLLAKANRGILY  151



>ref|YP_001019148.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Chlorokybus atmophyticus]
 gb|ABM87951.1| magnesium chelatase subunit of protochlorophyllide reductase 
[Chlorokybus atmophyticus]
Length=358

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 129/148 (87%), Gaps = 1/148 (1%)
 Frame = +2

Query  401  AKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDL  580
            A K AASE RPV+PF+AIVGQ+EMKL L+LNVIDP IGGVMIMGDRGTGKSTT+R+LVDL
Sbjct  4    ANKTAASE-RPVFPFTAIVGQEEMKLALILNVIDPDIGGVMIMGDRGTGKSTTIRALVDL  62

Query  581  LPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGT  760
            LPEI+VV  DPF+S P++PE+MS E+R+KI   E +    TKI +VDLPLGATEDRVCGT
Sbjct  63   LPEIEVVTNDPFHSHPNEPELMSDEVRQKIANNEPISTHFTKIPIVDLPLGATEDRVCGT  122

Query  761  IDIEKALTEGVKAFEPGLLAKANRGILY  844
            IDIEKAL EG+KAFEPGLLAKANRGILY
Sbjct  123  IDIEKALNEGIKAFEPGLLAKANRGILY  150



>ref|YP_002601047.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Monomastix sp. OKE-1]
 gb|ACK36901.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Monomastix sp. OKE-1]
Length=347

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            +   RPV+PF+AIVGQ+EMKL L+LNVIDPKIGGVM+MGDRGTGKSTTVR+L D+LPEI+
Sbjct  2    SQNERPVFPFTAIVGQEEMKLALILNVIDPKIGGVMVMGDRGTGKSTTVRALADILPEIE  61

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            +VA DPFNSDP+DPE MS  +R+ I   +   +  TKI MVDLPLGATEDRVCGTIDIEK
Sbjct  62   IVANDPFNSDPNDPEAMSDAVRDMIRQNKPFEITKTKITMVDLPLGATEDRVCGTIDIEK  121

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            ALTEGVKAFEPGLLAKANRGILY
Sbjct  122  ALTEGVKAFEPGLLAKANRGILY  144



>ref|WP_028083523.1| magnesium chelatase [Dolichospermum circinale]
Length=372

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +2

Query  434  VYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP  613
            V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI VVA DP
Sbjct  15   VFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIPVVANDP  74

Query  614  FNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGV  793
            FNSDP+DP++MS E+R+++  G ++P+A  K+ MVDLPLGATEDRVCGTIDIEKAL+EGV
Sbjct  75   FNSDPNDPDLMSDEVRQQVAQGLEVPIAHKKVQMVDLPLGATEDRVCGTIDIEKALSEGV  134

Query  794  KAFEPGLLAKANRGILY  844
            KAFEPGLLAKANRGILY
Sbjct  135  KAFEPGLLAKANRGILY  151



>ref|WP_008233259.1| Protoporphyrin IX Mg-chelatase subunit I [Richelia intracellularis]
 emb|CCH67102.1| Protoporphyrin IX Mg-chelatase subunit I [Richelia intracellularis 
HH01]
Length=363

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  413  AASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI  592
            + ++ R V+PF+AIVGQ EMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI
Sbjct  5    SGTKRRAVFPFTAIVGQQEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEI  64

Query  593  KVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIE  772
             +VA DPFNS P +P++MS +IR+++  GE++PVA  K+ M+DLPLGATEDRVCGTIDIE
Sbjct  65   PIVANDPFNSHPSEPDLMSDDIRQRLLQGENIPVAQKKVEMIDLPLGATEDRVCGTIDIE  124

Query  773  KALTEGVKAFEPGLLAKANRGILY  844
            KAL+EGVKAFEPGLLAKANRGILY
Sbjct  125  KALSEGVKAFEPGLLAKANRGILY  148



>gb|ABG52692.1| protoporphyrin IX magnesium-chelatase [Trichodesmium erythraeum 
IMS101]
Length=405

 Score =   234 bits (596),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +2

Query  407  KLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP  586
            K A   SR V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLP
Sbjct  53   KSAVPRSRAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLP  112

Query  587  EIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTID  766
            EIK+V  DPFNSDP DP++MS  +R+++   E++P+   K+ MVDLPLGATEDRVCGTID
Sbjct  113  EIKIVVDDPFNSDPYDPDLMSDSVRDRLVKQEEIPIFTRKVQMVDLPLGATEDRVCGTID  172

Query  767  IEKALTEGVKAFEPGLLAKANRGILY  844
            IEKAL+EGVKAFEPGLLAKANRGILY
Sbjct  173  IEKALSEGVKAFEPGLLAKANRGILY  198



>ref|WP_016873528.1| magnesium chelatase [Chlorogloeopsis fritschii]
Length=373

 Score =   233 bits (593),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  434  VYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP  613
            V+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI VVA DP
Sbjct  15   VFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIPVVANDP  74

Query  614  FNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGV  793
            FNS P DP++M  EIR+K+  GED+PV   K+ MVDLPLGATEDRVCGTIDIEKAL+EGV
Sbjct  75   FNSHPSDPDLMGDEIRQKLENGEDIPVVQKKVQMVDLPLGATEDRVCGTIDIEKALSEGV  134

Query  794  KAFEPGLLAKANRGILY  844
            KAFEPGLLAKANRGILY
Sbjct  135  KAFEPGLLAKANRGILY  151



>ref|WP_015165920.1| magnesium chelatase ATPase subunit I [Pseudanabaena sp. PCC 7367]
 gb|AFY70964.1| magnesium chelatase ATPase subunit I [Pseudanabaena sp. PCC 7367]
Length=357

 Score =   232 bits (591),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
            ++ RPV+PFSAIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L +LLPEI++
Sbjct  10   TQKRPVFPFSAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRALANLLPEIQI  69

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPF+SDP D ++ S E+R+++  GE LP+A  ++ MVDLPLGATEDRVCGTIDIEKA
Sbjct  70   VADDPFSSDPVDADLQSDEVRQRLAQGEQLPIAAKQVLMVDLPLGATEDRVCGTIDIEKA  129

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            LTEGVKAFEPGLLAKANRGILY
Sbjct  130  LTEGVKAFEPGLLAKANRGILY  151



>ref|WP_039741038.1| magnesium chelatase [Hassallia byssoidea]
 gb|KIF36176.1| magnesium chelatase [Hassallia byssoidea VB512170]
Length=372

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            AS  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    ASTRRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNSDP DP++MS E+R  +  G ++PV   K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFNSDPSDPDIMSDEVRALLEQGTEIPVVQKKVIMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>gb|KJB69598.1| hypothetical protein B456_011G032900 [Gossypium raimondii]
Length=326

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  470  MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMS  649
            MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI+VV GDP+NSDP+DPE M 
Sbjct  1    MKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIRVVFGDPYNSDPEDPESMG  60

Query  650  VEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  829
            +E+REK+  GE+L + +TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN
Sbjct  61   IEVREKVVNGEELTITMTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKAN  120

Query  830  RGILY  844
            RGILY
Sbjct  121  RGILY  125



>ref|WP_045872636.1| magnesium chelatase [Tolypothrix sp. PCC 7601]
Length=374

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            AS  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    ASTRRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIS  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNSDP DP++MS E+R+ +  G ++P    K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFNSDPSDPDLMSDEVRQMLEQGVEIPTVPKKVQMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|WP_015187653.1| magnesium chelatase ATPase subunit I [Gloeocapsa sp. PCC 7428]
 gb|AFZ29777.1| magnesium chelatase ATPase subunit I [Gloeocapsa sp. PCC 7428]
Length=368

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            A  +R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI+
Sbjct  5    AQATRRVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIE  64

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNSDP DPE+MS  +R+++    ++PVA  K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  65   VVADDPFNSDPHDPELMSDAVRQQLEQQIEIPVAHKKVPMVDLPLGATEDRVCGTIDIEK  124

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  125  ALSEGVKAFEPGLLAKANRGILY  147



>ref|WP_039933513.1| magnesium chelatase [Arthrospira maxima]
Length=365

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +2

Query  407  KLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP  586
            K++ +  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLP
Sbjct  12   KISQTSRRAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLP  71

Query  587  EIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTID  766
            EI+V+A DPFNS P DPE+MS  +RE+++  E +PV   K+ M+DLPLGATEDRVCGTID
Sbjct  72   EIEVIADDPFNSHPSDPELMSDGVRERMSLSEAIPVTRRKVQMIDLPLGATEDRVCGTID  131

Query  767  IEKALTEGVKAFEPGLLAKANRGILY  844
            IEKAL EGVKAFEPGLLAKANRGILY
Sbjct  132  IEKALAEGVKAFEPGLLAKANRGILY  157



>emb|CEO91133.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Tydemania expeditionis]
Length=373

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            RP++PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKST VR+LVDLLPEI+VVA 
Sbjct  33   RPIFPFTAIVGQEEMKLSLILNVIDPKIGGVMIMGDRGTGKSTAVRALVDLLPEIQVVAD  92

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPFNSDP+DPE MS  +REK T  E L     KI MVDLPLGATEDRVCGTID+EKALTE
Sbjct  93   DPFNSDPNDPEAMSDFVREKFTNNEPLLTNKKKIPMVDLPLGATEDRVCGTIDLEKALTE  152

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFEPGLLA+ANRGILY
Sbjct  153  GVKAFEPGLLAQANRGILY  171



>ref|WP_029634005.1| magnesium chelatase [[Scytonema hofmanni] UTEX B 1581]
Length=373

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            A+  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    ANTRRVVFPFTAIVGQEEMKLSLLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNSDP DP++MS E+R  I  G ++PV   K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFNSDPSDPDIMSDEVRALIEQGAEIPVVQKKVIMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|WP_017312410.1| magnesium chelatase [Fischerella sp. PCC 9339]
Length=369

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            A   R V+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  5    AVARRVVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  64

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNS P DP++MS EIR+K+ TG ++PV   K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  65   VVANDPFNSHPSDPDLMSDEIRQKLETGGEIPVDHKKVQMVDLPLGATEDRVCGTIDIEK  124

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  125  ALSEGVKAFEPGLLAKANRGILY  147



>ref|WP_028949018.1| magnesium chelatase [Synechocystis sp. PCC 6714]
 gb|AIE73447.1| Protoporphyrin IX Mg-chelatase subunit I [Synechocystis sp. PCC 
6714]
Length=357

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 130/158 (82%), Gaps = 9/158 (6%)
 Frame = +2

Query  371  ATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGK  550
            AT ATP++ R         R V+PF+AIVGQDEMKL LLLNVIDPKIGGVMIMGDRGTGK
Sbjct  3    ATLATPSKTR---------RVVFPFTAIVGQDEMKLALLLNVIDPKIGGVMIMGDRGTGK  53

Query  551  STTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPL  730
            STT+R+L DLLPEI+VVA DPFNS P DPE+MS E+R ++   E L +   K+ MVDLPL
Sbjct  54   STTIRALADLLPEIEVVANDPFNSSPSDPEMMSEEVRIRVDNQEPLAIVKKKVTMVDLPL  113

Query  731  GATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            GATEDRVCGTIDIEKAL+EGVKAFEPGLLAKANRGILY
Sbjct  114  GATEDRVCGTIDIEKALSEGVKAFEPGLLAKANRGILY  151



>ref|WP_017659838.1| magnesium chelatase [Geitlerinema sp. PCC 7105]
Length=365

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            R V+PF+AIVGQ+EMKL LLLNVIDPK+GGVMIMGDRGTGKSTT+R+L DLLPE+ VVA 
Sbjct  18   RAVFPFTAIVGQEEMKLALLLNVIDPKVGGVMIMGDRGTGKSTTIRALADLLPEMDVVAD  77

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPF+SDP +PE+MS ++R++++ GE LP+A  K+ MVDLPLGATEDRVCGTIDIEKAL+E
Sbjct  78   DPFDSDPSNPELMSDDVRDRLSRGETLPIAKKKVTMVDLPLGATEDRVCGTIDIEKALSE  137

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFEPGLLAKANRGILY
Sbjct  138  GVKAFEPGLLAKANRGILY  156



>gb|ACM51422.1| Mg-protoporphyrin IX chelatase [Caulerpa filiformis]
Length=347

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  422  ESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV  601
            + RP++PF+AIVGQ+EMK  L+LNVIDPKIGGVMIMGDRGTGKST VR+LVDLLPEI VV
Sbjct  6    DERPIFPFTAIVGQEEMKFSLILNVIDPKIGGVMIMGDRGTGKSTAVRALVDLLPEISVV  65

Query  602  AGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKAL  781
              DPFNSDP+DPE MS  +REK+   E L +   KI+MVDLPLGATEDRVCGTID+EKAL
Sbjct  66   GDDPFNSDPNDPEYMSDFVREKVQKNEQLIIKKKKISMVDLPLGATEDRVCGTIDLEKAL  125

Query  782  TEGVKAFEPGLLAKANRGILY  844
            TEG+KAFEPGLLA+ANRGILY
Sbjct  126  TEGIKAFEPGLLAQANRGILY  146



>ref|WP_015214442.1| protoporphyrin IX magnesium-chelatase [Anabaena cylindrica]
 gb|AFZ57806.1| protoporphyrin IX magnesium-chelatase [Anabaena cylindrica PCC 
7122]
Length=372

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
            S  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI V
Sbjct  10   SARRAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIPV  69

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPFNSDP+DP++MS E+R+ +  G ++P+   K+ MVDLPLGATEDRVCGTIDIEKA
Sbjct  70   VANDPFNSDPNDPDLMSDEVRQLLAEGGEIPIDHKKVQMVDLPLGATEDRVCGTIDIEKA  129

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            L+EGVKAFEPGLLAKANRGILY
Sbjct  130  LSEGVKAFEPGLLAKANRGILY  151



>ref|YP_009105764.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Koliella corcontica]
 gb|AIT94472.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Koliella corcontica]
Length=352

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            RP +PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTTVR+LVDLLP I+VV  
Sbjct  11   RPSFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPNIEVVEN  70

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPFNSDP+D E MS ++REKI   E+L +   KI MVDLPLGATEDRVCGTIDIEKAL+E
Sbjct  71   DPFNSDPNDFEAMSEDVREKIQNKENLKIVKKKITMVDLPLGATEDRVCGTIDIEKALSE  130

Query  788  GVKAFEPGLLAKANRGILY  844
            G+KAFEPGLLAKANRGILY
Sbjct  131  GIKAFEPGLLAKANRGILY  149



>gb|EDZ93252.1| magnesium chelatase ATPase subunit I [Arthrospira maxima CS-328]
 emb|CCE20090.1| Magnesium-chelatase 38 kDa subunit (Mg-protoporphyrin IX chelatase) 
[Arthrospira sp. PCC 8005]
 emb|CDM98575.1| Magnesium-chelatase 38 kDa subunit (Mg-protoporphyrin IX chelatase) 
[Arthrospira sp. PCC 8005]
Length=385

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +2

Query  407  KLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP  586
            K++ +  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLP
Sbjct  32   KISQTSRRAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLP  91

Query  587  EIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTID  766
            EI+V+A DPFNS P DPE+MS  +RE+++  E +PV   K+ M+DLPLGATEDRVCGTID
Sbjct  92   EIEVIADDPFNSHPSDPELMSDGVRERMSLSEAIPVTRRKVQMIDLPLGATEDRVCGTID  151

Query  767  IEKALTEGVKAFEPGLLAKANRGILY  844
            IEKAL EGVKAFEPGLLAKANRGILY
Sbjct  152  IEKALAEGVKAFEPGLLAKANRGILY  177



>ref|WP_035759985.1| magnesium chelatase [Arthrospira platensis]
Length=365

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +2

Query  407  KLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP  586
            K++ +  R V+PF+AIVGQ EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLP
Sbjct  12   KISQTSRRAVFPFTAIVGQKEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLP  71

Query  587  EIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTID  766
            EI+V+A DPFNS P DPE+MS  +RE+++  E +PV   K+ M+DLPLGATEDRVCGTID
Sbjct  72   EIEVIADDPFNSHPSDPELMSDGVRERMSLSEAIPVTRRKVQMIDLPLGATEDRVCGTID  131

Query  767  IEKALTEGVKAFEPGLLAKANRGILY  844
            IEKAL EGVKAFEPGLLAKANRGILY
Sbjct  132  IEKALAEGVKAFEPGLLAKANRGILY  157



>ref|WP_030007326.1| magnesium chelatase [Synechococcus sp. NKBG042902]
Length=360

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 130/157 (83%), Gaps = 6/157 (4%)
 Frame = +2

Query  374  TEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKS  553
            T   P QE+ K+      R V+PF+A++GQDEMKL L LN+IDPKIGGVMIMGDRGTGKS
Sbjct  4    TAEAPPQEKVKR------RVVFPFTAVIGQDEMKLALKLNIIDPKIGGVMIMGDRGTGKS  57

Query  554  TTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLG  733
            TT+R+L DLLPEI+VVA DPFNSDP +PE+M  E+R+K+   E L +A  K+ M+DLPLG
Sbjct  58   TTIRALADLLPEIEVVANDPFNSDPKNPELMGDEVRQKLENNETLEIARKKVPMIDLPLG  117

Query  734  ATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            ATEDRVCGTIDIEKAL+EGVKAFEPGLLAKANRG+LY
Sbjct  118  ATEDRVCGTIDIEKALSEGVKAFEPGLLAKANRGVLY  154



>ref|WP_037217496.1| magnesium chelatase [Richelia intracellularis]
Length=372

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            A+  R V+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    AATRRVVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNS P DP++MS ++R+ +  GE++P A  K+ M+DLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFNSHPHDPDLMSDDVRQMLLKGEEIPAAQKKVEMIDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|WP_009343328.1| magnesium chelatase [Raphidiopsis brookii]
 gb|EFA72807.1| Magnesium chelatase ATPase subunit I [Raphidiopsis brookii D9]
Length=372

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
            S  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI V
Sbjct  10   STRRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIPV  69

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPFNSDP+DP++MS E+R+++  G ++ +   K+ MVDLPLGATEDRVCGTIDIEKA
Sbjct  70   VANDPFNSDPEDPDLMSDEVRQQVAQGLEIAIGHKKVQMVDLPLGATEDRVCGTIDIEKA  129

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            L+EGVKAFEPGLLAKANRGILY
Sbjct  130  LSEGVKAFEPGLLAKANRGILY  151



>ref|WP_015148601.1| protoporphyrin IX magnesium-chelatase [Oscillatoria acuminata]
 gb|AFY81959.1| protoporphyrin IX magnesium-chelatase [Oscillatoria acuminata 
PCC 6304]
Length=363

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI+VVA 
Sbjct  17   RAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIEVVAD  76

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPFNS P DPE+MS  +R++++ GE +P+   K+ M+DLPLGATEDRVCGTIDIEKAL+E
Sbjct  77   DPFNSHPSDPELMSDVVRDRVSRGETVPLMQRKVQMIDLPLGATEDRVCGTIDIEKALSE  136

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFEPGLLAKANRGILY
Sbjct  137  GVKAFEPGLLAKANRGILY  155



>ref|WP_041032790.1| magnesium chelatase [Tolypothrix campylonemoides]
 gb|KIJ78619.1| magnesium chelatase [Tolypothrix campylonemoides VB511288]
Length=373

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  434  VYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP  613
            V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI VVA D 
Sbjct  15   VFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIPVVANDA  74

Query  614  FNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGV  793
            FNSDP DP++MS E+R+++  G D+PV   K+ MVDLPLGATEDRVCGTIDIEKAL+EGV
Sbjct  75   FNSDPSDPDLMSDEVRQQLEQGADIPVVQKKVQMVDLPLGATEDRVCGTIDIEKALSEGV  134

Query  794  KAFEPGLLAKANRGILY  844
            KAFEPGLLAKANRGILY
Sbjct  135  KAFEPGLLAKANRGILY  151



>gb|EKD09599.1| magnesium chelatase ATPase subunit I [Arthrospira platensis C1]
Length=385

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +2

Query  407  KLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP  586
            K++ +  R V+PF+AIVGQ EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLP
Sbjct  32   KISQTSRRAVFPFTAIVGQKEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLP  91

Query  587  EIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTID  766
            EI+V+A DPFNS P DPE+MS  +RE+++  E +PV   K+ M+DLPLGATEDRVCGTID
Sbjct  92   EIEVIADDPFNSHPSDPELMSDGVRERMSLSEAIPVTRRKVQMIDLPLGATEDRVCGTID  151

Query  767  IEKALTEGVKAFEPGLLAKANRGILY  844
            IEKAL EGVKAFEPGLLAKANRGILY
Sbjct  152  IEKALAEGVKAFEPGLLAKANRGILY  177



>ref|WP_010871795.1| magnesium-chelatase subunit ChlI [Synechocystis sp. PCC 6803]
 ref|NP_440486.1| Mg chelatase subunit ChlI [Synechocystis sp. PCC 6803]
 sp|P51634.2|CHLI_SYNY3 RecName: Full=Magnesium-chelatase subunit ChlI; AltName: Full=Mg-protoporphyrin 
IX chelatase [Synechocystis sp. PCC 6803 
substr. Kazusa]
 dbj|BAA17166.1| Mg chelatase subunit; ChlI [Synechocystis sp. PCC 6803]
 dbj|BAK49339.1| Mg chelatase subunit [Synechocystis sp. PCC 6803]
 dbj|BAL28338.1| Mg chelatase subunit [Synechocystis sp. PCC 6803 substr. GT-I]
 dbj|BAL31508.1| Mg chelatase subunit [Synechocystis sp. PCC 6803 substr. PCC-N]
 dbj|BAL34677.1| Mg chelatase subunit [Synechocystis sp. PCC 6803 substr. PCC-P]
 dbj|BAM50885.1| Mg chelatase subunit ChlI [Synechocystis sp. PCC 6803] [Synechocystis 
sp. PCC 6803]
 gb|AGF50856.1| Mg chelatase subunit ChlI [Synechocystis sp. PCC 6803]
Length=357

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 130/158 (82%), Gaps = 9/158 (6%)
 Frame = +2

Query  371  ATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGK  550
            AT A P++ R         R V+PF+AIVGQDEMKL LLLNVIDPKIGGVMIMGDRGTGK
Sbjct  3    ATLAAPSKTR---------RVVFPFTAIVGQDEMKLALLLNVIDPKIGGVMIMGDRGTGK  53

Query  551  STTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPL  730
            STT+R+L DLLPEI+VVA DPFNS P DPE+MS E+R ++ + E L +   K+ MVDLPL
Sbjct  54   STTIRALADLLPEIEVVANDPFNSSPSDPEMMSEEVRIRVDSQEPLSIVKKKVTMVDLPL  113

Query  731  GATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            GATEDRVCGTIDIEKAL+EGVKAFEPGLLAKANRGILY
Sbjct  114  GATEDRVCGTIDIEKALSEGVKAFEPGLLAKANRGILY  151



>ref|WP_017745273.1| magnesium chelatase [Scytonema hofmanni]
Length=371

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            AS  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    ASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPF+S P DP++MS E+R+++  G D+P +  K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFSSHPSDPDLMSDEVRQQLEQGADIPTSRKKVIMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|WP_012307853.1| magnesium chelatase [Synechococcus sp. PCC 7002]
 gb|ACB00235.1| magnesium chelatase ATPase subunit I [Synechococcus sp. PCC 7002]
Length=360

 Score =   230 bits (586),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 130/157 (83%), Gaps = 6/157 (4%)
 Frame = +2

Query  374  TEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKS  553
            T   P QE+ K+      R V+PF+A++GQDEMKL L LN+IDPKIGGVMIMGDRGTGKS
Sbjct  4    TAEAPPQEKVKR------RVVFPFTAVIGQDEMKLALKLNIIDPKIGGVMIMGDRGTGKS  57

Query  554  TTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLG  733
            TT+R+L DLLPEI+VVA DPFNSDP +PE+M  E+R+K+   E + VA  K+ M+DLPLG
Sbjct  58   TTIRALADLLPEIEVVANDPFNSDPKNPELMGDEVRQKLENNEPIEVARKKVPMIDLPLG  117

Query  734  ATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            ATEDRVCGTIDIEKAL+EGVKAFEPGLLAKANRG+LY
Sbjct  118  ATEDRVCGTIDIEKALSEGVKAFEPGLLAKANRGVLY  154



>ref|WP_006276817.1| magnesium chelatase [Cylindrospermopsis raciborskii]
 gb|EFA70236.1| Magnesium chelatase ATPase subunit I [Cylindrospermopsis raciborskii 
CS-505]
Length=370

 Score =   230 bits (586),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  419  SESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKV  598
            S  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI V
Sbjct  10   STRRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIPV  69

Query  599  VAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKA  778
            VA DPFNSDP DP++MS E+R+++  G ++ +   K+ MVDLPLGATEDRVCGTIDIEKA
Sbjct  70   VANDPFNSDPSDPDLMSDEVRQQVAEGLEIAIGHKKVQMVDLPLGATEDRVCGTIDIEKA  129

Query  779  LTEGVKAFEPGLLAKANRGILY  844
            L+EGVKAFEPGLLAKANRGILY
Sbjct  130  LSEGVKAFEPGLLAKANRGILY  151



>ref|WP_017321915.1| magnesium chelatase [cyanobacterium PCC 7702]
Length=374

 Score =   230 bits (586),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  437  YPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPF  616
            +PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI VVA DPF
Sbjct  16   FPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIPVVANDPF  75

Query  617  NSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVK  796
            NS P+DP++MS E+R+K+  GE++PV   K+ +VDLPLGATEDRVCGTIDIEKAL+EGVK
Sbjct  76   NSHPNDPDLMSDEVRQKLENGEEIPVVYKKVQIVDLPLGATEDRVCGTIDIEKALSEGVK  135

Query  797  AFEPGLLAKANRGILY  844
            AFEPGLLAKANRGILY
Sbjct  136  AFEPGLLAKANRGILY  151



>gb|AAC44138.1| Mg-Protoporhyrin IX [Synechocystis sp. PCC 6803]
Length=357

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 130/158 (82%), Gaps = 9/158 (6%)
 Frame = +2

Query  371  ATEATPAQERAKKLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGK  550
            AT A P++ R         R V+PF+AIVGQDEMKL LLLNVIDPKIGGVMIMGDRGTGK
Sbjct  3    ATLAAPSKTR---------RVVFPFTAIVGQDEMKLALLLNVIDPKIGGVMIMGDRGTGK  53

Query  551  STTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPL  730
            STT+R+L DLLPEI+VVA DPFNS P DPE+MS E+R ++ + E L +   K+ MVDLPL
Sbjct  54   STTIRALADLLPEIEVVANDPFNSSPSDPEMMSEEVRIRVDSQEPLSIVKKKVTMVDLPL  113

Query  731  GATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILY  844
            GATEDRVCGTIDIEKAL+EGVKAFEPGLLAKANRGILY
Sbjct  114  GATEDRVCGTIDIEKALSEGVKAFEPGLLAKANRGILY  151



>ref|WP_039713234.1| magnesium chelatase [Scytonema millei]
 gb|KIF20885.1| magnesium chelatase [Scytonema millei VB511283]
Length=374

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +2

Query  413  AASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI  592
            A +  R V+PF+AIVGQDEMKL LLLN+IDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI
Sbjct  4    ATAARRVVFPFTAIVGQDEMKLALLLNIIDPKIGGVMIMGDRGTGKSTTIRALADLLPEI  63

Query  593  KVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIE  772
            +VVA DPFNS P DP++M    R+K+  G ++PVA  KI MVDLPLGATEDRVCGTIDIE
Sbjct  64   EVVADDPFNSHPSDPDLMGDAARQKLEQGVEIPVAKKKITMVDLPLGATEDRVCGTIDIE  123

Query  773  KALTEGVKAFEPGLLAKANRGILY  844
            KAL+EGVKAFEPGLLAKANRGILY
Sbjct  124  KALSEGVKAFEPGLLAKANRGILY  147



>ref|WP_006911628.1| magnesium chelatase [Cyanobium sp. PCC 7001]
 gb|EDY39705.1| magnesium chelatase ATPase subunit I [Cyanobium sp. PCC 7001]
Length=362

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  410  LAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPE  589
            +  +  R V+PF+AIVGQ+EMKL LLLNVIDP+IGGVMIMGDRGTGKSTT+R+L DLLPE
Sbjct  1    MTQARKRRVFPFTAIVGQEEMKLALLLNVIDPRIGGVMIMGDRGTGKSTTIRALADLLPE  60

Query  590  IKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDI  769
            I VVAGDP+NS PDDP++ S E+R++   GE LPV   ++ MVDLPLGATEDR+CGTIDI
Sbjct  61   IPVVAGDPYNSSPDDPDLQSAEVRQRAEQGEQLPVEQRQVPMVDLPLGATEDRLCGTIDI  120

Query  770  EKALTEGVKAFEPGLLAKANRGILY  844
            EKAL+EGV+AFEPGLLAKANRG+LY
Sbjct  121  EKALSEGVRAFEPGLLAKANRGLLY  145



>ref|WP_026796343.1| MULTISPECIES: magnesium chelatase [Planktothrix]
 gb|KEI66912.1| ChlI [Planktothrix agardhii NIVA-CYA 126/8]
Length=363

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            RPV+PF+AIVGQ+EMKL L+LN IDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI+V+A 
Sbjct  20   RPVFPFTAIVGQEEMKLALILNTIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIEVIAD  79

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPFNS P D ++MS  +RE+++  +D+PV+  K+ MVDLPLGATEDRVCGTIDIEKAL+E
Sbjct  80   DPFNSHPTDADLMSDNVRERLSQHQDIPVSRKKVPMVDLPLGATEDRVCGTIDIEKALSE  139

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFEPGLLAKANRGILY
Sbjct  140  GVKAFEPGLLAKANRGILY  158



>ref|WP_019498563.1| magnesium chelatase [Pseudanabaena sp. PCC 6802]
Length=357

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +2

Query  422  ESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV  601
            + RPV+PFSAIVGQ+EMKL L+LN+IDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI +V
Sbjct  11   KKRPVFPFSAIVGQEEMKLALMLNIIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIDIV  70

Query  602  AGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKAL  781
            A DPFNS P D ++ S E+R+++  G++LP+A  ++ MVDLPLGATEDRVCGTIDIEKAL
Sbjct  71   ADDPFNSHPTDADLQSDEVRQRLLKGDNLPIAQKQVPMVDLPLGATEDRVCGTIDIEKAL  130

Query  782  TEGVKAFEPGLLAKANRGILY  844
            +EGVKAFEPGLLAKANRGILY
Sbjct  131  SEGVKAFEPGLLAKANRGILY  151



>ref|WP_015168968.1| magnesium chelatase ATPase subunit I [Synechococcus sp. PCC 7502]
 gb|AFY74313.1| magnesium chelatase ATPase subunit I [Synechococcus sp. PCC 7502]
Length=356

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            RPV+PFSAIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI+VVA 
Sbjct  12   RPVFPFSAIVGQEEMKLALMLNVIDPKIGGVMIMGDRGTGKSTTIRALTDLLPEIEVVAD  71

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPFNS P D ++ S E+RE++   E LP+   ++ M+DLPLGATEDRVCGTIDIEKAL+E
Sbjct  72   DPFNSHPFDADLQSDEVRERVRHNESLPIVKKQVTMIDLPLGATEDRVCGTIDIEKALSE  131

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFEPGLLAKANRGILY
Sbjct  132  GVKAFEPGLLAKANRGILY  150



>ref|WP_041236613.1| magnesium chelatase [Cyanothece sp. PCC 7425]
Length=355

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            RPV+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGK+TT+R+L DLLPEI VVA 
Sbjct  11   RPVFPFTAIVGQEEMKLSLLLNVIDPKIGGVMIMGDRGTGKTTTIRALADLLPEIDVVAD  70

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPFNS P D ++MS  ++  ++ G+ LP+A+ K+ MVDLPLGATEDRVCGTIDIEKAL+E
Sbjct  71   DPFNSHPQDADLMSDSVKAALSAGQSLPIAVKKVPMVDLPLGATEDRVCGTIDIEKALSE  130

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFEPGLLAKANRGILY
Sbjct  131  GVKAFEPGLLAKANRGILY  149



>ref|WP_027843787.1| magnesium chelatase [Mastigocoleus testarum]
Length=373

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +2

Query  407  KLAASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLP  586
            + +A + R V+PF+AIVGQ+EMKL L+LN IDPKIGGVMIMGDRGTGKSTT+R+L DLLP
Sbjct  6    QTSAMKGRVVFPFTAIVGQEEMKLALILNTIDPKIGGVMIMGDRGTGKSTTIRALADLLP  65

Query  587  EIKVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTID  766
            EI VVA DPFNSDP DPE+MS  +RE++  G D  V   K+ MVDLPLGATEDRVCGTID
Sbjct  66   EIAVVANDPFNSDPQDPELMSDGVREQVEQGVDPEVTRAKVQMVDLPLGATEDRVCGTID  125

Query  767  IEKALTEGVKAFEPGLLAKANRGILY  844
            IEKAL+EGVKAFEPGLLAKANRGILY
Sbjct  126  IEKALSEGVKAFEPGLLAKANRGILY  151



>ref|WP_036831959.1| MULTISPECIES: magnesium chelatase [Planktothrix]
Length=357

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            RPV+PF+AIVGQ+EMKL L+LN IDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI+V+A 
Sbjct  14   RPVFPFTAIVGQEEMKLALILNTIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIEVIAD  73

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPFNS P D ++MS  +RE+++  +D+PV+  K+ MVDLPLGATEDRVCGTIDIEKAL+E
Sbjct  74   DPFNSHPTDADLMSDNVRERLSQHQDIPVSRKKVPMVDLPLGATEDRVCGTIDIEKALSE  133

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFEPGLLAKANRGILY
Sbjct  134  GVKAFEPGLLAKANRGILY  152



>ref|WP_026785444.1| magnesium chelatase [Planktothrix rubescens]
Length=362

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            RPV+PF+AIVGQ+EMKL L+LN IDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI+V+A 
Sbjct  19   RPVFPFTAIVGQEEMKLALILNTIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIEVIAD  78

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPFNS P D ++MS  +RE+++  +D+PV+  K+ MVDLPLGATEDRVCGTIDIEKAL+E
Sbjct  79   DPFNSHPTDADLMSDNVRERLSQHQDIPVSRKKVPMVDLPLGATEDRVCGTIDIEKALSE  138

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFEPGLLAKANRGILY
Sbjct  139  GVKAFEPGLLAKANRGILY  157



>ref|WP_045053191.1| magnesium chelatase [Chroococcales cyanobacterium CENA595]
 gb|KJH73095.1| magnesium chelatase [Chroococcales cyanobacterium CENA595]
Length=368

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            R V+PF+AIVGQ+EMKL L+LN IDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI VVA 
Sbjct  9    RVVFPFTAIVGQEEMKLALILNTIDPKIGGVMIMGDRGTGKSTTIRALADLLPEITVVAD  68

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPFNSDP+DP++MS  +R+++    +LPVA  K+ MVDLPLGATEDRVCGTIDIEKAL+E
Sbjct  69   DPFNSDPNDPDLMSDAVRQQLEQQVELPVAQKKVTMVDLPLGATEDRVCGTIDIEKALSE  128

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFEPGLLAKANRGILY
Sbjct  129  GVKAFEPGLLAKANRGILY  147



>gb|ACL43356.1| magnesium chelatase ATPase subunit I [Cyanothece sp. PCC 7425]
Length=369

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            RPV+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGK+TT+R+L DLLPEI VVA 
Sbjct  25   RPVFPFTAIVGQEEMKLSLLLNVIDPKIGGVMIMGDRGTGKTTTIRALADLLPEIDVVAD  84

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPFNS P D ++MS  ++  ++ G+ LP+A+ K+ MVDLPLGATEDRVCGTIDIEKAL+E
Sbjct  85   DPFNSHPQDADLMSDSVKAALSAGQSLPIAVKKVPMVDLPLGATEDRVCGTIDIEKALSE  144

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFEPGLLAKANRGILY
Sbjct  145  GVKAFEPGLLAKANRGILY  163



>gb|AEN82484.1| AT4G18480-like protein, partial [Capsella rubella]
 gb|AEN82485.1| AT4G18480-like protein, partial [Capsella rubella]
 gb|AEN82486.1| AT4G18480-like protein, partial [Capsella rubella]
 gb|AEN82487.1| AT4G18480-like protein, partial [Capsella rubella]
 gb|AEN82488.1| AT4G18480-like protein, partial [Capsella rubella]
 gb|AEN82489.1| AT4G18480-like protein, partial [Capsella rubella]
 gb|AEN82490.1| AT4G18480-like protein, partial [Capsella rubella]
 gb|AEN82491.1| AT4G18480-like protein, partial [Capsella rubella]
Length=201

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  479  CLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPFNSDPDDPEVMSVEI  658
            CLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP+NSDP DPE M VE+
Sbjct  1    CLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDPYNSDPIDPEFMGVEV  60

Query  659  REKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGI  838
            RE++  GE +PV  TKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGI
Sbjct  61   RERVEKGEKVPVIATKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGI  120

Query  839  LY  844
            LY
Sbjct  121  LY  122



>ref|WP_002747283.1| magnesium chelatase ATPase subunit I [Microcystis aeruginosa]
 emb|CAO88902.1| chlI [Microcystis aeruginosa PCC 7806]
 gb|ELS45966.1| magnesium chelatase ATPase subunit I [Microcystis aeruginosa 
DIANCHI905]
Length=357

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            R V+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI VVA 
Sbjct  13   RVVFPFTAIVGQEEMKLSLMLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIDVVAN  72

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPFNSDP+DP++MS E+R+K+     L VA  K+ MVDLPLGATEDRVCGTIDIEKAL+E
Sbjct  73   DPFNSDPNDPDLMSDEVRQKVDEAIPLTVAKKKVTMVDLPLGATEDRVCGTIDIEKALSE  132

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFEPGLLAKANRGILY
Sbjct  133  GVKAFEPGLLAKANRGILY  151



>gb|KIE08482.1| magnesium chelatase [Tolypothrix bouteillei VB521301]
Length=371

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +2

Query  416  ASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIK  595
            AS  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI 
Sbjct  9    ASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIP  68

Query  596  VVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEK  775
            VVA DPFNS P DP++MS EIR ++  G ++P    K+ MVDLPLGATEDRVCGTIDIEK
Sbjct  69   VVANDPFNSHPSDPDLMSDEIRLQLEQGAEIPTVQKKVIMVDLPLGATEDRVCGTIDIEK  128

Query  776  ALTEGVKAFEPGLLAKANRGILY  844
            AL+EGVKAFEPGLLAKANRGILY
Sbjct  129  ALSEGVKAFEPGLLAKANRGILY  151



>ref|WP_015179225.1| protoporphyrin IX magnesium-chelatase [Oscillatoria nigro-viridis]
 gb|AFZ10024.1| protoporphyrin IX magnesium-chelatase [Oscillatoria nigro-viridis 
PCC 7112]
Length=371

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  413  AASESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEI  592
            A +  R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI
Sbjct  21   ATAARRAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALTDLLPEI  80

Query  593  KVVAGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIE  772
            +VVA DPFNS P DP++MS E+R++  +  ++ +A  K+ MVDLPLGATEDRVCGTIDIE
Sbjct  81   EVVADDPFNSHPTDPDLMSDEVRDRTLSQTEIKIARKKVQMVDLPLGATEDRVCGTIDIE  140

Query  773  KALTEGVKAFEPGLLAKANRGILY  844
            KAL+EGVKAFEPGLLAKANRGILY
Sbjct  141  KALSEGVKAFEPGLLAKANRGILY  164



>ref|WP_006632953.1| magnesium chelatase [Microcoleus vaginatus]
 gb|EGK88171.1| magnesium chelatase ATPase subunit I [Microcoleus vaginatus FGP-2]
Length=371

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            R V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI+VVA 
Sbjct  26   RAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALTDLLPEIEVVAD  85

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPFNS P DP++MS E+R++  +  D+ +A  K+ MVDLPLGATEDRVCGTIDIEKAL+E
Sbjct  86   DPFNSHPTDPDLMSDEVRDRTLSQTDIKIARKKVQMVDLPLGATEDRVCGTIDIEKALSE  145

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFEPGLLAKANRGILY
Sbjct  146  GVKAFEPGLLAKANRGILY  164



>gb|AID67423.1| magnesium chelatase subunit of protochlorophyllide reductase 
(chloroplast) [Prasinococcus sp. CCMP1194]
Length=359

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +2

Query  422  ESRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVV  601
            ESRPV+PF+AI+GQ+EMKL LLLNV+DP+IGGVM+MGDRGTGKST+VR+L DLLPEI+VV
Sbjct  16   ESRPVFPFTAIIGQEEMKLSLLLNVVDPRIGGVMVMGDRGTGKSTSVRALSDLLPEIEVV  75

Query  602  AGDPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKAL  781
              DPF SDP +PE+MS  +RE+I  GE + +  TKI++VDLPLGATEDRVCGTIDIEKAL
Sbjct  76   ENDPFQSDPRNPELMSDFVREQIQNGEPISIVKTKISIVDLPLGATEDRVCGTIDIEKAL  135

Query  782  TEGVKAFEPGLLAKANRGILY  844
            TEG KAFEPGLLAKANRGILY
Sbjct  136  TEGKKAFEPGLLAKANRGILY  156



>ref|WP_002770087.1| magnesium chelatase [Microcystis aeruginosa]
 emb|CCI03809.1| Magnesium-chelatase subunit ChlI [Microcystis aeruginosa PCC 
9443]
 emb|CCI18757.1| Magnesium-chelatase subunit ChlI [Microcystis aeruginosa PCC 
9807]
Length=357

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  428  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG  607
            R V+PF+AIVGQ+EMKL L+LNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI VVA 
Sbjct  13   RVVFPFTAIVGQEEMKLSLMLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEIDVVAN  72

Query  608  DPFNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTE  787
            DPFNSDP+DP++MS E+R+K+     L +A  K+ MVDLPLGATEDRVCGTIDIEKAL+E
Sbjct  73   DPFNSDPNDPDLMSDEVRQKVDEAIPLTIAKKKVTMVDLPLGATEDRVCGTIDIEKALSE  132

Query  788  GVKAFEPGLLAKANRGILY  844
            GVKAFEPGLLAKANRGILY
Sbjct  133  GVKAFEPGLLAKANRGILY  151



>gb|EKE99302.1| magnesium chelatase ATPase subunit I [Tolypothrix sp. PCC 7601]
Length=361

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +2

Query  434  VYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAGDP  613
            V+PF+AIVGQ+EMKL LLLNVIDPKIGGVMIMGDRGTGKSTT+R+L DLLPEI VVA DP
Sbjct  2    VFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEISVVANDP  61

Query  614  FNSDPDDPEVMSVEIREKITTGEDLPVALTKINMVDLPLGATEDRVCGTIDIEKALTEGV  793
            FNSDP DP++MS E+R+ +  G ++P    K+ MVDLPLGATEDRVCGTIDIEKAL+EGV
Sbjct  62   FNSDPSDPDLMSDEVRQMLEQGVEIPTVPKKVQMVDLPLGATEDRVCGTIDIEKALSEGV  121

Query  794  KAFEPGLLAKANRGILY  844
            KAFEPGLLAKANRGILY
Sbjct  122  KAFEPGLLAKANRGILY  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2090934484686