BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8605

Length=911
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009626422.1|  PREDICTED: epoxide hydrolase 3 isoform X2          311   1e-100   Nicotiana tomentosiformis
ref|XP_009775314.1|  PREDICTED: epoxide hydrolase 3 isoform X2          311   2e-100   Nicotiana sylvestris
ref|XP_006353829.1|  PREDICTED: uncharacterized protein LOC102586068    311   5e-100   Solanum tuberosum [potatoes]
ref|XP_009626420.1|  PREDICTED: epoxide hydrolase 3 isoform X1          311   6e-100   
ref|XP_009775310.1|  PREDICTED: epoxide hydrolase 3 isoform X1          310   9e-100   Nicotiana sylvestris
ref|XP_004246996.1|  PREDICTED: epoxide hydrolase 3 isoform X2          305   8e-98    Solanum lycopersicum
ref|XP_010037094.1|  PREDICTED: uncharacterized hydrolase YNR064C       304   5e-97    Eucalyptus grandis [rose gum]
ref|XP_011080549.1|  PREDICTED: uncharacterized protein LOC105163785    296   4e-94    Sesamum indicum [beniseed]
ref|XP_011458128.1|  PREDICTED: uncharacterized protein LOC101292280    285   4e-92    Fragaria vesca subsp. vesca
ref|XP_002271124.1|  PREDICTED: epoxide hydrolase 4 isoform X1          291   4e-92    Vitis vinifera
ref|XP_010678992.1|  PREDICTED: uncharacterized protein LOC104894460    289   2e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002527279.1|  hydrolase, putative                                288   2e-91    Ricinus communis
emb|CBI23337.3|  unnamed protein product                                289   4e-91    Vitis vinifera
ref|XP_012084566.1|  PREDICTED: epoxide hydrolase 3                     288   6e-91    
ref|XP_010095591.1|  hypothetical protein L484_007430                   287   1e-90    Morus notabilis
emb|CDP03986.1|  unnamed protein product                                286   3e-90    Coffea canephora [robusta coffee]
gb|AFK49471.1|  unknown                                                 286   4e-90    Lotus japonicus
ref|XP_007199912.1|  hypothetical protein PRUPE_ppa006807mg             285   5e-90    Prunus persica
ref|XP_008235874.1|  PREDICTED: uncharacterized hydrolase YNR064C       285   1e-89    Prunus mume [ume]
gb|KJB42614.1|  hypothetical protein B456_007G161100                    285   1e-89    Gossypium raimondii
ref|XP_007049546.1|  Alpha/beta-Hydrolases superfamily protein is...    285   1e-89    
ref|XP_006447950.1|  hypothetical protein CICLE_v10015502mg             284   1e-89    Citrus clementina [clementine]
ref|XP_006469341.1|  PREDICTED: uncharacterized hydrolase YNR064C...    284   2e-89    Citrus sinensis [apfelsine]
gb|KHN30854.1|  Haloalkane dehalogenase                                 283   3e-89    Glycine soja [wild soybean]
ref|XP_007134311.1|  hypothetical protein PHAVU_010G036500g             283   4e-89    Phaseolus vulgaris [French bean]
gb|KDO43504.1|  hypothetical protein CISIN_1g015903mg                   283   5e-89    Citrus sinensis [apfelsine]
ref|XP_011458132.1|  PREDICTED: uncharacterized hydrolase YNR064C...    283   5e-89    Fragaria vesca subsp. vesca
ref|XP_004292325.1|  PREDICTED: uncharacterized hydrolase YNR064C...    282   7e-89    Fragaria vesca subsp. vesca
ref|XP_003521017.2|  PREDICTED: uncharacterized hydrolase YNR064C       283   2e-88    
gb|EYU46070.1|  hypothetical protein MIMGU_mgv1a008062mg                280   8e-88    Erythranthe guttata [common monkey flower]
ref|XP_008802246.1|  PREDICTED: epoxide hydrolase 3                     279   1e-87    Phoenix dactylifera
ref|XP_010926737.1|  PREDICTED: epoxide hydrolase 3 isoform X2          279   1e-87    Elaeis guineensis
ref|XP_010926736.1|  PREDICTED: epoxide hydrolase 3 isoform X1          279   1e-87    Elaeis guineensis
ref|XP_009342379.1|  PREDICTED: uncharacterized hydrolase YNR064C...    279   2e-87    Pyrus x bretschneideri [bai li]
ref|XP_009358940.1|  PREDICTED: uncharacterized hydrolase YNR064C...    278   2e-87    Pyrus x bretschneideri [bai li]
gb|KEH18035.1|  alpha/beta fold hydrolase                               274   3e-86    Medicago truncatula
ref|XP_008382540.1|  PREDICTED: uncharacterized hydrolase YNR064C       276   3e-86    
gb|EPS68183.1|  hypothetical protein M569_06589                         274   3e-86    Genlisea aurea
gb|ABK94940.1|  unknown                                                 272   3e-86    Populus trichocarpa [western balsam poplar]
gb|KEH18034.1|  alpha/beta fold hydrolase                               275   7e-86    Medicago truncatula
ref|XP_004510185.1|  PREDICTED: 4,5:9,10-diseco-3-hydroxy-5,9,17-...    274   1e-85    Cicer arietinum [garbanzo]
ref|XP_011009615.1|  PREDICTED: epoxide hydrolase 3 isoform X2          271   2e-84    Populus euphratica
ref|XP_002320563.2|  hypothetical protein POPTR_0014s17410g             271   2e-84    Populus trichocarpa [western balsam poplar]
ref|XP_011009614.1|  PREDICTED: epoxide hydrolase 3 isoform X1          271   2e-84    Populus euphratica
ref|XP_010258608.1|  PREDICTED: epoxide hydrolase 3 isoform X1          271   2e-84    Nelumbo nucifera [Indian lotus]
ref|XP_006414993.1|  hypothetical protein EUTSA_v10025411mg             267   3e-84    
gb|KFK35301.1|  hypothetical protein AALP_AA5G266800                    268   2e-83    Arabis alpina [alpine rockcress]
ref|XP_011624947.1|  PREDICTED: uncharacterized protein LOC184381...    265   5e-83    
ref|XP_010532928.1|  PREDICTED: uncharacterized hydrolase YNR064C       267   9e-83    Tarenaya hassleriana [spider flower]
ref|XP_006414994.1|  hypothetical protein EUTSA_v10025411mg             266   1e-82    Eutrema salsugineum [saltwater cress]
ref|XP_011624946.1|  PREDICTED: epoxide hydrolase 3 isoform X2          264   9e-82    Amborella trichopoda
ref|XP_006848442.1|  PREDICTED: epoxide hydrolase 3 isoform X1          264   1e-81    Amborella trichopoda
ref|XP_010440628.1|  PREDICTED: uncharacterized hydrolase YNR064C...    263   2e-81    Camelina sativa [gold-of-pleasure]
ref|NP_001045213.1|  Os01g0919700                                       263   2e-81    
gb|EEE55899.1|  hypothetical protein OsJ_04564                          263   3e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009139658.1|  PREDICTED: uncharacterized hydrolase YNR064C       263   4e-81    Brassica rapa
ref|XP_010450251.1|  PREDICTED: uncharacterized hydrolase YNR064C...    262   7e-81    Camelina sativa [gold-of-pleasure]
ref|XP_002863288.1|  hydrolase, alpha/beta fold family protein          262   8e-81    Arabidopsis lyrata subsp. lyrata
tpg|DAA56123.1|  TPA: hydrolase-like protein                            258   1e-80    
ref|NP_001132271.2|  uncharacterized protein LOC100193707               258   1e-80    Zea mays [maize]
ref|NP_567394.1|  hydrolase, alpha/beta fold family protein             261   2e-80    Arabidopsis thaliana [mouse-ear cress]
gb|AAM61500.1|  hydrolase-like protein                                  261   2e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003564939.1|  PREDICTED: epoxide hydrolase 3                     260   2e-80    Brachypodium distachyon [annual false brome]
gb|ACG27604.1|  hydrolase-like protein                                  260   2e-80    Zea mays [maize]
ref|XP_010326244.1|  PREDICTED: epoxide hydrolase 3 isoform X1          260   3e-80    Solanum lycopersicum
gb|KCW48730.1|  hypothetical protein EUGRSUZ_K02363                     259   1e-79    Eucalyptus grandis [rose gum]
emb|CDY60486.1|  BnaC04g55880D                                          258   2e-79    Brassica napus [oilseed rape]
ref|XP_006646615.1|  PREDICTED: epoxide hydrolase 3-like                257   2e-79    
ref|XP_006282646.1|  hypothetical protein CARUB_v10004987mg             256   1e-78    Capsella rubella
ref|XP_009420324.1|  PREDICTED: uncharacterized protein LOC104000...    254   5e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420326.1|  PREDICTED: uncharacterized protein LOC104000...    254   5e-78    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM85669.1|  unnamed protein product                                253   8e-78    Triticum aestivum [Canadian hard winter wheat]
gb|EMT05833.1|  hypothetical protein F775_06870                         254   2e-77    
ref|XP_004971071.1|  PREDICTED: uncharacterized protein LOC101762...    251   1e-76    Setaria italica
gb|KDO43505.1|  hypothetical protein CISIN_1g015903mg                   244   3e-74    Citrus sinensis [apfelsine]
ref|XP_004510184.1|  PREDICTED: 4,5:9,10-diseco-3-hydroxy-5,9,17-...    238   1e-71    
ref|XP_004510183.1|  PREDICTED: uncharacterized protein LOC101497246    224   6e-69    
gb|EEC72048.1|  hypothetical protein OsI_04954                          194   2e-55    Oryza sativa Indica Group [Indian rice]
ref|XP_001751246.1|  predicted protein                                  194   2e-55    
gb|EMS59018.1|  hypothetical protein TRIUR3_05973                       184   6e-50    Triticum urartu
ref|XP_010926738.1|  PREDICTED: uncharacterized protein LOC105048...    177   4e-49    Elaeis guineensis
ref|XP_007049547.1|  Alpha/beta-Hydrolases superfamily protein is...    176   5e-48    
ref|XP_010645317.1|  PREDICTED: uncharacterized protein LOC100244...    174   6e-48    
ref|XP_004971072.1|  PREDICTED: uncharacterized protein LOC101762...    154   2e-40    
ref|XP_002983979.1|  hypothetical protein SELMODRAFT_119529             146   3e-37    
ref|XP_002960156.1|  hypothetical protein SELMODRAFT_402209             146   9e-37    
ref|XP_011009616.1|  PREDICTED: uncharacterized protein LOC105114...    120   8e-28    Populus euphratica
ref|XP_010258609.1|  PREDICTED: uncharacterized protein LOC104598...    113   2e-25    Nelumbo nucifera [Indian lotus]
ref|XP_007049548.1|  Alpha/beta-Hydrolases superfamily protein is...    113   4e-25    
emb|CAN81493.1|  hypothetical protein VITISV_019990                     111   9e-25    Vitis vinifera
gb|KCW48732.1|  hypothetical protein EUGRSUZ_K02363                   92.4    3e-18    Eucalyptus grandis [rose gum]
ref|WP_031294003.1|  hydrolase                                        85.9    4e-16    Leptolyngbya sp. Heron Island J
gb|ESA33321.1|  hydrolase or acyltransferase of alpha beta superf...  85.5    5e-16    Leptolyngbya sp. Heron Island J
ref|XP_010435351.1|  PREDICTED: uncharacterized protein LOC104719184  84.0    2e-15    
ref|WP_006454320.1|  hydrolase                                        83.6    2e-15    Synechococcus sp. PCC 7335
ref|WP_036018473.1|  hydrolase                                        80.1    4e-14    Leptolyngbya sp. PCC 7375
gb|EKV00984.1|  putative hydrolase or acyltransferase of alpha/be...  80.1    4e-14    Leptolyngbya sp. PCC 7375
emb|CAB41000.1|  hydrolase-like protein                               78.6    6e-14    Arabidopsis thaliana [mouse-ear cress]
ref|WP_015219733.1|  alpha/beta fold family hydrolase                 79.0    1e-13    Cyanobacterium aponinum
ref|WP_036006436.1|  hydrolase                                        76.3    1e-12    [Leptolyngbya] sp. JSC-1
ref|WP_042154997.1|  hydrolase                                        75.5    2e-12    Planktothrix agardhii
ref|WP_008185446.1|  hydrolase                                        75.1    2e-12    Moorea producens
ref|WP_026796846.1|  hydrolase                                        74.7    3e-12    Planktothrix
ref|WP_015228028.1|  alpha/beta hydrolase                             74.7    3e-12    Dactylococcopsis salina
ref|WP_026795117.1|  MULTISPECIES: hydrolase                          73.9    6e-12    Planktothrix
ref|WP_036531370.1|  hydrolase                                        73.9    6e-12    Neosynechococcus sphagnicola
ref|WP_026788344.1|  hydrolase                                        73.9    7e-12    Planktothrix rubescens
ref|WP_015187607.1|  Haloalkane dehalogenase                          73.6    1e-11    Gloeocapsa sp. PCC 7428
gb|ELR99120.1|  putative hydrolase or acyltransferase of alpha/be...  72.8    2e-11    Gloeocapsa sp. PCC 73106
ref|WP_034935658.1|  hydrolase                                        72.8    2e-11    Gloeocapsa sp. PCC 73106
ref|WP_027249864.1|  hydrolase                                        72.8    2e-11    Planktothrix agardhii
ref|WP_026079764.1|  hydrolase                                        72.4    3e-11    Spirulina subsalsa
ref|WP_017288262.1|  hypothetical protein                             72.0    3e-11    Leptolyngbya boryana
ref|WP_017324485.1|  hypothetical protein                             72.0    3e-11    Synechococcus sp. PCC 7336
ref|WP_019494557.1|  hydrolase                                        70.9    8e-11    Calothrix sp. PCC 7103
ref|WP_036617143.1|  hydrolase                                        70.1    2e-10    
gb|EKQ68909.1|  putative hydrolase or acyltransferase of alpha/be...  70.1    2e-10    Oscillatoriales cyanobacterium JSC-12
ref|WP_006624498.1|  MULTISPECIES: hydrolase                          69.7    2e-10    Arthrospira
ref|WP_012595411.1|  MULTISPECIES: hydrolase                          69.3    3e-10    Cyanothece
ref|WP_017300675.1|  hypothetical protein                             69.3    3e-10    Nodosilinea nodulosa
ref|WP_006508165.1|  putative hydrolase or acyltransferase of alp...  68.6    6e-10    Xenococcus sp. PCC 7305
ref|WP_028091278.1|  hydrolase                                        67.4    1e-09    Dolichospermum circinale
ref|WP_015222249.1|  alpha/beta fold family hydrolase                 67.4    1e-09    
ref|WP_015150409.1|  alpha/beta hydrolase                             67.4    2e-09    Oscillatoria acuminata
ref|WP_041233282.1|  hydrolase                                        67.4    2e-09    Cylindrospermum stagnale
gb|KIE12829.1|  hydrolase                                             67.0    2e-09    
gb|AFZ27564.1|  putative hydrolase or acyltransferase of alpha/be...  67.0    2e-09    Cylindrospermum stagnale PCC 7417
ref|WP_041268297.1|  hydrolase                                        66.6    3e-09    Geitlerinema sp. PCC 7407
ref|XP_003580670.1|  PREDICTED: uncharacterized hydrolase YNR064C     67.8    3e-09    Brachypodium distachyon [annual false brome]
ref|WP_028084529.1|  hydrolase                                        66.6    3e-09    Dolichospermum circinale
gb|AFY65727.1|  alpha/beta hydrolase fold protein                     67.0    3e-09    Geitlerinema sp. PCC 7407
ref|WP_040467239.1|  hydrolase                                        66.2    3e-09    
ref|WP_040944832.1|  hydrolase                                        66.2    3e-09    
ref|WP_040936045.1|  hydrolase                                        66.2    4e-09    
ref|WP_040939392.1|  hydrolase                                        66.2    4e-09    
gb|ERT04085.1|  alpha/beta hydrolase fold family protein              66.2    4e-09    Lyngbya aestuarii BL J
ref|WP_028947035.1|  hydrolase                                        66.2    4e-09    Synechocystis sp. PCC 6714
ref|WP_040484720.1|  hydrolase                                        66.2    4e-09    
ref|WP_038331165.1|  hydrolase                                        66.2    4e-09    
dbj|BAQ63671.1|  hydrolase                                            65.9    5e-09    Geminocystis sp. NIES-3709
emb|CAD23147.1|  alpha/beta hydrolase                                 63.9    5e-09    Oryza sativa [red rice]
ref|WP_039713141.1|  hydrolase                                        65.9    6e-09    
dbj|BAJ92131.1|  predicted protein                                    66.6    6e-09    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_036400096.1|  hydrolase                                        65.5    8e-09    Microcystis aeruginosa
emb|CAO89455.1|  unnamed protein product                              65.5    8e-09    Microcystis aeruginosa PCC 7806
ref|WP_015083225.1|  alpha/beta fold family hydrolase                 65.5    9e-09    Anabaena sp. 90
ref|WP_006103831.1|  hydrolase                                        65.1    1e-08    Coleofasciculus chthonoplastes
ref|XP_009144839.1|  PREDICTED: uncharacterized protein LOC103868501  65.5    1e-08    Brassica rapa
ref|WP_039896586.1|  hydrolase                                        65.1    1e-08    Lyngbya sp. PCC 8106
ref|WP_015182410.1|  alpha/beta hydrolase                             65.1    1e-08    Microcoleus sp. PCC 7113
ref|NP_001054059.1|  Os04g0644600                                     65.5    1e-08    
emb|CAJ86155.1|  H0413E07.8                                           65.5    1e-08    Oryza sativa [red rice]
gb|EAW35736.1|  Alpha/beta hydrolase fold protein                     64.7    1e-08    Lyngbya sp. PCC 8106
ref|WP_041803853.1|  hydrolase                                        64.7    2e-08    Microcystis
ref|NP_001031176.1|  putative hydrolase                               64.7    2e-08    
dbj|BAG01090.1|  alpha/beta fold family hydrolase                     64.3    2e-08    Microcystis aeruginosa NIES-843
gb|EMT19510.1|  hypothetical protein F775_09244                       65.1    2e-08    
dbj|BAD44400.1|  unknown protein                                      65.1    2e-08    Arabidopsis thaliana [mouse-ear cress]
emb|CCI17189.1|  Similar to tr|Q8YX62|Q8YX62                          64.3    2e-08    Microcystis aeruginosa PCC 9807
ref|NP_175660.2|  putative hydrolase                                  65.1    2e-08    Arabidopsis thaliana [mouse-ear cress]
emb|CCI03592.1|  Similar to tr|Q8YX62|Q8YX62                          64.3    2e-08    Microcystis aeruginosa PCC 9443
dbj|BAQ62762.1|  hydrolase                                            64.3    2e-08    Geminocystis sp. NIES-3708
ref|XP_006652910.1|  PREDICTED: uncharacterized hydrolase YNR064C...  65.1    2e-08    Oryza brachyantha
ref|WP_043996834.1|  hydrolase                                        64.3    2e-08    
ref|WP_017745935.1|  hydrolase                                        64.3    2e-08    
ref|WP_045361444.1|  hydrolase                                        64.3    2e-08    Microcystis aeruginosa
ref|WP_002795563.1|  hydrolase                                        64.3    2e-08    Microcystis aeruginosa
ref|WP_004158711.1|  hydrolase                                        64.3    2e-08    Microcystis aeruginosa
ref|WP_024971169.1|  hydrolase                                        64.3    2e-08    Microcystis aeruginosa
ref|WP_043995722.1|  hydrolase                                        64.3    2e-08    
gb|AAD55611.1|AC008016_21  Contains PF|00561 alpha/beta hydrolase...  64.7    2e-08    Arabidopsis thaliana [mouse-ear cress]
ref|WP_008202806.1|  hydrolase                                        64.3    2e-08    Microcystis sp. T1-4
ref|WP_002776195.1|  hydrolase                                        63.9    2e-08    Microcystis aeruginosa
gb|ACB50128.1|  putative hydrolase                                    63.9    3e-08    Cyanothece sp. ATCC 51142
gb|ELP55844.1|  alpha/beta hydrolase fold family protein              63.9    3e-08    Microcystis aeruginosa TAIHU98
ref|WP_009546017.1|  MULTISPECIES: hydrolase                          63.9    3e-08    Cyanothece
ref|WP_002791375.1|  hydrolase                                        63.9    3e-08    Microcystis aeruginosa
ref|WP_042790377.1|  hydrolase                                        63.9    3e-08    Microcystis aeruginosa
ref|WP_015122603.1|  alpha/beta hydrolase                             63.9    3e-08    Rivularia sp. PCC 7116
ref|WP_002782623.1|  hypothetical protein                             63.9    3e-08    Microcystis aeruginosa
ref|WP_016516984.1|  Haloalkane dehalogenase                          63.9    3e-08    Microcystis aeruginosa
ref|XP_003528305.1|  PREDICTED: uncharacterized hydrolase YNR064C...  64.3    3e-08    Glycine max [soybeans]
gb|KFK35798.1|  hypothetical protein AALP_AA4G037800                  63.9    3e-08    Arabis alpina [alpine rockcress]
gb|KHN01316.1|  Haloalkane dehalogenase                               63.9    3e-08    Glycine soja [wild soybean]
ref|XP_003604362.1|  hypothetical protein MTR_4g009990                61.2    3e-08    
emb|CDN17134.1|  Hydrolase, alpha/beta fold family protein, At1g5...  62.8    3e-08    Richelia intracellularis
ref|XP_010515363.1|  PREDICTED: uncharacterized protein LOC104791229  61.6    3e-08    
ref|WP_017314938.1|  hydrolase                                        63.5    3e-08    Mastigocladopsis repens
ref|WP_035994475.1|  hydrolase                                        63.5    4e-08    Leptolyngbya sp. KIOST-1
ref|WP_007356360.1|  MULTISPECIES: hydrolase                          63.5    4e-08    Kamptonema
ref|XP_008807054.1|  PREDICTED: uncharacterized hydrolase YNR064C     63.9    4e-08    Phoenix dactylifera
ref|XP_002894382.1|  hydrolase, alpha/beta fold family protein        63.9    4e-08    
ref|WP_017718654.1|  hypothetical protein                             63.2    4e-08    Oscillatoria sp. PCC 10802
gb|AES86560.2|  alpha/beta fold hydrolase                             63.9    4e-08    Medicago truncatula
ref|WP_002762599.1|  hydrolase                                        63.2    4e-08    Microcystis aeruginosa
ref|WP_039729142.1|  MULTISPECIES: hydrolase                          63.2    5e-08    Lyngbya confervoides
ref|WP_008274911.1|  hydrolase                                        63.2    5e-08    Cyanothece sp. CCY0110
ref|WP_029637501.1|  hydrolase [                                      62.8    6e-08    [Scytonema hofmanni] UTEX B 1581
ref|WP_007304188.1|  hydrolase                                        62.8    6e-08    Crocosphaera watsonii
ref|XP_010462087.1|  PREDICTED: uncharacterized protein LOC104742750  63.5    6e-08    Camelina sativa [gold-of-pleasure]
ref|XP_010479758.1|  PREDICTED: uncharacterized protein LOC104758569  63.5    6e-08    Camelina sativa [gold-of-pleasure]
ref|WP_009458171.1|  MULTISPECIES: hydrolase                          62.8    6e-08    Fischerella thermalis
ref|XP_006392914.1|  hypothetical protein EUTSA_v10011571mg           63.5    6e-08    Eutrema salsugineum [saltwater cress]
emb|CDX87912.1|  BnaC06g09740D                                        63.2    7e-08    
ref|WP_037224593.1|  hydrolase                                        62.4    7e-08    
gb|KIJ82046.1|  hydrolase                                             62.8    8e-08    
ref|WP_008314270.1|  putative hydrolase or acyltransferase of alp...  62.4    9e-08    Leptolyngbya sp. PCC 6406
ref|XP_006305087.1|  hypothetical protein CARUB_v10009454mg           62.8    1e-07    Capsella rubella
ref|WP_041225953.1|  hydrolase                                        62.4    1e-07    Crinalium epipsammum
gb|AFZ12088.1|  Haloalkane dehalogenase                               62.0    1e-07    Crinalium epipsammum PCC 9333
ref|WP_027404785.1|  hydrolase                                        62.4    1e-07    Aphanizomenon flos-aquae
ref|WP_017652808.1|  hydrolase                                        62.0    1e-07    Fortiea contorta
ref|WP_039756008.1|  MULTISPECIES: hydrolase                          62.0    1e-07    Synechococcus
ref|XP_007215166.1|  hypothetical protein PRUPE_ppa013578mg           59.3    1e-07    
gb|ABB56931.1|  Haloalkane dehalogenase                               62.0    1e-07    Synechococcus elongatus PCC 7942
ref|WP_011242951.1|  hydrolase                                        61.6    1e-07    Synechococcus elongatus
ref|WP_010871750.1|  hydrolase                                        61.6    2e-07    Synechocystis
ref|XP_010500850.1|  PREDICTED: uncharacterized hydrolase YNR064C...  62.4    2e-07    Camelina sativa [gold-of-pleasure]
ref|WP_041934044.1|  hydrolase                                        61.6    2e-07    Cyanothece sp. PCC 7822
gb|ADN17326.1|  alpha/beta hydrolase fold protein                     61.6    2e-07    Cyanothece sp. PCC 7822
ref|XP_003531724.1|  PREDICTED: uncharacterized hydrolase YNR064C...  62.0    2e-07    Glycine max [soybeans]
ref|WP_019508341.1|  hypothetical protein                             60.8    3e-07    Pleurocapsa sp. PCC 7319
ref|XP_002517672.1|  hydrolase, putative                              61.6    3e-07    Ricinus communis
ref|XP_004506956.1|  PREDICTED: haloalkane dehalogenase-like isof...  61.6    3e-07    Cicer arietinum [garbanzo]
ref|WP_039202194.1|  hydrolase                                        60.8    3e-07    Aphanizomenon flos-aquae
ref|WP_015226338.1|  alpha/beta fold family hydrolase                 60.8    3e-07    Halothece sp. PCC 7418
ref|WP_006276738.1|  hydrolase                                        60.8    4e-07    Cylindrospermopsis
ref|WP_016876323.1|  hydrolase                                        60.5    4e-07    Chlorogloeopsis fritschii
ref|WP_015127058.1|  alpha/beta fold family hydrolase                 60.5    4e-07    Calothrix sp. PCC 7507
ref|XP_007135767.1|  hypothetical protein PHAVU_010G157100g           60.5    6e-07    Phaseolus vulgaris [French bean]
ref|XP_010545744.1|  PREDICTED: uncharacterized protein LOC104818013  60.5    6e-07    Tarenaya hassleriana [spider flower]
ref|WP_015156929.1|  alpha/beta fold family hydrolase                 59.7    7e-07    Chroococcidiopsis thermalis
ref|WP_045055854.1|  hydrolase                                        59.7    8e-07    Aliterella atlantica
ref|XP_011073395.1|  PREDICTED: uncharacterized protein LOC105158360  60.1    8e-07    Sesamum indicum [beniseed]
ref|WP_017661847.1|  hypothetical protein                             59.7    9e-07    Geitlerinema sp. PCC 7105
ref|XP_004303285.1|  PREDICTED: abhydrolase domain-containing pro...  60.1    9e-07    Fragaria vesca subsp. vesca
ref|XP_004977019.1|  PREDICTED: uncharacterized hydrolase YNR064C...  60.1    9e-07    Setaria italica
ref|WP_016866268.1|  hydrolase                                        59.3    1e-06    Fischerella muscicola
ref|XP_012073134.1|  PREDICTED: uncharacterized hydrolase YNR064C...  59.7    1e-06    Jatropha curcas
ref|XP_012073133.1|  PREDICTED: uncharacterized hydrolase YNR064C...  59.7    1e-06    Jatropha curcas
ref|WP_027843394.1|  hydrolase                                        58.9    1e-06    Mastigocoleus testarum
ref|XP_002989699.1|  hypothetical protein SELMODRAFT_235851           59.3    1e-06    
ref|XP_009336311.1|  PREDICTED: uncharacterized protein LOC103928918  59.3    1e-06    Pyrus x bretschneideri [bai li]
gb|KJB35130.1|  hypothetical protein B456_006G101700                  58.2    1e-06    Gossypium raimondii
gb|ACN34535.1|  unknown                                               59.3    2e-06    Zea mays [maize]
ref|XP_001757240.1|  predicted protein                                58.9    2e-06    
ref|WP_041037141.1|  hydrolase                                        58.5    2e-06    Tolypothrix campylonemoides
ref|XP_010097191.1|  hypothetical protein L484_025738                 58.5    2e-06    
ref|WP_041619514.1|  hydrolase                                        58.2    2e-06    
ref|WP_017309612.1|  MULTISPECIES: hydrolase                          58.2    2e-06    Hapalosiphonaceae
ref|WP_015142537.1|  alpha/beta hydrolase                             58.2    3e-06    
gb|AFZ36991.1|  Haloalkane dehalogenase                               58.2    3e-06    Stanieria cyanosphaera PCC 7437
ref|WP_011611431.1|  hydrolase                                        58.2    3e-06    Trichodesmium erythraeum
ref|XP_004135862.2|  PREDICTED: uncharacterized protein LOC101210082  58.5    3e-06    Cucumis sativus [cucumbers]
ref|WP_016863530.1|  hydrolase                                        57.8    3e-06    Fischerella muscicola
ref|XP_010906730.1|  PREDICTED: uncharacterized hydrolase YNR064C     58.2    3e-06    Elaeis guineensis
ref|WP_015198753.1|  alpha/beta fold family hydrolase                 57.8    4e-06    Calothrix parietina
ref|XP_008461135.1|  PREDICTED: uncharacterized protein LOC103499813  57.8    4e-06    Cucumis melo [Oriental melon]
gb|ACK68666.1|  alpha/beta hydrolase fold protein                     57.4    4e-06    Cyanothece sp. PCC 7424
ref|WP_026734056.1|  hydrolase                                        57.4    5e-06    Fischerella sp. PCC 9605
ref|WP_035153850.1|  hydrolase                                        57.4    5e-06    Calothrix sp. 336/3
ref|WP_041237910.1|  hydrolase                                        57.4    5e-06    Cyanothece sp. PCC 7424
ref|XP_010250215.1|  PREDICTED: uncharacterized protein LOC104592505  57.8    5e-06    Nelumbo nucifera [Indian lotus]
ref|WP_015115701.1|  alpha/beta fold family hydrolase                 57.4    5e-06    Nostoc sp. PCC 7107
gb|KJB35127.1|  hypothetical protein B456_006G101700                  57.4    6e-06    Gossypium raimondii
ref|WP_040654915.1|  hydrolase                                        57.0    6e-06    Rubidibacter lacunae
ref|WP_038020775.1|  hydrolase                                        57.0    6e-06    
ref|XP_006856536.1|  PREDICTED: abhydrolase domain-containing pro...  57.4    6e-06    Amborella trichopoda
gb|ERN42726.1|  putative hydrolase or acyltransferase (alpha/beta...  57.0    6e-06    Rubidibacter lacunae KORDI 51-2
ref|XP_010033976.1|  PREDICTED: uncharacterized protein LOC104423192  57.4    6e-06    Eucalyptus grandis [rose gum]
ref|XP_010691107.1|  PREDICTED: uncharacterized protein LOC104904536  57.0    7e-06    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002263706.2|  PREDICTED: uncharacterized protein LOC100250971  57.0    8e-06    Vitis vinifera
emb|CDO98174.1|  unnamed protein product                              57.0    8e-06    Coffea canephora [robusta coffee]
emb|CBI36362.3|  unnamed protein product                              57.0    8e-06    Vitis vinifera
gb|KJB35128.1|  hypothetical protein B456_006G101700                  57.0    8e-06    Gossypium raimondii
ref|XP_006427394.1|  hypothetical protein CICLE_v100262911mg          56.2    8e-06    
ref|XP_006427393.1|  hypothetical protein CICLE_v100262911mg          55.8    9e-06    
ref|WP_041550127.1|  hydrolase                                        56.2    9e-06    
ref|WP_012307219.1|  alpha/beta fold family hydrolase                 56.2    9e-06    Synechococcus
gb|AFY96634.1|  putative hydrolase or acyltransferase of alpha/be...  56.2    9e-06    
gb|KDO41244.1|  hypothetical protein CISIN_1g022534mg                 55.8    1e-05    
ref|XP_008228721.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  56.6    1e-05    
ref|XP_007023283.1|  Alpha/beta-Hydrolases superfamily protein is...  56.2    1e-05    
ref|XP_002299933.2|  hypothetical protein POPTR_0001s20870g           56.2    2e-05    
ref|XP_006492082.1|  PREDICTED: uncharacterized hydrolase YNR064C...  55.8    2e-05    
ref|WP_026722226.1|  hydrolase                                        55.5    2e-05    
ref|WP_006196536.1|  hydrolase                                        55.5    2e-05    
ref|WP_045867625.1|  hydrolase                                        55.5    2e-05    
gb|KDO41243.1|  hypothetical protein CISIN_1g022534mg                 55.5    2e-05    
ref|XP_002991782.1|  hypothetical protein SELMODRAFT_134090           55.5    3e-05    
ref|WP_015141568.1|  alpha/beta hydrolase                             55.1    3e-05    
ref|XP_011007692.1|  PREDICTED: uncharacterized protein LOC105113285  55.1    3e-05    
gb|EYU21671.1|  hypothetical protein MIMGU_mgv11b007012mg             55.1    4e-05    
ref|WP_015134724.1|  alpha/beta fold family hydrolase                 54.7    4e-05    
ref|WP_016952131.1|  hydrolase                                        54.7    4e-05    
ref|XP_006356226.1|  PREDICTED: uncharacterized protein LOC102600388  54.7    5e-05    
ref|XP_009592214.1|  PREDICTED: uncharacterized protein LOC104089100  54.7    5e-05    
ref|XP_009786840.1|  PREDICTED: uncharacterized protein LOC104234896  54.3    7e-05    
ref|WP_011658245.1|  alpha/beta hydrolase                             53.5    8e-05    
ref|XP_004241692.1|  PREDICTED: uncharacterized protein LOC101262019  53.5    1e-04    
ref|WP_036478292.1|  hydrolase                                        52.8    1e-04    
ref|WP_027812252.1|  alpha/beta hydrolase                             52.8    2e-04    
ref|WP_034208707.1|  alpha/beta hydrolase                             52.4    2e-04    
ref|WP_012365008.1|  alpha/beta hydrolase                             52.4    2e-04    
ref|XP_004510274.1|  PREDICTED: uncharacterized protein LOC101500281  47.4    2e-04    
ref|WP_015175774.1|  Haloalkane dehalogenase                          52.0    2e-04    
ref|WP_015217274.1|  Haloalkane dehalogenase                          52.0    3e-04    
ref|WP_011546493.1|  alpha/beta hydrolase                             51.6    3e-04    
ref|WP_011694443.1|  alpha/beta hydrolase                             51.6    3e-04    
ref|WP_011321688.1|  hydrolase                                        51.6    4e-04    
ref|WP_045441910.1|  hydrolase                                        51.2    5e-04    
ref|WP_030007003.1|  hydrolase                                        51.2    5e-04    
ref|WP_039350208.1|  alpha/beta hydrolase                             51.2    5e-04    
ref|WP_027788826.1|  alpha/beta hydrolase                             50.8    6e-04    
ref|WP_006631240.1|  hydrolase                                        50.4    0.001    



>ref|XP_009626422.1| PREDICTED: epoxide hydrolase 3 isoform X2 [Nicotiana tomentosiformis]
Length=360

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 174/225 (77%), Gaps = 28/225 (12%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            L  LT+KK      G FSPI IKYAS HQ+K+N +ILLNPPLT++HA+LPSTLS+ SNFL
Sbjct  163  LNALTDKKVTLVVQGYFSPIAIKYASNHQEKLNGLILLNPPLTMQHADLPSTLSVLSNFL  222

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            LGEIF Q                            DPLRASDK +LSCGPYQ+KE+VAMV
Sbjct  223  LGEIFCQ----------------------------DPLRASDKTMLSCGPYQIKEDVAMV  254

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFD  338
            YRRPYLTSGS+GFALNA+S+AMKKQLKGY+E++R IL   NW VQTTVCWGQRDRWLSFD
Sbjct  255  YRRPYLTSGSAGFALNAISKAMKKQLKGYVEDSRAILMDNNWTVQTTVCWGQRDRWLSFD  314

Query  337  GVEDFCKESKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            GVEDFCKESK RLVELPM+GHHVQEDSGEE+GQ+IA IVGK+S +
Sbjct  315  GVEDFCKESKHRLVELPMSGHHVQEDSGEELGQLIAGIVGKRSSI  359



>ref|XP_009775314.1| PREDICTED: epoxide hydrolase 3 isoform X2 [Nicotiana sylvestris]
Length=360

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 172/225 (76%), Gaps = 28/225 (12%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            +  LT+KK      G FSPI IKYAS HQ+K+N +ILLNPPLT++HANLPSTLS+ SNFL
Sbjct  163  INALTDKKVTLVVQGYFSPIAIKYASNHQEKLNGLILLNPPLTMQHANLPSTLSVLSNFL  222

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            LGEIF Q                            DPLRASDK +LSCGPYQ+KE+VAMV
Sbjct  223  LGEIFCQ----------------------------DPLRASDKTMLSCGPYQIKEDVAMV  254

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFD  338
            YRRPYLTSGS+GFALNA+S+AMKKQLKGY+E+ R IL   NW VQTTVCWGQRDRWLSFD
Sbjct  255  YRRPYLTSGSAGFALNAISKAMKKQLKGYVEDTRAILMDNNWTVQTTVCWGQRDRWLSFD  314

Query  337  GVEDFCKESKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            GVEDFCKESK RLVELPM+GHHVQEDSGEE GQ++A IVGK+S +
Sbjct  315  GVEDFCKESKHRLVELPMSGHHVQEDSGEEFGQLLAGIVGKRSSI  359



>ref|XP_006353829.1| PREDICTED: uncharacterized protein LOC102586068 [Solanum tuberosum]
Length=384

 Score =   311 bits (796),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 171/225 (76%), Gaps = 28/225 (12%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            +  LT+KK      G FSPI IKYAS HQ+K+N +ILLNPPLT+ HA LPS+LS+ SNFL
Sbjct  188  INALTDKKVTLVVQGYFSPIAIKYASNHQEKLNGLILLNPPLTINHAKLPSSLSVLSNFL  247

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            LGEIF Q                            DPLRASDK LLSCGPYQ+KE+VAMV
Sbjct  248  LGEIFCQ----------------------------DPLRASDKTLLSCGPYQIKEDVAMV  279

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFD  338
            YRRPYLTSGS+GFALNA+S+AMKKQLKGY+E+ R IL   NW VQTTVCWGQRDRWLSFD
Sbjct  280  YRRPYLTSGSAGFALNAISKAMKKQLKGYVEDTRAILMDNNWSVQTTVCWGQRDRWLSFD  339

Query  337  GVEDFCKESKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            GVEDFCKESK RLVELPM+GHHVQEDSGEE+GQ+IA IVGK+S L
Sbjct  340  GVEDFCKESKHRLVELPMSGHHVQEDSGEELGQLIAGIVGKRSSL  384



>ref|XP_009626420.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009626421.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Nicotiana tomentosiformis]
Length=397

 Score =   311 bits (796),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 174/225 (77%), Gaps = 28/225 (12%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            L  LT+KK      G FSPI IKYAS HQ+K+N +ILLNPPLT++HA+LPSTLS+ SNFL
Sbjct  200  LNALTDKKVTLVVQGYFSPIAIKYASNHQEKLNGLILLNPPLTMQHADLPSTLSVLSNFL  259

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            LGEIF Q                            DPLRASDK +LSCGPYQ+KE+VAMV
Sbjct  260  LGEIFCQ----------------------------DPLRASDKTMLSCGPYQIKEDVAMV  291

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFD  338
            YRRPYLTSGS+GFALNA+S+AMKKQLKGY+E++R IL   NW VQTTVCWGQRDRWLSFD
Sbjct  292  YRRPYLTSGSAGFALNAISKAMKKQLKGYVEDSRAILMDNNWTVQTTVCWGQRDRWLSFD  351

Query  337  GVEDFCKESKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            GVEDFCKESK RLVELPM+GHHVQEDSGEE+GQ+IA IVGK+S +
Sbjct  352  GVEDFCKESKHRLVELPMSGHHVQEDSGEELGQLIAGIVGKRSSI  396



>ref|XP_009775310.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Nicotiana sylvestris]
 ref|XP_009775311.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Nicotiana sylvestris]
 ref|XP_009775312.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Nicotiana sylvestris]
 ref|XP_009775313.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Nicotiana sylvestris]
Length=397

 Score =   310 bits (795),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 172/225 (76%), Gaps = 28/225 (12%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            +  LT+KK      G FSPI IKYAS HQ+K+N +ILLNPPLT++HANLPSTLS+ SNFL
Sbjct  200  INALTDKKVTLVVQGYFSPIAIKYASNHQEKLNGLILLNPPLTMQHANLPSTLSVLSNFL  259

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            LGEIF Q                            DPLRASDK +LSCGPYQ+KE+VAMV
Sbjct  260  LGEIFCQ----------------------------DPLRASDKTMLSCGPYQIKEDVAMV  291

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFD  338
            YRRPYLTSGS+GFALNA+S+AMKKQLKGY+E+ R IL   NW VQTTVCWGQRDRWLSFD
Sbjct  292  YRRPYLTSGSAGFALNAISKAMKKQLKGYVEDTRAILMDNNWTVQTTVCWGQRDRWLSFD  351

Query  337  GVEDFCKESKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            GVEDFCKESK RLVELPM+GHHVQEDSGEE GQ++A IVGK+S +
Sbjct  352  GVEDFCKESKHRLVELPMSGHHVQEDSGEEFGQLLAGIVGKRSSI  396



>ref|XP_004246996.1| PREDICTED: epoxide hydrolase 3 isoform X2 [Solanum lycopersicum]
Length=384

 Score =   305 bits (781),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 169/225 (75%), Gaps = 28/225 (12%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            +  LT+KK      G FS I IKYAS HQ+K+N +ILLNPPLT+ HA LPS+LS+ SNFL
Sbjct  188  INALTDKKVTLVVQGYFSAIAIKYASNHQEKLNGLILLNPPLTINHAKLPSSLSVLSNFL  247

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            LGEIF Q                            DPLRASDK L SCGPYQ+KE+VAMV
Sbjct  248  LGEIFCQ----------------------------DPLRASDKTLQSCGPYQIKEDVAMV  279

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFD  338
            YRRPYLTSGS+GFALNA+S+AMKKQLKGY+E+ R IL   NW VQTTVCWGQRDRWLSFD
Sbjct  280  YRRPYLTSGSAGFALNAISKAMKKQLKGYVEDTRAILMDNNWSVQTTVCWGQRDRWLSFD  339

Query  337  GVEDFCKESKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            GVEDFCKESK RLVELPM+GHHVQEDSGEE+GQ+IA IVGK+S L
Sbjct  340  GVEDFCKESKHRLVELPMSGHHVQEDSGEELGQLIAGIVGKRSSL  384



>ref|XP_010037094.1| PREDICTED: uncharacterized hydrolase YNR064C [Eucalyptus grandis]
 gb|KCW48731.1| hypothetical protein EUGRSUZ_K02363 [Eucalyptus grandis]
Length=405

 Score =   304 bits (778),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 169/208 (81%), Gaps = 28/208 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS HQ+K+N +ILLNPPLT KHANLPS+LSIFSNFLLGEIFSQ       
Sbjct  223  GYFSPVVVKYASKHQEKLNHLILLNPPLTSKHANLPSSLSIFSNFLLGEIFSQ-------  275

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY+MKE+ AMVYRRPYLTSGSSGFA
Sbjct  276  ---------------------DPLRASDKALTSCGPYKMKEDDAMVYRRPYLTSGSSGFA  314

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAM+K+LK Y+EE R IL  +NW+V+TT+CWGQRDRWLS+DGVE+FCK+SKL++V
Sbjct  315  LNAISRAMRKELKNYVEETRTILKDENWKVKTTICWGQRDRWLSYDGVEEFCKDSKLKMV  374

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            ELPMAGHHVQEDSGEE+G++IAEIVG++
Sbjct  375  ELPMAGHHVQEDSGEELGKLIAEIVGRR  402



>ref|XP_011080549.1| PREDICTED: uncharacterized protein LOC105163785 [Sesamum indicum]
Length=386

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 165/211 (78%), Gaps = 28/211 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+V+KYA  HQ+K+N +ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ       
Sbjct  204  GYFAPVVVKYAKDHQEKLNDLILLNPPLTAKHANLPSTLSIFSNFLLGEIFSQ-------  256

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY++KE+VAMVYRRPYL+SGS+GFA
Sbjct  257  ---------------------DPLRASDKALTSCGPYKIKEDVAMVYRRPYLSSGSAGFA  295

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR+MKK+LKG++EE R  LT +NW+VQTTVCWGQRDRWLSF+GVEDFCK+S L+L+
Sbjct  296  LNAISRSMKKELKGFVEEMRRTLTDENWKVQTTVCWGQRDRWLSFEGVEDFCKQSNLQLI  355

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
             LPMAGHHVQED  EEVG +IA IV K+ R+
Sbjct  356  TLPMAGHHVQEDCSEEVGNLIAGIVSKRRRI  386



>ref|XP_011458128.1| PREDICTED: uncharacterized protein LOC101292280 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458129.1| PREDICTED: uncharacterized protein LOC101292280 [Fragaria vesca 
subsp. vesca]
Length=213

 Score =   285 bits (728),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 161/208 (77%), Gaps = 28/208 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P  +KYAS HQ+K++++ILLNPPLT KHANLPSTLS+FSNFLLGEIFSQ       
Sbjct  30   GYFAPAAVKYASIHQEKIDNIILLNPPLTAKHANLPSTLSVFSNFLLGEIFSQ-------  82

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY++KE+ AMVYR PYLTSG++GFA
Sbjct  83   ---------------------DPLRASDKTLTSCGPYKIKEDDAMVYRNPYLTSGAAGFA  121

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR MKK+LK Y+EE R ILT +NW+V TT+CWG+RDRWL++DGVEDFCK+SK +L+
Sbjct  122  LNAISRDMKKELKKYVEEMRTILTDENWKVPTTICWGKRDRWLTYDGVEDFCKDSKHKLI  181

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            E+PMAGHHVQED GEE+GQ+I +I+ K+
Sbjct  182  EIPMAGHHVQEDCGEELGQIIYDIIRKR  209



>ref|XP_002271124.1| PREDICTED: epoxide hydrolase 4 isoform X1 [Vitis vinifera]
 ref|XP_010645316.1| PREDICTED: epoxide hydrolase 4 isoform X2 [Vitis vinifera]
Length=392

 Score =   291 bits (744),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 163/211 (77%), Gaps = 28/211 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS+HQ+K+  +ILLNPPLT KHANLPS LSIFSNFLLGEIFSQ       
Sbjct  210  GYFSPVVVKYASSHQEKIKDLILLNPPLTAKHANLPSALSIFSNFLLGEIFSQ-------  262

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPYQMKE+ AMVYRRPYLTSGSSGFA
Sbjct  263  ---------------------DPLRASDKALTSCGPYQMKEDDAMVYRRPYLTSGSSGFA  301

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR+MKK+LK Y+EE R IL  K+W+VQTT+CWG+RDRWLS+DGVEDFCK S  +L+
Sbjct  302  LNAISRSMKKELKKYVEEMRTILIDKDWKVQTTICWGERDRWLSYDGVEDFCKRSNHKLL  361

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            +LPMAGHHVQED GEE+GQVI  ++ ++ R+
Sbjct  362  KLPMAGHHVQEDCGEELGQVINGVLSRRVRI  392



>ref|XP_010678992.1| PREDICTED: uncharacterized protein LOC104894460 [Beta vulgaris 
subsp. vulgaris]
Length=394

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 161/208 (77%), Gaps = 28/208 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+ +KYA  HQDKVN +ILLNPP+T KHANLPS+LSIFSNFLLGEIFSQ       
Sbjct  214  GYFSPVAVKYAFDHQDKVNDLILLNPPITAKHANLPSSLSIFSNFLLGEIFSQ-------  266

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L S GPY+MKE+ AMVYRRPYLTSGSSGFA
Sbjct  267  ---------------------DPLRASDKTLTSSGPYKMKEDDAMVYRRPYLTSGSSGFA  305

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKKQLK Y+EE R +L  +NW+++TTVCWGQRDRWL++DGVEDFCKES  +LV
Sbjct  306  LNAVSRAMKKQLKPYVEETRKMLMNENWKIRTTVCWGQRDRWLNYDGVEDFCKESNHKLV  365

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            ELPMAGHHVQEDSGEE+G++I+ ++ ++
Sbjct  366  ELPMAGHHVQEDSGEELGEIISGLLKRR  393



>ref|XP_002527279.1| hydrolase, putative [Ricinus communis]
 gb|EEF35123.1| hydrolase, putative [Ricinus communis]
Length=386

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 160/209 (77%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+ +++AS HQ+K+  +ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ       
Sbjct  206  GYFSPVAVQFASKHQEKLTDLILLNPPLTAKHANLPSTLSIFSNFLLGEIFSQ-------  258

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPYQMKE+ AMVYRRPYLTSGS+GFA
Sbjct  259  ---------------------DPLRASDKALTSCGPYQMKEDDAMVYRRPYLTSGSAGFA  297

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK LK Y+EE R IL  + W+V+TT+CWGQRDRWL +DGVEDFCK+SK RL+
Sbjct  298  LNAISRAMKKDLKNYVEEMRSILLDRTWKVRTTICWGQRDRWLGYDGVEDFCKDSKHRLI  357

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            ELPMAGHHVQED GEE+G +I+ ++ K+S
Sbjct  358  ELPMAGHHVQEDCGEELGGIISGVISKRS  386



>emb|CBI23337.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 162/209 (78%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS+HQ+K+  +ILLNPPLT KHANLPS LSIFSNFLLGEIFSQ       
Sbjct  210  GYFSPVVVKYASSHQEKIKDLILLNPPLTAKHANLPSALSIFSNFLLGEIFSQ-------  262

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPYQMKE+ AMVYRRPYLTSGSSGFA
Sbjct  263  ---------------------DPLRASDKALTSCGPYQMKEDDAMVYRRPYLTSGSSGFA  301

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR+MKK+LK Y+EE R IL  K+W+VQTT+CWG+RDRWLS+DGVEDFCK S  +L+
Sbjct  302  LNAISRSMKKELKKYVEEMRTILIDKDWKVQTTICWGERDRWLSYDGVEDFCKRSNHKLL  361

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            +LPMAGHHVQED GEE+GQVI  ++ +++
Sbjct  362  KLPMAGHHVQEDCGEELGQVINGVLSRRN  390



>ref|XP_012084566.1| PREDICTED: epoxide hydrolase 3 [Jatropha curcas]
 gb|KDP45211.1| hypothetical protein JCGZ_15076 [Jatropha curcas]
Length=392

 Score =   288 bits (736),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 159/207 (77%), Gaps = 28/207 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS HQ+K+  ++LLNPPL  +HANLPSTLSIFSNFLLGEIFSQ       
Sbjct  213  GYFSPVVVKYASKHQEKLKDLVLLNPPLIARHANLPSTLSIFSNFLLGEIFSQ-------  265

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPYQ+KE+ AMVYRRPYLTSGS+GFA
Sbjct  266  ---------------------DPLRASDKALTSCGPYQIKEDDAMVYRRPYLTSGSAGFA  304

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK+LK Y+EE R IL  KNW V+TTVCWGQRDRWLS+DGVE+FCKESK  L+
Sbjct  305  LNAISRAMKKELKAYVEEMRSILLDKNWNVKTTVCWGQRDRWLSYDGVEEFCKESKYNLI  364

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGK  215
            ELPMAGHHVQED GEE+G +I+ ++ +
Sbjct  365  ELPMAGHHVQEDRGEELGGIISGVLSR  391



>ref|XP_010095591.1| hypothetical protein L484_007430 [Morus notabilis]
 gb|EXB61164.1| hypothetical protein L484_007430 [Morus notabilis]
Length=387

 Score =   287 bits (734),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 162/211 (77%), Gaps = 28/211 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+V+KYASTHQDK+N +ILLNPPLT KH+NLPS LSIFSNFLLGEIFSQ       
Sbjct  205  GYFAPVVVKYASTHQDKINDIILLNPPLTAKHSNLPSALSIFSNFLLGEIFSQ-------  257

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DP+RASDKAL SCGPY++KE+  MVYRRPYLTSGSSGFA
Sbjct  258  ---------------------DPIRASDKALTSCGPYRIKEDDLMVYRRPYLTSGSSGFA  296

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR+MKK+LK Y+EE   IL  K+W+V+TTVCWGQRDRWL+FDGVE+FCK SK  L+
Sbjct  297  LNAISRSMKKELKNYVEETTAILLDKSWKVKTTVCWGQRDRWLTFDGVENFCKNSKQELI  356

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            ++P AGHHVQED GEE+GQ+I+ I+ K+S L
Sbjct  357  QIPNAGHHVQEDCGEELGQIISGIIRKRSFL  387



>emb|CDP03986.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 161/207 (78%), Gaps = 28/207 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS+ Q+K+  +ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ       
Sbjct  225  GYFSPVVVKYASSRQEKITDLILLNPPLTAKHANLPSTLSIFSNFLLGEIFSQ-------  277

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY +KE+VAMVYRRPYLTSGS+GFA
Sbjct  278  ---------------------DPLRASDKALTSCGPYVIKEDVAMVYRRPYLTSGSAGFA  316

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK+LK YIEE R IL  +NW+V TT+ WG+RDRWLS++GVE+FC ESK RL+
Sbjct  317  LNAISRAMKKELKPYIEEMRRILMDENWQVNTTIIWGERDRWLSYNGVEEFCIESKHRLI  376

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGK  215
             LPMAGHHVQEDSGEEV Q+IA++VG+
Sbjct  377  RLPMAGHHVQEDSGEEVAQLIAQVVGR  403



>gb|AFK49471.1| unknown [Lotus japonicus]
Length=397

 Score =   286 bits (731),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 160/208 (77%), Gaps = 28/208 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS+HQ+K+N+++LLNPPLT +HA LPSTLSIFSNFLLGEIFSQ       
Sbjct  217  GYFSPVVVKYASSHQEKINNLVLLNPPLTAQHAKLPSTLSIFSNFLLGEIFSQ-------  269

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY+MKEE AMVYRRPYLTSGSSGFA
Sbjct  270  ---------------------DPLRASDKALTSCGPYKMKEEHAMVYRRPYLTSGSSGFA  308

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR MKK+LKGY++  + IL  KNW+V+TT+CWGQRD WLS+DGVEDFCK+S   L+
Sbjct  309  LNAISRTMKKELKGYVDNMQTILKDKNWKVRTTICWGQRDHWLSYDGVEDFCKDSNHTLI  368

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            E+P AGHH QED GEE+GQ+I +I+ K+
Sbjct  369  EVPTAGHHAQEDCGEELGQLIYKILSKR  396



>ref|XP_007199912.1| hypothetical protein PRUPE_ppa006807mg [Prunus persica]
 gb|EMJ01111.1| hypothetical protein PRUPE_ppa006807mg [Prunus persica]
Length=394

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 166/211 (79%), Gaps = 29/211 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+ +KYAS+HQ+K++++ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ       
Sbjct  211  GYFAPVAVKYASSHQEKIDNIILLNPPLTAKHANLPSTLSIFSNFLLGEIFSQ-------  263

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY+MKE+ AMVYR PYLTSG+SGFA
Sbjct  264  ---------------------DPLRASDKALTSCGPYKMKEDDAMVYRNPYLTSGASGFA  302

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK+LK Y+EE R  LT +NW++ TTVCWG+RDRWLS+DGVE+FCK+SK +L+
Sbjct  303  LNAISRAMKKELKKYVEEMRTTLTDENWKIPTTVCWGKRDRWLSYDGVEEFCKDSKHKLI  362

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            E+PMAGHHVQED GEE+G+VI  ++ +++RL
Sbjct  363  EIPMAGHHVQEDRGEELGEVIKGVM-RRTRL  392



>ref|XP_008235874.1| PREDICTED: uncharacterized hydrolase YNR064C [Prunus mume]
Length=394

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 165/211 (78%), Gaps = 29/211 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+ +KYAS+HQ+K++++ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ       
Sbjct  211  GYFAPVAVKYASSHQEKIDNIILLNPPLTAKHANLPSTLSIFSNFLLGEIFSQ-------  263

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY+MKE+ AMVYR PYLTSG+SGFA
Sbjct  264  ---------------------DPLRASDKALTSCGPYKMKEDDAMVYRNPYLTSGASGFA  302

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK LK Y+EE R  L+ +NW++ TTVCWG+RDRWLS+DGVE+FCK+SK +L+
Sbjct  303  LNAISRAMKKDLKKYVEEMRTTLSDENWKIPTTVCWGKRDRWLSYDGVEEFCKDSKHKLI  362

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            E+PMAGHHVQED GEE+G+VI  ++ +++RL
Sbjct  363  EIPMAGHHVQEDRGEELGEVIKGVI-RRTRL  392



>gb|KJB42614.1| hypothetical protein B456_007G161100 [Gossypium raimondii]
Length=401

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 159/208 (76%), Gaps = 28/208 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V KYAS +Q+K+N +ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ       
Sbjct  219  GYFSPVVAKYASKNQEKLNDLILLNPPLTAKHANLPSTLSIFSNFLLGEIFSQ-------  271

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY MKE+ AMVYRRPYLTSGSSGFA
Sbjct  272  ---------------------DPLRASDKALTSCGPYAMKEDDAMVYRRPYLTSGSSGFA  310

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK+LK Y+E  + IL  KNW+V+TTVCWGQRDRWL++D VEDFCK S  +L+
Sbjct  311  LNAISRAMKKELKAYVEATKVILMDKNWKVRTTVCWGQRDRWLNYDEVEDFCKNSNHKLI  370

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            ELPMAGHHVQEDSGEE+G +I+ ++ ++
Sbjct  371  ELPMAGHHVQEDSGEELGGIISGLISRR  398



>ref|XP_007049546.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX93703.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=402

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 159/208 (76%), Gaps = 28/208 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS HQ+K+N +ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ       
Sbjct  220  GYFSPVVVKYASKHQEKLNDLILLNPPLTAKHANLPSTLSIFSNFLLGEIFSQ-------  272

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY MKE+ AMVYRRPYLTSGSSGFA
Sbjct  273  ---------------------DPLRASDKALTSCGPYAMKEDDAMVYRRPYLTSGSSGFA  311

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK+LK Y+EE + IL  K+W+VQTTVCWGQRDRWLS+D VED C+ S  +L+
Sbjct  312  LNAISRAMKKELKAYVEEMKVILMDKSWKVQTTVCWGQRDRWLSYDQVEDLCESSNHKLI  371

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            ELPMAGHHVQED GEE+G +I+ ++ ++
Sbjct  372  ELPMAGHHVQEDCGEEIGGIISGVISRR  399



>ref|XP_006447950.1| hypothetical protein CICLE_v10015502mg [Citrus clementina]
 gb|ESR61190.1| hypothetical protein CICLE_v10015502mg [Citrus clementina]
Length=398

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 156/208 (75%), Gaps = 28/208 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS H+DK+  +ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ       
Sbjct  215  GYFSPVVVKYASKHKDKLKDLILLNPPLTAKHANLPSTLSIFSNFLLGEIFSQ-------  267

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPYQMKE+ AMVYR PYL+SGSSGFA
Sbjct  268  ---------------------DPLRASDKALTSCGPYQMKEDDAMVYRSPYLSSGSSGFA  306

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A+SR MKKQLK Y+EE R IL   +W++ TTVCWGQRDRWL++DGVEDFC  S   L+
Sbjct  307  LTAISRGMKKQLKQYVEEMRTILMDNSWKIPTTVCWGQRDRWLNYDGVEDFCNNSNHELI  366

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            ELPMAGHHVQEDSGEE+G+VI+EI  K+
Sbjct  367  ELPMAGHHVQEDSGEELGKVISEIFRKR  394



>ref|XP_006469341.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Citrus sinensis]
Length=398

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 156/208 (75%), Gaps = 28/208 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS H+DK+  +ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ       
Sbjct  215  GYFSPVVVKYASKHKDKLKDLILLNPPLTAKHANLPSTLSIFSNFLLGEIFSQ-------  267

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPYQMKE+ AMVYR PYL+SGSSGFA
Sbjct  268  ---------------------DPLRASDKALTSCGPYQMKEDDAMVYRSPYLSSGSSGFA  306

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A+SR MKKQLK Y+EE R IL   +W++ TTVCWGQRDRWL++DGVEDFC  S   L+
Sbjct  307  LTAISRGMKKQLKQYVEEMRTILMDNSWKIPTTVCWGQRDRWLNYDGVEDFCNNSNHELI  366

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            ELPMAGHHVQEDSGEE+G+VI+EI  K+
Sbjct  367  ELPMAGHHVQEDSGEELGKVISEIFRKR  394



>gb|KHN30854.1| Haloalkane dehalogenase [Glycine soja]
Length=401

 Score =   283 bits (725),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 160/211 (76%), Gaps = 28/211 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V KYAS HQ+KV+++ILLNPPLT +HA LP TLSIFSNFLLGEIFSQ       
Sbjct  219  GYFSPVVAKYASIHQEKVSNLILLNPPLTAQHAKLPPTLSIFSNFLLGEIFSQ-------  271

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY+MKEE AMVYRRPYLTSGSSGFA
Sbjct  272  ---------------------DPLRASDKALTSCGPYKMKEEDAMVYRRPYLTSGSSGFA  310

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR M K LK Y+E+ + IL  KNW+VQTT+CWGQRDRWLS+DGVEDFCK+S  +L+
Sbjct  311  LNAISRNMNKDLKRYVEDMQTILKDKNWKVQTTICWGQRDRWLSYDGVEDFCKDSNHKLI  370

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            ++P AGHHVQED GEEVGQ+I  I+ K++++
Sbjct  371  DVPTAGHHVQEDCGEEVGQLIRGIISKRTKI  401



>ref|XP_007134311.1| hypothetical protein PHAVU_010G036500g [Phaseolus vulgaris]
 gb|ESW06305.1| hypothetical protein PHAVU_010G036500g [Phaseolus vulgaris]
Length=400

 Score =   283 bits (725),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 160/211 (76%), Gaps = 28/211 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS HQDK++++ILLNPPLT +HA LPSTLSIFSNFLLGEIFSQ       
Sbjct  218  GYFSPVVVKYASIHQDKLSNLILLNPPLTAQHAKLPSTLSIFSNFLLGEIFSQ-------  270

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY+MKEE AMVYRRPYLTSGSSGFA
Sbjct  271  ---------------------DPLRASDKALTSCGPYKMKEEDAMVYRRPYLTSGSSGFA  309

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR M K LK Y+E+   IL  KNW+VQTT+CWGQRDRWLS+DGVEDF K+S  +L+
Sbjct  310  LNAISRNMSKDLKRYVEDMHRILKDKNWKVQTTICWGQRDRWLSYDGVEDFSKDSNHKLI  369

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            E+P AGHHVQED GEE+GQ+I  I+ +++++
Sbjct  370  EVPTAGHHVQEDCGEEIGQLICRIISRRTKI  400



>gb|KDO43504.1| hypothetical protein CISIN_1g015903mg [Citrus sinensis]
Length=398

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 157/208 (75%), Gaps = 28/208 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS H+DK+  +ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ       
Sbjct  215  GYFSPVVVKYASKHKDKLKDLILLNPPLTAKHANLPSTLSIFSNFLLGEIFSQ-------  267

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPYQMKE+ AMVYR PYL+SGSSGFA
Sbjct  268  ---------------------DPLRASDKALTSCGPYQMKEDDAMVYRSPYLSSGSSGFA  306

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A+S+ MKKQLK Y+EE R IL  K+W++ TTVCWGQRDRWL+ DGVEDFC +S   L+
Sbjct  307  LTAISKGMKKQLKQYVEEMRTILMDKSWKIPTTVCWGQRDRWLNNDGVEDFCNDSNHELI  366

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            ELPMAGHHVQEDSGEE+G+VI+EI  K+
Sbjct  367  ELPMAGHHVQEDSGEELGKVISEIFRKR  394



>ref|XP_011458132.1| PREDICTED: uncharacterized hydrolase YNR064C-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=389

 Score =   283 bits (723),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 161/208 (77%), Gaps = 28/208 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P  +KYAS HQ+K++++ILLNPPLT KHANLPSTLS+FSNFLLGEIFSQ       
Sbjct  206  GYFAPAAVKYASIHQEKIDNIILLNPPLTAKHANLPSTLSVFSNFLLGEIFSQ-------  258

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY++KE+ AMVYR PYLTSG++GFA
Sbjct  259  ---------------------DPLRASDKTLTSCGPYKIKEDDAMVYRNPYLTSGAAGFA  297

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR MKK+LK Y+EE R ILT +NW+V TT+CWG+RDRWL++DGVEDFCK+SK +L+
Sbjct  298  LNAISRDMKKELKKYVEEMRTILTDENWKVPTTICWGKRDRWLTYDGVEDFCKDSKHKLI  357

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            E+PMAGHHVQED GEE+GQ+I +I+ K+
Sbjct  358  EIPMAGHHVQEDRGEELGQIIYDIIRKR  385



>ref|XP_004292325.1| PREDICTED: uncharacterized hydrolase YNR064C-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=394

 Score =   282 bits (722),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 161/208 (77%), Gaps = 28/208 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P  +KYAS HQ+K++++ILLNPPLT KHANLPSTLS+FSNFLLGEIFSQ       
Sbjct  211  GYFAPAAVKYASIHQEKIDNIILLNPPLTAKHANLPSTLSVFSNFLLGEIFSQ-------  263

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY++KE+ AMVYR PYLTSG++GFA
Sbjct  264  ---------------------DPLRASDKTLTSCGPYKIKEDDAMVYRNPYLTSGAAGFA  302

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR MKK+LK Y+EE R ILT +NW+V TT+CWG+RDRWL++DGVEDFCK+SK +L+
Sbjct  303  LNAISRDMKKELKKYVEEMRTILTDENWKVPTTICWGKRDRWLTYDGVEDFCKDSKHKLI  362

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            E+PMAGHHVQED GEE+GQ+I +I+ K+
Sbjct  363  EIPMAGHHVQEDRGEELGQIIYDIIRKR  390



>ref|XP_003521017.2| PREDICTED: uncharacterized hydrolase YNR064C [Glycine max]
Length=443

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 159/211 (75%), Gaps = 28/211 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V KYAS HQ+KV ++ILLNPPLT +HA LP TLSIFSNFLLGEIFSQ       
Sbjct  261  GYFSPVVAKYASIHQEKVRNLILLNPPLTAQHAKLPPTLSIFSNFLLGEIFSQ-------  313

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY+MKEE AMVYRRPYLTSGSSGFA
Sbjct  314  ---------------------DPLRASDKALTSCGPYKMKEEDAMVYRRPYLTSGSSGFA  352

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR M K LK Y+E+ + IL  KNW+VQTT+CWGQRDRWLS+DGVEDFCK+S  +L+
Sbjct  353  LNAISRNMNKDLKRYVEDMQTILKDKNWKVQTTICWGQRDRWLSYDGVEDFCKDSNHKLI  412

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            ++P AGHHVQED GEEVGQ+I  I+ K++++
Sbjct  413  DVPTAGHHVQEDCGEEVGQLIRGIISKRTKI  443



>gb|EYU46070.1| hypothetical protein MIMGU_mgv1a008062mg [Erythranthe guttata]
Length=386

 Score =   280 bits (715),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 160/211 (76%), Gaps = 28/211 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYA  +Q+K++++ILLNPPLT KH NLPSTL+IFSNFLLGEIFSQ       
Sbjct  204  GYFSPVVVKYAKDNQEKISNLILLNPPLTEKHGNLPSTLAIFSNFLLGEIFSQ-------  256

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL S GPY+MKE+ AMVYRRPYLTSGSSGFA
Sbjct  257  ---------------------DPLRASDKALTSSGPYKMKEDDAMVYRRPYLTSGSSGFA  295

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR+MKK+LKG IEE R  L  +NW+V+TTVCWG RDRWLSFDGVEDFCKESK +L+
Sbjct  296  LNAISRSMKKELKGCIEEMRKTLMDENWKVRTTVCWGLRDRWLSFDGVEDFCKESKHQLI  355

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
             LPMAGHHVQED  EE+G +IA I+ K+ R+
Sbjct  356  TLPMAGHHVQEDCSEEIGDIIAGILSKRRRI  386



>ref|XP_008802246.1| PREDICTED: epoxide hydrolase 3 [Phoenix dactylifera]
Length=379

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 155/207 (75%), Gaps = 28/207 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+V+KYAS HQ+K+  ++L+NPPL  KHA LPSTL++FSNFLLGEIFSQ       
Sbjct  199  GYFAPVVVKYASCHQEKLRDLVLINPPLMEKHAKLPSTLALFSNFLLGEIFSQ-------  251

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY MKEE AMVYRRPYLTSGSSGFA
Sbjct  252  ---------------------DPLRASDKALTSCGPYMMKEEDAMVYRRPYLTSGSSGFA  290

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK LK Y+   R ILT K+W+  TT+CWG RDRWLS+DGVEDFCK S  +LV
Sbjct  291  LNAISRAMKKDLKAYVGTMRTILTNKSWKTNTTICWGLRDRWLSYDGVEDFCKASNHKLV  350

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGK  215
            +LPMAGHHVQEDSGEE+G++IAEI+ K
Sbjct  351  QLPMAGHHVQEDSGEELGRIIAEIISK  377



>ref|XP_010926737.1| PREDICTED: epoxide hydrolase 3 isoform X2 [Elaeis guineensis]
Length=379

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 155/207 (75%), Gaps = 28/207 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+V+KYAS HQ+K+  ++L+NPPL  KHA LPSTL++FSNFLLGEIFSQ       
Sbjct  199  GYFAPVVVKYASCHQEKLRDLVLINPPLMEKHAKLPSTLALFSNFLLGEIFSQ-------  251

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY MKEE AMVYRRPYLTSGSSGFA
Sbjct  252  ---------------------DPLRASDKALTSCGPYMMKEEDAMVYRRPYLTSGSSGFA  290

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK LK Y+   R ILT K+W+V TT+CWG RDRWLS+DGVEDFCK S  +LV
Sbjct  291  LNAISRAMKKDLKAYVRTMRTILTNKSWKVNTTICWGLRDRWLSYDGVEDFCKASNHKLV  350

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGK  215
             LPMAGHHVQEDSGEE+G++IAEI+ K
Sbjct  351  RLPMAGHHVQEDSGEELGRIIAEIIRK  377



>ref|XP_010926736.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Elaeis guineensis]
Length=387

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 155/207 (75%), Gaps = 28/207 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+V+KYAS HQ+K+  ++L+NPPL  KHA LPSTL++FSNFLLGEIFSQ       
Sbjct  207  GYFAPVVVKYASCHQEKLRDLVLINPPLMEKHAKLPSTLALFSNFLLGEIFSQ-------  259

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY MKEE AMVYRRPYLTSGSSGFA
Sbjct  260  ---------------------DPLRASDKALTSCGPYMMKEEDAMVYRRPYLTSGSSGFA  298

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK LK Y+   R ILT K+W+V TT+CWG RDRWLS+DGVEDFCK S  +LV
Sbjct  299  LNAISRAMKKDLKAYVRTMRTILTNKSWKVNTTICWGLRDRWLSYDGVEDFCKASNHKLV  358

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGK  215
             LPMAGHHVQEDSGEE+G++IAEI+ K
Sbjct  359  RLPMAGHHVQEDSGEELGRIIAEIIRK  385



>ref|XP_009342379.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Pyrus x bretschneideri]
Length=396

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 164/211 (78%), Gaps = 29/211 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+V+KYAS+HQ+K++++ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ       
Sbjct  213  GYFAPVVVKYASSHQEKIDNIILLNPPLTEKHANLPSTLSIFSNFLLGEIFSQ-------  265

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL S GPY+MKE+ AMVYR PYLTSG+SGFA
Sbjct  266  ---------------------DPLRASDKALESSGPYKMKEDDAMVYRNPYLTSGASGFA  304

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK+LK Y+ E + ILT +NW+V TTVCWG+RDRWLS+DGVE+FCK SK +L+
Sbjct  305  LNAISRAMKKELKKYVGEMKTILTEENWKVPTTVCWGKRDRWLSYDGVEEFCKNSKHKLI  364

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            E+PMAGHHVQED GEE+G+V+  I+ ++SR 
Sbjct  365  EIPMAGHHVQEDRGEELGEVLKGII-RRSRF  394



>ref|XP_009358940.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Pyrus x bretschneideri]
Length=394

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 165/211 (78%), Gaps = 29/211 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+V+KYAS+H++K++++ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ       
Sbjct  211  GYFAPVVVKYASSHREKIDNIILLNPPLTEKHANLPSTLSIFSNFLLGEIFSQ-------  263

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL S GPY+MKE+ AMVYR PYLTSG+SGFA
Sbjct  264  ---------------------DPLRASDKALESSGPYKMKEDDAMVYRNPYLTSGASGFA  302

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK+LK Y+ E + ILT +NW+V TTVCWG+RDRWLS+DGVE+FCK+SK +L+
Sbjct  303  LNAISRAMKKELKKYVGEIKTILTDENWKVPTTVCWGKRDRWLSYDGVEEFCKDSKHKLI  362

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            E+PMAGHHVQED GEE+G+V+  I+ ++SR 
Sbjct  363  EIPMAGHHVQEDRGEELGEVLKGII-RRSRF  392



>gb|KEH18035.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=344

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 157/209 (75%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+V+KYAS HQ+K+N++IL+NPPLT +HA LP TLSIFSNFLLGEIFSQ       
Sbjct  164  GYFAPVVVKYASKHQEKINNLILINPPLTAQHAKLPPTLSIFSNFLLGEIFSQ-------  216

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY+MKEE AMVYRRPYL SGSSGFA
Sbjct  217  ---------------------DPLRASDKALTSCGPYKMKEEDAMVYRRPYLISGSSGFA  255

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA++R MKK LK Y+E+ + IL  K+W V+TTVCWGQRDRWLS++GVEDFCK+S  +L+
Sbjct  256  LNAITRTMKKDLKRYVEDMQTILKDKSWNVRTTVCWGQRDRWLSYEGVEDFCKDSNHKLI  315

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            E+P AGHH QED GEE+GQ+I  I+ KK+
Sbjct  316  EVPKAGHHAQEDCGEELGQLIYGIIRKKN  344



>ref|XP_008382540.1| PREDICTED: uncharacterized hydrolase YNR064C [Malus domestica]
Length=396

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 163/211 (77%), Gaps = 29/211 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+V+KYAS HQ+K++++ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ       
Sbjct  213  GYFAPVVVKYASXHQEKIDNLILLNPPLTEKHANLPSTLSIFSNFLLGEIFSQ-------  265

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL S GPY+MKE+ AMVYR PYLTSG+SGFA
Sbjct  266  ---------------------DPLRASDKALESSGPYKMKEDDAMVYRNPYLTSGASGFA  304

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK LK Y+ E + ILT ++W+V TTVCWG+RDRWLS+DGVE+FCK+SK +L+
Sbjct  305  LNAISRAMKKXLKKYVGEMKTILTDEDWKVPTTVCWGKRDRWLSYDGVEEFCKDSKHKLI  364

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            E+PMAGHHVQED GEE+G+V+  I+ ++SR 
Sbjct  365  EIPMAGHHVQEDRGEELGEVLKGII-RRSRF  394



>gb|EPS68183.1| hypothetical protein M569_06589, partial [Genlisea aurea]
Length=335

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 159/212 (75%), Gaps = 28/212 (13%)
 Frame = -2

Query  865  TNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEI  686
            TNKK      G F+P+V+KYA  ++DK+ ++ILLNPPLTVKHANLPSTLS+FSNFLLGEI
Sbjct  152  TNKKITLVVQGYFAPVVVKYAGVYRDKLRNLILLNPPLTVKHANLPSTLSVFSNFLLGEI  211

Query  685  FSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRP  506
            FSQ                            DP+RASDKAL S GPY++KEEVAMVYRRP
Sbjct  212  FSQ----------------------------DPIRASDKALTSSGPYKIKEEVAMVYRRP  243

Query  505  YLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVED  326
            YLTSGS+GFALNA+SR+MKK LK Y+E+ R IL  + WEV+T +CWG+RDRWLSF+GVED
Sbjct  244  YLTSGSAGFALNAISRSMKKGLKAYVEDMRSILMDEKWEVETMICWGERDRWLSFEGVED  303

Query  325  FCKESKLRLVELPMAGHHVQEDSGEEVGQVIA  230
            FC+ SK RLV LP AGHHVQED G+EVG++IA
Sbjct  304  FCRGSKHRLVALPTAGHHVQEDCGQEVGELIA  335



>gb|ABK94940.1| unknown [Populus trichocarpa]
Length=282

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 154/211 (73%), Gaps = 28/211 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSPI +KYAS  Q K+N +ILLNPPLT  HANLPS LSIFS FLLGEIF Q       
Sbjct  100  GYFSPIAVKYASNLQGKLNDLILLNPPLTATHANLPSALSIFSTFLLGEIFCQ-------  152

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L S GPY+MKE+ AMVYRRPYLTSGS+GFA
Sbjct  153  ---------------------DPLRASDKTLTSSGPYKMKEDDAMVYRRPYLTSGSAGFA  191

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LN +S+AMKK LK Y+EE R  L  +NW+V+TTVCWGQRDRWLS+DGVEDF K SK +L+
Sbjct  192  LNVISKAMKKDLKAYVEETRKTLLDENWKVRTTVCWGQRDRWLSYDGVEDFLKNSKHKLI  251

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            ELPMAGHHVQED GEE+G +I+ I+G++SR+
Sbjct  252  ELPMAGHHVQEDCGEELGGIISGILGRRSRI  282



>gb|KEH18034.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=384

 Score =   275 bits (702),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 157/209 (75%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+V+KYAS HQ+K+N++IL+NPPLT +HA LP TLSIFSNFLLGEIFSQ       
Sbjct  204  GYFAPVVVKYASKHQEKINNLILINPPLTAQHAKLPPTLSIFSNFLLGEIFSQ-------  256

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY+MKEE AMVYRRPYL SGSSGFA
Sbjct  257  ---------------------DPLRASDKALTSCGPYKMKEEDAMVYRRPYLISGSSGFA  295

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA++R MKK LK Y+E+ + IL  K+W V+TTVCWGQRDRWLS++GVEDFCK+S  +L+
Sbjct  296  LNAITRTMKKDLKRYVEDMQTILKDKSWNVRTTVCWGQRDRWLSYEGVEDFCKDSNHKLI  355

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            E+P AGHH QED GEE+GQ+I  I+ KK+
Sbjct  356  EVPKAGHHAQEDCGEELGQLIYGIIRKKN  384



>ref|XP_004510185.1| PREDICTED: 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate 
hydrolase-like isoform X2 [Cicer arietinum]
Length=382

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 157/209 (75%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS HQ+K+N++ILLNPPLT +HANLP TLSIFSNFLLGEIFSQ       
Sbjct  202  GYFSPVVVKYASIHQEKINNLILLNPPLTAQHANLPPTLSIFSNFLLGEIFSQ-------  254

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY+MKEE AMVYRRPYL SGSSGFA
Sbjct  255  ---------------------DPLRASDKALTSCGPYKMKEEDAMVYRRPYLISGSSGFA  293

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA++R +KK LK Y+E+ + IL  K+  V+TT+CWGQRDRWLS+DGVEDFCK+S   L+
Sbjct  294  LNAITRTLKKDLKRYVEDMQTILKDKSCNVRTTICWGQRDRWLSYDGVEDFCKDSNHTLI  353

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            ++P AGHHVQED GEE+GQ+I  I+ KK+
Sbjct  354  QVPKAGHHVQEDCGEELGQLIYGIIRKKN  382



>ref|XP_011009615.1| PREDICTED: epoxide hydrolase 3 isoform X2 [Populus euphratica]
Length=391

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 153/209 (73%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSPI +KYAS  Q K+N +ILLNPPLT  HANLPS LSIFSNFLLGEIF Q       
Sbjct  211  GYFSPIAVKYASNLQGKLNDLILLNPPLTATHANLPSALSIFSNFLLGEIFCQ-------  263

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L S GPY+MKE+ AMVYRRPYLTSGS+GFA
Sbjct  264  ---------------------DPLRASDKTLTSSGPYKMKEDDAMVYRRPYLTSGSAGFA  302

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LN +S+AMKK LK Y+EE R  L  +NW+V+TTVCWGQRDRWLS+DGVEDF K SK +L+
Sbjct  303  LNVISKAMKKDLKAYVEETRKTLLDENWKVKTTVCWGQRDRWLSYDGVEDFLKNSKHKLI  362

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            ELPMAGHHVQED GEE+G +I+ I+G++S
Sbjct  363  ELPMAGHHVQEDCGEELGGIISGILGRRS  391



>ref|XP_002320563.2| hypothetical protein POPTR_0014s17410g [Populus trichocarpa]
 gb|EEE98878.2| hypothetical protein POPTR_0014s17410g [Populus trichocarpa]
Length=393

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 154/211 (73%), Gaps = 28/211 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSPI +KYAS  Q K+N +ILLNPPLT  HANLPS LSIFS FLLGEIF Q       
Sbjct  211  GYFSPIAVKYASNLQGKLNDLILLNPPLTATHANLPSALSIFSTFLLGEIFCQ-------  263

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L S GPY+MKE+ AMVYRRPYLTSGS+GFA
Sbjct  264  ---------------------DPLRASDKTLTSSGPYKMKEDDAMVYRRPYLTSGSAGFA  302

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LN +S+AMKK LK Y+EE R  L  +NW+V+TTVCWGQRDRWLS+DGVEDF K SK +L+
Sbjct  303  LNVISKAMKKDLKAYVEETRKTLLDENWKVRTTVCWGQRDRWLSYDGVEDFLKNSKHKLI  362

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            ELPMAGHHVQED GEE+G +I+ I+G++SR+
Sbjct  363  ELPMAGHHVQEDCGEELGGIISGILGRRSRI  393



>ref|XP_011009614.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Populus euphratica]
Length=392

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 153/209 (73%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSPI +KYAS  Q K+N +ILLNPPLT  HANLPS LSIFSNFLLGEIF Q       
Sbjct  212  GYFSPIAVKYASNLQGKLNDLILLNPPLTATHANLPSALSIFSNFLLGEIFCQ-------  264

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L S GPY+MKE+ AMVYRRPYLTSGS+GFA
Sbjct  265  ---------------------DPLRASDKTLTSSGPYKMKEDDAMVYRRPYLTSGSAGFA  303

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LN +S+AMKK LK Y+EE R  L  +NW+V+TTVCWGQRDRWLS+DGVEDF K SK +L+
Sbjct  304  LNVISKAMKKDLKAYVEETRKTLLDENWKVKTTVCWGQRDRWLSYDGVEDFLKNSKHKLI  363

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            ELPMAGHHVQED GEE+G +I+ I+G++S
Sbjct  364  ELPMAGHHVQEDCGEELGGIISGILGRRS  392



>ref|XP_010258608.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Nelumbo nucifera]
Length=393

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 153/207 (74%), Gaps = 28/207 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+PIV+KYAS HQ+K+N +ILLNPPL   HA LPSTLSIFSNFLLGEIFSQ       
Sbjct  214  GYFAPIVVKYASNHQEKLNDLILLNPPLVENHAELPSTLSIFSNFLLGEIFSQ-------  266

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY+MKE  AMVYRRPYLTSGSSGFA
Sbjct  267  ---------------------DPLRASDKPLTSCGPYKMKEVDAMVYRRPYLTSGSSGFA  305

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A++RAM+K+LK Y +E R IL+ +NW+V+TTVCWGQRD WL +DGV+DFCK S  ++V
Sbjct  306  LTAITRAMRKELKTYTKEMRMILSNENWKVRTTVCWGQRDNWLGYDGVDDFCKHSSHKVV  365

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGK  215
            EL MAGHHVQEDSGEE+GQ+I  I+ K
Sbjct  366  ELAMAGHHVQEDSGEELGQLITSILSK  392



>ref|XP_006414993.1| hypothetical protein EUTSA_v10025411mg [Eutrema salsugineum]
 gb|ESQ56446.1| hypothetical protein EUTSA_v10025411mg [Eutrema salsugineum]
Length=284

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 152/209 (73%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FS   +KYA    +K+ ++ILLNPPLT +HA LPSTLS+FSNFLLGEIFSQ       
Sbjct  102  GYFSTAAVKYARNRPEKIKNLILLNPPLTPEHAKLPSTLSVFSNFLLGEIFSQ-------  154

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY+MKE+ AMVYRRPYLTSGSSGFA
Sbjct  155  ---------------------DPLRASDKPLTSCGPYKMKEDDAMVYRRPYLTSGSSGFA  193

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK+LKGY EE R  L  KNW++ TTVCWGQRD+WLS++GVEDFCK S  +L+
Sbjct  194  LNAISRAMKKELKGYAEEMRTSLMDKNWKIPTTVCWGQRDKWLSYEGVEDFCKSSGHKLI  253

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            ELPMAGHHVQED GEE+G +I+ I+ K +
Sbjct  254  ELPMAGHHVQEDCGEELGGIISRIISKAA  282



>gb|KFK35301.1| hypothetical protein AALP_AA5G266800 [Arabis alpina]
Length=394

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 152/209 (73%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FS  V+KYA    +K+ ++ILLNPPLT +HA LPSTLS+FSNFLLGEIFSQ       
Sbjct  212  GYFSTTVVKYARKRPEKIKNLILLNPPLTPEHAKLPSTLSVFSNFLLGEIFSQ-------  264

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY+MKE+ AMVYRRPYLTSGSSGFA
Sbjct  265  ---------------------DPLRASDKPLTSCGPYKMKEDAAMVYRRPYLTSGSSGFA  303

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK+LKG  EE R  L  KNW++ TTVCWGQRDRWLS++GVEDFCK S  +LV
Sbjct  304  LNAISRAMKKELKGSAEEMRKSLMDKNWKIPTTVCWGQRDRWLSYEGVEDFCKSSGHKLV  363

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            ELPMAGHHVQED GEE+G +I+ I+ K +
Sbjct  364  ELPMAGHHVQEDCGEELGGIISRIISKNA  392



>ref|XP_011624947.1| PREDICTED: uncharacterized protein LOC18438190 isoform X3 [Amborella 
trichopoda]
Length=330

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 154/214 (72%), Gaps = 29/214 (14%)
 Frame = -2

Query  853  GYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQV  674
            G+P S G F+P+V+KY  +HQ+ V ++IL+NPPLT KHA LPSTLS FSNFLLGEIFSQ 
Sbjct  144  GFP-SQGYFAPVVVKYVYSHQENVKNLILVNPPLTDKHAKLPSTLSSFSNFLLGEIFSQ-  201

Query  673  G*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTS  494
                                       DPLRASDK L +CGPY MKEE AMVYRRPYLTS
Sbjct  202  ---------------------------DPLRASDKPLTNCGPYAMKEEDAMVYRRPYLTS  234

Query  493  GSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE  314
            GSSGFAL ALSR+MKK+LK Y+EE R IL+ + W V TT+CWG+RDRWLS+DGV+DFC  
Sbjct  235  GSSGFALTALSRSMKKELKAYVEETRRILSSQTWMVNTTICWGRRDRWLSYDGVQDFCNL  294

Query  313  SKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            S  +LVELPMAGHH QED GEE+G +IA ++  K
Sbjct  295  SNHKLVELPMAGHHAQEDCGEELGGIIAGLLRNK  328



>ref|XP_010532928.1| PREDICTED: uncharacterized hydrolase YNR064C [Tarenaya hassleriana]
Length=395

 Score =   267 bits (682),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 154/211 (73%), Gaps = 28/211 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KY    Q+K+  +IL+NPPLT KHANLPSTLS+FSNFLLGEIFSQ       
Sbjct  213  GYFSPVVVKYVRNRQEKIKDLILVNPPLTAKHANLPSTLSVFSNFLLGEIFSQ-------  265

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY+MKE+ AMVYRRPYL SGSSGFA
Sbjct  266  ---------------------DPLRASDKPLTSCGPYKMKEDDAMVYRRPYLMSGSSGFA  304

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMK++LK Y+EE +  L  K+W++  TVCWGQRDRWLS+DGVE+FCK S  +LV
Sbjct  305  LNAISRAMKRELKSYVEEMKTSLMDKDWKIPVTVCWGQRDRWLSYDGVEEFCKSSGHKLV  364

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKSRL  203
            ++PMAGHHVQED GEE+G +I+ ++ K + +
Sbjct  365  QVPMAGHHVQEDCGEELGGIISRVISKSATI  395



>ref|XP_006414994.1| hypothetical protein EUTSA_v10025411mg [Eutrema salsugineum]
 gb|ESQ56447.1| hypothetical protein EUTSA_v10025411mg [Eutrema salsugineum]
Length=393

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 151/207 (73%), Gaps = 28/207 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FS   +KYA    +K+ ++ILLNPPLT +HA LPSTLS+FSNFLLGEIFSQ       
Sbjct  211  GYFSTAAVKYARNRPEKIKNLILLNPPLTPEHAKLPSTLSVFSNFLLGEIFSQ-------  263

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY+MKE+ AMVYRRPYLTSGSSGFA
Sbjct  264  ---------------------DPLRASDKPLTSCGPYKMKEDDAMVYRRPYLTSGSSGFA  302

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK+LKGY EE R  L  KNW++ TTVCWGQRD+WLS++GVEDFCK S  +L+
Sbjct  303  LNAISRAMKKELKGYAEEMRTSLMDKNWKIPTTVCWGQRDKWLSYEGVEDFCKSSGHKLI  362

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGK  215
            ELPMAGHHVQED GEE+G +I+ I+ K
Sbjct  363  ELPMAGHHVQEDCGEELGGIISRIISK  389



>ref|XP_011624946.1| PREDICTED: epoxide hydrolase 3 isoform X2 [Amborella trichopoda]
Length=380

 Score =   264 bits (674),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 150/208 (72%), Gaps = 28/208 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+V+KY  +HQ+ V ++IL+NPPLT KHA LPSTLS FSNFLLGEIFSQ       
Sbjct  199  GYFAPVVVKYVYSHQENVKNLILVNPPLTDKHAKLPSTLSSFSNFLLGEIFSQ-------  251

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L +CGPY MKEE AMVYRRPYLTSGSSGFA
Sbjct  252  ---------------------DPLRASDKPLTNCGPYAMKEEDAMVYRRPYLTSGSSGFA  290

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L ALSR+MKK+LK Y+EE R IL+ + W V TT+CWG+RDRWLS+DGV+DFC  S  +LV
Sbjct  291  LTALSRSMKKELKAYVEETRRILSSQTWMVNTTICWGRRDRWLSYDGVQDFCNLSNHKLV  350

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            ELPMAGHH QED GEE+G +IA ++  K
Sbjct  351  ELPMAGHHAQEDCGEELGGIIAGLLRNK  378



>ref|XP_006848442.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Amborella trichopoda]
 gb|ERN10023.1| hypothetical protein AMTR_s00013p00241300 [Amborella trichopoda]
Length=395

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 150/208 (72%), Gaps = 28/208 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+V+KY  +HQ+ V ++IL+NPPLT KHA LPSTLS FSNFLLGEIFSQ       
Sbjct  214  GYFAPVVVKYVYSHQENVKNLILVNPPLTDKHAKLPSTLSSFSNFLLGEIFSQ-------  266

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L +CGPY MKEE AMVYRRPYLTSGSSGFA
Sbjct  267  ---------------------DPLRASDKPLTNCGPYAMKEEDAMVYRRPYLTSGSSGFA  305

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L ALSR+MKK+LK Y+EE R IL+ + W V TT+CWG+RDRWLS+DGV+DFC  S  +LV
Sbjct  306  LTALSRSMKKELKAYVEETRRILSSQTWMVNTTICWGRRDRWLSYDGVQDFCNLSNHKLV  365

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            ELPMAGHH QED GEE+G +IA ++  K
Sbjct  366  ELPMAGHHAQEDCGEELGGIIAGLLRNK  393



>ref|XP_010440628.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Camelina sativa]
Length=394

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 152/209 (73%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FS  V+KYA T  DK+ ++ILLNPPLT +HA LPSTLS+FSNFLLGEIFSQ       
Sbjct  212  GYFSTAVVKYARTRPDKIKNLILLNPPLTPEHAKLPSTLSVFSNFLLGEIFSQ-------  264

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY+MKE+ AMVYRRPYLTSGSSGFA
Sbjct  265  ---------------------DPLRASDKPLTSCGPYKMKEDDAMVYRRPYLTSGSSGFA  303

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK+LK Y EE R  L  K+W++ TTVCWGQRDRWLS++GVE+FCK S   LV
Sbjct  304  LNAISRAMKKELKKYAEEMRTSLMDKSWKIPTTVCWGQRDRWLSYEGVEEFCKSSGHNLV  363

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            E+P AGHHVQED GEE+G++I+ I+ K +
Sbjct  364  EMPNAGHHVQEDCGEELGRIISRIISKSA  392



>ref|NP_001045213.1| Os01g0919700 [Oryza sativa Japonica Group]
 dbj|BAD87632.1| hydrolase-like [Oryza sativa Japonica Group]
 dbj|BAF07127.1| Os01g0919700 [Oryza sativa Japonica Group]
 dbj|BAG86873.1| unnamed protein product [Oryza sativa Japonica Group]
Length=379

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 150/205 (73%), Gaps = 28/205 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+PIVIKYA+ HQDK+N +IL+NPP+T KHA LPSTL+ FSNFLLGEIFSQ       
Sbjct  201  GYFAPIVIKYANEHQDKLNHLILVNPPITDKHAKLPSTLACFSNFLLGEIFSQ-------  253

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL S GPY MKEE AMVYRRPYL SGSSGFA
Sbjct  254  ---------------------DPLRASDKALTSSGPYMMKEEDAMVYRRPYLVSGSSGFA  292

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK LK YIE  R IL+  +W+ +TTVCWG RDRWL++DGVEDFC  +  +++
Sbjct  293  LNAISRAMKKDLKVYIESMRNILSSDSWKTKTTVCWGLRDRWLNYDGVEDFCGSANYKIL  352

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIV  221
            ELPMAGHHVQED GEE+G+++  I+
Sbjct  353  ELPMAGHHVQEDRGEELGKLVKRIL  377



>gb|EEE55899.1| hypothetical protein OsJ_04564 [Oryza sativa Japonica Group]
Length=395

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 150/205 (73%), Gaps = 28/205 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+PIVIKYA+ HQDK+N +IL+NPP+T KHA LPSTL+ FSNFLLGEIFSQ       
Sbjct  201  GYFAPIVIKYANEHQDKLNHLILVNPPITDKHAKLPSTLACFSNFLLGEIFSQ-------  253

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL S GPY MKEE AMVYRRPYL SGSSGFA
Sbjct  254  ---------------------DPLRASDKALTSSGPYMMKEEDAMVYRRPYLVSGSSGFA  292

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK LK YIE  R IL+  +W+ +TTVCWG RDRWL++DGVEDFC  +  +++
Sbjct  293  LNAISRAMKKDLKVYIESMRNILSSDSWKTKTTVCWGLRDRWLNYDGVEDFCGSANYKIL  352

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIV  221
            ELPMAGHHVQED GEE+G+++  I+
Sbjct  353  ELPMAGHHVQEDRGEELGKLVKRIL  377



>ref|XP_009139658.1| PREDICTED: uncharacterized hydrolase YNR064C [Brassica rapa]
 emb|CDY39712.1| BnaA04g07230D [Brassica napus]
Length=393

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 149/207 (72%), Gaps = 28/207 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FS   +KYA    +K+ ++ILLNPPLT +HA LPSTLS+FSNFLLGEIFSQ       
Sbjct  211  GYFSTAAVKYARNRPEKIKNLILLNPPLTPEHAKLPSTLSVFSNFLLGEIFSQ-------  263

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY+MKE+ AMVYRRPYLTSGSSGFA
Sbjct  264  ---------------------DPLRASDKPLTSCGPYKMKEDDAMVYRRPYLTSGSSGFA  302

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK+LKGY EE R  L  K+W++ TTVCWGQRD+WLS+ GVE+FCK S   LV
Sbjct  303  LNAISRAMKKELKGYTEEMRSSLMDKDWKIPTTVCWGQRDKWLSYQGVEEFCKSSGHNLV  362

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGK  215
            ELPMAGHHVQED GEE+G +I+ I+ K
Sbjct  363  ELPMAGHHVQEDCGEEIGGLISRIISK  389



>ref|XP_010450251.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Camelina sativa]
Length=394

 Score =   262 bits (669),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 151/209 (72%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FS  V+KYA T  DK+ ++ILLNPPLT +HA LPSTLS+FSNFLLGEIFSQ       
Sbjct  212  GYFSTAVVKYARTRPDKIKNLILLNPPLTPEHAKLPSTLSVFSNFLLGEIFSQ-------  264

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY+MKE+ AMVYRRPYLTSGSSGFA
Sbjct  265  ---------------------DPLRASDKPLTSCGPYKMKEDDAMVYRRPYLTSGSSGFA  303

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR MKK+LK Y EE R  L  K+W++ TTVCWGQRDRWLS++GVE+FCK S   LV
Sbjct  304  LNAISRTMKKELKKYAEEMRTSLMDKSWKIPTTVCWGQRDRWLSYEGVEEFCKSSGHNLV  363

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            E+P AGHHVQED GEE+G++I+ I+ K +
Sbjct  364  EMPNAGHHVQEDCGEELGRIISRIISKSA  392



>ref|XP_002863288.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH39547.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=393

 Score =   262 bits (669),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 149/209 (71%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FS  V+KYA    DK+ ++ILLNPPLT +HA LPSTLS+FSNFLLGEIFSQ       
Sbjct  211  GYFSTAVVKYARNRPDKIKNLILLNPPLTPEHAKLPSTLSVFSNFLLGEIFSQ-------  263

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY+MKE+ AMVYRRPYLTSGSSGFA
Sbjct  264  ---------------------DPLRASDKPLTSCGPYKMKEDDAMVYRRPYLTSGSSGFA  302

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR+MKK+LK Y EE R  L  KNW++  TVCWGQRDRWLSF+GVE+FCK S   LV
Sbjct  303  LNAISRSMKKELKKYAEEMRTSLMDKNWKIPITVCWGQRDRWLSFEGVEEFCKSSGHNLV  362

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            ELP AGHHVQED GEE+G +I+ I+ K +
Sbjct  363  ELPNAGHHVQEDCGEELGGIISRIISKSA  391



>tpg|DAA56123.1| TPA: hydrolase-like protein [Zea mays]
 tpg|DAA56124.1| TPA: hydrolase-like protein [Zea mays]
Length=302

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 145/205 (71%), Gaps = 28/205 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+ +KYAS HQDK+N ++L+NPP+T KH NLPSTL+ FSNFLLGEIFSQ       
Sbjct  125  GYFAPVAVKYASEHQDKLNHLVLVNPPITDKHLNLPSTLASFSNFLLGEIFSQ-------  177

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY MKEE AMVYRRPYL SGSSGFA
Sbjct  178  ---------------------DPLRASDKVLTSCGPYMMKEEDAMVYRRPYLVSGSSGFA  216

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+S+AMKK LK YIE  R IL   +W+ +TTVCWG RDRWLS+DGVE+F      ++V
Sbjct  217  LNAISKAMKKDLKAYIESMRSILRSSSWKTKTTVCWGMRDRWLSYDGVEEFFGGLNQKIV  276

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIV  221
            ELPMAGHHVQED GEE+G +I  I+
Sbjct  277  ELPMAGHHVQEDRGEELGNIIKSIL  301



>ref|NP_001132271.2| uncharacterized protein LOC100193707 [Zea mays]
 gb|ACF81048.2| unknown [Zea mays]
Length=301

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 145/205 (71%), Gaps = 28/205 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+ +KYAS HQDK+N ++L+NPP+T KH NLPSTL+ FSNFLLGEIFSQ       
Sbjct  124  GYFAPVAVKYASEHQDKLNHLVLVNPPITDKHLNLPSTLASFSNFLLGEIFSQ-------  176

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY MKEE AMVYRRPYL SGSSGFA
Sbjct  177  ---------------------DPLRASDKVLTSCGPYMMKEEDAMVYRRPYLVSGSSGFA  215

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+S+AMKK LK YIE  R IL   +W+ +TTVCWG RDRWLS+DGVE+F      ++V
Sbjct  216  LNAISKAMKKDLKAYIESMRSILRSSSWKTKTTVCWGMRDRWLSYDGVEEFFGGLNQKIV  275

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIV  221
            ELPMAGHHVQED GEE+G +I  I+
Sbjct  276  ELPMAGHHVQEDRGEELGNIIKSIL  300



>ref|NP_567394.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
 gb|AAL08293.1| AT4g12830/T20K18_180 [Arabidopsis thaliana]
 gb|AAL90986.1| AT4g12830/T20K18_180 [Arabidopsis thaliana]
 gb|AEE83190.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
Length=393

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 149/209 (71%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FS  V+KYA    DK+ ++ILLNPPLT +HA LPSTLS+FSNFLLGEIFSQ       
Sbjct  211  GYFSAAVVKYARNRPDKIKNLILLNPPLTPEHAKLPSTLSVFSNFLLGEIFSQ-------  263

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY+MKE+ AMVYRRPYLTSGSSGFA
Sbjct  264  ---------------------DPLRASDKPLTSCGPYKMKEDDAMVYRRPYLTSGSSGFA  302

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR+MKK+LK Y EE R  L  KNW++  TVCWGQRDRWLS++GVE+FCK S   LV
Sbjct  303  LNAISRSMKKELKKYAEEMRTSLMDKNWKIPITVCWGQRDRWLSYEGVEEFCKSSGHNLV  362

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            ELP AGHHVQED GEE+G +I+ I+ K +
Sbjct  363  ELPNAGHHVQEDCGEELGGIISRIISKSA  391



>gb|AAM61500.1| hydrolase-like protein [Arabidopsis thaliana]
Length=393

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 149/209 (71%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FS  V+KYA    DK+ ++ILLNPPLT +HA LPSTLS+FSNFLLGEIFSQ       
Sbjct  211  GYFSAAVVKYARNRPDKIKNLILLNPPLTPEHAKLPSTLSVFSNFLLGEIFSQ-------  263

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY+MKE+ AMVYRRPYLTSGSSGFA
Sbjct  264  ---------------------DPLRASDKPLTSCGPYKMKEDDAMVYRRPYLTSGSSGFA  302

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR+MKK+LK Y EE R  L  KNW++  TVCWGQRDRWLS++GVE+FCK S   LV
Sbjct  303  LNAISRSMKKELKKYAEEMRTSLMDKNWKIPITVCWGQRDRWLSYEGVEEFCKSSGHNLV  362

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            ELP AGHHVQED GEE+G +I+ I+ K +
Sbjct  363  ELPNAGHHVQEDCGEELGGIISRIISKSA  391



>ref|XP_003564939.1| PREDICTED: epoxide hydrolase 3 [Brachypodium distachyon]
Length=378

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 144/205 (70%), Gaps = 28/205 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+PIV+KYAS HQDK+N +IL+NPP+T KHA LPSTL+ FSNFLLGE+FSQ       
Sbjct  200  GYFAPIVVKYASKHQDKLNHLILVNPPITDKHAKLPSTLACFSNFLLGEVFSQ-------  252

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL S GPY MKEE A VYRRPYL SGSSGFA
Sbjct  253  ---------------------DPLRASDKALTSSGPYMMKEEDATVYRRPYLVSGSSGFA  291

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA++RAM K LK YIE  R IL   +W  +TT+CWG RDRWLS+DGVEDFC   K + V
Sbjct  292  LNAMTRAMGKDLKVYIESMRSILVSDSWNTKTTICWGLRDRWLSYDGVEDFCDGVKHKFV  351

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIV  221
            ELPMAGHHVQED GEE+G +I  I+
Sbjct  352  ELPMAGHHVQEDRGEELGNIIKRIL  376



>gb|ACG27604.1| hydrolase-like protein [Zea mays]
Length=380

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 145/205 (71%), Gaps = 28/205 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+ +KYAS HQDK+N ++L+NPP+T KH NLPSTL+ FSNFLLGEIFSQ       
Sbjct  203  GYFAPVAVKYASEHQDKLNHLVLVNPPITDKHLNLPSTLASFSNFLLGEIFSQ-------  255

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY MKEE AMVYRRPYL SGSSGFA
Sbjct  256  ---------------------DPLRASDKVLTSCGPYMMKEEDAMVYRRPYLVSGSSGFA  294

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+S+AMKK LK YIE  R IL   +W+ +TTVCWG RDRWLS+DGVEDF      ++V
Sbjct  295  LNAISKAMKKDLKAYIESMRSILRSSSWKTKTTVCWGMRDRWLSYDGVEDFFGGLNQKIV  354

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIV  221
            ELPMAGHHVQED GEE+G +I  I+
Sbjct  355  ELPMAGHHVQEDRGEELGNIIKSIL  379



>ref|XP_010326244.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Solanum lycopersicum]
Length=389

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 144/198 (73%), Gaps = 28/198 (14%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            +  LT+KK      G FS I IKYAS HQ+K+N +ILLNPPLT+ HA LPS+LS+ SNFL
Sbjct  188  INALTDKKVTLVVQGYFSAIAIKYASNHQEKLNGLILLNPPLTINHAKLPSSLSVLSNFL  247

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            LGEIF Q                            DPLRASDK L SCGPYQ+KE+VAMV
Sbjct  248  LGEIFCQ----------------------------DPLRASDKTLQSCGPYQIKEDVAMV  279

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFD  338
            YRRPYLTSGS+GFALNA+S+AMKKQLKGY+E+ R IL   NW VQTTVCWGQRDRWLSFD
Sbjct  280  YRRPYLTSGSAGFALNAISKAMKKQLKGYVEDTRAILMDNNWSVQTTVCWGQRDRWLSFD  339

Query  337  GVEDFCKESKLRLVELPM  284
            GVEDFCKESK RLVELPM
Sbjct  340  GVEDFCKESKHRLVELPM  357



>gb|KCW48730.1| hypothetical protein EUGRSUZ_K02363 [Eucalyptus grandis]
Length=416

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 145/185 (78%), Gaps = 28/185 (15%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS HQ+K+N +ILLNPPLT KHANLPS+LSIFSNFLLGEIFSQ       
Sbjct  223  GYFSPVVVKYASKHQEKLNHLILLNPPLTSKHANLPSSLSIFSNFLLGEIFSQ-------  275

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY+MKE+ AMVYRRPYLTSGSSGFA
Sbjct  276  ---------------------DPLRASDKALTSCGPYKMKEDDAMVYRRPYLTSGSSGFA  314

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAM+K+LK Y+EE R IL  +NW+V+TT+CWGQRDRWLS+DGVE+FCK+SKL++V
Sbjct  315  LNAISRAMRKELKNYVEETRTILKDENWKVKTTICWGQRDRWLSYDGVEEFCKDSKLKMV  374

Query  295  ELPMA  281
            ELPM 
Sbjct  375  ELPMG  379



>emb|CDY60486.1| BnaC04g55880D [Brassica napus]
Length=393

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 149/209 (71%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FS   +K A    +K+ ++ILLNPPLT +HA LPSTLS+FSNFLLGEIFSQ       
Sbjct  211  GYFSTAAVKCARNRPEKIKNLILLNPPLTPEHAKLPSTLSVFSNFLLGEIFSQ-------  263

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY+MKE+ AMVYRRPYLTSGSSGFA
Sbjct  264  ---------------------DPLRASDKPLTSCGPYKMKEDDAMVYRRPYLTSGSSGFA  302

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK+LKGY EE R  L  K+W++ TTVCWGQRD+WLS+ GVE+FCK S   LV
Sbjct  303  LNAISRAMKKELKGYTEEMRTSLMDKDWKIPTTVCWGQRDKWLSYQGVEEFCKSSGHDLV  362

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            ELPMAGHHVQED GEE+G +I+ I+ K +
Sbjct  363  ELPMAGHHVQEDCGEEIGGLISRIISKSA  391



>ref|XP_006646615.1| PREDICTED: epoxide hydrolase 3-like [Oryza brachyantha]
Length=372

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 147/205 (72%), Gaps = 28/205 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+PIV+KYA+ HQDK+N +IL+NP +T KHA LPSTL+ FSNFLLGEIFSQ       
Sbjct  195  GYFAPIVVKYANEHQDKLNHLILVNPSITDKHAKLPSTLACFSNFLLGEIFSQ-------  247

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL+S GPY MKEE AMVYRRPYL SGSSGFA
Sbjct  248  ---------------------DPLRASDKALISSGPYMMKEEDAMVYRRPYLVSGSSGFA  286

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK LK YIE  R IL+  +W+ +TTVCWG RDRWL++DGVEDFC      ++
Sbjct  287  LNAISRAMKKDLKVYIESMRNILSNDSWKTKTTVCWGLRDRWLNYDGVEDFCGSLNHNIL  346

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIV  221
            ELPMAGHHVQED GEE+G ++  I+
Sbjct  347  ELPMAGHHVQEDRGEELGNLVKRIL  371



>ref|XP_006282646.1| hypothetical protein CARUB_v10004987mg [Capsella rubella]
 gb|EOA15544.1| hypothetical protein CARUB_v10004987mg [Capsella rubella]
Length=395

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 149/209 (71%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FS  V+KYA    DK+ ++ILLNPPLT +HA LPSTLS+FSNFLLGEIFSQ       
Sbjct  213  GYFSTAVVKYARNRPDKIKNLILLNPPLTPEHAKLPSTLSVFSNFLLGEIFSQ-------  265

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY+MKE+ AMVYRRPYLTSGSSGFA
Sbjct  266  ---------------------DPLRASDKPLTSCGPYKMKEDDAMVYRRPYLTSGSSGFA  304

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SR+MKK+LK Y EE R  L  K+W++  TVCWG+RDRWLS++GVE+FCK S   LV
Sbjct  305  LNAISRSMKKELKKYAEEMRTSLMDKSWKIPITVCWGKRDRWLSYEGVEEFCKSSGHNLV  364

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            ELP AGHHVQED GEE+G +I+ I+ K +
Sbjct  365  ELPNAGHHVQEDCGEELGGIISRIISKSA  393



>ref|XP_009420324.1| PREDICTED: uncharacterized protein LOC104000104 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=381

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 148/208 (71%), Gaps = 28/208 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS HQ+K+  ++L+NPPL   H  LPS+L++FSNFLLG I SQ       
Sbjct  201  GYFSPVVLKYASCHQEKLTDLVLINPPLMENHVKLPSSLALFSNFLLGLIISQ-------  253

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL ASD+AL SCGPY MKEE AMVYRRPYLTSGSSGFA
Sbjct  254  ---------------------DPLSASDRALTSCGPYMMKEEDAMVYRRPYLTSGSSGFA  292

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNALS AMKK+LK Y+E  R  L  + W+ +TT+CWG RDRWL +DGVE+FCK S  +LV
Sbjct  293  LNALSGAMKKELKAYVEAMRTTLASETWKTRTTICWGMRDRWLKYDGVEEFCKASNHKLV  352

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            EL MAGHHVQEDSGEE+G++I++I+ K+
Sbjct  353  ELAMAGHHVQEDSGEELGRIISQIISKR  380



>ref|XP_009420326.1| PREDICTED: uncharacterized protein LOC104000104 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=379

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 148/208 (71%), Gaps = 28/208 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS HQ+K+  ++L+NPPL   H  LPS+L++FSNFLLG I SQ       
Sbjct  199  GYFSPVVLKYASCHQEKLTDLVLINPPLMENHVKLPSSLALFSNFLLGLIISQ-------  251

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL ASD+AL SCGPY MKEE AMVYRRPYLTSGSSGFA
Sbjct  252  ---------------------DPLSASDRALTSCGPYMMKEEDAMVYRRPYLTSGSSGFA  290

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNALS AMKK+LK Y+E  R  L  + W+ +TT+CWG RDRWL +DGVE+FCK S  +LV
Sbjct  291  LNALSGAMKKELKAYVEAMRTTLASETWKTRTTICWGMRDRWLKYDGVEEFCKASNHKLV  350

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            EL MAGHHVQEDSGEE+G++I++I+ K+
Sbjct  351  ELAMAGHHVQEDSGEELGRIISQIISKR  378



>emb|CDM85669.1| unnamed protein product [Triticum aestivum]
Length=375

 Score =   253 bits (647),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 143/205 (70%), Gaps = 28/205 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+PIV+KYA  HQDK+N +IL+NPP+T KHA LPSTL+ FSNFLLGE+FSQ       
Sbjct  198  GYFAPIVVKYAKEHQDKLNHLILVNPPITDKHAKLPSTLACFSNFLLGEVFSQ-------  250

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL S GPY MKEE A VYRRPYL SG+SGFA
Sbjct  251  ---------------------DPLRASDKALTSSGPYMMKEEDATVYRRPYLVSGASGFA  289

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA++RAM+K LK YIE  R IL   +W  +TT+CWG RDRWL++DGVEDFC   K  +V
Sbjct  290  LNAITRAMEKDLKAYIESMRSILASDSWNTKTTICWGLRDRWLTYDGVEDFCDGLKHNVV  349

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIV  221
            +LPMAGHH QED GEE+G +I  I+
Sbjct  350  QLPMAGHHAQEDRGEELGNIIKRIL  374



>gb|EMT05833.1| hypothetical protein F775_06870 [Aegilops tauschii]
Length=441

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 143/205 (70%), Gaps = 28/205 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+PIV+KYA+ HQDK+N +IL+NPP+T KHA LPSTL+ FSNFLLGE+FSQ       
Sbjct  209  GYFAPIVVKYANEHQDKLNHLILVNPPITDKHAKLPSTLACFSNFLLGEVFSQ-------  261

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL S GPY MKEE A VYRRPYL SG+SGFA
Sbjct  262  ---------------------DPLRASDKALTSSGPYMMKEEDATVYRRPYLVSGASGFA  300

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA++RAM K LK YIE  R IL   +W  +TT+CWG RDRWL++DGVEDFC   K  +V
Sbjct  301  LNAITRAMGKDLKAYIESMRSILASDSWNTKTTICWGLRDRWLTYDGVEDFCDGLKHNVV  360

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIV  221
            +LPMAGHH QED GEE+G +I  I+
Sbjct  361  QLPMAGHHAQEDRGEELGNIIKRIL  385



>ref|XP_004971071.1| PREDICTED: uncharacterized protein LOC101762331 isoform X1 [Setaria 
italica]
Length=380

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 144/205 (70%), Gaps = 28/205 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+ +KYAS +QDK+N ++L+NPP+T KH +LPS L+ FSNFLLGEIFSQ       
Sbjct  203  GYFAPVAVKYASEYQDKLNHLVLVNPPITDKHVSLPSPLASFSNFLLGEIFSQ-------  255

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY MKEE AMVYRRPYL SGSSGFA
Sbjct  256  ---------------------DPLRASDKVLTSCGPYMMKEEDAMVYRRPYLVSGSSGFA  294

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+S+AMKK LK YIE  R IL   +W+ +TT+CWG RDRWLS+DGVE+F      ++V
Sbjct  295  LNAISKAMKKDLKAYIESMRSILGSDSWKTKTTICWGMRDRWLSYDGVEEFFGGLNQKIV  354

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIV  221
            ELPMAGHHVQED GEE+G +I  I+
Sbjct  355  ELPMAGHHVQEDRGEELGNIIKSIL  379



>gb|KDO43505.1| hypothetical protein CISIN_1g015903mg [Citrus sinensis]
Length=380

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 135/184 (73%), Gaps = 28/184 (15%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS H+DK+  +ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ       
Sbjct  215  GYFSPVVVKYASKHKDKLKDLILLNPPLTAKHANLPSTLSIFSNFLLGEIFSQ-------  267

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPYQMKE+ AMVYR PYL+SGSSGFA
Sbjct  268  ---------------------DPLRASDKALTSCGPYQMKEDDAMVYRSPYLSSGSSGFA  306

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A+S+ MKKQLK Y+EE R IL  K+W++ TTVCWGQRDRWL+ DGVEDFC +S   L+
Sbjct  307  LTAISKGMKKQLKQYVEEMRTILMDKSWKIPTTVCWGQRDRWLNNDGVEDFCNDSNHELI  366

Query  295  ELPM  284
            ELPM
Sbjct  367  ELPM  370



>ref|XP_004510184.1| PREDICTED: 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate 
hydrolase-like isoform X1 [Cicer arietinum]
Length=388

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 136/183 (74%), Gaps = 28/183 (15%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS HQ+K+N++ILLNPPLT +HANLP TLSIFSNFLLGEIFSQ       
Sbjct  202  GYFSPVVVKYASIHQEKINNLILLNPPLTAQHANLPPTLSIFSNFLLGEIFSQ-------  254

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY+MKEE AMVYRRPYL SGSSGFA
Sbjct  255  ---------------------DPLRASDKALTSCGPYKMKEEDAMVYRRPYLISGSSGFA  293

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA++R +KK LK Y+E+ + IL  K+  V+TT+CWGQRDRWLS+DGVEDFCK+S   L+
Sbjct  294  LNAITRTLKKDLKRYVEDMQTILKDKSCNVRTTICWGQRDRWLSYDGVEDFCKDSNHTLI  353

Query  295  ELP  287
            ++P
Sbjct  354  QVP  356



>ref|XP_004510183.1| PREDICTED: uncharacterized protein LOC101497246 [Cicer arietinum]
Length=174

 Score =   224 bits (570),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 132/188 (70%), Gaps = 28/188 (15%)
 Frame = -2

Query  775  VILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLV  596
            VI L   LT +HA LP+TL+IF+NFLLGEIFSQ                           
Sbjct  7    VIQLFIKLTTQHAKLPTTLAIFNNFLLGEIFSQ---------------------------  39

Query  595  KDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEAR  416
             DPLRASDKAL SCGPY+MKEE AMVYRRPYL SGSSGFALNA++R +KK LK Y+E+ +
Sbjct  40   -DPLRASDKALTSCGPYKMKEEDAMVYRRPYLISGSSGFALNAITRTLKKDLKRYVEDMQ  98

Query  415  GILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLVELPMAGHHVQEDSGEEVGQV  236
             IL  ++  V TT+CWGQRDRWLS+DGVEDFCK+S   L+++P AGHH QED GEE+GQ+
Sbjct  99   TILKDESCNVPTTICWGQRDRWLSYDGVEDFCKDSNHTLIQVPKAGHHAQEDCGEELGQL  158

Query  235  IAEIVGKK  212
            I  I+ KK
Sbjct  159  IYGIIRKK  166



>gb|EEC72048.1| hypothetical protein OsI_04954 [Oryza sativa Indica Group]
Length=347

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 124/205 (60%), Gaps = 59/205 (29%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+PIV+KYA+ HQDK+N +IL+NPP+T KHA LPSTL+ FSNFLLGEIFSQ       
Sbjct  201  GYFAPIVVKYANEHQDKLNHLILVNPPITDKHAKLPSTLACFSNFLLGEIFSQ-------  253

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL S GPY MKEE AMVYRRPYL SGSSGFA
Sbjct  254  ---------------------DPLRASDKALTSSGPYMMKEEDAMVYRRPYLVSGSSGFA  292

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK LK YIE  R IL+  +W+ +TT                           
Sbjct  293  LNAISRAMKKDLKVYIESMRNILSSDSWKTKTT---------------------------  325

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIV  221
                AGHHVQED GEE+G+++  I+
Sbjct  326  ----AGHHVQEDRGEELGKLVKRIL  346



>ref|XP_001751246.1| predicted protein [Physcomitrella patens]
 gb|EDQ83563.1| predicted protein, partial [Physcomitrella patens]
Length=347

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 131/209 (63%), Gaps = 28/209 (13%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F P  +++A  +++ V  +IL+NPP+T +H  LPS+LS FS FLLGE+F+Q       
Sbjct  165  GFFVPAALQFAKNNEETVKQLILINPPVTDQHTKLPSSLSAFSTFLLGEVFAQ-------  217

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL+ASDK L  CGPY + EE A+VYRRPYLTSG+SGFA
Sbjct  218  ---------------------DPLKASDKPLTDCGPYILDEEDAVVYRRPYLTSGASGFA  256

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A+SR +K +LK +++E + IL+  +W+   ++ WG +DRWL F+GVE F K     LV
Sbjct  257  LVAISRNLKIELKVFVKELKRILSPTSWKKPVSIVWGLKDRWLDFNGVEAFAKSINADLV  316

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            +LP  GHH QED GEEV + +  ++ ++S
Sbjct  317  QLPQVGHHAQEDFGEEVAKSLKALIRRRS  345



>gb|EMS59018.1| hypothetical protein TRIUR3_05973 [Triticum urartu]
Length=502

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 101/134 (75%), Gaps = 2/134 (1%)
 Frame = -2

Query  616  LRLILLVK--DPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQ  443
            L  ++LV   DPLRASDKAL S GPY MKEE A VYRRPYL SG+SGFALNA++RAM K 
Sbjct  368  LNHLILVNPPDPLRASDKALTSSGPYMMKEEDATVYRRPYLVSGASGFALNAITRAMGKD  427

Query  442  LKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLVELPMAGHHVQE  263
            LK YIE  R IL   +W  +TT+CWG RDRWL++DGVEDFC   K  +V+LPMAGHH QE
Sbjct  428  LKAYIESMRSILASDSWNTKTTICWGLRDRWLTYDGVEDFCDGLKHNVVQLPMAGHHAQE  487

Query  262  DSGEEVGQVIAEIV  221
            D GEE+G ++  I+
Sbjct  488  DRGEELGNILKRIL  501


 Score = 47.0 bits (110),  Expect(3) = 0.001, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPP  755
            G F+PIV+KYA  HQDK+N +IL+NPP
Sbjct  351  GYFAPIVVKYAKEHQDKLNHLILVNPP  377


 Score = 22.3 bits (46),  Expect(3) = 0.001, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -1

Query  911  LDEYVSSLESVIN  873
            LDEY S+LES+I+
Sbjct  326  LDEYTSALESLID  338


 Score = 20.4 bits (41),  Expect(3) = 0.001, Method: Compositional matrix adjust.
 Identities = 7/11 (64%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = -3

Query  858  KKVTLVVQGYF  826
             K+++VVQGYF
Sbjct  343  DKLSIVVQGYF  353



>ref|XP_010926738.1| PREDICTED: uncharacterized protein LOC105048934 isoform X3 [Elaeis 
guineensis]
Length=336

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 116/207 (56%), Gaps = 79/207 (38%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+V+KYAS HQ+K+  ++L+NPPL  KHA LPSTL++FSNFLLGEIFSQ       
Sbjct  207  GYFAPVVVKYASCHQEKLRDLVLINPPLMEKHAKLPSTLALFSNFLLGEIFSQ-------  259

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY MKEE AMVYRRPYLTSGSSGFA
Sbjct  260  ---------------------DPLRASDKALTSCGPYMMKEEDAMVYRRPYLTSGSSGFA  298

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            LNA+SRAMKK LK                                               
Sbjct  299  LNAISRAMKKDLK-----------------------------------------------  311

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGK  215
                AGHHVQEDSGEE+G++IAEI+ K
Sbjct  312  ----AGHHVQEDSGEELGRIIAEIIRK  334



>ref|XP_007049547.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOX93704.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
Length=367

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 98/133 (74%), Gaps = 28/133 (21%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS HQ+K+N +ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ       
Sbjct  220  GYFSPVVVKYASKHQEKLNDLILLNPPLTAKHANLPSTLSIFSNFLLGEIFSQ-------  272

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPY MKE+ AMVYRRPYLTSGSSGFA
Sbjct  273  ---------------------DPLRASDKALTSCGPYAMKEDDAMVYRRPYLTSGSSGFA  311

Query  475  LNALSRAMKKQLK  437
            LNA+SRAMKK+LK
Sbjct  312  LNAISRAMKKELK  324



>ref|XP_010645317.1| PREDICTED: uncharacterized protein LOC100244633 isoform X3 [Vitis 
vinifera]
Length=320

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 98/133 (74%), Gaps = 28/133 (21%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G FSP+V+KYAS+HQ+K+  +ILLNPPLT KHANLPS LSIFSNFLLGEIFSQ       
Sbjct  210  GYFSPVVVKYASSHQEKIKDLILLNPPLTAKHANLPSALSIFSNFLLGEIFSQ-------  262

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDKAL SCGPYQMKE+ AMVYRRPYLTSGSSGFA
Sbjct  263  ---------------------DPLRASDKALTSCGPYQMKEDDAMVYRRPYLTSGSSGFA  301

Query  475  LNALSRAMKKQLK  437
            LNA+SR+MKK+LK
Sbjct  302  LNAISRSMKKELK  314



>ref|XP_004971072.1| PREDICTED: uncharacterized protein LOC101762331 isoform X2 [Setaria 
italica]
Length=311

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 91/133 (68%), Gaps = 28/133 (21%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P+ +KYAS +QDK+N ++L+NPP+T KH +LPS L+ FSNFLLGEIFSQ       
Sbjct  203  GYFAPVAVKYASEYQDKLNHLVLVNPPITDKHVSLPSPLASFSNFLLGEIFSQ-------  255

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPLRASDK L SCGPY MKEE AMVYRRPYL SGSSGFA
Sbjct  256  ---------------------DPLRASDKVLTSCGPYMMKEEDAMVYRRPYLVSGSSGFA  294

Query  475  LNALSRAMKKQLK  437
            LNA+S+AMKK LK
Sbjct  295  LNAISKAMKKDLK  307



>ref|XP_002983979.1| hypothetical protein SELMODRAFT_119529, partial [Selaginella 
moellendorffii]
 gb|EFJ14991.1| hypothetical protein SELMODRAFT_119529, partial [Selaginella 
moellendorffii]
Length=334

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/205 (37%), Positives = 115/205 (56%), Gaps = 28/205 (14%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G F+P V++Y S +  K+  +I++NPP++ +H+ LPS L  F+N  LG+IFSQ       
Sbjct  155  GHFTPPVVEYISANPFKIVKLIMINPPVSKEHSTLPSNLLEFTNLFLGDIFSQ-------  207

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DP +ASD A+     Y + EE  MVYR+PYL+SGS+GFA
Sbjct  208  ---------------------DPFKASDGAMSRISYYAITEEDKMVYRKPYLSSGSAGFA  246

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L ++ ++ KK+LK  I   R +LT KNWE       G  DRWL++  ++ FC+E + +L+
Sbjct  247  LKSVIKSFKKELKDSILSVRSLLTSKNWETPIYFIGGLNDRWLNYKSLKTFCEEFQFKLI  306

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIV  221
             L   GH +QED   ++  +I  ++
Sbjct  307  TLDKGGHLLQEDIEIDLANIITGLL  331



>ref|XP_002960156.1| hypothetical protein SELMODRAFT_402209 [Selaginella moellendorffii]
 gb|EFJ37695.1| hypothetical protein SELMODRAFT_402209 [Selaginella moellendorffii]
Length=391

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/205 (37%), Positives = 114/205 (56%), Gaps = 28/205 (14%)
 Frame = -2

Query  844  CSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P  665
             + G F+P V++Y S +  K+  +I++NPP++ +H+ LPS L  F+N  LG+IFSQ    
Sbjct  198  VAQGHFTPPVVEYISANPFKIVKLIMINPPVSKEHSALPSNLLEFTNLFLGDIFSQ----  253

Query  664  *LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSS  485
                                    DP +ASD A+     Y + EE  MVYR+PYL+SGS+
Sbjct  254  ------------------------DPFKASDGAMSRISYYAITEEDKMVYRKPYLSSGSA  289

Query  484  GFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKL  305
            GFAL ++ ++ KK+LK  I   R +LT KNWE       G  DRWL++  ++ FC+E + 
Sbjct  290  GFALKSVIKSFKKELKDSILSVRSLLTSKNWETPIYFIGGLNDRWLNYKSLKTFCEEFQF  349

Query  304  RLVELPMAGHHVQEDSGEEVGQVIA  230
            +L+ L   GH +QED   ++  +I 
Sbjct  350  KLITLDKGGHLLQEDIEIDLANIIT  374



>ref|XP_011009616.1| PREDICTED: uncharacterized protein LOC105114684 isoform X3 [Populus 
euphratica]
Length=314

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  436  GYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLVELPMAGHHVQEDS  257
             Y+EE R  L  +NW+V+TTVCWGQRDRWLS+DGVEDF K SK +L+ELPMAGHHVQED 
Sbjct  239  AYVEETRKTLLDENWKVKTTVCWGQRDRWLSYDGVEDFLKNSKHKLIELPMAGHHVQEDC  298

Query  256  GEEVGQVIAEIVGKKS  209
            GEE+G +I+ I+G++S
Sbjct  299  GEELGGIISGILGRRS  314


 Score = 42.7 bits (99),  Expect(3) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVK  743
            G FSPI +KYAS  Q K+N +ILLNPP  V+
Sbjct  212  GYFSPIAVKYASNLQGKLNDLILLNPPAYVE  242


 Score = 24.6 bits (52),  Expect(3) = 3e-04, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = -3

Query  861  TKKVTLVVQGYF  826
            T+KV+LVVQGYF
Sbjct  203  TEKVSLVVQGYF  214


 Score = 23.9 bits (50),  Expect(3) = 3e-04, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -1

Query  911  LDEYVSSLESVIN  873
            +DE+V+SLES+IN
Sbjct  187  MDEFVASLESLIN  199



>ref|XP_010258609.1| PREDICTED: uncharacterized protein LOC104598304 isoform X2 [Nelumbo 
nucifera]
Length=315

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  433  YIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLVELPMAGHHVQEDSG  254
            Y +E R IL+ +NW+V+TTVCWGQRD WL +DGV+DFCK S  ++VEL MAGHHVQEDSG
Sbjct  242  YTKEMRMILSNENWKVRTTVCWGQRDNWLGYDGVDDFCKHSSHKVVELAMAGHHVQEDSG  301

Query  253  EEVGQVIAEIVGK  215
            EE+GQ+I  I+ K
Sbjct  302  EELGQLITSILSK  314


 Score = 49.7 bits (117),  Expect(3) = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVK  743
            G F+PIV+KYAS HQ+K+N +ILLNPP   K
Sbjct  214  GYFAPIVVKYASNHQEKLNDLILLNPPTYTK  244


 Score = 22.3 bits (46),  Expect(3) = 1e-04, Method: Compositional matrix adjust.
 Identities = 9/10 (90%), Positives = 10/10 (100%), Gaps = 0/10 (0%)
 Frame = -3

Query  855  KVTLVVQGYF  826
            KV+LVVQGYF
Sbjct  207  KVSLVVQGYF  216


 Score = 20.4 bits (41),  Expect(3) = 1e-04, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -1

Query  911  LDEYVSSLESVIN  873
            LDEYV +LES+I 
Sbjct  189  LDEYVLALESLIG  201



>ref|XP_007049548.1| Alpha/beta-Hydrolases superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX93705.1| Alpha/beta-Hydrolases superfamily protein isoform 3 [Theobroma 
cacao]
Length=350

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  439  KGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLVELPMAGHHVQED  260
            + Y+EE + IL  K+W+VQTTVCWGQRDRWLS+D VED C+ S  +L+ELPMAGHHVQED
Sbjct  272  QAYVEEMKVILMDKSWKVQTTVCWGQRDRWLSYDQVEDLCESSNHKLIELPMAGHHVQED  331

Query  259  SGEEVGQVIAEIVGKK  212
             GEE+G +I+ ++ ++
Sbjct  332  CGEEIGGIISGVISRR  347


 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQ  677
            G FSP+V+KYAS HQ+K+N +ILLNPPLT KHANLPSTLSIFSNFLLGEIFSQ
Sbjct  220  GYFSPVVVKYASKHQEKLNDLILLNPPLTAKHANLPSTLSIFSNFLLGEIFSQ  272



>emb|CAN81493.1| hypothetical protein VITISV_019990 [Vitis vinifera]
Length=315

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 76/137 (55%), Gaps = 52/137 (38%)
 Frame = -2

Query  610  LILL-VKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKG  434
            LILL   DPLRASDKAL SCGPYQMKE+ AMVYRRPYLTSGSSGFALNA+SR+MKK+LK 
Sbjct  230  LILLNPPDPLRASDKALTSCGPYQMKEDDAMVYRRPYLTSGSSGFALNAISRSMKKELK-  288

Query  433  YIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLVELPMAGHHVQEDSG  254
                                                              AGHHVQED G
Sbjct  289  --------------------------------------------------AGHHVQEDCG  298

Query  253  EEVGQVIAEIVGKKSRL  203
            EE+GQVI  ++ ++ R+
Sbjct  299  EELGQVINGVLSRRVRI  315



>gb|KCW48732.1| hypothetical protein EUGRSUZ_K02363 [Eucalyptus grandis]
Length=290

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQ  677
            G FSP+V+KYAS HQ+K+N +ILLNPPLT KHANLPS+LSIFSNFLLGEIFSQ
Sbjct  223  GYFSPVVVKYASKHQEKLNHLILLNPPLTSKHANLPSSLSIFSNFLLGEIFSQ  275



>ref|WP_031294003.1| hydrolase [Leptolyngbya sp. Heron Island J]
Length=283

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 91/201 (45%), Gaps = 37/201 (18%)
 Frame = -2

Query  808  YASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF*L  629
            YA+ H DK+  +I+LN PL  K ANLP  + +     +G++ +Q                
Sbjct  116  YAAQHPDKIEKLIILNTPLPPK-ANLPLPVKMMGWPFVGDMMTQ----------------  158

Query  628  FSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMK  449
                        DPL   D+ L   GPYQ+ +E   +YRRP+L S   G AL    RAMK
Sbjct  159  ------------DPLLV-DRTLEGGGPYQVSDEDLDIYRRPFLKSSDVGRALMWTIRAMK  205

Query  448  -KQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLRLVELPMAGH  275
              Q+   I  A+G     NW   T V WG  D WLS    + F +       VEL   GH
Sbjct  206  MPQITEQI--AQGF---ANWPRPTLVAWGISDPWLSAADAKTFAQGLDDGEYVELEEVGH  260

Query  274  HVQEDSGEEVGQVIAEIVGKK  212
            + QED  E+V + +   + K+
Sbjct  261  YAQEDWAEKVSEAVVPFLRKQ  281



>gb|ESA33321.1| hydrolase or acyltransferase of alpha beta superfamily [Leptolyngbya 
sp. Heron Island J]
Length=275

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 91/201 (45%), Gaps = 37/201 (18%)
 Frame = -2

Query  808  YASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF*L  629
            YA+ H DK+  +I+LN PL  K ANLP  + +     +G++ +Q                
Sbjct  108  YAAQHPDKIEKLIILNTPLPPK-ANLPLPVKMMGWPFVGDMMTQ----------------  150

Query  628  FSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMK  449
                        DPL   D+ L   GPYQ+ +E   +YRRP+L S   G AL    RAMK
Sbjct  151  ------------DPLLV-DRTLEGGGPYQVSDEDLDIYRRPFLKSSDVGRALMWTIRAMK  197

Query  448  -KQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLRLVELPMAGH  275
              Q+   I  A+G     NW   T V WG  D WLS    + F +       VEL   GH
Sbjct  198  MPQITEQI--AQGF---ANWPRPTLVAWGISDPWLSAADAKTFAQGLDDGEYVELEEVGH  252

Query  274  HVQEDSGEEVGQVIAEIVGKK  212
            + QED  E+V + +   + K+
Sbjct  253  YAQEDWAEKVSEAVVPFLRKQ  273



>ref|XP_010435351.1| PREDICTED: uncharacterized protein LOC104719184 [Camelina sativa]
Length=278

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG  671
            G FS  V+KYA T  DK+ ++ILLNPPLT +HA LPSTLS+FSNFLLGEIFSQVG
Sbjct  212  GYFSTAVVKYARTRPDKIKNLILLNPPLTPEHAKLPSTLSVFSNFLLGEIFSQVG  266



>ref|WP_006454320.1| hydrolase [Synechococcus sp. PCC 7335]
 gb|EDX84573.1| hydrolase, alpha/beta fold family, putative [Synechococcus sp. 
PCC 7335]
Length=285

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/225 (28%), Positives = 103/225 (46%), Gaps = 37/225 (16%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            L  L   + Y    G      + YA+ H DK+  +++LN PLT   A +P  +S     L
Sbjct  93   LDSLEIDRFYLVVQGFLGSAGLLYAAKHPDKIERLVILNTPLTTA-AKVPFKISQLGIPL  151

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            +G++ +Q                            DP+   D+ L   GPY + ++   V
Sbjct  152  VGDMLTQ----------------------------DPILV-DRTLEGAGPYVVDDKDLEV  182

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSF  341
            YR+P+L S  +G +L A  + +  QLK  + E   I  G  +W + T + WG  D+WL  
Sbjct  183  YRQPFLKSSDAGRSLLATVKQL--QLKRILPE---IDQGFADWSIPTLIAWGTADKWLPV  237

Query  340  DGVEDFCKE-SKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
               ++F K  + + + EL   GH+ QED  E+V +V+   + +K+
Sbjct  238  SLAKNFAKTLTDVEIAELEETGHYAQEDWSEKVSEVVVPFLRRKA  282



>ref|WP_036018473.1| hydrolase [Leptolyngbya sp. PCC 7375]
Length=283

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 91/201 (45%), Gaps = 37/201 (18%)
 Frame = -2

Query  808  YASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF*L  629
            YA+ + DK+  +I+LN PL  K A LP ++ +     +G++ +Q                
Sbjct  116  YAAQNPDKIERLIILNTPLPPK-AELPFSVKMMGWPFVGDMVTQ----------------  158

Query  628  FSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMK  449
                        DPL   D+ L   GPYQ+ ++   VYRRP+L S   G +L    RAMK
Sbjct  159  ------------DPLLV-DRTLEGGGPYQVSDDDLDVYRRPFLKSSDVGRSLMWTIRAMK  205

Query  448  -KQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKL-RLVELPMAGH  275
              Q+   I +        NW   T V WG  D WLS +  + F K  +    +E+   GH
Sbjct  206  MPQITEQISQGFA-----NWSRPTLVAWGISDPWLSAESAKAFAKGVEDGEYIEMTEVGH  260

Query  274  HVQEDSGEEVGQVIAEIVGKK  212
            + QED  E+V + +   + K+
Sbjct  261  YAQEDWAEKVSEAVVPFLRKQ  281



>gb|EKV00984.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Leptolyngbya sp. PCC 7375]
Length=275

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 91/201 (45%), Gaps = 37/201 (18%)
 Frame = -2

Query  808  YASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF*L  629
            YA+ + DK+  +I+LN PL  K A LP ++ +     +G++ +Q                
Sbjct  108  YAAQNPDKIERLIILNTPLPPK-AELPFSVKMMGWPFVGDMVTQ----------------  150

Query  628  FSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMK  449
                        DPL   D+ L   GPYQ+ ++   VYRRP+L S   G +L    RAMK
Sbjct  151  ------------DPLLV-DRTLEGGGPYQVSDDDLDVYRRPFLKSSDVGRSLMWTIRAMK  197

Query  448  -KQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKL-RLVELPMAGH  275
              Q+   I +        NW   T V WG  D WLS +  + F K  +    +E+   GH
Sbjct  198  MPQITEQISQGFA-----NWSRPTLVAWGISDPWLSAESAKAFAKGVEDGEYIEMTEVGH  252

Query  274  HVQEDSGEEVGQVIAEIVGKK  212
            + QED  E+V + +   + K+
Sbjct  253  YAQEDWAEKVSEAVVPFLRKQ  273



>emb|CAB41000.1| hydrolase-like protein [Arabidopsis thaliana]
 emb|CAB78325.1| hydrolase-like protein [Arabidopsis thaliana]
Length=319

 Score = 78.6 bits (192),  Expect(3) = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQ  677
            G FS  V+KYA    DK+ ++ILLNPPLT +HA LPSTLS+FSNFLLGEIFSQ
Sbjct  211  GYFSAAVVKYARNRPDKIKNLILLNPPLTPEHAKLPSTLSVFSNFLLGEIFSQ  263


 Score = 24.3 bits (51),  Expect(3) = 6e-14, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = -3

Query  861  TKKVTLVVQGYF  826
            T KV+LVVQGYF
Sbjct  202  TSKVSLVVQGYF  213


 Score = 22.3 bits (46),  Expect(3) = 6e-14, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -1

Query  911  LDEYVSSLESVIN  873
            +DE+VSSLES I+
Sbjct  186  MDEFVSSLESFID  198


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  433  YIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLVELP  287
            Y EE R  L  KNW++  TVCWGQRDRWLS++GVE+FCK S   LVELP
Sbjct  265  YAEEMRTSLMDKNWKIPITVCWGQRDRWLSYEGVEEFCKSSGHNLVELP  313



>ref|WP_015219733.1| alpha/beta fold family hydrolase [Cyanobacterium aponinum]
 gb|AFZ54008.1| alpha/beta hydrolase fold protein [Cyanobacterium aponinum PCC 
10605]
Length=281

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 98/210 (47%), Gaps = 37/210 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    I I+YA  + +K++ +++LN P+T + A LP  ++     LLG++ +Q       
Sbjct  106  GFLGTIGIQYALKYPEKIDHLVILNAPITTE-AKLPWQIAQCGFPLLGDMVTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     + + +    +YR+P +TS ++G  
Sbjct  158  ---------------------DPLIV-DRTLEKGSGFVISDNNLALYRKPIVTSSAAGRM  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCK-ESKLR  302
            L  + + +  QLK   +  + I TG K WE    + WG  D WL  D VE+  K  +KL+
Sbjct  196  LVTIVKNL--QLK---QTTKEIETGLKTWEKPCLIIWGNEDPWLEIDSVENLIKTNNKLK  250

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            L  LP A H+ QE   EE+  +I   +G +
Sbjct  251  LTPLPEAKHYPQEHFSEEISPLIINFLGSR  280



>ref|WP_036006436.1| hydrolase [Leptolyngbya sp. JSC-1]
Length=282

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 92/210 (44%), Gaps = 37/210 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H D +  + +LN P+T   A LP  +      L+GE+ +Q       
Sbjct  106  GFLGSVGLQYALRHPDSIERLAILNAPITTA-AKLPWKIKQLGLPLVGEMLTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L   G Y++++    VYRRP+L S ++G +
Sbjct  158  ---------------------DPLLV-DRTLEGGGGYRVEDADLDVYRRPFLKSSAAGRS  195

Query  475  LNALSRAMK-KQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCK-ESKLR  302
            L  + + +K  Q    IE         NW+  T V WG RD WL F   E F K   +  
Sbjct  196  LFTVVQKLKLAQATAEIEAGFA-----NWQQPTLVAWGMRDPWLPFSIAEAFSKIVPQAE  250

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            L +L   GH+ QED  E+V  V+   + ++
Sbjct  251  LAQLEEVGHYPQEDWHEKVNAVLLNFLRRQ  280



>ref|WP_042154997.1| hydrolase [Planktothrix agardhii]
 gb|KEI67780.1| hydrolase [Planktothrix agardhii NIVA-CYA 126/8]
Length=281

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 101/223 (45%), Gaps = 35/223 (16%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            L  L  +K Y    G    + ++YA  + +++  +I+LN P++     LP  L   +   
Sbjct  91   LKQLKIEKFYLVVQGFLGSMGLQYALRYPEQIEKLIILNTPISTS-VKLPWKLQQMALPF  149

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            +G++ +Q                            DPL   D+ L     Y ++++V  V
Sbjct  150  VGDMITQ----------------------------DPLLV-DRTLEGGSKYVIEDKVLEV  180

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFD  338
            YR P+L + ++G +L A+ + ++ +    IE   G    KNW   T + WG  D WL+F 
Sbjct  181  YRSPFLKASAAGRSLLAILKNLRLK-DAMIEIESGF---KNWHRPTQIIWGLIDPWLNFT  236

Query  337  GVEDFCKE-SKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
             VE F K  S + ++ L  AGH+ QE   +E+ Q +   + KK
Sbjct  237  DVETFAKGISDIEIITLEKAGHYPQEHWPQEISQALILFLRKK  279



>ref|WP_008185446.1| hydrolase [Moorea producens]
 gb|EGJ32080.1| putative hydrolase/acyltransferase, alpha/beta hydrolase superfamily 
[Moorea producens 3L]
Length=281

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 99/210 (47%), Gaps = 35/210 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  H D++  +++LN P++   A LPS +  +    +G++ +Q       
Sbjct  106  GFLASVGLQYALRHSDQIERLVILNTPVS-SAAKLPSKMQQWGWPFIGDMLTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D++L     Y+++++   +YR+P+L S   G +
Sbjct  158  ---------------------DPLLV-DRSLEGGSRYRIEDKYLDLYRKPFLKSSDPGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKL-RL  299
            L A  + ++   K   E   G    +NW+  T + WG +D WL  D  E F  + K   L
Sbjct  196  LVATIKNIQMN-KCMAEIESGF---RNWDKPTLIVWGLKDPWLPVDQAEQFANQLKNGEL  251

Query  298  VELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            V+L  AGH+ QE   +E+ +++   + +K+
Sbjct  252  VKLEEAGHYPQEHWSKEISEILVPFLRRKA  281



>ref|WP_026796846.1| hydrolase [Planktothrix prolifica]
Length=281

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 101/223 (45%), Gaps = 35/223 (16%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            L  L  +K Y    G    + ++YA  + +++  +I+LN P++     LP  L   +   
Sbjct  91   LKQLKIEKFYLVVQGFLGSMGLQYALRYPEQIEKLIILNTPISTS-VKLPWKLQQMALPF  149

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            +G++ +Q                            DPL   D+ L     Y ++++V  V
Sbjct  150  VGDMITQ----------------------------DPLLV-DRTLEVGSKYVIEDKVLEV  180

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFD  338
            YR P+L + ++G +L A+ + ++ +    IE   G    KNW   T + WG  D WL+F 
Sbjct  181  YRSPFLKASAAGRSLLAILKNLRLK-DAMIEIESGF---KNWHRPTQIIWGLIDPWLNFT  236

Query  337  GVEDFCKE-SKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
             VE F K  S + ++ L  AGH+ QE   +E+ Q +   + KK
Sbjct  237  DVETFAKGISDIEIITLEKAGHYPQEHWPQEISQALILFLRKK  279



>ref|WP_015228028.1| alpha/beta hydrolase [Dactylococcopsis salina]
 gb|AFZ49015.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Dactylococcopsis salina PCC 8305]
Length=282

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 93/208 (45%), Gaps = 47/208 (23%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    I ++YA  H +++  +++LN PL+   A LP  +  +S  L+GE+ +Q       
Sbjct  106  GFIGSIGLQYAFRHPEQIERLVILNTPLS-SAARLPWLMRQWSFPLMGEMLTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y + EE   VYR+P+L +  +G +
Sbjct  158  ---------------------DPLLV-DRTLEKGSGYVISEENLGVYRQPFLKNSQAGRS  195

Query  475  LNA------LSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE  314
            L A      L +AM++   G+          KNWE  T + WG  D WLS    E   KE
Sbjct  196  LVATIKNLNLPKAMQEIEAGW----------KNWEQPTQILWGMDDPWLSATVPEAIAKE  245

Query  313  SK-LRLVELPMAGHHVQEDSGEEVGQVI  233
             K +R V+L  A H+ QE   EE+  ++
Sbjct  246  KKNIRFVKLEEAKHYPQEHWSEEISPIM  273



>ref|WP_026795117.1| MULTISPECIES: hydrolase [Planktothrix]
Length=281

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 100/223 (45%), Gaps = 35/223 (16%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            L  L  +K Y    G    + ++YA  + +++  +I+LN P++     LP  L   +   
Sbjct  91   LKQLKIEKFYLVVQGFLGSMGLQYALRYPEQIEKLIILNTPISTS-VKLPWKLQQMALPF  149

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            +G++ +Q                            DPL   D+ L     Y ++++V  V
Sbjct  150  VGDMITQ----------------------------DPLLV-DRTLEGGSKYVIEDKVLEV  180

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFD  338
            YR P+L + ++G +L A  + ++ +    IE   G    KNW   T + WG  D WL+F 
Sbjct  181  YRSPFLKASAAGRSLLATLKNLRLK-DAMIEIESGF---KNWHRPTQIIWGLIDPWLNFT  236

Query  337  GVEDFCKE-SKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
             VE F K  S + ++ L  AGH+ QE   +E+ Q +   + KK
Sbjct  237  DVETFAKGISDIEIITLEKAGHYPQEHWPQEISQALILFLRKK  279



>ref|WP_036531370.1| hydrolase [Neosynechococcus sphagnicola]
 gb|KGF73582.1| hydrolase [Neosynechococcus sphagnicola sy1]
Length=282

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 87/198 (44%), Gaps = 35/198 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++Y   H D++  +++LN P+T   A LP  +      L+G++ +Q       
Sbjct  106  GFLGSVGLQYGLRHPDQIERLVILNTPIT-PTAKLPWKIKQLGLPLIGDMLTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L   GPYQ++     VYRRP+LTS S+G A
Sbjct  158  ---------------------DPLLV-DRTLEGGGPYQVQNAALDVYRRPFLTSSSAGRA  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLRL  299
            L A  R +  QL   + E     T  +W+  T + WG +D WL     +      +   +
Sbjct  196  LLATVRHL--QLATAMAEITAGFT--HWQQPTLLVWGLQDPWLPLSMAQQVASGLAGGEI  251

Query  298  VELPMAGHHVQEDSGEEV  245
            V L   GH+ QED  E+V
Sbjct  252  VTLDQVGHYPQEDWPEQV  269



>ref|WP_026788344.1| hydrolase [Planktothrix rubescens]
Length=281

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 100/223 (45%), Gaps = 35/223 (16%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            L  L  +K Y    G    + ++YA  + +++  +I+LN P++     LP  L   +   
Sbjct  91   LKQLKIEKFYLVVQGFLGSMGLQYALRYPEQIEKLIILNTPISTS-VKLPWKLQQMALPF  149

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            +G++ +Q                            DPL   D+ L     Y ++++V  V
Sbjct  150  VGDMITQ----------------------------DPLLV-DRTLEGGSKYVIEDKVLEV  180

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFD  338
            YR P+L + ++G +L A  + ++ +    IE   G    KNW   T + WG  D WL+F 
Sbjct  181  YRSPFLKASAAGRSLLATLKNLRLK-DAMIEIESGF---KNWHRPTQIIWGLIDPWLNFT  236

Query  337  GVEDFCKE-SKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
             VE F K  S + ++ L  AGH+ QE   +E+ Q +   + KK
Sbjct  237  DVETFAKGISDIEIITLEKAGHYPQEHWPQEISQALILFLRKK  279



>ref|WP_015187607.1| Haloalkane dehalogenase [Gloeocapsa sp. PCC 7428]
 gb|AFZ29731.1| Haloalkane dehalogenase [Gloeocapsa sp. PCC 7428]
Length=280

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 97/202 (48%), Gaps = 35/202 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  +  ++  + +LN P++  +A LP  L             Q+G P + 
Sbjct  105  GFLGSVGLQYALRNPQQIERLAILNAPIS-PNAKLPWRLK------------QLGLPFMG  151

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                             +L +DPL   D+ L +   YQ+ E+   +YR+P+LTS ++G +
Sbjct  152  D----------------MLTQDPLLV-DRTLETGSRYQISEQELNIYRKPFLTSSAAGRS  194

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESK-LRL  299
            L A  R +  QL+  + E    L  + W   T V WG +D WLS    ++  +  K + L
Sbjct  195  LLATVRNL--QLQQSLAEIDSGL--REWHQPTMVIWGIKDPWLSITDTQNAVESLKNVEL  250

Query  298  VELPMAGHHVQEDSGEEVGQVI  233
            V++P AGH+ QE   E+VG ++
Sbjct  251  VQIPEAGHYPQEHWSEKVGDLL  272



>gb|ELR99120.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Gloeocapsa sp. PCC 73106]
Length=280

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/210 (27%), Positives = 96/210 (46%), Gaps = 35/210 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + I+YA TH + ++ +I+LN PL VK A LP ++  ++  L GE+ +Q       
Sbjct  104  GFLASVGIQYALTHPEAIHRLIILNTPL-VKSAKLPWSMGQWTIPLAGEMLTQ-------  155

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     + + E     YR+P+L + ++G +
Sbjct  156  ---------------------DPLLI-DRTLEKGSGFVINEPDLAQYRQPFLRNSAAGRS  193

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCK-ESKLRL  299
            L   +R +  QL   + +    L    W   T + WG  D WL+ D +E+  +  + L  
Sbjct  194  LMTATRNL--QLTQSLNQIE--LGLATWTKPTLILWGMADPWLNSDSIENLAQSNANLEF  249

Query  298  VELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             +LP+A H+ QE   EE+   I   + ++S
Sbjct  250  RKLPLAKHYPQEHWFEEINPKIINFLRRQS  279



>ref|WP_034935658.1| hydrolase [Gloeocapsa sp. PCC 73106]
Length=278

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/210 (27%), Positives = 96/210 (46%), Gaps = 35/210 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + I+YA TH + ++ +I+LN PL VK A LP ++  ++  L GE+ +Q       
Sbjct  102  GFLASVGIQYALTHPEAIHRLIILNTPL-VKSAKLPWSMGQWTIPLAGEMLTQ-------  153

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     + + E     YR+P+L + ++G +
Sbjct  154  ---------------------DPLLI-DRTLEKGSGFVINEPDLAQYRQPFLRNSAAGRS  191

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCK-ESKLRL  299
            L   +R +  QL   + +    L    W   T + WG  D WL+ D +E+  +  + L  
Sbjct  192  LMTATRNL--QLTQSLNQIE--LGLATWTKPTLILWGMADPWLNSDSIENLAQSNANLEF  247

Query  298  VELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             +LP+A H+ QE   EE+   I   + ++S
Sbjct  248  RKLPLAKHYPQEHWFEEINPKIINFLRRQS  277



>ref|WP_027249864.1| hydrolase [Planktothrix agardhii]
Length=281

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 100/223 (45%), Gaps = 35/223 (16%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            L  L  +K Y    G    + ++YA  + +++  +I+LN P++     LP  L   +   
Sbjct  91   LKQLKIEKFYLVVQGFLGSMGLQYALRYPEQIEKLIILNTPISTS-VKLPWKLQQMALPF  149

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            +G++ +Q                            DPL   D+ L     Y ++++V  V
Sbjct  150  VGDMITQ----------------------------DPLLV-DRTLEGGSKYVIEDKVLEV  180

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFD  338
            YR P+L + ++G +L A  + ++ +    IE   G    KNW   T + WG  D WL+F 
Sbjct  181  YRSPFLKASAAGRSLLATLKNLRLK-DAMIEIESGF---KNWHRPTQIIWGLIDPWLNFT  236

Query  337  GVEDFCKE-SKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
             VE F K  S + ++ L  AGH+ QE   +E+ + +   + KK
Sbjct  237  DVETFAKGISDIEIITLEKAGHYPQEHWPQEISEALILFLRKK  279



>ref|WP_026079764.1| hydrolase [Spirulina subsalsa]
Length=279

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 91/197 (46%), Gaps = 34/197 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + +++A  ++D++  +++ N PL+   A LP  +  +   L+G++ +Q       
Sbjct  104  GFLGSVGLQFALRNRDRLERLMIFNTPLS-PSAKLPWKMQQWGIPLVGDMLTQ-------  155

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     +Q+ ++   +YRRP+L + S+G +
Sbjct  156  ---------------------DPLLI-DRTLEGGSGFQISDDDLDIYRRPFLQTSSTGRS  193

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  + ++   +   E A G+   K W   T + WG  D WL    VE F  +S +  V
Sbjct  194  LVATIKNLQLP-QATAEIAEGL---KTWTKPTQIIWGMLDPWLDSAMVEPFASQSNVEWV  249

Query  295  ELPMAGHHVQEDSGEEV  245
            +LP A H+ QE  GEE+
Sbjct  250  KLPEAKHYPQEHWGEEI  266



>ref|WP_017288262.1| hypothetical protein [Leptolyngbya boryana]
Length=277

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 96/210 (46%), Gaps = 42/210 (20%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + I+YA  H D+V  + + N P+  + A LP  L   S  L+G++ +Q       
Sbjct  106  GFLGSVGIQYALRHPDQVERLAIFNCPI-FQAAKLPWKLKQMSIPLVGDMMTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L   G Y++++    VYRRP+L +   G A
Sbjct  158  ---------------------DPLLV-DRTLEGGGGYRIEDADLDVYRRPWLKTSDVGRA  195

Query  475  LNALSRAMK-KQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLR  302
            L A+ + ++ KQ+   IE      TG K+W+    + WG RD WL+ +  +         
Sbjct  196  LFAILQNLQLKQVTAEIE------TGLKDWKKPLLIGWGARDPWLAIETAKSLYPT----  245

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            LVEL   GH+ QED  E+V +++   + +K
Sbjct  246  LVELDEVGHYPQEDWHEKVNEILVPFLRQK  275



>ref|WP_017324485.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=282

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 88/203 (43%), Gaps = 35/203 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    I ++Y + ++D+++ +++LN P     A LP  L      L+GE+ +Q       
Sbjct  106  GFVGSIGLQYLAQNRDRIDRLVILNAPF-FTAAKLPWKLQQLGLPLIGEMLTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L   G   + E    VYR PYL S  +G +
Sbjct  158  ---------------------DPL-CVDRTLEGGGGKIVSESDLEVYRNPYLRSSKAGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLRL  299
            L A  R +  QL+  + E   +L   NW   + V WG++D WL  +  E   +   K   
Sbjct  196  LLATVRNL--QLRDSMRETEAVLA--NWRQPSLVLWGEKDAWLPVELAERAARSLPKAEF  251

Query  298  VELPMAGHHVQEDSGEEVGQVIA  230
              +  AGH+ Q D  E VG+++A
Sbjct  252  KRIAGAGHYPQLDEPEAVGEIVA  274



>ref|WP_019494557.1| hydrolase [Calothrix sp. PCC 7103]
Length=283

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 92/201 (46%), Gaps = 37/201 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++ ++ +LN P++ + A +P  +      L GE+ +Q       
Sbjct  106  GFLGSVGLQYALRHPEQIANIAILNAPIS-QSAKVPWKIQQMGLPLAGEMMTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y++ ++   +YR+PYL S SSG A
Sbjct  158  ---------------------DPLLV-DRTLEGGARYRIDDQHLDIYRKPYLKSSSSGRA  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLR-  302
            L A  R +  QL   ++E   I TG K W+    V WG  D WLS D  E F K +  R 
Sbjct  196  LLATIRNL--QLDKAMQE---IETGFKEWKQPVLVQWGAIDPWLSVDMAETFAKATPDRE  250

Query  301  LVELPMAGHHVQEDSGEEVGQ  239
            LV+L   GH+ QE   E + Q
Sbjct  251  LVKLNNVGHYPQEHYHETILQ  271



>ref|WP_036617143.1| hydrolase [Oscillatoriales cyanobacterium JSC-12]
Length=273

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/210 (28%), Positives = 90/210 (43%), Gaps = 37/210 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++  + + N P+T   A LP  +      L+G++ +Q       
Sbjct  98   GFLGTVGLQYALRHPERIERLAIFNAPITTA-AKLPWKMQQLGIPLVGDMITQ-------  149

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L   G Y++++    VYRRP+L +  SG A
Sbjct  150  ---------------------DPLLV-DRTLEGGGGYRVEDADLDVYRRPFLQTSDSGRA  187

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L  L+     QLK    E   I TG + W+    V WG RD WL     E F +      
Sbjct  188  L--LATVQNLQLKQVTTE---IETGFREWQKPVLVAWGDRDPWLPIVMAESFAQSVPHAE  242

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
             V+L   GH+ QED  E+V  V+   + ++
Sbjct  243  FVKLEEVGHYPQEDWHEKVNDVLLSFLRRQ  272



>gb|EKQ68909.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Oscillatoriales cyanobacterium JSC-12]
Length=280

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/210 (28%), Positives = 90/210 (43%), Gaps = 37/210 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++  + + N P+T   A LP  +      L+G++ +Q       
Sbjct  105  GFLGTVGLQYALRHPERIERLAIFNAPITTA-AKLPWKMQQLGIPLVGDMITQ-------  156

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L   G Y++++    VYRRP+L +  SG A
Sbjct  157  ---------------------DPLLV-DRTLEGGGGYRVEDADLDVYRRPFLQTSDSGRA  194

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L  L+     QLK    E   I TG + W+    V WG RD WL     E F +      
Sbjct  195  L--LATVQNLQLKQVTTE---IETGFREWQKPVLVAWGDRDPWLPIVMAESFAQSVPHAE  249

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
             V+L   GH+ QED  E+V  V+   + ++
Sbjct  250  FVKLEEVGHYPQEDWHEKVNDVLLSFLRRQ  279



>ref|WP_006624498.1| MULTISPECIES: hydrolase [Arthrospira]
 gb|EDZ95839.1| alpha/beta hydrolase fold protein [Arthrospira maxima CS-328]
 emb|CCE17521.1| Alpha/beta hydrolase fold protein [Arthrospira sp. PCC 8005]
 gb|EKD07622.1| alpha/beta hydrolase fold protein [Arthrospira platensis C1]
 emb|CDM96440.1| Alpha/beta hydrolase fold protein [Arthrospira sp. PCC 8005]
Length=281

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/225 (28%), Positives = 102/225 (45%), Gaps = 37/225 (16%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            LT L   K Y    G    + ++YA  H +++  +++LN P++ + A LP  +   S   
Sbjct  91   LTTLKLTKFYLVVQGFLGSVGLQYALRHPEQIERLLVLNTPVSTE-AKLPWKIKQMSLPF  149

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            +G++ +Q                            DPL   D+ L     Y ++++   V
Sbjct  150  VGDMMTQ----------------------------DPLLV-DRTLEGGSGYVIEDKDLDV  180

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSF  341
            YRRP+L S S+G AL A  + +  QLK  +EE   I++G   W+  T + WG  D WL  
Sbjct  181  YRRPFLKSSSTGRALMATIKNL--QLKEAMEE---IVSGFPKWDHPTEIVWGTADPWLDL  235

Query  340  DGVEDFC-KESKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
               E    K     LV+L  AGH+ Q+   +E+ + +   + KK+
Sbjct  236  SMAESLVEKIPGAVLVKLDKAGHYPQDHWPQEIAESLLLFLRKKA  280



>ref|WP_012595411.1| MULTISPECIES: hydrolase [Cyanothece]
 gb|ACK66143.1| Haloalkane dehalogenase [Cyanothece sp. PCC 8801]
 gb|ACV01042.1| alpha/beta hydrolase fold protein [Cyanothece sp. PCC 8802]
Length=279

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 96/210 (46%), Gaps = 35/210 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + I+YA T+ DK++ +I+LN PL+     LP  +  ++   +G++ +Q       
Sbjct  104  GFLASVGIQYALTYPDKIDRLIILNTPLS-PDVKLPWLMQQWAIPFMGDMVTQ-------  155

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     + + +E   VYR+P+L S + G A
Sbjct  156  ---------------------DPLLV-DRTLEGGSGFVISDEDLAVYRQPFLKSSAVGRA  193

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFC-KESKLRL  299
            L A ++ +  QL   +   +   T   WE  T + WG  D WLS +  E    +   + L
Sbjct  194  LLATTKNL--QLAASMTAIQEGFT--TWEHPTLMIWGMADPWLSSESPEKLANRYGNVEL  249

Query  298  VELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            ++L  A H+ QE  G+EV + I   + +++
Sbjct  250  IQLGEAKHYPQEHWGQEVSEAIVNFLRRQA  279



>ref|WP_017300675.1| hypothetical protein [Nodosilinea nodulosa]
Length=284

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 84/204 (41%), Gaps = 45/204 (22%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + I+YA  + D+V+ ++++N P+    A LP  +      L G++ +Q       
Sbjct  108  GFLGSVGIQYALQNPDRVDRLVIINAPIG-PGAKLPWKIRQMGLPLAGDMITQ-------  159

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L   GPYQ+ +    VYRRP+L S   G A
Sbjct  160  ---------------------DPLLV-DRTLEGGGPYQVADADLDVYRRPFLKSSDVGRA  197

Query  475  LNALSRAMKKQLKGYIEEARGILTG--KNWEVQTTVCWGQRDRWLSFD----GVEDFCKE  314
            L    R M       I+E  G +      WE  T V WG  D WLS D     V+D    
Sbjct  198  LMTTVRRMA------IDEVSGAIAAALPAWEHPTLVLWGVSDPWLSVDLAKAAVQDLPNG  251

Query  313  SKLRLVELPMAGHHVQEDSGEEVG  242
                L E+   GH+ QED  E+V 
Sbjct  252  ELETLTEV---GHYAQEDWPEKVA  272



>ref|WP_006508165.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Xenococcus sp. PCC 7305]
 gb|ELS04730.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Xenococcus sp. PCC 7305]
Length=280

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 98/216 (45%), Gaps = 35/216 (16%)
 Frame = -2

Query  856  KGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQ  677
            K Y  + G    + I+YA  + DK+  +++LN PLT K   LP  +  +    +G++ +Q
Sbjct  97   KFYLVAQGYLGSVGIQYALRNSDKIERLVILNSPLT-KQDKLPWKMKQWGLPFVGDMMTQ  155

Query  676  VG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLT  497
                                        DPL+  D+ L S   + + E+   V+R+P+L 
Sbjct  156  ----------------------------DPLQV-DRTLESGSGFVVPEKDLSVHRKPFLE  186

Query  496  SGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCK  317
            S + G +L A+ + ++   K   E ++G++  K     T + WG+ D WL  D  E   K
Sbjct  187  SSAVGRSLMAIVKNLELD-KATTEISQGLVKLKT---PTLILWGEEDPWLDVDEAEAIAK  242

Query  316  -ESKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
              S + +V+L  A H+ QE   EE+   I +   +K
Sbjct  243  SNSSVDIVKLTEAKHYPQEHWPEEIAIAIFQFFRRK  278



>ref|WP_028091278.1| hydrolase [Dolichospermum circinale]
Length=283

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 89/198 (45%), Gaps = 35/198 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H DK+ ++ +LN P++     +P  +      L G+I +Q       
Sbjct  106  GFLGSVGLQYALRHADKIANIAILNTPISTS-VKIPWKIKQMGLPLAGDIITQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L S   Y+++++   VYR+P+L S +SG +
Sbjct  158  ---------------------DPLLV-DRTLESGSCYRIEDQDLDVYRKPFLKSSASGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLRL  299
            L A  R ++ + K  IE   G+   K W+    V WG  D WLS D  E+  K  +   +
Sbjct  196  LLATIRNLQLE-KAMIEIENGL---KEWQKPILVQWGTIDPWLSVDIAENLVKSVANGEI  251

Query  298  VELPMAGHHVQEDSGEEV  245
            ++L   GH+ QE   E +
Sbjct  252  IKLNNVGHYPQEHYHEVI  269



>ref|WP_015222249.1| alpha/beta fold family hydrolase [Cyanobacterium stanieri]
 gb|AFZ46931.1| alpha/beta hydrolase fold protein [Cyanobacterium stanieri PCC 
7202]
Length=277

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/207 (28%), Positives = 91/207 (44%), Gaps = 37/207 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + I I+YA  + DK++ +I+LN PL+   A LP             +  Q G P L 
Sbjct  106  GFLATIGIQYALENPDKIDKLIILNSPLSTT-AKLPW------------LIKQCGIPFLG  152

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                             ++ +DPL   D+ L     Y + +E    YR+P +TS  +G  
Sbjct  153  D----------------MVTQDPLFV-DRTLEKGAGYVISDENLAYYRKPIVTSSLAGRT  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            +  + + M+     + +  + I  G K WE    + WG  D WLS + VE   KE S L 
Sbjct  196  MVTIVKRMQ-----FFDTMKTIEAGLKAWEKPCLIIWGVDDPWLSIEPVEAMVKENSHLT  250

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIV  221
            L +L  A H+ QE   +E+  ++   +
Sbjct  251  LKKLAEAKHYPQEHFSKEISPILVNFL  277



>ref|WP_015150409.1| alpha/beta hydrolase [Oscillatoria acuminata]
 gb|AFY83785.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Oscillatoria acuminata PCC 6304]
Length=282

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 90/216 (42%), Gaps = 35/216 (16%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            LT L   + Y    G    + +++A  H DKV  + +LN P+T   + LP  +      L
Sbjct  92   LTTLEIDRCYLVVQGFLGSVGLQFALRHPDKVLRLAVLNAPVT-PDSQLPWKMQQLGLPL  150

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            +GE+ +Q                            DPL   D+ L +   Y + +    +
Sbjct  151  MGEMMTQ----------------------------DPLLV-DRTLEAGSKYTISDADLDI  181

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFD  338
            YRRP+L S ++G +L    R +K + +   E A G      W+  T + WG +D WL   
Sbjct  182  YRRPFLKSSAAGRSLMWTIRNLKLK-QAMAEIAEGF---PQWDKPTLIVWGVQDPWLPLT  237

Query  337  GVEDFCKE-SKLRLVELPMAGHHVQEDSGEEVGQVI  233
              E F    +    V L  AGH+ QE   EEV Q +
Sbjct  238  QGETFAGSINNAEWVTLAEAGHYPQEHWSEEVTQAL  273



>ref|WP_041233282.1| hydrolase [Cylindrospermum stagnale]
Length=283

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 91/207 (44%), Gaps = 37/207 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++ ++ +LN P+T   A LP  +      L GE+ +Q       
Sbjct  106  GYLGSVGLQYALRHPEQIANIAILNTPITTS-AKLPWKIQQLGLPLAGEVMTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y+++++   +YR+PYL S +SG  
Sbjct  158  ---------------------DPLLV-DRTLEGGTRYRIEDKDLDIYRKPYLKSSASGRG  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKES-KLR  302
            L A  R +  QL   + E   I TG K W+    + WG  D WLS D  E F K +    
Sbjct  196  LLATVRNL--QLFPAMTE---IETGFKQWQQPILIQWGMIDPWLSVDIAEKFAKNAPNAE  250

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIV  221
            L++L   GH+ QE   E + Q +   V
Sbjct  251  LIKLNNVGHYPQEHYHETILQDLLPFV  277



>gb|KIE12829.1| hydrolase [Tolypothrix bouteillei VB521301]
Length=281

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 90/207 (43%), Gaps = 37/207 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++ +V++LN P+T K A LP  +      L GE+ +Q       
Sbjct  106  GFLGSVGLQYALRHPEQIANVVILNAPVT-KQAKLPWKIQQMGLPLAGEMMTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y + E    VYR+PYL S +SG +
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYVIPERDLDVYRKPYLKSSASGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L A  R +  QL   + E   I TG   W+    + WG  D WLS D  ++F     +  
Sbjct  196  LLATIRNL--QLDKAMAE---IETGFPQWQQPVLLHWGTTDPWLSVDIAQNFVNTLPQGE  250

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIV  221
            L++L   GH+ QE   E + Q +   V
Sbjct  251  LIKLNGGGHYPQEHHSEPILQDLLPFV  277



>gb|AFZ27564.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Cylindrospermum stagnale PCC 7417]
Length=305

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 91/207 (44%), Gaps = 37/207 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++ ++ +LN P+T   A LP  +      L GE+ +Q       
Sbjct  128  GYLGSVGLQYALRHPEQIANIAILNTPITTS-AKLPWKIQQLGLPLAGEVMTQ-------  179

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y+++++   +YR+PYL S +SG  
Sbjct  180  ---------------------DPLLV-DRTLEGGTRYRIEDKDLDIYRKPYLKSSASGRG  217

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKES-KLR  302
            L A  R +  QL   + E   I TG K W+    + WG  D WLS D  E F K +    
Sbjct  218  LLATVRNL--QLFPAMTE---IETGFKQWQQPILIQWGMIDPWLSVDIAEKFAKNAPNAE  272

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIV  221
            L++L   GH+ QE   E + Q +   V
Sbjct  273  LIKLNNVGHYPQEHYHETILQDLLPFV  299



>ref|WP_041268297.1| hydrolase [Geitlerinema sp. PCC 7407]
Length=282

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 87/202 (43%), Gaps = 35/202 (17%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            I++A  H+D+V  + +LN P+    A LP  +      L G++F+Q              
Sbjct  113  IQFALRHRDRVQRLAILNAPIATA-AQLPWRIRQLGLPLAGDMFTQ--------------  157

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                          DPL   D+ L   G Y++ +E   VYRRP+L S  +G +L A  R 
Sbjct  158  --------------DPLLV-DRTLEGGGRYEVADEDLDVYRRPFLKSSDAGRSLLATVRN  202

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFC-KESKLRLVELPMAG  278
            +  QL     E    L    W     + WG++D WL     E    + S L LV L   G
Sbjct  203  L--QLPKVTAEIEAGLA--EWSQPGLLIWGRQDPWLPLAIAEAAVQRNSNLELVSLDEVG  258

Query  277  HHVQEDSGEEVGQVIAEIVGKK  212
            H+ QED  E+V + +   + ++
Sbjct  259  HYPQEDWHEKVTEALLPFLRRQ  280



>ref|XP_003580670.1| PREDICTED: uncharacterized hydrolase YNR064C [Brachypodium distachyon]
Length=392

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 85/192 (44%), Gaps = 34/192 (18%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            + +A  +  KV  + +LN PLTV  + +P   +     L GE   Q              
Sbjct  224  LTWALKNSSKVRKLAILNSPLTVS-SPVPGLFNQLRLPLFGEFTCQ--------------  268

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                     IL        +++ + +  PY +K E A VYR PYL+SG+ GFAL  L  A
Sbjct  269  -------NAIL--------AERFIEAGSPYVLKSEKADVYRLPYLSSGAPGFAL--LEAA  311

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESK--LRLVELPMA  281
             K + +  +       +  +WE    + WG+ D++L     E+F K +   ++L  +  A
Sbjct  312  RKAKFQDVLSRISAGFSSNSWEKPILLAWGESDKYLPLSIAEEFKKSNPAVVKLKTIEGA  371

Query  280  GHHVQEDSGEEV  245
            GH  QED  E+V
Sbjct  372  GHMPQEDWPEKV  383



>ref|WP_028084529.1| hydrolase [Dolichospermum circinale]
Length=283

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 89/198 (45%), Gaps = 35/198 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +K+ ++ +LN P++     +P  +      L G+I +Q       
Sbjct  106  GFLGSVGLQYALRHAEKIANIAILNTPISTS-VKIPWKIKQMGLPLAGDIITQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L S   Y+++++   VYR+P+L S +SG +
Sbjct  158  ---------------------DPLLV-DRTLESGSCYRIEDQDLDVYRKPFLKSSASGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLRL  299
            L    R ++ + KG IE   G+   K W+    V WG  D WLS D  E+  K  +   +
Sbjct  196  LLGTIRNLQLE-KGMIEIENGL---KEWQKPILVQWGMIDPWLSVDMAENLVKSVANGEI  251

Query  298  VELPMAGHHVQEDSGEEV  245
            ++L   GH+ QE   E +
Sbjct  252  IKLNNVGHYPQEHYHEVI  269



>gb|AFY65727.1| alpha/beta hydrolase fold protein [Geitlerinema sp. PCC 7407]
Length=311

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 87/202 (43%), Gaps = 35/202 (17%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            I++A  H+D+V  + +LN P+    A LP  +      L G++F+Q              
Sbjct  142  IQFALRHRDRVQRLAILNAPIATA-AQLPWRIRQLGLPLAGDMFTQ--------------  186

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                          DPL   D+ L   G Y++ +E   VYRRP+L S  +G +L A  R 
Sbjct  187  --------------DPLLV-DRTLEGGGRYEVADEDLDVYRRPFLKSSDAGRSLLATVRN  231

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFC-KESKLRLVELPMAG  278
            +  QL     E    L    W     + WG++D WL     E    + S L LV L   G
Sbjct  232  L--QLPKVTAEIEAGLA--EWSQPGLLIWGRQDPWLPLAIAEAAVQRNSNLELVSLDEVG  287

Query  277  HHVQEDSGEEVGQVIAEIVGKK  212
            H+ QED  E+V + +   + ++
Sbjct  288  HYPQEDWHEKVTEALLPFLRRQ  309



>ref|WP_040467239.1| hydrolase [Geminocystis herdmanii]
Length=275

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/200 (28%), Positives = 89/200 (45%), Gaps = 37/200 (19%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + I+YA  + DK++ +I+LN P+    A LP  ++     LLG++ +Q       
Sbjct  104  GFLATVGIQYALQYPDKIDKLIILNTPI-YSTAKLPWQIAQCGFPLLGDMVTQ-------  155

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     + + +     YR+P +TS  +G  
Sbjct  156  ---------------------DPLIV-DRTLEKGSGFVISDNNLAFYRKPIVTSSLAGRT  193

Query  475  LNALSRAMK-KQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESK-LR  302
            L  + + +  KQ+   IE     L  K WE    + WG+ D WL F+ VE   K +K L+
Sbjct  194  LVTVVKKLNLKQVITDIE-----LGLKQWEKPCLIIWGKDDPWLDFEPVETLVKSNKNLK  248

Query  301  LVELPMAGHHVQEDSGEEVG  242
            L+ L  A H+ QE   +E+ 
Sbjct  249  LITLEEAKHYPQEHFSKEIA  268



>ref|WP_040944832.1| hydrolase [Prochloron didemni]
Length=277

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 94/206 (46%), Gaps = 35/206 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + I+YA  + DK+ S+I+LN PL+     LP  +  +   L+G++ +Q       
Sbjct  104  GFLGSVGIQYALRNPDKIESLIILNTPLS-PSVKLPRIIQQWGWPLIGDMLAQ-------  155

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL + D+AL     + + +    +YR+P+L + +SG +
Sbjct  156  ---------------------DPL-SVDRALEKGSGFVISDRNLGIYRKPFLQTSASGRS  193

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCK-ESKLRL  299
            L A+ + +K  L   ++E    L+  NW   T + WG  D W+  +  E+  K    ++L
Sbjct  194  LIAIIKNLK--LPETMKEIESALS--NWTKPTLIVWGMEDPWIGSEDAENLAKLLDNVKL  249

Query  298  VELPMAGHHVQEDSGEEVGQVIAEIV  221
            V L    H+ QE   +E+ + I + +
Sbjct  250  VPLEKGKHYPQEHWSDEIREEIVKFL  275



>ref|WP_040936045.1| hydrolase [Prochloron didemni]
Length=277

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 94/206 (46%), Gaps = 35/206 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + I+YA  + DK+ S+I+LN PL+     LP  +  +   L+G++ +Q       
Sbjct  104  GFLGSVGIQYALRNPDKIESLIILNTPLS-PSVKLPRIIQQWGWPLIGDMLAQ-------  155

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL + D+AL     + + +    +YR+P+L + +SG +
Sbjct  156  ---------------------DPL-SIDRALEKGSGFVISDRNLGIYRKPFLQTSASGRS  193

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCK-ESKLRL  299
            L A+ + +K  L   ++E    L+  NW   T + WG  D W+  +  E+  K    ++L
Sbjct  194  LIAIIKNLK--LPETMKEIESALS--NWTKPTLIVWGMEDPWIGSEDAENLAKLLDNVKL  249

Query  298  VELPMAGHHVQEDSGEEVGQVIAEIV  221
            V L    H+ QE   +E+ + I + +
Sbjct  250  VPLEKGKHYPQEHWSDEIREEIVKFL  275



>ref|WP_040939392.1| hydrolase [Prochloron didemni]
Length=277

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 53/206 (26%), Positives = 94/206 (46%), Gaps = 35/206 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + I+YA  + DK+ S+I+LN PL+     LP  +  +   L+G+           
Sbjct  104  GFLGSVGIQYALRNPDKIESLIILNTPLS-PSVKLPRIIQQWGWPLVGD-----------  151

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                             LL +DPL + D+AL     + + +    +YR+P+L + +SG +
Sbjct  152  -----------------LLAQDPL-SIDRALEKGSGFVISDRNLGIYRKPFLQTSASGRS  193

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCK-ESKLRL  299
            L A+ + +K  L   ++E    L+  NW   T + WG  D W+  +  E+  K    ++L
Sbjct  194  LIAIIKNLK--LPETMKEIESALS--NWTKPTLIVWGMEDPWIGSEDAENLAKLLDNVKL  249

Query  298  VELPMAGHHVQEDSGEEVGQVIAEIV  221
            V L    H+ QE   +E+ + I + +
Sbjct  250  VPLEKGKHYPQEHWSDEIREEIVKFL  275



>gb|ERT04085.1| alpha/beta hydrolase fold family protein [Lyngbya aestuarii BL 
J]
Length=279

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 101/211 (48%), Gaps = 37/211 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  + DK++ +I+LN P++   A LP  +             Q+G P + 
Sbjct  103  GFLGSVGLQYALQNPDKIDRLIVLNTPVS-STAKLPWKIK------------QMGLPFVG  149

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                             ++V+DPL   D+ L     Y ++++   VYR P+L S +SG +
Sbjct  150  D----------------MMVQDPLLV-DRTLEGGSGYVIEDKDLDVYRSPFLKSSASGRS  192

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKESK-LR  302
            L A  + +K  LK  + E   I TG K WE  T + WG  D WL  +  E+F K  +   
Sbjct  193  LLATIKNLK--LKEAMAE---ISTGFKTWENPTQIIWGVADPWLGVEQAEEFAKLVRGSE  247

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            LV+L  AGH+ Q+   +E+ + +   + K++
Sbjct  248  LVKLEKAGHYPQDHWPKEISESLLLFLRKQA  278



>ref|WP_028947035.1| hydrolase [Synechocystis sp. PCC 6714]
 gb|AIE75641.1| Hydrolase, alpha/beta fold family protein [Synechocystis sp. 
PCC 6714]
Length=283

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 89/202 (44%), Gaps = 34/202 (17%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            I+YA  H D++  + +LN P+ V   +LP  +  ++  L+G++ +Q              
Sbjct  113  IEYALNHPDQIERLAILNTPV-VPPVSLPWPMRQWTIPLVGDMVTQ--------------  157

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                          DPL   D+ L     + + +E   +YR+P+L + ++G AL A   A
Sbjct  158  --------------DPL-IIDRTLEGGSGFVISDEKLNIYRKPWLKTSAAGRALMA---A  199

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCK-ESKLRLVELPMAG  278
             K           G    K W   T   WG  D+WLS + +E   +  + L LV+LP A 
Sbjct  200  TKNLPTTNALTKIGDRLQKEWRKPTCFIWGIADKWLSVEPIEHLVQGANHLELVKLPEAK  259

Query  277  HHVQEDSGEEVGQVIAEIVGKK  212
            H+ QE   +EVG+ +     K+
Sbjct  260  HYPQEHFPQEVGETLQTFFRKQ  281



>ref|WP_040484720.1| hydrolase [Lyngbya aestuarii]
Length=282

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 101/211 (48%), Gaps = 37/211 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  + DK++ +I+LN P++   A LP  +             Q+G P + 
Sbjct  106  GFLGSVGLQYALQNPDKIDRLIVLNTPVS-STAKLPWKIK------------QMGLPFVG  152

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                             ++V+DPL   D+ L     Y ++++   VYR P+L S +SG +
Sbjct  153  D----------------MMVQDPLLV-DRTLEGGSGYVIEDKDLDVYRSPFLKSSASGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKESK-LR  302
            L A  + +K  LK  + E   I TG K WE  T + WG  D WL  +  E+F K  +   
Sbjct  196  LLATIKNLK--LKEAMAE---ISTGFKTWENPTQIIWGVADPWLGVEQAEEFAKLVRGSE  250

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            LV+L  AGH+ Q+   +E+ + +   + K++
Sbjct  251  LVKLEKAGHYPQDHWPKEISESLLLFLRKQA  281



>ref|WP_038331165.1| hydrolase [filamentous cyanobacterium ESFC-1]
Length=283

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/213 (26%), Positives = 93/213 (44%), Gaps = 39/213 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  + DK+  +++LN PL    A LP  +  +   L+G++ +Q       
Sbjct  107  GFLGSMGLQYAIRNPDKIERLVILNTPLN-PTAKLPLKMKQWGWPLVGDMLTQ-------  158

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     +Q+ +    +YR+P+L + +SG +
Sbjct  159  ---------------------DPLLV-DRTLEGGSGFQIGDRNLDIYRKPFLQTSASGRS  196

Query  475  LNALSRAMK-KQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKL  305
            L A  + +   Q+   IE      TG K+W     + WG  D WL  D  E   K  S +
Sbjct  197  LLATVQKLNLPQITAEIE------TGLKDWTKPVQIFWGCADPWLDVDMAETLAKSRSNV  250

Query  304  RLVELPMAGHHVQEDSGEEVGQVIAEIVGKKSR  206
             + +LP A H+ QE   EE+G  +   + ++ R
Sbjct  251  DMTQLPEARHYPQEHWSEEIGPDLITFLRRQMR  283



>dbj|BAQ63671.1| hydrolase [Geminocystis sp. NIES-3709]
Length=277

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/199 (27%), Positives = 92/199 (46%), Gaps = 37/199 (19%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + I+YA  + DK++ +++LN P             IFS+  L    +Q G P L 
Sbjct  106  GFLATVGIQYALQYPDKIDKLVILNTP-------------IFSSEKLPWQMAQCGFPLLG  152

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                             ++ +DPL   D+ L     + + ++    YR+P +TS  +G  
Sbjct  153  D----------------MVTQDPLIV-DRTLEKGSGFVISDQNLAFYRKPIVTSSLAGRT  195

Query  475  LNALSRAMK-KQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L  + + +  KQ+   IE     +  K WE    + WG+ D WL F+ +E+  K+ +KL+
Sbjct  196  LVTIVKKLNIKQVTEEIE-----MGLKQWEKPCLIIWGKDDPWLKFEPLEELVKDNNKLK  250

Query  301  LVELPMAGHHVQEDSGEEV  245
            L+ L  A H+ QE   +E+
Sbjct  251  LIVLEEAKHYPQEHFSKEI  269



>emb|CAD23147.1| alpha/beta hydrolase [Oryza sativa]
Length=165

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 50/99 (51%), Gaps = 4/99 (4%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+SG+ GFAL  L  A K   +  +          +WE    + 
Sbjct  56   PYVLKSEKADVYRLPYLSSGAPGFAL--LEAARKANFRDVLSRISAGFASNSWEKPILLA  113

Query  370  WGQRDRWLSFDGVEDFCK--ESKLRLVELPMAGHHVQED  260
            WG  D++L     E+F K   + ++L  +  AGH  QED
Sbjct  114  WGISDKYLPLPIAEEFQKGNPAAIKLEPIEGAGHMPQED  152



>ref|WP_039713141.1| hydrolase [Scytonema millei]
 gb|KIF20789.1| hydrolase [Scytonema millei VB511283]
Length=281

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 89/210 (42%), Gaps = 35/210 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H D+V ++ +LN PLT   A LP  +  +   L G++ +Q       
Sbjct  106  GFLGSVGLQYALHHSDRVENIAILNTPLTTA-AKLPWQMQQWGLPLAGDMATQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     YQ+ E    V+R+P+L S  +G +
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYQISEADLDVFRKPFLKSSKAGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLRL  299
            L    R +K       E A G    ++W+    + WG  D WL  +  + F     +  +
Sbjct  196  LMTTVRNLKMS-PSMTEIADGF---QDWKKPLLIVWGVNDPWLPVEIAQKFASNLPQAEI  251

Query  298  VELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            V+L  AGH+ QE   E++ Q +   V + S
Sbjct  252  VKLEKAGHYPQEHFAEDILQDLLPFVRRAS  281



>dbj|BAJ92131.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=402

 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 85/192 (44%), Gaps = 34/192 (18%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            + +A  + +K+  + +LN PLTV  + +P         LLGE   Q              
Sbjct  234  LTWALKNSNKLLKIAILNSPLTVS-SPVPGVFKQLRFPLLGEFTCQ--------------  278

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                     IL        +++ + +  PY +K E A VYR PYL+SG+ GFAL  L  A
Sbjct  279  -------NAIL--------AERFIEAGSPYVLKSEKADVYRLPYLSSGAPGFAL--LETA  321

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE--SKLRLVELPMA  281
             K   +  +       +  +W+    + WG+ D++L     E+F K   S ++L  +  A
Sbjct  322  RKANFQDVLSRISAGFSSNSWDKPILLAWGESDKYLPLSIAEEFKKNNPSVVKLKPIEGA  381

Query  280  GHHVQEDSGEEV  245
            GH  QED  E+V
Sbjct  382  GHMPQEDWPEKV  393



>ref|WP_036400096.1| hydrolase [Microcystis aeruginosa]
Length=288

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 92/209 (44%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+ +   LP  +  +    LG++ +Q       
Sbjct  114  GFLASVGLQYALENPDKIERLIILNTPLS-RDVKLPWIMKQWGIPFLGDMATQ-------  165

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L +   + + +    ++R+PYL + ++G A
Sbjct  166  ---------------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAAGRA  203

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  204  LVATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMGDPWLSSVTVEKLATKSGVELI  259

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  260  SLAEAKHYPQEHWSKEINPQIINFLGRKT  288



>emb|CAO89455.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS48945.1| alpha/beta hydrolase fold family protein [Microcystis aeruginosa 
DIANCHI905]
Length=280

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 92/209 (44%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+ +   LP  +  +    LG++ +Q       
Sbjct  106  GFLASVGLQYALENPDKIERLIILNTPLS-RDVKLPWIMKQWGIPFLGDMATQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L +   + + +    ++R+PYL + ++G A
Sbjct  158  ---------------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAAGRA  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  196  LVATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMGDPWLSSVTVEKLATKSGVELI  251

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  252  SLAEAKHYPQEHWSKEINPQIINFLGRKT  280



>ref|WP_015083225.1| alpha/beta fold family hydrolase [Anabaena sp. 90]
 gb|AFW96670.1| alpha/beta hydrolase fold protein [Anabaena sp. 90]
Length=283

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 88/206 (43%), Gaps = 35/206 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +K+ ++ +LN P+T   A +P  +      L G+I +Q       
Sbjct  106  GFLGSVGLQYALRHPEKIANIAILNTPITTS-AKIPWKIKQMGLPLAGDIITQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y++++E   +YR+P+L S +SG +
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYRIEDEDLDIYRKPFLKSSASGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLRL  299
            L    R  + + K  IE   G    K W     V WG  D WLS D  E F K  +   +
Sbjct  196  LLTTIRNFQLE-KAMIEIENGF---KEWPQPILVQWGIIDPWLSVDMAETFVKSVANGEI  251

Query  298  VELPMAGHHVQEDSGEEVGQVIAEIV  221
            ++L   GH+ QE   E + Q +   V
Sbjct  252  IKLNNVGHYPQEHYHEVILQDLLPFV  277



>ref|WP_006103831.1| hydrolase [Coleofasciculus chthonoplastes]
 gb|EDX73029.1| hydrolase, alpha/beta fold family, putative [Coleofasciculus 
chthonoplastes PCC 7420]
Length=282

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/211 (27%), Positives = 92/211 (44%), Gaps = 35/211 (17%)
 Frame = -2

Query  868  LTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGE  689
            L  ++ Y    G    + ++YA  + D+V  + +LN P++   + LP  +      L+G+
Sbjct  95   LQIERFYLVVQGFLGSVGLQYALRYPDQVERLAILNTPVS-SASQLPWKIKQLGLPLVGD  153

Query  688  IFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRR  509
            + +Q                            DPL   D+ L     Y++ ++   VYRR
Sbjct  154  MLTQ----------------------------DPLLV-DRTLEGGSGYRVSDKDLDVYRR  184

Query  508  PYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVE  329
            P+L+S  +G +L  L      Q K  + E       +NW   T + WG +D WL    V+
Sbjct  185  PFLSSSDAGRSL--LMTVKNLQFKSSMAEIEAGF--RNWNQPTLILWGIKDPWLPLVQVQ  240

Query  328  DFCKESK-LRLVELPMAGHHVQEDSGEEVGQ  239
            +F K  K + LVEL  AGH+ Q+   E+V  
Sbjct  241  EFAKMIKNVELVELEEAGHYPQDHWSEKVSN  271



>ref|XP_009144839.1| PREDICTED: uncharacterized protein LOC103868501 [Brassica rapa]
 emb|CDY49911.1| BnaA05g14820D [Brassica napus]
Length=376

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 58/106 (55%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+SG  GFAL  L  A K      + +     +  +W+  T + 
Sbjct  267  PYVLKNEKADVYRLPYLSSGGPGFAL--LETAKKINFGDTLGQIANGFSSGSWDKPTLLA  324

Query  370  WGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            WG  D++LS    E+F K++    KLRL+E   AGH  QED  E+V
Sbjct  325  WGIADKYLSQSIAEEFEKQNPQNVKLRLIE--GAGHLPQEDWPEKV  368



>ref|WP_039896586.1| hydrolase [Lyngbya sp. PCC 8106]
Length=281

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/210 (26%), Positives = 100/210 (48%), Gaps = 35/210 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  + DK++ +I+LN P++   A +P  +             Q+G P + 
Sbjct  105  GFLGSVGLQYALKNPDKIDRLIVLNTPIS-STAKIPWKIK------------QMGLPFVG  151

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                             ++V+DPL   D+ L     Y ++++   VYR P+L S +SG +
Sbjct  152  D----------------MMVQDPLLV-DRTLEGGSGYVIEDKDLDVYRSPFLKSSASGRS  194

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESK-LRL  299
            L A  + +K + +  +E + G    K WE  T + WG  D WL  +  E+F K  +   L
Sbjct  195  LLATIKNLKLK-EAMVEVSTGF---KTWEHPTQIIWGVADPWLGVEQAEEFSKLVRGSEL  250

Query  298  VELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            V++  AGH+ Q+   +E+ + +   + K++
Sbjct  251  VKIEKAGHYPQDHWPKEISESLLLFLRKQA  280



>ref|WP_015182410.1| alpha/beta hydrolase [Microcoleus sp. PCC 7113]
 gb|AFZ18261.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Microcoleus sp. PCC 7113]
Length=282

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/203 (26%), Positives = 94/203 (46%), Gaps = 37/203 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + +++  + +LN PLT   A LP T+  +    +G++ +Q       
Sbjct  106  GFLASVGLQYALRYPEQIERIAILNTPLT-SDAKLPWTMQQWGFPFVGDMLTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y++ ++   +YR+P+L S   G +
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYRISDKDLDIYRKPFLKSSDPGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L A  + M  Q K  + E   I +G +NW+  T + WG +D WL  +  + F K    + 
Sbjct  196  LVATIKNM--QWKSSMAE---IESGFRNWKQPTLIVWGMKDPWLPVELAQQFAKGIQNVE  250

Query  301  LVELPMAGHHVQEDSGEEVGQVI  233
            LV+L  +GH+ Q+   E+V + +
Sbjct  251  LVQLEESGHYPQDHWSEKVSESL  273



>ref|NP_001054059.1| Os04g0644600 [Oryza sativa Japonica Group]
 emb|CAD41916.2| OSJNBa0033G05.17 [Oryza sativa Japonica Group]
 dbj|BAF15973.1| Os04g0644600 [Oryza sativa Japonica Group]
 gb|EAZ32187.1| hypothetical protein OsJ_16393 [Oryza sativa Japonica Group]
 dbj|BAG94379.1| unnamed protein product [Oryza sativa Japonica Group]
Length=392

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 82/192 (43%), Gaps = 34/192 (18%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            + +A  +  KV  V +LN PLTV  + +P   +     L GE   Q              
Sbjct  225  LTWALKNSSKVLKVAILNSPLTVS-SPVPGLFNQLRLPLFGEFTCQ--------------  269

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                     +L        +++ + +  PY +K E A VYR PYL+SG+ GFAL  L  A
Sbjct  270  -------NAVL--------AERFIEAGSPYVLKSEKADVYRLPYLSSGAPGFAL--LEAA  312

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCK--ESKLRLVELPMA  281
             K   +  +          +WE    + WG  D++L     E+F K   + ++L  +  A
Sbjct  313  RKANFRDVLSRISAGFASNSWEKPILLAWGISDKYLPLPIAEEFQKGNPAAIKLEPIEGA  372

Query  280  GHHVQEDSGEEV  245
            GH  QED  E+V
Sbjct  373  GHMPQEDWPEKV  384



>emb|CAJ86155.1| H0413E07.8 [Oryza sativa Indica Group]
 gb|EAY95781.1| hypothetical protein OsI_17656 [Oryza sativa Indica Group]
Length=392

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 82/192 (43%), Gaps = 34/192 (18%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            + +A  +  KV  V +LN PLTV  + +P   +     L GE   Q              
Sbjct  225  LTWALKNSSKVLKVAILNSPLTVS-SPVPGLFNQLRLPLFGEFTCQ--------------  269

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                     +L        +++ + +  PY +K E A VYR PYL+SG+ GFAL  L  A
Sbjct  270  -------NAVL--------AERFIEAGSPYVLKSEKADVYRLPYLSSGAPGFAL--LEAA  312

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCK--ESKLRLVELPMA  281
             K   +  +          +WE    + WG  D++L     E+F K   + ++L  +  A
Sbjct  313  RKANFRDVLSRISAGFASNSWEKPILLAWGISDKYLPLPIAEEFQKGNPAAIKLEPIEGA  372

Query  280  GHHVQEDSGEEV  245
            GH  QED  E+V
Sbjct  373  GHMPQEDWPEKV  384



>gb|EAW35736.1| Alpha/beta hydrolase fold protein [Lyngbya sp. PCC 8106]
Length=279

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/210 (26%), Positives = 100/210 (48%), Gaps = 35/210 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  + DK++ +I+LN P++   A +P  +             Q+G P + 
Sbjct  103  GFLGSVGLQYALKNPDKIDRLIVLNTPIS-STAKIPWKIK------------QMGLPFVG  149

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                             ++V+DPL   D+ L     Y ++++   VYR P+L S +SG +
Sbjct  150  D----------------MMVQDPLLV-DRTLEGGSGYVIEDKDLDVYRSPFLKSSASGRS  192

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESK-LRL  299
            L A  + +K + +  +E + G    K WE  T + WG  D WL  +  E+F K  +   L
Sbjct  193  LLATIKNLKLK-EAMVEVSTGF---KTWEHPTQIIWGVADPWLGVEQAEEFSKLVRGSEL  248

Query  298  VELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            V++  AGH+ Q+   +E+ + +   + K++
Sbjct  249  VKIEKAGHYPQDHWPKEISESLLLFLRKQA  278



>ref|WP_041803853.1| hydrolase [Microcystis aeruginosa]
Length=288

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+             S+  L  I  Q G P L 
Sbjct  114  GFLASVGLQYALENPDKIERLIILNTPLS-------------SDVKLPWIMKQWGLPFLG  160

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
               +Q                DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  161  DMATQ----------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  203

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  204  LLATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMADPWLSSVTVEKLATKSGVELI  259

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  260  PLAEAKHYPQEHWSKEISPQIINFLGRKT  288



>ref|NP_001031176.1| putative hydrolase [Arabidopsis thaliana]
 gb|AEE32817.1| putative hydrolase [Arabidopsis thaliana]
Length=288

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 57/106 (54%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+SG  GFAL  L  A K      + +     +  +W+  T + 
Sbjct  179  PYVLKNEKADVYRLPYLSSGGPGFAL--LETAKKINFGDTLSQIANGFSSGSWDKPTLLA  236

Query  370  WGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E+F K++    KLRL+E   AGH  QED  E+V
Sbjct  237  WGIADKYLPQSIAEEFEKQNPQNVKLRLIE--GAGHLPQEDWPEKV  280



>dbj|BAG01090.1| alpha/beta fold family hydrolase [Microcystis aeruginosa NIES-843]
Length=280

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+             S+  L  I  Q G P L 
Sbjct  106  GFLASVGLQYALENPDKIERLIILNTPLS-------------SDVKLPWIMKQWGLPFLG  152

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
               +Q                DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  153  DMATQ----------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  196  LLATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMADPWLSSVTVEKLATKSGVELI  251

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  252  PLAEAKHYPQEHWSKEISPQIINFLGRKT  280



>gb|EMT19510.1| hypothetical protein F775_09244 [Aegilops tauschii]
Length=446

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 89/206 (43%), Gaps = 36/206 (17%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            + +A  + +K+  V +LN PLTV  + +P         L+GE   Q              
Sbjct  231  LTWALKNSNKLLKVAILNSPLTVS-SPVPGVFKQLRFPLVGEFTCQ--------------  275

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                     IL        +++ + +  PY +K E A VYR PYL+SG+ GFAL  L  A
Sbjct  276  -------NAIL--------AERFIEAGSPYVLKSEKADVYRLPYLSSGAPGFAL--LEAA  318

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE--SKLRLVELPMA  281
             K   +  +       +  +W+    + WG+ D++L     E+F K   S ++L  +  A
Sbjct  319  RKANFQDVLSRISAGFSSNSWDKPILLAWGESDKYLPLSIAEEFKKNNPSVVKLKPIEGA  378

Query  280  GHHVQEDSGEEVGQVIAEIVGKKSRL  203
            GH  QED  +   Q + E V    R+
Sbjct  379  GHMPQEDCSD--AQYVNERVEDNLRV  402



>dbj|BAD44400.1| unknown protein [Arabidopsis thaliana]
Length=380

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 57/106 (54%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+SG  GFAL  L  A K      + +     +  +W+  T + 
Sbjct  271  PYVLKNEKADVYRLPYLSSGGPGFAL--LETAKKINFGDTLSQIANGFSSGSWDKPTLLA  328

Query  370  WGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E+F K++    KLRL+E   AGH  QED  E+V
Sbjct  329  WGIADKYLPQSIAEEFEKQNPQNVKLRLIE--GAGHLPQEDWPEKV  372



>emb|CCI17189.1| Similar to tr|Q8YX62|Q8YX62 [Microcystis aeruginosa PCC 9807]
Length=287

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+             S+  L  I  Q G P L 
Sbjct  113  GFLASVGLQYALENPDKIERLIVLNTPLS-------------SDVKLPWIMKQWGIPFLG  159

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
               +Q                DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  160  DMATQ----------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  202

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  203  LVATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMGDPWLSSVTVEKLATKSGVELI  258

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  259  SLAEAKHYPQEHWSKEINPQIINFLGRKT  287



>ref|NP_175660.2| putative hydrolase [Arabidopsis thaliana]
 gb|AAL38708.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51368.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43191.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44235.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32816.1| putative hydrolase [Arabidopsis thaliana]
Length=380

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 57/106 (54%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+SG  GFAL  L  A K      + +     +  +W+  T + 
Sbjct  271  PYVLKNEKADVYRLPYLSSGGPGFAL--LETAKKINFGDTLSQIANGFSSGSWDKPTLLA  328

Query  370  WGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E+F K++    KLRL+E   AGH  QED  E+V
Sbjct  329  WGIADKYLPQSIAEEFEKQNPQNVKLRLIE--GAGHLPQEDWPEKV  372



>emb|CCI03592.1| Similar to tr|Q8YX62|Q8YX62 [Microcystis aeruginosa PCC 9443]
Length=287

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+             S+  L  I  Q G P L 
Sbjct  113  GFLASVGLQYALENPDKIERLIVLNTPLS-------------SDVKLPWIMKQWGIPFLG  159

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
               +Q                DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  160  DMATQ----------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  202

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  203  LVATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMGDPWLSSVTVEKLATKSGVELI  258

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  259  SLAEAKHYPQEHWSKEINPQIINFLGRKT  287



>dbj|BAQ62762.1| hydrolase [Geminocystis sp. NIES-3708]
Length=281

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/211 (24%), Positives = 93/211 (44%), Gaps = 37/211 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + I I+YA  + +K++ +I+LN P++   A LP  ++      LG++ +Q       
Sbjct  106  GFLATIGIQYALQYPEKIDKLIILNTPIS-SSAKLPWQIAQCGVLFLGDMVTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     + + ++    YR+P +TS  +G  
Sbjct  158  ---------------------DPLIV-DRTLEKGSGFVISDQNLAFYRKPIVTSSLAGRT  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKES-KLR  302
            L  + + +  +     +  R I TG + W+    + WG+ D WL    VE+    + KL+
Sbjct  196  LVTVVKKLNLK-----QVTREIETGLQQWQKSCLIIWGKDDPWLEITPVEELVNSNKKLK  250

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            L+ +  A H+ QE   +E+  +I   +G  +
Sbjct  251  LITIEEAKHYPQEHFSKEISPMIVNFLGSNN  281



>ref|XP_006652910.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Oryza brachyantha]
Length=391

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 83/192 (43%), Gaps = 34/192 (18%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            + +A  +  KV  V +LN PLTV  + +P   +     L GE   Q              
Sbjct  224  LTWALKNSGKVLKVAILNSPLTVS-SPVPGLFNQLRFPLFGEFTCQ--------------  268

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                     +L        +++ + +  PY +K E A VYR PYL+SG+ GFAL  L  A
Sbjct  269  -------NAVL--------AERFIEAGSPYVLKSEKADVYRLPYLSSGAPGFAL--LEAA  311

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCK--ESKLRLVELPMA  281
             K   +  +       +  +WE    + WG  D++L     E+F K   + ++L  +  A
Sbjct  312  RKANFRDVLNRISSGFSSNSWEKPILLAWGISDKYLPLAIAEEFKKGNPAAIKLEAIEGA  371

Query  280  GHHVQEDSGEEV  245
            GH  QED  E+V
Sbjct  372  GHMPQEDWPEKV  383



>ref|WP_043996834.1| hydrolase [Microcystis aeruginosa]
Length=280

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+             S+  L  I  Q G P L 
Sbjct  106  GFLASVGLQYALENPDKIERLIVLNTPLS-------------SDVKLPWIMKQWGIPFLG  152

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
               +Q                DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  153  DMATQ----------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  196  LVATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMGDPWLSSVTVEKLATKSGVELI  251

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  252  SLAEAKHYPQEHWSKEINPQIINFLGRKT  280



>ref|WP_017745935.1| hydrolase [Scytonema hofmanni]
Length=286

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/207 (28%), Positives = 90/207 (43%), Gaps = 37/207 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++ ++++LN P++   A LP  +      L GE+ +Q       
Sbjct  106  GFLGSVGLQYALRHPEQIANIVILNTPVS-SQAKLPWKIQQIGLPLAGEMIAQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y + +    VYR+PYL S +SG +
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYVINDSDLDVYRKPYLKSSASGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L A  R +  QL   + E   I +G K W+    V WG  D WLS D  ++F     +  
Sbjct  196  LLATIRNL--QLNTAMAE---IESGFKQWQQPILVQWGTTDPWLSVDIAQNFVNTLPQGE  250

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIV  221
            L++L   GH+ QE   E + Q +   V
Sbjct  251  LIKLNGGGHYPQEHHSEPILQDLLPFV  277



>ref|WP_045361444.1| hydrolase [Microcystis aeruginosa]
 dbj|GAL95189.1| hydrolase, alpha/beta fold family protein, At1g52510/AT4G12830 
homolog [Microcystis aeruginosa NIES-44]
Length=288

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 91/209 (44%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+ +   LP  +  +    LG++ +Q       
Sbjct  114  GFLASVGLQYALENPDKIERLIILNTPLS-RDVKLPWIMKQWGIPFLGDMATQ-------  165

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  166  ---------------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  203

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  204  LLATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMADPWLSSVTVEKLATKSGVELI  259

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  260  PLAEAKHYPQEHWSKEISPRIINFLGRKT  288



>ref|WP_002795563.1| hydrolase [Microcystis aeruginosa]
 emb|CCI22943.1| Alpha/beta fold family hydrolase [Microcystis aeruginosa PCC 
9809]
Length=288

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+             S+  L  I  Q G P L 
Sbjct  114  GFLASVGLQYALENPDKIERLIVLNTPLS-------------SDVKLPWIMKQWGLPFLG  160

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
               +Q                DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  161  DMATQ----------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  203

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  204  LLATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMADPWLSSVTVEKLATKSGVELI  259

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  260  PLAEAKHYPQEHWSKEISPQIINFLGRKT  288



>ref|WP_004158711.1| hydrolase [Microcystis aeruginosa]
 emb|CCH93967.1| Alpha/beta fold family hydrolase [Microcystis aeruginosa PCC 
9432]
Length=288

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+             S+  L  I  Q G P L 
Sbjct  114  GFLASVGLQYALENPDKIERLIVLNTPLS-------------SDVKLPWIIKQWGLPFLG  160

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
               +Q                DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  161  DMATQ----------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  203

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  204  LLATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMADPWLSSVTVEKLATKSGVELI  259

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  260  PLAEAKHYPQEHWSKEISPRIINFLGRKT  288



>ref|WP_024971169.1| hydrolase [Microcystis aeruginosa]
Length=288

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+             S+  L  I  Q G P L 
Sbjct  114  GFLASVGLQYALENPDKIERLIVLNTPLS-------------SDVKLPWIMKQWGLPFLG  160

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
               +Q                DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  161  DMATQ----------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  203

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  204  LLATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMADPWLSSVTVEKLATKSGVELI  259

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  260  PLAEAKHYPQEHWSKEINPRIINFLGRKT  288



>ref|WP_043995722.1| hydrolase [Microcystis aeruginosa]
Length=280

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+             S+  L  I  Q G P L 
Sbjct  106  GFLASVGLQYALENPDKIERLIVLNTPLS-------------SDVKLPWIMKQWGIPFLG  152

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
               +Q                DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  153  DMATQ----------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  196  LVATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMGDPWLSSVTVEKLATKSGVELI  251

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  252  SLAEAKHYPQEHWSKEINPQIINFLGRKT  280



>gb|AAD55611.1|AC008016_21 Contains PF|00561 alpha/beta hydrolase fold [Arabidopsis thaliana]
Length=379

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 57/106 (54%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+SG  GFAL  L  A K      + +     +  +W+  T + 
Sbjct  270  PYVLKNEKADVYRLPYLSSGGPGFAL--LETAKKINFGDTLSQIANGFSSGSWDKPTLLA  327

Query  370  WGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E+F K++    KLRL+E   AGH  QED  E+V
Sbjct  328  WGIADKYLPQSIAEEFEKQNPQNVKLRLIE--GAGHLPQEDWPEKV  371



>ref|WP_008202806.1| hydrolase [Microcystis sp. T1-4]
 emb|CCI32930.1| Alpha/beta fold family hydrolase [Microcystis sp. T1-4]
Length=288

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+             S+  L  I  Q G P L 
Sbjct  114  GFLASVGLQYALENPDKIERLIVLNTPLS-------------SDVKLPWIMKQWGLPFLG  160

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
               +Q                DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  161  DMATQ----------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  203

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  204  LLATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMADPWLSSVTVEKLATKSGVELI  259

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  260  PLSEAKHYPQEHWSKEISPRIINFLGRKT  288



>ref|WP_002776195.1| hydrolase [Microcystis aeruginosa]
 emb|CCI06611.1| Alpha/beta fold family hydrolase [Microcystis aeruginosa PCC 
7941]
Length=288

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+             S+  L  I  Q G P L 
Sbjct  114  GFLASVGLQYALENPDKIERLIVLNTPLS-------------SDVKLPWIMKQWGLPFLG  160

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
               +Q                DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  161  DMATQ----------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  203

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  204  LLATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMADPWLSSVTVEKLATKSGVELI  259

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  260  PLAEAKHYPQEHWSKEISPRIINFLGRKT  288



>gb|ACB50128.1| putative hydrolase [Cyanothece sp. ATCC 51142]
Length=285

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 88/202 (44%), Gaps = 39/202 (19%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA TH D +  +I+LN PL+     LP  +  +S   +G++ +Q       
Sbjct  109  GFLASVALQYAFTHADAIERLIILNTPLS-PDVKLPWLMQQWSIPFMGDMVTQ-------  160

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     + ++++   ++R+PYL S + G A
Sbjct  161  ---------------------DPLLV-DRTLEKGSGFVIEDKDLDIFRQPYLKSSAVGRA  198

Query  475  LNALSRAMK--KQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDF-CKESKL  305
            L   ++ +K  + LK    E         W V T + WG  D WLS D  E      S +
Sbjct  199  LLTTTKNLKLSQTLKDIETEF------SRWTVPTLILWGMADPWLSADIPEKLAANSSNV  252

Query  304  RLVELPMAGHHVQEDSGEEVGQ  239
             +V+L  A H+ QE   +EV +
Sbjct  253  EMVKLEEAKHYPQEHWPKEVSE  274



>gb|ELP55844.1| alpha/beta hydrolase fold family protein [Microcystis aeruginosa 
TAIHU98]
Length=280

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+             S+  L  I  Q G P L 
Sbjct  106  GFLASVGLQYALENPDKIECLIVLNTPLS-------------SDVKLPWIMKQWGLPFLG  152

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
               +Q                DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  153  DMATQ----------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  196  LLATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMADPWLSSVTVEKLATKSGVELI  251

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  252  PLSEAKHYPQEHWSKEISPQIINFLGRKT  280



>ref|WP_009546017.1| MULTISPECIES: hydrolase [Cyanothece]
Length=281

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 88/202 (44%), Gaps = 39/202 (19%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA TH D +  +I+LN PL+     LP  +  +S   +G++ +Q       
Sbjct  105  GFLASVALQYAFTHADAIERLIILNTPLS-PDVKLPWLMQQWSIPFMGDMVTQ-------  156

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     + ++++   ++R+PYL S + G A
Sbjct  157  ---------------------DPLLV-DRTLEKGSGFVIEDKDLDIFRQPYLKSSAVGRA  194

Query  475  LNALSRAMK--KQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDF-CKESKL  305
            L   ++ +K  + LK    E         W V T + WG  D WLS D  E      S +
Sbjct  195  LLTTTKNLKLSQTLKDIETEF------SRWTVPTLILWGMADPWLSADIPEKLAANSSNV  248

Query  304  RLVELPMAGHHVQEDSGEEVGQ  239
             +V+L  A H+ QE   +EV +
Sbjct  249  EMVKLEEAKHYPQEHWPKEVSE  270



>ref|WP_002791375.1| hydrolase [Microcystis aeruginosa]
 emb|CCI29356.1| Alpha/beta fold family hydrolase [Microcystis aeruginosa PCC 
9808]
 emb|CCI37203.1| Alpha/beta fold family hydrolase [Microcystis aeruginosa PCC 
9701]
Length=288

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+             S+  L  I  Q G P L 
Sbjct  114  GFLASVGLQYALENPDKIERLIVLNTPLS-------------SDVKLPWIMKQWGIPFLG  160

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
               +Q                DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  161  DMATQ----------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  203

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  204  LLATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMADPWLSSVTVEKLATKSGVELI  259

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  260  PLAEAKHYPQEHWSKEISPQIINFLGRKT  288



>ref|WP_042790377.1| hydrolase [Microcystis aeruginosa]
Length=288

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+             S+  L  I  Q G P L 
Sbjct  114  GFLASVGLQYALENPDKIECLIVLNTPLS-------------SDVKLPWIMKQWGLPFLG  160

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
               +Q                DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  161  DMATQ----------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  203

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  204  LLATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMADPWLSSVTVEKLATKSGVELI  259

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  260  PLSEAKHYPQEHWSKEISPQIINFLGRKT  288



>ref|WP_015122603.1| alpha/beta hydrolase [Rivularia sp. PCC 7116]
 gb|AFY59054.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Rivularia sp. PCC 7116]
Length=280

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/207 (28%), Positives = 94/207 (45%), Gaps = 37/207 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  + DK+ S+I+LN P++   A LP  +      L GE+ +Q       
Sbjct  106  GFLGSVGLQYALRNPDKIASLIILNTPIS-STAKLPWKIQQMGLPLAGEMMTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y +K++   +YR+P+L + ++G +
Sbjct  158  ---------------------DPLLV-DRTLEGGCRYVIKDKDLDIYRKPFLKASATGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKESK-LR  302
            L A  R +  QLK  +EE   I +G K W+    V WG+ D WL+ +  E F   +   +
Sbjct  196  LLATIRNL--QLKAAMEE---IESGFKEWQKPILVQWGKTDPWLNVEMAEKFVGSAPDAQ  250

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIV  221
            +V +   GH+ QE   E + Q +   V
Sbjct  251  IVRINDVGHYPQEHHHEAILQDMKPFV  277



>ref|WP_002782623.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI12379.1| Similar to tr|Q8YX62|Q8YX62 [Microcystis aeruginosa PCC 9806]
Length=288

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 90/209 (43%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+             S+  L  I  Q G P L 
Sbjct  114  GFLASVGLQYALENPDKIERLIVLNTPLS-------------SDVKLPWIMKQWGLPFLG  160

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
               +Q                DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  161  DMATQ----------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  203

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  204  LLATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMGDPWLSSVTVEKLATKSGVELI  259

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  260  PLAEAKHYPQEHWSKEINPQIINFLGRKT  288



>ref|WP_016516984.1| Haloalkane dehalogenase [Microcystis aeruginosa]
 gb|EPF17468.1| Haloalkane dehalogenase [Microcystis aeruginosa SPC777]
Length=288

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 91/209 (44%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+ +   LP  +  +    LG++ +Q       
Sbjct  114  GFLASVGLQYALENPDKIERLIVLNTPLS-RDVKLPWIMKQWGIPFLGDMATQ-------  165

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  166  ---------------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  203

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  204  LLATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMADPWLSSVTVEKLATKSGVELI  259

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  260  PLAEAKHYPQEHWSKEISPQIINFLGRKT  288



>ref|XP_003528305.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Glycine max]
Length=374

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 53/106 (50%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL S   GFAL  L  A K   KG   E     T + W+    + 
Sbjct  265  PYVLKNEKADVYRLPYLASSGPGFAL--LEAARKANFKGTFSEISAGFTTERWDKPILLA  322

Query  370  WGQRDRWLSFDGVEDFCK----ESKLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E F K    + +L+L+E   AGH  QED  E+V
Sbjct  323  WGLSDKYLPQSVAEQFQKGNPAQIQLKLIE--GAGHMPQEDWPEKV  366



>gb|KFK35798.1| hypothetical protein AALP_AA4G037800 [Arabis alpina]
Length=290

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 83/194 (43%), Gaps = 38/194 (20%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            + +A  +  K+  + +LN PLTV  + +P         L GE   Q              
Sbjct  123  LTWALKNPSKIEKIAILNSPLTVS-SPVPGLFKQLRIPLFGEFTCQ--------------  167

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                     IL        +++ +    PY +K E A VYR PYL+SG  GFAL  L  A
Sbjct  168  -------NAIL--------AERFIEGGSPYVLKNEKADVYRLPYLSSGGPGFAL--LETA  210

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKES----KLRLVELP  287
             K      + E     +  +W+    + WG  D++L     E+F K++    KLRL+E  
Sbjct  211  KKINFGNTLSEIASGFSSGSWDKPALLAWGIGDKYLPQSIAEEFEKQNPQNVKLRLIE--  268

Query  286  MAGHHVQEDSGEEV  245
             AGH  QED  E+V
Sbjct  269  GAGHLPQEDWPEKV  282



>gb|KHN01316.1| Haloalkane dehalogenase [Glycine soja]
Length=290

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 53/106 (50%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL S   GFAL  L  A K   KG   E     T + W+    + 
Sbjct  181  PYVLKNEKADVYRLPYLASSGPGFAL--LEAARKANFKGTFSEISAGFTTERWDKPMLLA  238

Query  370  WGQRDRWLSFDGVEDFCK----ESKLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E F K    + +L+L+E   AGH  QED  E+V
Sbjct  239  WGLSDKYLPQSVAEQFQKGNPAQIQLKLIE--GAGHMPQEDWPEKV  282



>ref|XP_003604362.1| hypothetical protein MTR_4g009990 [Medicago truncatula]
Length=128

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 51/105 (49%), Gaps = 8/105 (8%)
 Frame = -2

Query  547  YQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCW  368
            Y +K E A VYR PYL SG  GFAL  L  A K    G   E         W+    + W
Sbjct  20   YVLKNEKADVYRLPYLASGGPGFAL--LEAARKANFNGTFSEIAEGFAANRWDKPVLLAW  77

Query  367  GQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            G  D++L     E+F K +    KL+L+E   AGH  QED  E+V
Sbjct  78   GLSDKYLPQSIAEEFQKGNTQNIKLKLIE--GAGHMPQEDWPEKV  120



>emb|CDN17134.1| Hydrolase, alpha/beta fold family protein, At1g52510/AT4G12830 
homolog [Richelia intracellularis]
Length=224

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 91/211 (43%), Gaps = 37/211 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +K+ S+ +LN P++   A LP  +      L G++ +Q       
Sbjct  49   GFLGSVGLQYALRHPEKIASIAILNAPIS-PTAKLPWKIKQMGLPLAGDMITQ-------  100

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y + EE   VYR+P+L + +SG +
Sbjct  101  ---------------------DPLLV-DRTLEGGSCYVISEEHLGVYRKPFLKTSASGRS  138

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L A  R +  QL   +EE   I +G K+WE    V WG  D WL     ++F K      
Sbjct  139  LLATIRNL--QLSKSMEE---IDSGFKDWEKPILVQWGAIDPWLDVSMADNFVKSLPNGE  193

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            L+ L   GH+ QE   E + + +   V + S
Sbjct  194  LIRLNNVGHYPQEHYHETILEDLLPFVRRSS  224



>ref|XP_010515363.1| PREDICTED: uncharacterized protein LOC104791229 [Camelina sativa]
Length=160

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 55/106 (52%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+SG  GFAL  L  A K      + +     +  +W     + 
Sbjct  51   PYVLKNEKADVYRLPYLSSGGPGFAL--LETAKKINFGDTLSQIANGFSSGSWNKPILLA  108

Query  370  WGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E+F K++    KLRL+E   AGH  QED  E+V
Sbjct  109  WGIADKYLPQSIAEEFEKQNPENVKLRLIE--GAGHLPQEDWPEKV  152



>ref|WP_017314938.1| hydrolase [Mastigocladopsis repens]
Length=284

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 87/198 (44%), Gaps = 35/198 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++ ++ +LN P++   A LP  +      L GE+ +Q       
Sbjct  106  GFLGSVGLQYALRHPEQIANIAILNTPIS-SQAKLPWKIQQMGLPLAGEMLTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y ++E+   +YR+P+L S S+G +
Sbjct  158  ---------------------DPLLV-DRTLEGGCRYVIEEKDLNIYRKPFLKSSSAGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLRL  299
            L A  R ++ Q     E   G    K W+ Q  + WG +D WL  D  ++F    ++  L
Sbjct  196  LLASIRNLQLQ-SAMTEIESGF---KTWQQQILIFWGIKDPWLPLDIAQNFVSSLAQGEL  251

Query  298  VELPMAGHHVQEDSGEEV  245
            ++L   GH+ QE   E +
Sbjct  252  IKLNNVGHYPQEHYHETI  269



>ref|WP_035994475.1| hydrolase [Leptolyngbya sp. KIOST-1]
Length=286

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 57/197 (29%), Positives = 80/197 (41%), Gaps = 39/197 (20%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            I+YA  H ++V+ ++++N P+    A LP  +      L G++ +Q              
Sbjct  117  IQYALQHPERVDRLVMINAPIG-PEAKLPWKIRQMGLPLAGDMITQ--------------  161

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                          DPL   D+ L   GPYQ+ +    VYRRP+L S   G AL    R 
Sbjct  162  --------------DPLLV-DRTLEGGGPYQIDDADLDVYRRPFLKSSDVGRALMTTVRR  206

Query  454  MKKQLKGYIEEAR-GILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFC-KESKLRLVELPM  284
            +       IEE R  I  G   W+  T   WG  D WL     E    K +   L  L  
Sbjct  207  LA------IEEVRQSIAAGLPGWDHPTLALWGLSDPWLPVSLAEAAVQKLANGELQTLEQ  260

Query  283  AGHHVQEDSGEEVGQVI  233
             GH+ QED  E+V   +
Sbjct  261  VGHYAQEDWAEKVATAL  277



>ref|WP_007356360.1| MULTISPECIES: hydrolase [Kamptonema]
 emb|CBN57156.1| alpha/beta hydrolase fold [ [[Oscillatoria] sp. PCC 6506]
Length=282

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 58/210 (28%), Positives = 96/210 (46%), Gaps = 37/210 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + I+YA  H DK+  + +LN P++++ + LP  +             Q+G P + 
Sbjct  106  GFLGSVGIQYALRHPDKIERLAILNAPISIE-SRLPWKIQ------------QLGLPFVG  152

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                             ++V+DPL   D+ L S   Y + ++   VYRRP+L S  +G +
Sbjct  153  D----------------MIVQDPLLV-DRTLESGCRYPISDKDLDVYRRPFLKSSQAGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L A  R +  QL   + E   I TG K W+  T + WG  D W++ D  ++  K      
Sbjct  196  LLATVRNL--QLSESMAE---IETGLKEWKRPTLILWGTGDPWINIDQAKNSVKSIPNGE  250

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            LV+L  A H+ QE   E++   +   + +K
Sbjct  251  LVKLEGAAHYPQEHWSEKISNALLSFLRRK  280



>ref|XP_008807054.1| PREDICTED: uncharacterized hydrolase YNR064C [Phoenix dactylifera]
Length=393

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 82/196 (42%), Gaps = 34/196 (17%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            + +A  + +K+  + +LN PLTV  + LP         L GE   Q              
Sbjct  222  LTWALKNSNKITKLAVLNSPLTVS-SPLPGLFQKLRFPLYGEFTCQNA------------  268

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                               +++ + +  PY +K E A VYR PYL SG  GFAL  L  A
Sbjct  269  -----------------VMAERFIEAGSPYVLKLEKADVYRLPYLESGGPGFAL--LEAA  309

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESK--LRLVELPMA  281
             K   K  +    G  +  +W+    + WG  D++L     E+F K +   ++L  +  A
Sbjct  310  RKANFKDILSRIAGGFSSTSWDKPILLAWGIADKYLPLSEAEEFQKRNPGVVKLKPIEGA  369

Query  280  GHHVQEDSGEEVGQVI  233
            GH  QED  E++ + +
Sbjct  370  GHMPQEDWPEKIVEAL  385



>ref|XP_002894382.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH70641.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=380

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 55/106 (52%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+SG  GFAL  L  A K      + +     +  +W+  T + 
Sbjct  271  PYVLKNEKADVYRLPYLSSGGPGFAL--LETAKKINFGDTLSQIANGFSSDSWDKPTLLA  328

Query  370  WGQRDRWLSFDGVEDFCK----ESKLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E+F K      KLRL+E   AGH  QED  E+V
Sbjct  329  WGIADKYLPQSIAEEFEKLNPQNVKLRLIE--GAGHLPQEDWPEKV  372



>ref|WP_017718654.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=282

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 92/217 (42%), Gaps = 37/217 (17%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            L  L  ++ Y  + G    + ++YA  H ++V  + +LN P++   A LP  +      L
Sbjct  92   LKTLEIQQFYLVAQGFLGSVGLQYALRHPEQVGRLAVLNAPVS-PDAKLPWKIQQLGLPL  150

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
            +G++ +Q                            DPL   D+ L +   + + +E   V
Sbjct  151  VGDMMTQ----------------------------DPLLV-DRTLEAGSRFVVSDEDLDV  181

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSF  341
            YRRP+L S  +G +L A  R +  QLK  + E   I +G   W   T + WG  D WL F
Sbjct  182  YRRPFLKSSDAGRSLLATVRNL--QLKQAMAE---ISSGFSRWAQPTLIVWGMADPWLPF  236

Query  340  DGVEDFCK-ESKLRLVELPMAGHHVQEDSGEEVGQVI  233
               E F        +V+L  AGH+ QE    EV   +
Sbjct  237  TQAETFAGIVQNAEIVKLEEAGHYPQEHWSVEVSNAL  273



>gb|AES86560.2| alpha/beta fold hydrolase [Medicago truncatula]
Length=383

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 52/106 (49%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL SG  GFAL  L  A K    G   E         W+    + 
Sbjct  274  PYVLKNEKADVYRLPYLASGGPGFAL--LEAARKANFNGTFSEIAEGFAANRWDKPVLLA  331

Query  370  WGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E+F K +    KL+L+E   AGH  QED  E+V
Sbjct  332  WGLSDKYLPQSIAEEFQKGNTQNIKLKLIE--GAGHMPQEDWPEKV  375



>ref|WP_002762599.1| hydrolase [Microcystis aeruginosa]
 emb|CCH99311.1| Alpha/beta fold family hydrolase [Microcystis aeruginosa PCC 
9717]
Length=288

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 91/209 (44%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  + DK+  +I+LN PL+ +   LP  +  +    LG++ +Q       
Sbjct  114  GFLASVGLQYALENPDKIERLIVLNTPLS-RDVKLPWIMKQWGLPFLGDMATQ-------  165

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L +   + + +    ++R+PYL + + G A
Sbjct  166  ---------------------DPLLV-DRTLETGSGFVISDADLAIFRQPYLKTSAVGRA  203

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  R +    K   E   G+   +N+E      WG  D WLS   VE    +S + L+
Sbjct  204  LLATIRNLNLS-KTMAEIETGL---ENFEKPILFVWGMGDPWLSSVTVEKLATKSGVELI  259

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             L  A H+ QE   +E+   I   +G+K+
Sbjct  260  PLAEAKHYPQEHWSKEISPQIINFLGRKT  288



>ref|WP_039729142.1| MULTISPECIES: hydrolase [Oscillatoriophycideae]
 gb|KIF24633.1| hydrolase [Aphanocapsa montana BDHKU210001]
 gb|KIF41498.1| hydrolase [Lyngbya confervoides BDU141951]
Length=287

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 88/216 (41%), Gaps = 35/216 (16%)
 Frame = -2

Query  877  LTPLTNKKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFL  698
            LT L   K +  + G      + +A  H ++V  ++++N PL      LP  +   +  L
Sbjct  94   LTALEIDKVHLVAQGFMGVYGVLFALRHPERVERLVIINTPLA-PEVKLPGAIRRMTWPL  152

Query  697  LGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMV  518
             GE+ +Q                            DPL   D+ L   GPYQ+ +    V
Sbjct  153  AGEMMTQ----------------------------DPLLV-DRTLEGGGPYQVDDSDLDV  183

Query  517  YRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFD  338
            YR+P+LT+ S+G +L    R  K  L    +E    L   +W   T + WG  D W+   
Sbjct  184  YRKPFLTTSSAGRSLLFTLRNFK--LAEITQEIAAKL--PDWPKMTQLIWGTADPWVPVA  239

Query  337  GVEDFCKESKL-RLVELPMAGHHVQEDSGEEVGQVI  233
              E +        LV+L   GH+ QED  E+V   +
Sbjct  240  LAEKWVDTVPTGELVKLDEMGHYAQEDWAEKVADAL  275



>ref|WP_008274911.1| hydrolase [Cyanothece sp. CCY0110]
 gb|EAZ92120.1| hypothetical protein CY0110_00640 [Cyanothece sp. CCY0110]
Length=281

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 94/211 (45%), Gaps = 39/211 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + ++YA  H D +  +I+LN PL+     LP  +  +S   +G++ +Q       
Sbjct  105  GFLASVALQYAFNHADTIERLIILNTPLS-PDVKLPWLMQQWSIPFMGDMVTQ-------  156

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     + ++++   ++R+PYL S + G A
Sbjct  157  ---------------------DPLLV-DRTLEKGSGFVIEDKDLDIFRQPYLKSSAVGRA  194

Query  475  LNALSRAMK--KQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDF-CKESKL  305
            L   ++ +K  + LK    E +      +W+V T + WG  D WLS D  E      S +
Sbjct  195  LLTTTKNLKLSQTLKNL--ETKFF----SWQVPTLILWGMADPWLSADIPEKLAANTSNI  248

Query  304  RLVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
             +V+L  A H+ QE   +EV + I   + ++
Sbjct  249  EMVKLEEAKHYPQEHWPKEVSEEIITFLRRQ  279



>ref|WP_029637501.1| hydrolase [[Scytonema hofmanni] UTEX B 1581]
Length=283

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 84/198 (42%), Gaps = 35/198 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++ ++ ++N P+T   A LP  +      L GE+ +Q       
Sbjct  106  GFLGSVGLQYALRHPEQIANIAIINTPIT-SAAKLPWKIQQLGLPLAGEMMTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y ++E+   +YR+PYL S S+G  
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYVIEEKDLDIYRKPYLKSSSAGRG  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLRL  299
            L +  R ++ Q     E   G    K W+    + WG  D WLS D  ++F    S   L
Sbjct  196  LLSTIRNLQLQ-PAMTEIESGF---KEWQQPILIQWGMIDPWLSVDIAQNFADSVSNAEL  251

Query  298  VELPMAGHHVQEDSGEEV  245
            ++L   GH+ QE   E V
Sbjct  252  IKLHNVGHYPQEHYHETV  269



>ref|WP_007304188.1| hydrolase [Crocosphaera watsonii]
 gb|EAM52539.1| Alpha/beta hydrolase fold [Crocosphaera watsonii WH 8501]
 gb|EHJ14242.1| putative hydrolase [Crocosphaera watsonii WH 0003]
 emb|CCQ63640.1| Hydrolase, alpha/beta fold family protein,At1g52510/AT4G12830 
homolog [Crocosphaera watsonii WH 0401]
 emb|CCQ52359.1| Hydrolase, alpha/beta fold family protein, At1g52510/AT4G12830 
homolog [Crocosphaera watsonii WH 8502]
 emb|CCQ54586.1| Hydrolase, alpha/beta fold family protein,At1g52510/AT4G12830 
homolog [Crocosphaera watsonii WH 0005]
Length=281

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 92/215 (43%), Gaps = 47/215 (22%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  + + I+YA  H   ++ +I+LN PL+     LP  +  ++   +G++ +Q       
Sbjct  105  GFLASVAIQYAFNHSHTIHRLIVLNTPLS-PEIKLPWLMQQWTIPFVGDMVTQ-------  156

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     + ++++   ++R+PYL S + G A
Sbjct  157  ---------------------DPLLV-DRTLEKGSGFVIEDQDLDIFRKPYLKSSAVGRA  194

Query  475  LNA------LSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDF-CK  317
            L        LS+ MK   KG+            W+V T + WG  D WLS D  E     
Sbjct  195  LLTTTKNLKLSQTMKDIEKGF----------SAWDVPTLMLWGMADPWLSADIPEKLTAN  244

Query  316  ESKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
             S + +V+L  A H+ QE   +EV + I   + ++
Sbjct  245  ASNIEMVKLDEAKHYPQEHWPKEVSEEIITFLRRQ  279



>ref|XP_010462087.1| PREDICTED: uncharacterized protein LOC104742750 [Camelina sativa]
 ref|XP_010462088.1| PREDICTED: uncharacterized protein LOC104742750 [Camelina sativa]
Length=381

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 55/106 (52%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+SG  GFAL  L  A K      + +     +  +W     V 
Sbjct  272  PYVLKNEKADVYRLPYLSSGGPGFAL--LETAKKINFGDTLSQIANGFSSGSWNKPILVA  329

Query  370  WGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E+F K++    KLRL+E   AGH  QED  E+V
Sbjct  330  WGIADKYLPQSIAEEFEKQNPENVKLRLIE--GAGHLPQEDWPEKV  373



>ref|XP_010479758.1| PREDICTED: uncharacterized protein LOC104758569 [Camelina sativa]
 ref|XP_010479759.1| PREDICTED: uncharacterized protein LOC104758569 [Camelina sativa]
Length=382

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 55/106 (52%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+SG  GFAL  L  A K      + +     +  +W     V 
Sbjct  273  PYVLKNEKADVYRLPYLSSGGPGFAL--LETAKKINFGDTLSQIANGFSSGSWNKPILVA  330

Query  370  WGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E+F K++    KLRL+E   AGH  QED  E+V
Sbjct  331  WGIADKYLPQSIAEEFEKQNPENVKLRLIE--GAGHLPQEDWPEKV  374



>ref|WP_009458171.1| MULTISPECIES: hydrolase [Fischerella]
 gb|EHC11730.1| alpha/beta hydrolase fold protein [Fischerella sp. JSC-11]
Length=283

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 89/199 (45%), Gaps = 37/199 (19%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++ ++++LN P++   A LP  +      L GE+ +Q       
Sbjct  106  GFLGSVGLQYALRHPEQIANIVILNTPIS-STAKLPWKIQQMGLPLAGEMMTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y + ++   VYR+P+L + ++G A
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYVIPDKDLDVYRQPFLKTSAAGRA  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L  LS     QL   + E   I TG K+W+    + WG  D WL+ D  E+F K     +
Sbjct  196  L--LSTIRNLQLAKAMSE---IETGFKHWQQPILIQWGVIDPWLNLDMAENFAKSVPNGK  250

Query  301  LVELPMAGHHVQEDSGEEV  245
            LV+L   GH+ QE   E +
Sbjct  251  LVKLNNVGHYPQEHYHETI  269



>ref|XP_006392914.1| hypothetical protein EUTSA_v10011571mg [Eutrema salsugineum]
 gb|ESQ30200.1| hypothetical protein EUTSA_v10011571mg [Eutrema salsugineum]
Length=382

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 56/106 (53%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+SG  GFAL  L  A K      + +     +  +W+    + 
Sbjct  273  PYVLKNEKADVYRLPYLSSGGPGFAL--LETAKKINFGDILSQIANGFSSDSWDKPILLA  330

Query  370  WGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E+F K++    KLRL+E   AGH  QED  E+V
Sbjct  331  WGIADKYLPQSIAEEFEKQNSQNVKLRLIE--GAGHLPQEDWPEKV  374



>emb|CDX87912.1| BnaC06g09740D [Brassica napus]
Length=376

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 85/194 (44%), Gaps = 38/194 (20%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            + +A  +  KV  + +LN PLTV  + +P         L GE   Q              
Sbjct  209  LTWALKNPSKVEKIAILNTPLTVS-SPVPGLFKQLRIPLFGEFTCQ--------------  253

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                     IL        +++ +    PY +K E A VYR PYL+SG  GFAL  L  A
Sbjct  254  -------NAIL--------AERFIEGGSPYVLKNEKADVYRLPYLSSGGPGFAL--LETA  296

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKES----KLRLVELP  287
             K      + +     +  +W+  T + WG  D++LS    E+F K++    KL+L+E  
Sbjct  297  KKINFGDTLGQIANGFSSGSWDKPTLLAWGIVDKYLSQSIAEEFEKQNPQNVKLQLIE--  354

Query  286  MAGHHVQEDSGEEV  245
             AGH  QED  E+V
Sbjct  355  GAGHLPQEDWPEKV  368



>ref|WP_037224593.1| hydrolase [Richelia intracellularis]
Length=274

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 91/211 (43%), Gaps = 37/211 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +K+ S+ +LN P++   A LP  +      L G++ +Q       
Sbjct  99   GFLGSVGLQYALRHPEKIASIAILNAPIS-PTAKLPWKIKQMGLPLAGDMITQ-------  150

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y + EE   VYR+P+L + +SG +
Sbjct  151  ---------------------DPLLV-DRTLEGGSCYVISEEHLGVYRKPFLKTSASGRS  188

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L A  R +  QL   +EE   I +G K+WE    V WG  D WL     ++F K      
Sbjct  189  LLATIRNL--QLSKSMEE---IDSGFKDWEKPILVQWGAIDPWLDVSMADNFVKSLPNGE  243

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            L+ L   GH+ QE   E + + +   V + S
Sbjct  244  LIRLNNVGHYPQEHYHETILEDLLPFVRRSS  274



>gb|KIJ82046.1| hydrolase [Scytonema tolypothrichoides VB-61278]
Length=285

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 87/198 (44%), Gaps = 35/198 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++ ++ +LN P++ + A LP  +      L GE+ +Q       
Sbjct  106  GFLGSVGLQYALRHPEQIANIAILNTPISTQ-AKLPWKIQQMGLPLAGEMMTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y + EE   +YR+P+L S ++G +
Sbjct  158  ---------------------DPLLV-DRTLEGGCRYVITEEHLNIYRKPFLKSSAAGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKL-RL  299
            L A  R +  QL   ++E    L  K  + +  + WG  D WL  D  +DF    K  RL
Sbjct  196  LLATIRNL--QLPSAMKEIE--LGLKQSQQEILILWGMIDPWLPIDIAQDFVGSLKTGRL  251

Query  298  VELPMAGHHVQEDSGEEV  245
            ++L   GH+ QE   E +
Sbjct  252  IKLNNVGHYPQEHYHETI  269



>ref|WP_008314270.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Leptolyngbya sp. PCC 6406]
Length=287

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 66/129 (51%), Gaps = 6/129 (5%)
 Frame = -2

Query  604  LLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIE  425
            ++ +DPL   D+ L   GPY++ +    VYR+P+LT+ ++G AL A  R  + QL     
Sbjct  156  MITQDPLLV-DRTLEGGGPYRVDDGDLDVYRKPFLTTSAAGRALLATVR--RLQLATVTA  212

Query  424  EARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLRLVELPMAGHHVQEDSGEE  248
            +    L   +W+  T + WG  D WL  D  E +     +  L +L   GH+ QED  E+
Sbjct  213  QLETGLA--SWQHPTLMVWGVEDPWLPVDLAETWATALPQGELAKLEQVGHYAQEDWAEK  270

Query  247  VGQVIAEIV  221
            V +V+   +
Sbjct  271  VSEVLVPFL  279



>ref|XP_006305087.1| hypothetical protein CARUB_v10009454mg [Capsella rubella]
 gb|EOA37985.1| hypothetical protein CARUB_v10009454mg [Capsella rubella]
Length=379

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 56/106 (53%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+SG  GFAL  L  A K      + +     +  +W+    + 
Sbjct  270  PYVLKNEKADVYRLPYLSSGGPGFAL--LETAKKINFGDTLSQIANGFSSGSWDKPILLA  327

Query  370  WGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E+F K++    KLRL+E   AGH  QED  E+V
Sbjct  328  WGIADKYLPQSIAEEFEKQNPQNVKLRLIE--GAGHLPQEDWPEKV  371



>ref|WP_041225953.1| hydrolase [Crinalium epipsammum]
Length=282

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 88/209 (42%), Gaps = 35/209 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + I+YA  H +++  + +LN PL+   A LP  +      L+GE+ +Q       
Sbjct  106  GFLGSVGIQYALRHPNQIERLTILNAPLS-PSAKLPWKIKQLGIPLVGEMLTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L S   Y++ +    VYRRP+L S  +G +
Sbjct  158  ---------------------DPLLV-DRTLESGSRYRVSDADLDVYRRPFLKSSDAGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESK-LRL  299
            L A  + +  QLK  + E    L    W + T + WG +D WL     E      K + L
Sbjct  196  LFATVQNL--QLKQSMAEITSSLNA--WSIPTQLIWGIKDPWLPLTEAEYLANSLKQVEL  251

Query  298  VELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            ++L   GH+ Q+    +V   +   + ++
Sbjct  252  IKLEEGGHYPQDHWSAQVSDALVYFLRRQ  280



>gb|AFZ12088.1| Haloalkane dehalogenase [Crinalium epipsammum PCC 9333]
Length=260

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 88/209 (42%), Gaps = 35/209 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + I+YA  H +++  + +LN PL+   A LP  +      L+GE+ +Q       
Sbjct  84   GFLGSVGIQYALRHPNQIERLTILNAPLS-PSAKLPWKIKQLGIPLVGEMLTQ-------  135

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L S   Y++ +    VYRRP+L S  +G +
Sbjct  136  ---------------------DPLLV-DRTLESGSRYRVSDADLDVYRRPFLKSSDAGRS  173

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESK-LRL  299
            L A  + +  QLK  + E    L    W + T + WG +D WL     E      K + L
Sbjct  174  LFATVQNL--QLKQSMAEITSSLNA--WSIPTQLIWGIKDPWLPLTEAEYLANSLKQVEL  229

Query  298  VELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            ++L   GH+ Q+    +V   +   + ++
Sbjct  230  IKLEEGGHYPQDHWSAQVSDALVYFLRRQ  258



>ref|WP_027404785.1| hydrolase [Aphanizomenon flos-aquae]
Length=283

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 85/200 (43%), Gaps = 35/200 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +KV ++ +LN P++   A LP  +        G++ +Q       
Sbjct  106  GFLGSVGLQYALRHPEKVANIAILNTPISTA-AKLPWKIKQMGLPFAGDMITQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y++++E   VYR+P+L S + G +
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYRIEDEDLDVYRKPFLKSSAPGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLRL  299
            L A  R  + + K  +E   G    K W+    V WG  D WLS D  E F K      +
Sbjct  196  LLATIRNFQLE-KAMLEIENGF---KEWQQPILVQWGIIDPWLSVDMAETFVKSVPNGEI  251

Query  298  VELPMAGHHVQEDSGEEVGQ  239
            ++L   GH+ QE   E + Q
Sbjct  252  IKLNNVGHYAQEHYHEVILQ  271



>ref|WP_017652808.1| hydrolase [Microchaete sp. PCC 7126]
Length=284

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 89/199 (45%), Gaps = 37/199 (19%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +K+ ++++LN P++   A LP  +      L GE+ +Q       
Sbjct  106  GFLGSVGLQYALRHPEKIANLVILNTPVS-PEAKLPWKIKQMGLPLAGEMMTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     +++++    VYR+P+L S + G A
Sbjct  158  ---------------------DPLLV-DRTLEGGSRFRIEDRDLDVYRKPFLKSSAPGRA  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKES-KLR  302
            L A  R +  QL+  + E   I +G K W+    V WG  D WLS D  ++F   +    
Sbjct  196  LLATIRNL--QLEPAMSE---IASGFKEWQKPILVQWGMIDPWLSIDIAQNFVNSAHNAE  250

Query  301  LVELPMAGHHVQEDSGEEV  245
            L++L   GH+ QE   E +
Sbjct  251  LIKLNNVGHYPQEHYHEAI  269



>ref|WP_039756008.1| MULTISPECIES: hydrolase [Synechococcus]
 gb|AJD58541.1| hydrolase [Synechococcus sp. UTEX 2973]
Length=284

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 86/204 (42%), Gaps = 39/204 (19%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + + +A+ H D+V  + L N P     A++P  +      L GE           
Sbjct  107  GYLGAVGLLWAAQHPDRVERIALFNTPFYAG-ASVPWKIRQLGLPLAGE-----------  154

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                             +L +DPL   D+ L   G Y++++    VYRRPYL+S ++G A
Sbjct  155  -----------------MLCQDPLTV-DRVLEGGGGYRVEDADLDVYRRPYLSSSAAGRA  196

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKL---  305
            L A  R +  Q +   E A  +     W     V WG RD WL++  VE     +KL   
Sbjct  197  LLATVRQL-DQARVSTEIASAL---AQWSQPILVGWGDRDPWLTW--VEAEAAAAKLPSA  250

Query  304  RLVELPMAGHHVQEDSGEEVGQVI  233
              V     GH+ QED  E++ Q +
Sbjct  251  EFVRFEETGHYPQEDWPEKLCQAL  274



>ref|XP_007215166.1| hypothetical protein PRUPE_ppa013578mg [Prunus persica]
 gb|EMJ16365.1| hypothetical protein PRUPE_ppa013578mg [Prunus persica]
Length=115

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 58/110 (53%), Gaps = 10/110 (9%)
 Frame = -2

Query  559  SCGPYQMKEEVAMVYRRPYLTSGSSGFA-LNALSRAMKKQLKGYIEEARGILTGKNWEVQ  383
            S   Y +K E A VYR PYL+S   GFA L A  +A    +   I  A G  +G +W++ 
Sbjct  3    SFNSYVLKLEKADVYRLPYLSSSGPGFAILEATRKANFNNISTQI--ASGFASG-SWDIP  59

Query  382  TTVCWGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            T V WG  D++L     E+F K +    KL+L+E   AGH  QED  E V
Sbjct  60   TLVAWGIADKYLPQSVAEEFQKGNPTAVKLKLIE--GAGHMPQEDWPERV  107



>gb|ABB56931.1| Haloalkane dehalogenase [Synechococcus elongatus PCC 7942]
Length=298

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 86/204 (42%), Gaps = 39/204 (19%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + + +A+ H D+V  + L N P     A++P  +      L GE           
Sbjct  121  GYLGAVGLLWAAQHPDRVERIALFNTPFYAG-ASVPWKIRQLGLPLAGE-----------  168

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                             +L +DPL   D+ L   G Y++++    VYRRPYL+S ++G A
Sbjct  169  -----------------MLCQDPLTV-DRVLEGGGGYRVEDADLDVYRRPYLSSSAAGRA  210

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKL---  305
            L A  R +  Q +   E A  +     W     V WG RD WL++  VE     +KL   
Sbjct  211  LLATVRQL-DQARVSTEIASAL---AQWSQPILVGWGDRDPWLTW--VEAEAAAAKLPSA  264

Query  304  RLVELPMAGHHVQEDSGEEVGQVI  233
              V     GH+ QED  E++ Q +
Sbjct  265  EFVRFEETGHYPQEDWPEKLCQAL  288



>ref|WP_011242951.1| hydrolase [Synechococcus elongatus]
 dbj|BAD78829.1| putative hydrolase [Synechococcus elongatus PCC 6301]
Length=284

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 84/202 (42%), Gaps = 35/202 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + + +A+ H D+V  + L N P     A++P  +      L GE           
Sbjct  107  GYLGAVGLLWAAQHPDRVERIALFNTPFYAG-ASVPWKIRQLGLPLAGE-----------  154

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                             +L +DPL   D+ L   G Y++++    VYRRPYL+S ++G A
Sbjct  155  -----------------MLCQDPLTV-DRVLEGGGGYRVEDADLDVYRRPYLSSSAAGRA  196

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFC-KESKLRL  299
            L A  R +  Q +   E A  +     W     V WG RD WL++   E    K +    
Sbjct  197  LLATVRQL-DQARVSTEIASAL---AQWSQPILVGWGDRDPWLTWVEAEAGAGKLTSAEF  252

Query  298  VELPMAGHHVQEDSGEEVGQVI  233
            V     GH+ QED  E++ Q +
Sbjct  253  VRFEETGHYPQEDWPEKLCQAL  274



>ref|WP_010871750.1| hydrolase [Synechocystis sp. PCC 6803]
 dbj|BAA17121.1| slr2053 [Synechocystis sp. PCC 6803]
 dbj|BAK49294.1| hypothetical protein SYNGTS_0546 [Synechocystis sp. PCC 6803]
 dbj|BAL28293.1| hypothetical protein SYNGTI_0546 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL31463.1| hypothetical protein SYNPCCN_0546 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL34632.1| hypothetical protein SYNPCCP_0546 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM50838.1| hypothetical protein BEST7613_1907 [Synechocystis sp. PCC 6803] 
[Synechocystis sp. PCC 6803]
 gb|AGF50811.1| hypothetical protein MYO_15510 [Synechocystis sp. PCC 6803]
Length=283

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 93/211 (44%), Gaps = 38/211 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G  +   I+YA  H D++  + +LN P+ V   +LP  +  ++  L+G++ +Q       
Sbjct  106  GFLATAGIEYALNHPDQIERLAILNTPV-VPPVSLPWPMRQWTIPLVGDMVTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     + + +E   +YR+P+L + ++G A
Sbjct  158  ---------------------DPL-IIDRTLEGGSGFVISDEKLDIYRKPWLKTSAAGRA  195

Query  475  LNALSRAMK--KQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCK-ESKL  305
            L A+++ +     L    +  R       W+  T   WG  D+WLS + +E   +  + L
Sbjct  196  LMAVTKNLPTTNALTKIGDRLR-----TEWQKPTCFIWGTADKWLSVEPIEQLVQGVNHL  250

Query  304  RLVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
             L++L  A H+ QE   +EVG  +     K+
Sbjct  251  ELIKLSEAKHYPQEHFPQEVGTALQTFFRKQ  281



>ref|XP_010500850.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Camelina sativa]
Length=380

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 55/106 (52%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+SG  GFAL  L  A K      + +     +  +W     + 
Sbjct  271  PYVLKNEKADVYRLPYLSSGGPGFAL--LETAKKINFGDTLSQIANGFSSGSWNKPILLA  328

Query  370  WGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E+F K++    KLRL+E   AGH  QED  E+V
Sbjct  329  WGIADKYLPQSIAEEFEKQNPENVKLRLIE--GAGHLPQEDWPEKV  372



>ref|WP_041934044.1| hydrolase [Cyanothece sp. PCC 7822]
Length=278

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 94/209 (45%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA   ++ +  +I+LN PL+  +A LP  +  ++  L+G++ +Q       
Sbjct  104  GFLGSVGLQYALRSKEMIERLIILNTPLST-NAKLPWAMKQWALPLVGDMVTQ-------  155

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     + + +E   VYR+P+L + ++G A
Sbjct  156  ---------------------DPLLV-DRTLEGGSGFVISDERLSVYRKPFLKTSATGRA  193

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  + +K   +   E   G+    ++   T + WG  D WLS    E    +S + L+
Sbjct  194  LLATIKNLKLA-ESMAELESGL---ADFSKPTLIIWGSADPWLSSADAEKLATKSNIELI  249

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            +L  A H+ QE    E+ Q++   + +++
Sbjct  250  KLEEAKHYPQEHWSGEISQIMVNFLRRQT  278



>gb|ADN17326.1| alpha/beta hydrolase fold protein [Cyanothece sp. PCC 7822]
Length=280

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 94/209 (45%), Gaps = 34/209 (16%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA   ++ +  +I+LN PL+  +A LP  +  ++  L+G++ +Q       
Sbjct  106  GFLGSVGLQYALRSKEMIERLIILNTPLST-NAKLPWAMKQWALPLVGDMVTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     + + +E   VYR+P+L + ++G A
Sbjct  158  ---------------------DPLLV-DRTLEGGSGFVISDERLSVYRKPFLKTSATGRA  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A  + +K   +   E   G+    ++   T + WG  D WLS    E    +S + L+
Sbjct  196  LLATIKNLKLA-ESMAELESGL---ADFSKPTLIIWGSADPWLSSADAEKLATKSNIELI  251

Query  295  ELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
            +L  A H+ QE    E+ Q++   + +++
Sbjct  252  KLEEAKHYPQEHWSGEISQIMVNFLRRQT  280



>ref|XP_003531724.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Glycine max]
Length=376

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 51/106 (48%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL S   GFAL  L  A K   KG   E         W+    + 
Sbjct  266  PYVLKNEKADVYRLPYLASSGPGFAL--LEAARKANFKGTFSEIAAGFATDRWDKPILLA  323

Query  370  WGQRDRWLSFDGVEDFCK----ESKLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E F K    + +L+L+E   AGH  QED  E+V
Sbjct  324  WGLSDKYLPQSVAEQFQKGNPAQIQLKLIE--GAGHMPQEDWPEKV  367



>ref|WP_019508341.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=280

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 56/227 (25%), Positives = 96/227 (42%), Gaps = 39/227 (17%)
 Frame = -2

Query  877  LTPLTN----KKGYPCSPGIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIF  710
            LT L N     K Y    G    + ++YA  + +++  +I+LN P+T   A LP  +   
Sbjct  86   LTELINALKLDKFYLVVQGFLGSVGLQYAFQNPEQIEGLIILNTPITTS-AKLPWAMKQM  144

Query  709  SNFLLGEIFSQVG*P*LSSRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEE  530
            +  L+G++ +Q                            DPL   D+ +     + + +E
Sbjct  145  TFPLVGDMMTQ----------------------------DPLLV-DRTIEKGSGFVVADE  175

Query  529  VAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRW  350
               V R+P+L S   G +L A+ +  K QL+   +E    L+   W     + WG  D W
Sbjct  176  DLDVLRKPFLQSSDVGRSLMAILK--KLQLENTTKEIETGLS--QWAKPALIIWGTADNW  231

Query  349  LSFDGVEDF-CKESKLRLVELPMAGHHVQEDSGEEVGQVIAEIVGKK  212
            L+   ++      S++ LVELP A H+ QE    ++   I +   +K
Sbjct  232  LNVTDIQKLAATNSEITLVELPEAKHYPQEHWSSDIATEILQFFRRK  278



>ref|XP_002517672.1| hydrolase, putative [Ricinus communis]
 gb|EEF44836.1| hydrolase, putative [Ricinus communis]
Length=375

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 83/194 (43%), Gaps = 38/194 (20%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            + +A  +Q K++ + + N PLTV  + +P         L GE  SQ              
Sbjct  208  LTWALKNQSKISKIAIFNSPLTVS-SPVPGLFQKLRIPLYGEFTSQNA------------  254

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                               +++ + +  PY +K E A VYR PYL S   GFAL  L  A
Sbjct  255  -----------------IEAERFIEAGSPYVLKLEKADVYRLPYLASSGPGFAL--LEAA  295

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKES----KLRLVELP  287
             K ++K  + +       + W+    + WG  D++L     E+F K +    KL+L+E  
Sbjct  296  RKIKIKDILSQITDGFASEKWDKPILLAWGISDKYLPQSIAEEFQKGNPDTVKLKLIE--  353

Query  286  MAGHHVQEDSGEEV  245
             AGH  QED  E+V
Sbjct  354  GAGHMPQEDWPEKV  367



>ref|XP_004506956.1| PREDICTED: haloalkane dehalogenase-like isoform X1 [Cicer arietinum]
Length=381

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 57/107 (53%), Gaps = 10/107 (9%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKG-YIEEARGILTGKNWEVQTTV  374
            PY +K E A VYR PYL S   GFAL  L  A K   KG + E + G  T + W+    +
Sbjct  272  PYVLKNEKADVYRLPYLASSGPGFAL--LEAARKANFKGTFTEISEGFATNR-WDKPVLL  328

Query  373  CWGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
             WG  D++L     E+F K +    KL+L+E   AGH  QED  E+V
Sbjct  329  AWGLSDKYLPQYVAEEFQKGNPQHIKLKLIE--GAGHMPQEDWPEKV  373



>ref|WP_039202194.1| hydrolase [Aphanizomenon flos-aquae]
 gb|KHG41048.1| hydrolase [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=283

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/200 (27%), Positives = 85/200 (43%), Gaps = 35/200 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +KV ++ +LN P++   A LP  +        G++ +Q       
Sbjct  106  GFLGSVGLQYALRHPEKVANIAILNTPISTA-AKLPWKIKQMGLPFAGDMITQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y+++++   VYR+P+L S + G +
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYRIEDQDLDVYRKPFLKSSAPGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLRL  299
            L A  R  + + K  +E   G    K W+    V WG  D WLS D  E F K      +
Sbjct  196  LLATIRNFQLE-KAMLEIENGF---KEWQQPILVQWGIIDPWLSVDMAETFVKSVPNGEI  251

Query  298  VELPMAGHHVQEDSGEEVGQ  239
            ++L   GH+ QE   E + Q
Sbjct  252  IKLNNVGHYAQEHYHEVILQ  271



>ref|WP_015226338.1| alpha/beta fold family hydrolase [Halothece sp. PCC 7418]
 gb|AFZ44463.1| alpha/beta hydrolase fold protein [Halothece sp. PCC 7418]
Length=283

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 89/208 (43%), Gaps = 47/208 (23%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++  +++LN PL+     LP  +  +   L+GE+ +Q       
Sbjct  107  GFVGSVGLQYAFRHPEQIERLVILNTPLS-SSVRLPWLMRRWGFPLMGEMLTQ-------  158

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L +   Y + +E   +YR+P+L +  +G +
Sbjct  159  ---------------------DPLLV-DRTLETGSGYVISDENLGIYRQPFLKNSKAGRS  196

Query  475  LNA------LSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE  314
            L A      LS AM +   G+           NWE  T + WG  D WLS D      +E
Sbjct  197  LVATIKNLNLSDAMTEIEAGW----------SNWEKPTQIIWGMDDPWLSSDIPAAIAQE  246

Query  313  SK-LRLVELPMAGHHVQEDSGEEVGQVI  233
             + + L +L  A H+ QE   +E+  ++
Sbjct  247  HQNVNLAKLEEAKHYPQEHWSDEISPIL  274



>ref|WP_006276738.1| hydrolase [Cylindrospermopsis raciborskii]
 gb|EFA70287.1| Alpha/beta hydrolase fold protein [Cylindrospermopsis raciborskii 
CS-505]
Length=287

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/200 (26%), Positives = 88/200 (44%), Gaps = 35/200 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +K+ ++++LN P+    A LP  +      + GEI +Q       
Sbjct  106  GFLGSVGLQYALRHPEKIANIVILNTPIGTS-AKLPWKIRQMGLPIAGEIITQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L S   Y+++++   +YR+P+L + +SG +
Sbjct  158  ---------------------DPLLV-DRTLESGSCYRIEDKDLDIYRKPFLKTSASGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLRL  299
            L  LS     QL    +E    +  + W+    V WG  D WLS +  E F +    + +
Sbjct  196  L--LSTIRNLQLDAVTKEIE--MGFQKWQKPILVQWGAIDPWLSVELAESFAQSVPDVEI  251

Query  298  VELPMAGHHVQEDSGEEVGQ  239
            ++L   GH+ QE   E + Q
Sbjct  252  IKLNNVGHYPQEHYHEVILQ  271



>ref|WP_016876323.1| hydrolase [Chlorogloeopsis fritschii]
Length=283

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 86/199 (43%), Gaps = 37/199 (19%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++ ++ +LN P++   A LP  +      L GE+ +Q       
Sbjct  106  GFLGSVGLQYALRHPEQIVNIAILNTPISTT-AKLPWKIQQMGLPLAGEMMTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y + +    VYR+PYL S S+G A
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYVISDADLDVYRKPYLKSSSAGRA  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L A  R +  QL   ++E   I +G + W+    + WG+ D WLS D  E F        
Sbjct  196  LLASIRNL--QLANAMQE---IESGFQQWQKPLLIQWGKNDPWLSLDMAEKFATTVPDGE  250

Query  301  LVELPMAGHHVQEDSGEEV  245
            L++L   GH+ QE   E +
Sbjct  251  LIKLNDVGHYPQEHHHETI  269



>ref|WP_015127058.1| alpha/beta fold family hydrolase [Calothrix sp. PCC 7507]
 gb|AFY31233.1| alpha/beta hydrolase fold protein [Calothrix sp. PCC 7507]
Length=283

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/199 (27%), Positives = 87/199 (44%), Gaps = 37/199 (19%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++ ++ +LN P++   A LP  +      L GE+ +Q       
Sbjct  106  GFLGSVGLQYALRHPEQIANLAILNTPISTA-AKLPWKIKQMGLPLAGEMMTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y++ ++   VYR+P+L S + G A
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYRIADKDLDVYRKPFLKSSAPGRA  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L A  R +  QL+  + E   I +G K W+    + WG  D WLS D  ++F        
Sbjct  196  LLATIRNL--QLEPAMTE---ITSGFKEWQQPILIQWGMIDPWLSVDTAQEFANSVPNAE  250

Query  301  LVELPMAGHHVQEDSGEEV  245
            L++L   GH+ QE   E +
Sbjct  251  LIKLNNVGHYPQEHYHETI  269



>ref|XP_007135767.1| hypothetical protein PHAVU_010G157100g [Phaseolus vulgaris]
 gb|ESW07761.1| hypothetical protein PHAVU_010G157100g [Phaseolus vulgaris]
Length=372

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 53/106 (50%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+S   GFAL  L  A K   KG   +       + W+    V 
Sbjct  263  PYVLKNEKADVYRLPYLSSSGPGFAL--LEAARKANFKGTFSQIAEGFATERWDKPILVG  320

Query  370  WGQRDRWLSFDGVEDFCK----ESKLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E F K    + +L+L+E   AGH  QED  E+V
Sbjct  321  WGLSDKYLPQSVAEQFQKGNPAQIQLKLIE--GAGHMPQEDWPEKV  364



>ref|XP_010545744.1| PREDICTED: uncharacterized protein LOC104818013 [Tarenaya hassleriana]
Length=386

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 56/106 (53%), Gaps = 8/106 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+SG+ GFAL  L  A K   +  + +        +W+    + 
Sbjct  277  PYVLKNEKADVYRLPYLSSGAPGFAL--LEAAKKINFRDTLSQIADGFASGSWDKPVLLA  334

Query  370  WGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E+F K +    K++L+E   AGH  QED  E+V
Sbjct  335  WGIADKYLPQSIAEEFQKRNSDAVKVKLLE--GAGHMPQEDWPEKV  378



>ref|WP_015156929.1| alpha/beta fold family hydrolase [Chroococcidiopsis thermalis]
 gb|AFY90391.1| alpha/beta hydrolase fold protein [Chroococcidiopsis thermalis 
PCC 7203]
Length=281

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 49/198 (25%), Positives = 83/198 (42%), Gaps = 35/198 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H D+V ++ +LN PLT   A LP  +  +     G++ +Q       
Sbjct  106  GFLGSVGLQYALRHSDRVENIAILNTPLTTA-AKLPWQMQQWGLPFAGDMATQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     YQ+ +    ++R+P+L S  +G +
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYQISDADLDIFRKPFLKSSKAGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLRL  299
            L    R +K       E A G    ++W+    + WG  D WL  +  + F     +  +
Sbjct  196  LMTAVRNLKMS-PSMSEIADGF---QDWQKPLLIVWGVNDPWLPVEIAQKFASSLPQAEI  251

Query  298  VELPMAGHHVQEDSGEEV  245
            V+L  AGH+ QE   E++
Sbjct  252  VKLEKAGHYPQEHFAEDI  269



>ref|WP_045055854.1| hydrolase [Chroococcales cyanobacterium CENA595]
 gb|KJH70729.1| hydrolase [Chroococcales cyanobacterium CENA595]
Length=281

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 82/198 (41%), Gaps = 35/198 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    I ++YA  H +++ S+ +LN P+    A LP  +  +     G++ +Q       
Sbjct  106  GFLGSIGLQYALRHAEQIESLAILNTPIAAT-AKLPWKMQQWGLPFAGDMLTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y++ +    +YR+P+L S ++G +
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYRIADADLDIYRQPFLKSSAAGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESK-LRL  299
            L    R M  Q+   + E       K W+  TT+ WG  D WL     ++F    K   L
Sbjct  196  LMYAIRNM--QMPAAMAEIEAGF--KQWQYPTTIIWGLTDPWLPVSMAKNFASTIKHAEL  251

Query  298  VELPMAGHHVQEDSGEEV  245
            VEL   GH+ QE   + +
Sbjct  252  VELDDVGHYPQEHHSDVI  269



>ref|XP_011073395.1| PREDICTED: uncharacterized protein LOC105158360 [Sesamum indicum]
Length=368

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 83/194 (43%), Gaps = 38/194 (20%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            + +A  +Q K++ + +LN PLT+  + LP             +F Q+  P       QN 
Sbjct  201  LTWALKNQSKISKLAILNTPLTIS-SPLPG------------LFQQLRIPFFGEFTCQN-  246

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                               +++ + +  PY +K E A VYR PYL S   GFAL  L  A
Sbjct  247  ----------------AVMAERFIEAGSPYVLKLEKADVYRLPYLASSGPGFAL--LEAA  288

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKES----KLRLVELP  287
             +   K    +        +W+    V WG  D++L     E+F K +    KL+++E  
Sbjct  289  KRANFKDITSQISAGFASGSWDKPILVAWGISDKYLPQSIAEEFQKGNPDVIKLKMIE--  346

Query  286  MAGHHVQEDSGEEV  245
             AGH  QED  E+V
Sbjct  347  GAGHMPQEDWPEKV  360



>ref|WP_017661847.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=284

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 56/211 (27%), Positives = 88/211 (42%), Gaps = 37/211 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H D+++ V +LN PL+   A LP  L   S   +G++ +Q       
Sbjct  106  GFLGSVGLQYALRHGDRIDRVAVLNAPLS-PDAKLPWMLKQMSLPFIGDMMTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     + + ++   VYRRP+L S  SG A
Sbjct  158  ---------------------DPLLV-DRTLEKGSGFVIPDKDLDVYRRPWLKSSDSGRA  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L  L      QL     E   I +G + W     V WG  D WLS +  + F       +
Sbjct  196  L--LYTLKNLQLDRATAE---IDSGFRQWTKPALVVWGVLDPWLSVEPAKTFADNLENGK  250

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIVGKKS  209
             + L  A H+ QE   ++VG+ +   + ++S
Sbjct  251  FISLEEAAHYPQEHWSQDVGKALIPFLRRRS  281



>ref|XP_004303285.1| PREDICTED: abhydrolase domain-containing protein 8 [Fragaria 
vesca subsp. vesca]
Length=384

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 57/106 (54%), Gaps = 10/106 (9%)
 Frame = -2

Query  547  YQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEE-ARGILTGKNWEVQTTVC  371
            Y +K E A VYR PYL+S   GFA+  L  A K   +  + + A G  +G+ W+V T V 
Sbjct  276  YALKLEKADVYRLPYLSSSGPGFAI--LEAARKADFRSILSQIASGFASGR-WDVPTLVA  332

Query  370  WGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            WG  D++L     E+F K +     L+L+E   AGH  QED  E V
Sbjct  333  WGISDKYLPQSVAEEFKKANPSVVNLKLIE--GAGHMPQEDWPERV  376



>ref|XP_004977019.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Setaria italica]
Length=408

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 4/111 (4%)
 Frame = -2

Query  547  YQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCW  368
            Y +K E A VYR PYL+SG+ GFAL  L  A K   +  +       +  +WE    + W
Sbjct  300  YVLKLEKADVYRLPYLSSGAPGFAL--LEAARKVNFQDVLSRISAGFSSNSWEKPILLAW  357

Query  367  GQRDRWLSFDGVEDFCKESK--LRLVELPMAGHHVQEDSGEEVGQVIAEIV  221
            G  D++L     E+F K +   ++L  +  AGH  QED  E+V + +   +
Sbjct  358  GISDKYLPLSVAEEFKKANPDVVKLEAIEGAGHMPQEDWPEKVVKALISFL  408



>ref|WP_016866268.1| hydrolase [Fischerella muscicola]
Length=283

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 89/207 (43%), Gaps = 37/207 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++ ++ +LN P++     LP  +      L GE+ +Q       
Sbjct  106  GFLGSVGLQYALRHPEQIANITILNTPIS-STVKLPWKIQQMGLPLAGEMMTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y + ++   VYR+P+L + ++G A
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYVIPDKDLDVYRQPFLKTSAAGRA  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L  LS     QL   + E   I TG K+W+    + WG  D WL+ D  E+F K      
Sbjct  196  L--LSTIRNLQLAKAMSE---IETGFKDWQQPILIQWGVIDPWLNVDIAENFAKSVPNGE  250

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIV  221
            LV+L   GH+ QE   E + Q +   V
Sbjct  251  LVKLNNVGHYPQEHYHETILQDLLPFV  277



>ref|XP_012073134.1| PREDICTED: uncharacterized hydrolase YNR064C isoform X2 [Jatropha 
curcas]
Length=368

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 85/198 (43%), Gaps = 38/198 (19%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            + +A  +Q K++ + +LN PLTV  + +P         L GE  SQ              
Sbjct  201  LTWALKNQSKISKIAILNSPLTVS-SPVPGLFQKLKIPLYGEFTSQ--------------  245

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                     I+        +++ + +  PY +K E A VYR PYL S   GFAL  L  A
Sbjct  246  -------NAIM--------AERFIEAGSPYVLKLEKADVYRLPYLASSGPGFAL--LEAA  288

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKES----KLRLVELP  287
             K   +    +       + W+    + WG  D++L     E+F K +    KL+L+E  
Sbjct  289  RKINFRDITSQIAEGFVSERWDKPILLAWGIADKYLPQSVAEEFQKGNPDAVKLKLIE--  346

Query  286  MAGHHVQEDSGEEVGQVI  233
             AGH  QED  E++ + +
Sbjct  347  GAGHMPQEDWPEKIVEAL  364



>ref|XP_012073133.1| PREDICTED: uncharacterized hydrolase YNR064C isoform X1 [Jatropha 
curcas]
 gb|KDP37054.1| hypothetical protein JCGZ_06110 [Jatropha curcas]
Length=374

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 85/198 (43%), Gaps = 38/198 (19%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            + +A  +Q K++ + +LN PLTV  + +P         L GE  SQ              
Sbjct  207  LTWALKNQSKISKIAILNSPLTVS-SPVPGLFQKLKIPLYGEFTSQ--------------  251

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                     I+        +++ + +  PY +K E A VYR PYL S   GFAL  L  A
Sbjct  252  -------NAIM--------AERFIEAGSPYVLKLEKADVYRLPYLASSGPGFAL--LEAA  294

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKES----KLRLVELP  287
             K   +    +       + W+    + WG  D++L     E+F K +    KL+L+E  
Sbjct  295  RKINFRDITSQIAEGFVSERWDKPILLAWGIADKYLPQSVAEEFQKGNPDAVKLKLIE--  352

Query  286  MAGHHVQEDSGEEVGQVI  233
             AGH  QED  E++ + +
Sbjct  353  GAGHMPQEDWPEKIVEAL  370



>ref|WP_027843394.1| hydrolase [Mastigocoleus testarum]
Length=285

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/207 (26%), Positives = 88/207 (43%), Gaps = 37/207 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +K+ ++ +LN P++   A +P  +      L GE+ +Q       
Sbjct  106  GFLGSVGLQYALRHPEKIANISILNTPVSTT-AKVPWKIQQMGLPLAGEMMTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y + EE   VYR+P+LT+ +SG +
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYVIAEEHLGVYRKPFLTASASGRS  195

Query  475  LNALSRAMK-KQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L A  R ++  ++   IE        K W+    + WG+ D WLS +  E F        
Sbjct  196  LLATIRNLQLPKITAEIESGF-----KEWQNPVLLQWGKNDPWLSLEMGEKFADSLPDGG  250

Query  301  LVELPMAGHHVQEDSGEEVGQVIAEIV  221
            +++L   GH+ QE   E + Q +   V
Sbjct  251  IIKLNNVGHYSQEHHQEVILQDLLPFV  277



>ref|XP_002989699.1| hypothetical protein SELMODRAFT_235851 [Selaginella moellendorffii]
 gb|EFJ09176.1| hypothetical protein SELMODRAFT_235851 [Selaginella moellendorffii]
Length=330

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 83/200 (42%), Gaps = 36/200 (18%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            + +A  + ++V+ +++LN PLT   A LP   +      LGE  SQ              
Sbjct  165  LTWALKNTERVSKLVILNTPLT-PSAPLPGLFNQLRLPFLGEFISQ--------------  209

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                          D + A +K +     Y +K E A VYR PYL S   GFAL  L  A
Sbjct  210  --------------DAMMA-EKFIEKGSAYVLKVEKADVYRLPYLGSSGPGFAL--LEAA  252

Query  454  MKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCK--ESKLRLVELPMA  281
             K      +         K+W   T V WGQ D++L      +F K     +R V +  A
Sbjct  253  RKVSFPSLMSTISAGF--KSWSKPTLVAWGQEDKYLPKTQAMEFEKLNPDVIRTVLMEGA  310

Query  280  GHHVQEDSGEEVGQVIAEIV  221
            GH  QED  E+V + +A  +
Sbjct  311  GHMPQEDWPEKVVEALAAFL  330



>ref|XP_009336311.1| PREDICTED: uncharacterized protein LOC103928918 [Pyrus x bretschneideri]
 ref|XP_009338525.1| PREDICTED: uncharacterized protein LOC103930858 [Pyrus x bretschneideri]
Length=390

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 52/105 (50%), Gaps = 8/105 (8%)
 Frame = -2

Query  547  YQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCW  368
            Y +K E A VYR PYL+S   GFAL   +R  K    G + +         W+  T V W
Sbjct  282  YVLKLEKADVYRLPYLSSSGPGFALLETTR--KADFNGILSQISSGFASGRWDTPTLVVW  339

Query  367  GQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQEDSGEEV  245
            G  D++L     E+F K +    +L+L+E   AGH  QED  E V
Sbjct  340  GISDKYLPQSIAEEFQKANPTAVQLKLIE--GAGHMPQEDWPERV  382



>gb|KJB35130.1| hypothetical protein B456_006G101700 [Gossypium raimondii]
Length=233

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 89/195 (46%), Gaps = 40/195 (21%)
 Frame = -2

Query  814  IKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LSSRPSQNF  635
            + +A  +  K++ + +LN PLTV  + +P             +F Q+  P      SQN 
Sbjct  66   LTWALKNPSKISKLAILNTPLTVS-SPVPG------------LFQQLRIPLFGEFTSQN-  111

Query  634  *LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFALNALSRA  455
                               +++ + +  PY +K E A VYR PYL S   GFAL   +R 
Sbjct  112  ----------------AVIAERFIEAGSPYVLKLEKADVYRLPYLASSGPGFALLEAARK  155

Query  454  MK-KQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKES----KLRLVEL  290
            +  + +   I  A G  +G+ W+    V WG  D++L     E+F K++    +L+L+E 
Sbjct  156  INFRDISSQI--ADGFASGR-WDKPVLVAWGLADKYLPQTIAEEFRKQNLSSVELKLIE-  211

Query  289  PMAGHHVQEDSGEEV  245
              AGH  QED  E+V
Sbjct  212  -GAGHMPQEDWPEKV  225



>gb|ACN34535.1| unknown [Zea mays]
 gb|AFW59650.1| hypothetical protein ZEAMMB73_032229 [Zea mays]
Length=403

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 55/111 (50%), Gaps = 4/111 (4%)
 Frame = -2

Query  547  YQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCW  368
            Y +K E A VYR PYL+SG+ GFAL  L  A K   +  +       +   WE    + W
Sbjct  295  YMLKLEKADVYRLPYLSSGAPGFAL--LEAARKINFQDVLSRISAGFSSNGWEKPILLAW  352

Query  367  GQRDRWLSFDGVEDFCKESK--LRLVELPMAGHHVQEDSGEEVGQVIAEIV  221
            G  D++L     E+F + +   ++L  +  AGH  QED  E+V + +   +
Sbjct  353  GISDKYLPLSIAEEFKQANPGVVKLEAIEGAGHMPQEDWPEKVVKALTSFL  403



>ref|XP_001757240.1| predicted protein [Physcomitrella patens]
 gb|EDQ78099.1| predicted protein [Physcomitrella patens]
Length=388

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 54/108 (50%), Gaps = 4/108 (4%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY ++ + A VYR PYL S   GF+L  L+ A K  LK             +W+V TTV 
Sbjct  278  PYVLELDDADVYRLPYLDSSDPGFSL--LAAARKAPLKDLTTRIAQGFASSSWKVPTTVA  335

Query  370  WGQRDRWLSFDGVEDFCKESK--LRLVELPMAGHHVQEDSGEEVGQVI  233
            WG  D+ L     E+F K +   L+ V L   GH  QED  E+V + +
Sbjct  336  WGVSDKHLPKSEAENFVKTNPDVLKAVMLDGTGHLPQEDWPEKVVEAL  383



>ref|WP_041037141.1| hydrolase [Tolypothrix campylonemoides]
 gb|KIJ76441.1| hydrolase [Tolypothrix campylonemoides VB511288]
Length=283

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 82/198 (41%), Gaps = 35/198 (18%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++ ++ +LN P++   A LP  +      L GE+ +Q       
Sbjct  106  GFLGSVGLQYALRHPEQIANIAILNTPIS-SQAKLPWKIQQMGLPLAGEMITQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y + E+   +YR+P+L S ++G +
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYVITEKDLDIYRKPFLKSSAAGRS  195

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKL-RL  299
            L A  R +  QL   + E       K W+ Q  + WG  D WL     +DF        L
Sbjct  196  LLATIRNL--QLPSAMTEIESGF--KKWQQQILILWGMIDPWLPLKIAQDFVNPLPYGDL  251

Query  298  VELPMAGHHVQEDSGEEV  245
            ++L   GH+ QE   E +
Sbjct  252  IKLNNVGHYPQEHYYETI  269



>ref|XP_010097191.1| hypothetical protein L484_025738 [Morus notabilis]
 gb|EXB67258.1| hypothetical protein L484_025738 [Morus notabilis]
Length=397

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 50/101 (50%), Gaps = 8/101 (8%)
 Frame = -2

Query  550  PYQMKEEVAMVYRRPYLTSGSSGFALNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVC  371
            PY +K E A VYR PYL+SG  GFAL  L  A K   K    +         W+    V 
Sbjct  283  PYVLKLEKADVYRLPYLSSGGPGFAL--LEAARKANFKDISSQIAAGFAAGRWDGPILVA  340

Query  370  WGQRDRWLSFDGVEDFCKES----KLRLVELPMAGHHVQED  260
            WG  D++L     E+F K +    +L+L+E   AGH  QED
Sbjct  341  WGISDKYLPQSIAEEFKKGNPNSVQLKLIE--GAGHMPQED  379



>ref|WP_041619514.1| hydrolase [Stanieria cyanosphaera]
Length=287

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 86/202 (43%), Gaps = 34/202 (17%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++  +I+LN P+    A LP  +  +    +G++ +Q       
Sbjct  112  GFLGSVGLQYALRHPEQIERLIILNTPIATT-AKLPWKMKQWGFPFIGDMATQ-------  163

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     + + ++   V R+P+L + S G A
Sbjct  164  ---------------------DPLLV-DRTLEGGSGFVISDKDLDVLRKPFLQTSSVGRA  201

Query  475  LNALSRAMKKQLKGYIEEARGILTGKNWEVQTTVCWGQRDRWLSFDGVEDFCKESKLRLV  296
            L A+ + M  + K   E A G+ T   WE    + WG  D WL+    E     S + ++
Sbjct  202  LVAIIKRMALE-KSMNEIATGLST---WEKPACLIWGMLDPWLAAQDAETLAANSSIEIL  257

Query  295  ELPMAGHHVQEDSGEEVGQVIA  230
            +L  A H+ QE    E+ + I+
Sbjct  258  KLAEAKHYPQEHWSSEIAEKIS  279



>ref|WP_017309612.1| MULTISPECIES: hydrolase [Stigonematales]
 gb|KIY11094.1| hydrolase [Mastigocladus laminosus UU774]
Length=284

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/199 (27%), Positives = 86/199 (43%), Gaps = 37/199 (19%)
 Frame = -2

Query  835  GIFSPIVIKYASTHQDKVNSVILLNPPLTVKHANLPSTLSIFSNFLLGEIFSQVG*P*LS  656
            G    + ++YA  H +++ ++ +LN P++   A LP  +        G++ +Q       
Sbjct  106  GFLGSVGLQYALRHPEQIANIAILNTPIS-STAKLPWKIQQMGLPFAGDMMTQ-------  157

Query  655  SRPSQNF*LFSPTLRLILLVKDPLRASDKALLSCGPYQMKEEVAMVYRRPYLTSGSSGFA  476
                                 DPL   D+ L     Y + ++   VYR+P+L + ++G A
Sbjct  158  ---------------------DPLLV-DRTLEGGSRYIIPDKDLDVYRKPFLKTSAAGRA  195

Query  475  LNALSRAMKKQLKGYIEEARGILTG-KNWEVQTTVCWGQRDRWLSFDGVEDFCKE-SKLR  302
            L  LS     QL   + E   I TG K+W+    + WG  D WL+ D  E+F K      
Sbjct  196  L--LSTIRNLQLAKAMSE---IETGFKDWQQPILIQWGAIDPWLNVDMAENFAKSVPNGE  250

Query  301  LVELPMAGHHVQEDSGEEV  245
            LV+L   GH+ QE   E +
Sbjct  251  LVKLNNVGHYPQEHYHETI  269



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2104600723148