BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8558

Length=921
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002531856.1|  starch synthase, putative                          418   4e-137   Ricinus communis
ref|XP_002278470.2|  PREDICTED: granule-bound starch synthase 2, ...    417   2e-136   Vitis vinifera
ref|XP_010661072.1|  PREDICTED: granule-bound starch synthase 2, ...    417   4e-136   Vitis vinifera
ref|XP_004232219.1|  PREDICTED: granule-bound starch synthase 2, ...    415   8e-136   Solanum lycopersicum
ref|XP_010257576.1|  PREDICTED: granule-bound starch synthase 2, ...    412   2e-134   Nelumbo nucifera [Indian lotus]
ref|NP_001274977.1|  granule-bound starch synthase 2, chloroplast...    411   3e-134   Solanum tuberosum [potatoes]
gb|ABV25894.1|  starch synthase isoform II                              410   7e-134   Manihot esculenta [manioc]
ref|XP_010551849.1|  PREDICTED: starch synthase 2, chloroplastic/...    410   1e-133   Tarenaya hassleriana [spider flower]
gb|AAY89383.1|  starch synthase isoform 2                               390   1e-133   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009628770.1|  PREDICTED: granule-bound starch synthase 2, ...    410   2e-133   Nicotiana tomentosiformis
ref|XP_009778986.1|  PREDICTED: granule-bound starch synthase 2, ...    409   2e-133   Nicotiana sylvestris
gb|AAC19119.1|  starch synthase                                         404   3e-133   Ipomoea batatas [batate]
ref|XP_010551848.1|  PREDICTED: starch synthase 2, chloroplastic/...    410   5e-133   Tarenaya hassleriana [spider flower]
ref|XP_007214968.1|  hypothetical protein PRUPE_ppa001734mg             406   2e-132   Prunus persica
ref|XP_002324061.2|  glycogen synthase family protein                   404   6e-132   
ref|XP_011098636.1|  PREDICTED: granule-bound starch synthase 2, ...    405   9e-132   
ref|XP_011098635.1|  PREDICTED: granule-bound starch synthase 2, ...    405   1e-131   Sesamum indicum [beniseed]
emb|CDY37538.1|  BnaA05g34030D                                          402   1e-131   Brassica napus [oilseed rape]
ref|XP_011035764.1|  PREDICTED: granule-bound starch synthase 2, ...    403   1e-131   Populus euphratica
ref|XP_011035763.1|  PREDICTED: granule-bound starch synthase 2, ...    404   2e-131   Populus euphratica
ref|XP_011098633.1|  PREDICTED: granule-bound starch synthase 2, ...    404   2e-131   Sesamum indicum [beniseed]
ref|XP_011098634.1|  PREDICTED: granule-bound starch synthase 2, ...    404   2e-131   Sesamum indicum [beniseed]
ref|XP_008230773.1|  PREDICTED: granule-bound starch synthase 2, ...    404   2e-131   Prunus mume [ume]
ref|XP_006297008.1|  hypothetical protein CARUB_v10013000mg             404   3e-131   Capsella rubella
ref|XP_006431165.1|  hypothetical protein CICLE_v10011124mg             403   4e-131   Citrus clementina [clementine]
ref|XP_008341578.1|  PREDICTED: LOW QUALITY PROTEIN: granule-boun...    403   5e-131   
ref|XP_012084711.1|  PREDICTED: granule-bound starch synthase 2, ...    401   9e-131   Jatropha curcas
ref|XP_009147403.1|  PREDICTED: starch synthase 2, chloroplastic/...    402   9e-131   Brassica rapa
ref|XP_009376273.1|  PREDICTED: granule-bound starch synthase 2, ...    402   1e-130   Pyrus x bretschneideri [bai li]
gb|KJB33541.1|  hypothetical protein B456_006G016400                    400   2e-130   Gossypium raimondii
ref|XP_009360619.1|  PREDICTED: granule-bound starch synthase 2, ...    400   5e-130   Pyrus x bretschneideri [bai li]
ref|XP_008365401.1|  PREDICTED: granule-bound starch synthase 2, ...    400   6e-130   Malus domestica [apple tree]
gb|KHG22363.1|  Granule-bound starch synthase 2, chloroplastic/am...    399   6e-130   Gossypium arboreum [tree cotton]
ref|XP_010258328.1|  PREDICTED: granule-bound starch synthase 2, ...    400   6e-130   Nelumbo nucifera [Indian lotus]
gb|KJB61261.1|  hypothetical protein B456_009G348800                    384   1e-129   Gossypium raimondii
ref|XP_007032555.1|  Starch synthase 2                                  399   2e-129   
ref|XP_008443400.1|  PREDICTED: granule-bound starch synthase 2, ...    399   2e-129   Cucumis melo [Oriental melon]
ref|XP_004489397.1|  PREDICTED: granule-bound starch synthase 2, ...    398   2e-129   Cicer arietinum [garbanzo]
emb|CDY43274.1|  BnaC05g48670D                                          396   3e-129   Brassica napus [oilseed rape]
ref|XP_006408470.1|  hypothetical protein EUTSA_v10020091mg             399   3e-129   Eutrema salsugineum [saltwater cress]
ref|XP_006482606.1|  PREDICTED: granule-bound starch synthase 2, ...    398   3e-129   Citrus sinensis [apfelsine]
ref|NP_186767.1|  starch synthase 2                                     398   6e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011467955.1|  PREDICTED: granule-bound starch synthase 2, ...    397   7e-129   Fragaria vesca subsp. vesca
gb|KFK37580.1|  hypothetical protein AALP_AA3G001700                    398   7e-129   Arabis alpina [alpine rockcress]
gb|ACL98481.1|  starch synthase IIa precursor                           398   7e-129   Lotus japonicus
ref|XP_002882195.1|  hypothetical protein ARALYDRAFT_477411             397   1e-128   
ref|XP_010485530.1|  PREDICTED: starch synthase 2, chloroplastic/...    397   2e-128   Camelina sativa [gold-of-pleasure]
ref|XP_010463566.1|  PREDICTED: starch synthase 2, chloroplastic/...    397   2e-128   Camelina sativa [gold-of-pleasure]
gb|KGN59559.1|  hypothetical protein Csa_3G825040                       377   3e-128   Cucumis sativus [cucumbers]
ref|XP_011652235.1|  PREDICTED: granule-bound starch synthase 2, ...    397   3e-128   Cucumis sativus [cucumbers]
emb|CDP02238.1|  unnamed protein product                                395   7e-128   Coffea canephora [robusta coffee]
gb|ACL98482.1|  starch synthase IIb precursor                           395   1e-127   Lotus japonicus
ref|XP_010414882.1|  PREDICTED: starch synthase 2, chloroplastic/...    395   1e-127   Camelina sativa [gold-of-pleasure]
gb|KJB11066.1|  hypothetical protein B456_001G239200                    392   2e-127   Gossypium raimondii
gb|AAF13168.1|AF173900_1  granule bound starch synthase II precursor    393   2e-127   Manihot esculenta [manioc]
gb|KHF99320.1|  Granule-bound starch synthase 2, chloroplastic/am...    390   5e-127   Gossypium arboreum [tree cotton]
gb|KHN13221.1|  Granule-bound starch synthase 2, chloroplastic/am...    392   6e-127   Glycine soja [wild soybean]
gb|KCW51890.1|  hypothetical protein EUGRSUZ_J01349                     382   1e-126   Eucalyptus grandis [rose gum]
ref|XP_010693244.1|  PREDICTED: granule-bound starch synthase 2, ...    391   3e-126   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006827270.1|  PREDICTED: granule-bound starch synthase 2, ...    389   1e-125   Amborella trichopoda
gb|KCW51889.1|  hypothetical protein EUGRSUZ_J01349                     388   1e-125   Eucalyptus grandis [rose gum]
ref|XP_010088149.1|  Granule-bound starch synthase 2                    392   4e-125   
ref|NP_001235811.1|  starch synthase IIa-2                              387   4e-125   Glycine max [soybeans]
gb|AHA51126.1|  granule bound starch synthase                           371   6e-125   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010032498.1|  PREDICTED: granule-bound starch synthase 2, ...    387   1e-124   Eucalyptus grandis [rose gum]
ref|NP_001235796.1|  starch synthase IIa-1                              385   2e-124   Glycine max [soybeans]
ref|XP_009415589.1|  PREDICTED: granule-bound starch synthase 2, ...    371   2e-124   
gb|AES74718.2|  granule bound starch synthase                           385   2e-124   Medicago truncatula
gb|ABA64552.1|  starch synthase II                                      387   2e-124   Amaranthus hybridus subsp. cruentus [African-spinach]
ref|XP_010939803.1|  PREDICTED: soluble starch synthase 2-2, chlo...    381   1e-122   Elaeis guineensis
ref|XP_007139519.1|  hypothetical protein PHAVU_008G036600g             379   2e-122   Phaseolus vulgaris [French bean]
gb|ACL98484.1|  starch synthase IIb precursor                           378   2e-122   Vigna unguiculata
gb|ACL98485.1|  starch synthase IIa precursor                           379   3e-122   Vigna radiata [mung bean]
gb|ACL98486.1|  starch synthase IIb precursor                           377   1e-121   Vigna radiata [mung bean]
dbj|BAD18846.1|  starch synthase II precursor                           377   1e-121   Phaseolus vulgaris [French bean]
sp|Q43093.1|SSG2_PEA  RecName: Full=Granule-bound starch synthase...    378   1e-121   Pisum sativum [garden pea]
gb|AAB26592.1|  granule-bound starch synthase isoform II, GBSSII        378   2e-121   Pisum sativum [garden pea]
ref|XP_007151233.1|  hypothetical protein PHAVU_004G029100g             377   2e-121   Phaseolus vulgaris [French bean]
dbj|BAD18847.1|  starch synthase II-2 precursor                         376   3e-121   Phaseolus vulgaris [French bean]
gb|ACL98483.1|  starch synthase IIa precursor                           377   4e-121   Vigna unguiculata
emb|CBI22230.3|  unnamed protein product                                377   5e-121   Vitis vinifera
ref|XP_009395950.1|  PREDICTED: granule-bound starch synthase 2, ...    372   1e-120   
dbj|BAD15539.1|  putative soluble starch synthase 2                     367   1e-120   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003618500.1|  Starch synthase II                                 381   2e-120   
emb|CAC59826.1|  soluble starch synthase 2                              371   2e-120   Oryza sativa [red rice]
ref|XP_002982595.1|  starch synthase                                    374   3e-120   
gb|EPS68296.1|  hypothetical protein M569_06471                         367   4e-120   Genlisea aurea
ref|XP_008802589.1|  PREDICTED: granule-bound starch synthase 2, ...    374   5e-120   Phoenix dactylifera
gb|EYU34066.1|  hypothetical protein MIMGU_mgv1a002012mg                372   9e-120   Erythranthe guttata [common monkey flower]
ref|NP_001048104.1|  Os02g0744700                                       370   1e-119   
gb|ACY56195.1|  soluble starch synthase II-2                            371   2e-119   Oryza sativa Indica Group [Indian rice]
sp|Q6Z2T8.2|SSY22_ORYSJ  RecName: Full=Soluble starch synthase 2-...    371   2e-119   Oryza sativa Japonica Group [Japonica rice]
gb|EEC73999.1|  hypothetical protein OsI_08916                          371   2e-119   Oryza sativa Indica Group [Indian rice]
ref|XP_010917861.1|  PREDICTED: granule-bound starch synthase 2, ...    371   5e-119   
ref|XP_010917860.1|  PREDICTED: granule-bound starch synthase 2, ...    372   5e-119   
gb|AAK81729.1|AF395537_1  soluble starch synthase II-2                  369   1e-118   Oryza sativa [red rice]
gb|ACY41545.1|  soluble starch synthase II-3                            352   1e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010917859.1|  PREDICTED: granule-bound starch synthase 2, ...    371   2e-118   Elaeis guineensis
ref|XP_008789818.1|  PREDICTED: granule-bound starch synthase 2, ...    370   7e-118   Phoenix dactylifera
ref|XP_008789825.1|  PREDICTED: granule-bound starch synthase 2, ...    369   7e-118   Phoenix dactylifera
gb|ACY41555.1|  soluble starch synthase II-3                            350   1e-117   Oryza sativa Indica Group [Indian rice]
ref|XP_009405801.1|  PREDICTED: granule-bound starch synthase 2, ...    368   1e-117   
ref|XP_009405800.1|  PREDICTED: soluble starch synthase 2-2, chlo...    368   2e-117   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACY41546.1|  soluble starch synthase II-3                            348   3e-117   Oryza sativa Indica Group [Indian rice]
gb|ACY41554.1|  soluble starch synthase II-3                            348   4e-117   Oryza sativa Japonica Group [Japonica rice]
gb|ACF87565.1|  unknown                                                 351   1e-116   Zea mays [maize]
gb|AAP41030.1|  soluble starch synthase II                              366   2e-116   Colocasia esculenta [cocoyam]
ref|XP_006647881.1|  PREDICTED: soluble starch synthase 2-2, chlo...    362   4e-116   
ref|XP_006662378.1|  PREDICTED: soluble starch synthase 2-1, chlo...    361   1e-115   
gb|ACN31779.1|  unknown                                                 360   2e-115   Zea mays [maize]
gb|ACN39858.1|  unknown                                                 361   5e-115   Picea sitchensis
ref|XP_002467190.1|  hypothetical protein SORBIDRAFT_01g021190          353   9e-115   
gb|ABK97467.1|  putative starch synthase IIa                            343   1e-114   Sorghum bicolor [broomcorn]
gb|EEE51014.1|  hypothetical protein OsJ_31644                          360   1e-114   Oryza sativa Japonica Group [Japonica rice]
gb|ABK97462.1|  putative starch synthase IIa                            342   1e-114   Sorghum bicolor [broomcorn]
ref|XP_004953871.1|  PREDICTED: soluble starch synthase 2-2, chlo...    358   1e-114   Setaria italica
ref|XP_002452556.1|  hypothetical protein SORBIDRAFT_04g028060          358   2e-114   Sorghum bicolor [broomcorn]
gb|ACC86845.1|  starch synthase IIb precursor                           358   2e-114   Sorghum bicolor [broomcorn]
gb|EEC67024.1|  hypothetical protein OsI_33746                          359   2e-114   Oryza sativa Indica Group [Indian rice]
gb|AAK64284.1|AF383878_1  soluble starch synthase II-1                  359   2e-114   Oryza sativa [red rice]
gb|ACY56170.1|  soluble starch synthase II-1                            359   2e-114   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064678.1|  Os10g0437600                                       359   3e-114   
ref|XP_008680930.1|  PREDICTED: starch synthase IIb-2 precursor i...    357   3e-114   Zea mays [maize]
ref|NP_001106014.1|  starch synthase IIb-2 precursor                    357   3e-114   Zea mays [maize]
gb|ACY56176.1|  soluble starch synthase II-1                            358   3e-114   Oryza sativa Indica Group [Indian rice]
gb|AII21929.1|  soluble starch synthase iic                             358   4e-114   Oryza sativa Indica Group [Indian rice]
gb|ABK97461.1|  putative starch synthase IIa                            341   5e-114   Sorghum bicolor [broomcorn]
ref|XP_003573954.1|  PREDICTED: soluble starch synthase 2-1, chlo...    358   5e-114   Brachypodium distachyon [annual false brome]
ref|XP_010234757.1|  PREDICTED: soluble starch synthase 2-1, chlo...    358   7e-114   Brachypodium distachyon [annual false brome]
gb|ABY27639.1|  starch synthase IIc precursor                           357   9e-114   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010234756.1|  PREDICTED: soluble starch synthase 2-1, chlo...    358   1e-113   Brachypodium distachyon [annual false brome]
ref|XP_010236121.1|  PREDICTED: soluble starch synthase 2-2, chlo...    355   2e-113   Brachypodium distachyon [annual false brome]
ref|XP_001757452.1|  predicted protein                                  348   2e-113   
ref|XP_004983043.1|  PREDICTED: soluble starch synthase 2-1, chlo...    356   4e-113   Setaria italica
ref|NP_001104880.1|  starch synthase homolog1                           354   6e-113   
gb|ABY27640.1|  starch synthase IIc precursor                           355   8e-113   Sorghum bicolor [broomcorn]
dbj|BAK03612.1|  predicted protein                                      354   1e-112   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009395949.1|  PREDICTED: granule-bound starch synthase 2, ...    354   3e-112   
gb|AAQ99280.1|  soluble starch synthase II                              355   3e-112   Oryza sativa Indica Group [Indian rice]
gb|AAB17085.1|  starch synthase                                         345   4e-112   Triticum aestivum [Canadian hard winter wheat]
sp|P0C586.1|SSY23_ORYSI  RecName: Full=Soluble starch synthase 2-...    355   4e-112   Oryza sativa Indica Group [Indian rice]
ref|XP_010227825.1|  PREDICTED: soluble starch synthase 2-2, chlo...    355   4e-112   Brachypodium distachyon [annual false brome]
ref|XP_004983042.1|  PREDICTED: soluble starch synthase 2-1, chlo...    356   5e-112   
gb|AFW68716.1|  starch synthase IIc                                     353   9e-112   
gb|EMT20525.1|  Soluble starch synthase 2-1, chloroplastic/amylop...    357   1e-111   
gb|ACY56200.1|  soluble starch synthase II-3                            352   3e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001778218.1|  predicted protein                                  343   5e-111   
gb|EAZ00249.1|  hypothetical protein OsI_22256                          352   5e-111   Oryza sativa Indica Group [Indian rice]
emb|CAB96627.1|  starch synthase IIa-3                                  352   6e-111   Triticum aestivum [Canadian hard winter wheat]
emb|CDI68214.1|  starch synthase IIa-A                                  351   6e-111   Triticum monococcum subsp. monococcum
gb|ABY56824.3|  starch synthase IIb precursor                           348   8e-111   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009416022.1|  PREDICTED: soluble starch synthase 2-2, chlo...    352   8e-111   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD90592.1|  starch synthase IIa                                    351   8e-111   Oryza sativa Japonica Group [Japonica rice]
emb|CAB96626.1|  starch synthase IIa-2                                  351   1e-110   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001057216.1|  Os06g0229800                                       351   1e-110   
emb|CDI68213.1|  starch synthase IIa-A                                  350   2e-110   Triticum urartu
ref|NP_001108120.1|  starch synthase IIc precursor                      350   2e-110   Zea mays [maize]
ref|XP_001754221.1|  predicted protein                                  341   2e-110   
gb|EMT13996.1|  Soluble starch synthase 2-3, chloroplastic/amylop...    348   3e-110   
gb|EMT23057.1|  Soluble starch synthase 2-2, chloroplastic/amylop...    348   3e-110   
gb|AAN28307.1|  starch synthase II                                      350   3e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAN28309.1|  starch synthase II                                      350   3e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAD53263.1|AF155217_1  starch synthase IIA                           348   8e-110   Triticum aestivum [Canadian hard winter wheat]
gb|AAN28308.1|  starch synthase II                                      348   8e-110   Aegilops tauschii
gb|AFW76788.1|  sugary2                                                 347   9e-110   
ref|NP_001288582.1|  soluble starch synthase 2-3, chloroplastic/a...    346   2e-109   Zea mays [maize]
ref|XP_006656809.1|  PREDICTED: soluble starch synthase 2-3, chlo...    347   2e-109   
gb|AAS77569.1|  starch synthase IIa                                     345   2e-109   Zea mays [maize]
dbj|BAE48800.1|  starch synthase II-D                                   347   4e-109   Triticum aestivum [Canadian hard winter wheat]
emb|CAB86618.1|  starch synthase IIa-1                                  347   4e-109   Triticum aestivum [Canadian hard winter wheat]
gb|AAD13341.1|  starch synthase isoform zSTSII-1                        345   5e-109   Zea mays [maize]
ref|XP_004965048.1|  PREDICTED: soluble starch synthase 2-3, chlo...    345   8e-109   
dbj|BAK03716.1|  predicted protein                                      346   1e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACC86844.1|  starch synthase IIa precursor                           342   1e-107   Sorghum bicolor [broomcorn]
ref|XP_002436755.1|  hypothetical protein SORBIDRAFT_10g008200          342   1e-107   
ref|XP_001697289.1|  hypothetical protein CHLREDRAFT_109372             309   9e-101   Chlamydomonas reinhardtii
ref|XP_002946924.1|  hypothetical protein VOLCADRAFT_103172             315   6e-98    Volvox carteri f. nagariensis
gb|AAC17970.2|  soluble starch synthase                                 307   3e-96    Chlamydomonas reinhardtii
ref|XP_001691829.1|  soluble starch synthase II                         308   2e-95    Chlamydomonas reinhardtii
ref|XP_005852072.1|  hypothetical protein CHLNCDRAFT_6734               297   6e-93    Chlorella variabilis
ref|XP_011400772.1|  Granule-bound starch synthase 2, chloroplast...    294   4e-92    Auxenochlorella protothecoides
gb|EEE57801.1|  hypothetical protein OsJ_08360                          298   1e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_005851974.1|  hypothetical protein CHLNCDRAFT_6787               288   2e-89    Chlorella variabilis
gb|AFB74094.1|  starch synthase I-1                                     278   2e-89    Triticum aestivum [Canadian hard winter wheat]
gb|ACN36715.1|  unknown                                                 283   2e-89    Zea mays [maize]
ref|XP_005649059.1|  hypothetical protein COCSUDRAFT_14487              286   3e-89    Coccomyxa subellipsoidea C-169
ref|XP_003083728.1|  soluble starch synthase II (IC)                    288   3e-89    
ref|NP_001104892.1|  starch synthase I, chloroplastic precursor         284   1e-86    Zea mays [maize]
gb|AFW85727.1|  starch synthase I                                       283   2e-86    
ref|XP_002506460.1|  glycosyltransferase family 5 protein               280   2e-86    Micromonas commoda
emb|CAX51357.1|  soluble starch synthase                                278   9e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS62751.1|  soluble starch synthase 1, chloroplastic/amylopla...    279   2e-85    Genlisea aurea
gb|AEB33739.1|  soluble starch synthase 1                               278   2e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006656668.1|  PREDICTED: soluble starch synthase 1, chloro...    281   3e-85    
sp|Q43654.2|SSY1_WHEAT  RecName: Full=Starch synthase 1, chloropl...    280   5e-85    Triticum aestivum [Canadian hard winter wheat]
ref|XP_004964777.1|  PREDICTED: soluble starch synthase 1, chloro...    280   6e-85    Setaria italica
gb|AAF03557.1|  starch synthase I                                       280   6e-85    Aegilops tauschii
emb|CAB99209.1|  starch synthase I-1                                    280   6e-85    Triticum aestivum [Canadian hard winter wheat]
gb|AAD54661.1|  starch synthase I                                       279   8e-85    Triticum aestivum [Canadian hard winter wheat]
pdb|4HLN|A  Chain A, Structure Of Barley Starch Synthase I In Com...    279   9e-85    Hordeum vulgare [barley]
ref|XP_003561063.1|  PREDICTED: starch synthase 1, chloroplastic/...    279   9e-85    Brachypodium distachyon [annual false brome]
gb|AAF37876.1|AF234163_1  starch synthase I                             279   1e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ35910.1|  hypothetical protein OsJ_20213                          279   1e-84    Oryza sativa Japonica Group [Japonica rice]
sp|Q0DEC8.1|SSY1_ORYSJ  RecName: Full=Soluble starch synthase 1, ...    278   2e-84    Oryza sativa Japonica Group [Japonica rice]
gb|ACY56162.1|  soluble starch synthase I                               278   3e-84    Oryza sativa Indica Group [Indian rice]
sp|A2Y9M4.1|SSY1_ORYSI  RecName: Full=Soluble starch synthase 1, ...    277   7e-84    Oryza sativa Indica Group [Indian rice]
ref|XP_010671436.1|  PREDICTED: starch synthase 1, chloroplastic/...    278   1e-83    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008783180.1|  PREDICTED: soluble starch synthase 1, chloro...    268   2e-82    Phoenix dactylifera
ref|XP_010245296.1|  PREDICTED: LOW QUALITY PROTEIN: granule-boun...    264   2e-82    
ref|XP_002321996.2|  hypothetical protein POPTR_0015s01470g             272   4e-82    
ref|XP_011044647.1|  PREDICTED: starch synthase 1, chloroplastic/...    271   8e-82    Populus euphratica
gb|AJG44455.1|  soluble starch synthase                                 266   1e-81    Lilium davidii var. unicolor
gb|AAB02197.1|  soluble starch synthase                                 270   2e-81    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009624828.1|  PREDICTED: soluble starch synthase 1, chloro...    270   2e-81    Nicotiana tomentosiformis
gb|KEH35457.1|  starch synthase 2/amyloplastic protein                  265   3e-81    Medicago truncatula
ref|XP_010266555.1|  PREDICTED: soluble starch synthase 1, chloro...    273   3e-81    Nelumbo nucifera [Indian lotus]
ref|XP_009352031.1|  PREDICTED: starch synthase 1, chloroplastic/...    270   4e-81    Pyrus x bretschneideri [bai li]
ref|XP_011075969.1|  PREDICTED: soluble starch synthase 1, chloro...    269   5e-81    Sesamum indicum [beniseed]
ref|XP_004307998.1|  PREDICTED: starch synthase 1, chloroplastic/...    269   6e-81    Fragaria vesca subsp. vesca
ref|XP_009782631.1|  PREDICTED: soluble starch synthase 1, chloro...    269   8e-81    Nicotiana sylvestris
ref|XP_008380770.1|  PREDICTED: starch synthase 1, chloroplastic/...    269   9e-81    Malus domestica [apple tree]
ref|XP_008783179.1|  PREDICTED: soluble starch synthase 1, chloro...    268   1e-80    Phoenix dactylifera
gb|EMS47550.1|  Starch synthase 1, chloroplastic/amyloplastic           266   1e-80    Triticum urartu
ref|XP_008783178.1|  PREDICTED: soluble starch synthase 1, chloro...    268   1e-80    Phoenix dactylifera
ref|XP_009624826.1|  PREDICTED: soluble starch synthase 1, chloro...    268   1e-80    Nicotiana tomentosiformis
ref|XP_009624825.1|  PREDICTED: soluble starch synthase 1, chloro...    268   1e-80    
ref|XP_009624824.1|  PREDICTED: soluble starch synthase 1, chloro...    268   1e-80    Nicotiana tomentosiformis
ref|XP_006350536.1|  PREDICTED: soluble starch synthase 1, chloro...    268   2e-80    Solanum tuberosum [potatoes]
ref|XP_010109255.1|  hypothetical protein L484_011877                   268   2e-80    Morus notabilis
ref|XP_007220640.1|  hypothetical protein PRUPE_ppa002686mg             268   2e-80    Prunus persica
gb|KDO54223.1|  hypothetical protein CISIN_1g006091mg                   266   3e-80    Citrus sinensis [apfelsine]
ref|XP_004502658.1|  PREDICTED: soluble starch synthase 1, chloro...    267   4e-80    
ref|XP_007508676.1|  predicted protein                                  268   4e-80    Bathycoccus prasinos
ref|XP_004502657.1|  PREDICTED: soluble starch synthase 1, chloro...    267   4e-80    Cicer arietinum [garbanzo]
ref|XP_003602259.1|  Soluble starch synthase                            267   5e-80    Medicago truncatula
ref|XP_012067140.1|  PREDICTED: starch synthase 1, chloroplastic/...    267   5e-80    Jatropha curcas
gb|KDO54222.1|  hypothetical protein CISIN_1g006091mg                   267   7e-80    Citrus sinensis [apfelsine]
ref|XP_006493328.1|  PREDICTED: starch synthase 1, chloroplastic/...    266   8e-80    Citrus sinensis [apfelsine]
ref|NP_001275074.1|  soluble starch synthase 1, chloroplastic/amy...    266   8e-80    Solanum tuberosum [potatoes]
ref|XP_006852610.1|  PREDICTED: soluble starch synthase 1, chloro...    266   8e-80    Amborella trichopoda
gb|KJB37357.1|  hypothetical protein B456_006G201600                    266   1e-79    Gossypium raimondii
dbj|BAL41367.1|  soluble starch synthase I                              265   2e-79    Amaranthus hybridus subsp. cruentus [African-spinach]
ref|XP_005644873.1|  hypothetical protein COCSUDRAFT_30877              264   2e-79    Coccomyxa subellipsoidea C-169
ref|XP_010915976.1|  PREDICTED: soluble starch synthase 1, chloro...    260   2e-79    Elaeis guineensis
gb|AHW50660.1|  starch synthase I                                       265   2e-79    Lens culinaris
gb|KHG22522.1|  hypothetical protein F383_00713                         265   3e-79    Gossypium arboreum [tree cotton]
gb|EYU25238.1|  hypothetical protein MIMGU_mgv1a005697mg                260   3e-79    Erythranthe guttata [common monkey flower]
ref|XP_008234756.1|  PREDICTED: soluble starch synthase 1, chloro...    265   3e-79    Prunus mume [ume]
ref|XP_004234971.1|  PREDICTED: soluble starch synthase 1, chloro...    265   3e-79    Solanum lycopersicum
ref|XP_010318024.1|  PREDICTED: soluble starch synthase 1, chloro...    264   4e-79    Solanum lycopersicum
ref|XP_010250353.1|  PREDICTED: granule-bound starch synthase 2, ...    256   7e-79    
ref|XP_010915975.1|  PREDICTED: soluble starch synthase 1, chloro...    260   8e-79    
ref|XP_010035274.1|  PREDICTED: soluble starch synthase 1, chloro...    264   1e-78    Eucalyptus grandis [rose gum]
gb|AAN37578.1|  soluble starch synthase I                               262   3e-78    Colocasia esculenta [cocoyam]
ref|XP_008357052.1|  PREDICTED: starch synthase 1, chloroplastic/...    258   5e-78    Malus domestica [apple tree]
ref|XP_009390713.1|  PREDICTED: soluble starch synthase 1, chloro...    261   5e-78    
ref|XP_010915972.1|  PREDICTED: soluble starch synthase 1, chloro...    261   6e-78    Elaeis guineensis
ref|XP_009119837.1|  PREDICTED: starch synthase 2, chloroplastic/...    253   6e-78    Brassica rapa
ref|XP_009368661.1|  PREDICTED: starch synthase 1, chloroplastic/...    261   7e-78    Pyrus x bretschneideri [bai li]
gb|KJB74679.1|  hypothetical protein B456_012G002300                    261   8e-78    Gossypium raimondii
gb|AIG99437.1|  soluble starch synthase I                               262   9e-78    Musa acuminata AAA Group [Cavendish banana]
ref|XP_009390712.1|  PREDICTED: soluble starch synthase 1, chloro...    262   1e-77    
gb|ABV25893.1|  starch synthase isoform I                               260   1e-77    Manihot esculenta [manioc]
emb|CBI23015.3|  unnamed protein product                                259   1e-77    Vitis vinifera
ref|XP_010247390.1|  PREDICTED: granule-bound starch synthase 2, ...    252   1e-77    Nelumbo nucifera [Indian lotus]
ref|XP_003523360.1|  PREDICTED: soluble starch synthase 1, chloro...    260   2e-77    Glycine max [soybeans]
ref|XP_002277372.1|  PREDICTED: starch synthase 1, chloroplastic/...    259   2e-77    Vitis vinifera
ref|XP_008357050.1|  PREDICTED: starch synthase 1, chloroplastic/...    259   3e-77    Malus domestica [apple tree]
ref|XP_007136519.1|  hypothetical protein PHAVU_009G052100g             259   4e-77    Phaseolus vulgaris [French bean]
dbj|BAD18845.1|  starch synthase I precursor                            259   4e-77    Phaseolus vulgaris [French bean]
ref|XP_009150951.1|  PREDICTED: starch synthase 1, chloroplastic/...    259   5e-77    Brassica rapa
emb|CDX80428.1|  BnaC07g30160D                                          259   5e-77    
ref|XP_009357315.1|  PREDICTED: starch synthase 1, chloroplastic/...    258   6e-77    Pyrus x bretschneideri [bai li]
emb|CDP05054.1|  unnamed protein product                                258   1e-76    Coffea canephora [robusta coffee]
ref|XP_003061105.1|  glycosyltransferase family 5 protein               253   3e-76    Micromonas pusilla CCMP1545
ref|XP_010259190.1|  PREDICTED: granule-bound starch synthase 2, ...    259   6e-76    
gb|AAF24126.1|AF121673_1  soluble starch synthase                       254   6e-76    Arabidopsis thaliana [mouse-ear cress]
gb|KFK27706.1|  hypothetical protein AALP_AA8G418500                    256   7e-76    Arabis alpina [alpine rockcress]
ref|XP_010493573.1|  PREDICTED: starch synthase 1, chloroplastic/...    256   1e-75    Camelina sativa [gold-of-pleasure]
ref|XP_007039070.1|  Glycogen/starch synthases isoform 1                255   1e-75    
ref|XP_010454734.1|  PREDICTED: starch synthase 1, chloroplastic/...    255   1e-75    
ref|XP_010421252.1|  PREDICTED: starch synthase 1, chloroplastic/...    255   1e-75    
ref|XP_002872103.1|  hypothetical protein ARALYDRAFT_489289             255   2e-75    
ref|NP_197818.1|  starch synthase 1                                     254   2e-75    
ref|XP_006394684.1|  hypothetical protein EUTSA_v10003782mg             254   4e-75    
ref|XP_006287170.1|  hypothetical protein CARUB_v10000355mg             254   6e-75    
ref|XP_002503944.1|  glycosyltransferase family 5 protein               250   7e-75    
ref|XP_010258404.1|  PREDICTED: granule-bound starch synthase 2, ...    248   1e-74    
ref|XP_003527986.1|  PREDICTED: starch synthase 1, chloroplastic/...    251   7e-74    
ref|XP_001784416.1|  predicted protein                                  248   8e-74    
gb|KIZ02940.1|  starch synthase                                         248   2e-73    
ref|XP_002963372.1|  starch synthase                                    247   2e-73    
ref|XP_010541484.1|  PREDICTED: starch synthase 1, chloroplastic/...    248   5e-73    
ref|XP_003082594.1|  SSI (ISS)                                          241   3e-71    
gb|KIY95719.1|  starch synthase                                         228   8e-71    
gb|EPS58867.1|  hypothetical protein M569_15944                         237   5e-70    
emb|CEG00084.1|  Glycosyl transferase, family 1                         241   6e-70    
ref|XP_001420930.1|  predicted protein                                  237   7e-70    
ref|XP_010248162.1|  PREDICTED: granule-bound starch synthase 2, ...    224   3e-69    
gb|AAD45815.2|  soluble starch synthase                                 236   2e-68    
ref|XP_003063348.1|  glycosyltransferase family 5 protein               232   2e-67    
gb|AAS88880.1|  SSII                                                    230   4e-67    
ref|XP_010266626.1|  PREDICTED: granule-bound starch synthase 2, ...    222   6e-66    
ref|XP_007508324.1|  predicted protein                                  230   9e-66    
gb|AAD49850.1|AF165890_1  soluble starch synthase                       226   9e-65    
dbj|BAA03739.1|  soluble starch synthase precursor                      226   9e-65    
gb|KHN23362.1|  Soluble starch synthase, chloroplastic/amyloplastic     223   8e-64    
ref|XP_005832860.1|  hypothetical protein GUITHDRAFT_159665             221   3e-63    
ref|XP_003058812.1|  glycosyltransferase family 5 protein               222   6e-63    
ref|XP_005823580.1|  hypothetical protein GUITHDRAFT_78834              221   7e-63    
ref|XP_001698697.1|  soluble starch synthase                            219   1e-62    
ref|XP_002502943.1|  glycosyltransferase family 5 protein               216   1e-61    
ref|XP_005651605.1|  hypothetical protein COCSUDRAFT_34675              216   2e-61    
ref|XP_010915974.1|  PREDICTED: soluble starch synthase 1, chloro...    215   3e-61    
ref|XP_010915973.1|  PREDICTED: soluble starch synthase 1, chloro...    216   4e-61    
gb|KCW46565.1|  hypothetical protein EUGRSUZ_K00387                     214   1e-60    
ref|XP_005824660.1|  hypothetical protein GUITHDRAFT_165414             214   3e-60    
ref|XP_002505194.1|  glycosyltransferase family 5 protein               211   1e-59    
gb|KIY97962.1|  starch synthase                                         209   9e-59    
ref|WP_011984463.1|  glycogen synthase                                  204   5e-58    
gb|KDO54224.1|  hypothetical protein CISIN_1g006091mg                   206   1e-57    
gb|ADG38335.1|  AT3G01180-like protein                                  194   2e-57    
ref|WP_013626875.1|  glycogen synthase                                  201   2e-56    
ref|WP_016465771.1|  glycogen synthase                                  200   3e-56    
gb|ADG38341.1|  AT3G01180-like protein                                  190   1e-55    
ref|WP_004253505.1|  MULTISPECIES: glycogen synthase                    198   1e-55    
ref|WP_006499194.1|  glycogen synthase                                  198   1e-55    
ref|WP_034539267.1|  glycogen synthase                                  198   1e-55    
ref|WP_006154159.1|  glycogen synthase                                  198   2e-55    
ref|WP_006148603.1|  glycogen synthase                                  197   4e-55    
emb|CEY29334.1|  glycogen synthase                                      190   8e-55    
ref|WP_006151913.1|  glycogen synthase                                  196   9e-55    
ref|WP_006151145.1|  glycogen synthase                                  196   1e-54    
ref|WP_045614964.1|  glycogen synthase                                  196   1e-54    
ref|WP_007207139.1|  glycogen synthase                                  195   2e-54    
gb|AEN81698.1|  AT3G01180-like protein                                  186   3e-54    
gb|AEN81696.1|  AT3G01180-like protein                                  186   3e-54    
gb|EJG44544.1|  glycogen synthase                                       190   4e-54    
ref|WP_002293407.1|  glycogen synthase                                  194   8e-54    
gb|AEV91542.1|  starch synthase                                         191   8e-54    
ref|WP_003088966.1|  glycogen synthase                                  193   1e-53    
ref|WP_018364021.1|  glycogen synthase                                  193   1e-53    
ref|WP_002266146.1|  glycogen synthase                                  193   1e-53    
ref|WP_019805139.1|  glycogen synthase                                  193   2e-53    
ref|WP_019313683.1|  glycogen synthase                                  193   2e-53    
ref|WP_002271911.1|  glycogen synthase                                  193   2e-53    
ref|WP_002284491.1|  glycogen synthase                                  193   2e-53    
ref|WP_019316522.1|  glycogen synthase                                  193   2e-53    
ref|WP_019323718.1|  glycogen synthase                                  193   2e-53    
ref|WP_019317023.1|  glycogen synthase                                  193   2e-53    
ref|WP_002268545.1|  glycogen synthase                                  193   2e-53    
ref|WP_002262948.1|  glycogen synthase                                  193   2e-53    
ref|WP_044793183.1|  glycogen synthase                                  192   2e-53    
ref|WP_002305244.1|  glycogen synthase                                  192   2e-53    
ref|WP_002302326.1|  glycogen synthase                                  192   2e-53    
ref|WP_019319759.1|  glycogen synthase                                  192   2e-53    
ref|WP_002283170.1|  glycogen synthase                                  192   2e-53    
ref|WP_002308044.1|  glycogen synthase                                  192   2e-53    
ref|WP_002275912.1|  glycogen synthase                                  192   2e-53    
ref|WP_002273071.1|  glycogen synthase                                  192   2e-53    
ref|WP_009732552.1|  glycogen synthase                                  192   2e-53    
ref|WP_027719471.1|  glycogen synthase                                  193   2e-53    
ref|WP_019315980.1|  glycogen synthase                                  192   2e-53    
ref|WP_002897912.1|  glycogen synthase                                  192   2e-53    
ref|WP_019314126.1|  glycogen synthase                                  192   2e-53    
ref|WP_002295346.1|  glycogen synthase                                  192   2e-53    
ref|WP_018164157.1|  glycogen synthase                                  192   2e-53    
gb|AEU41068.1|  Glycogen synthase, ADP-glucose transglucosylase         190   3e-53    
ref|WP_006145634.1|  glycogen synthase                                  192   3e-53    
ref|WP_002282480.1|  glycogen synthase                                  192   3e-53    
ref|WP_002300545.1|  glycogen synthase                                  192   3e-53    
ref|WP_019323305.1|  glycogen synthase                                  192   3e-53    
ref|WP_003012102.1|  glycogen synthase                                  192   3e-53    
ref|WP_003002466.1|  glycogen synthase                                  192   4e-53    
ref|XP_003060422.1|  glycosyltransferase family 5 protein               193   4e-53    
ref|WP_027975674.1|  glycogen synthase                                  192   4e-53    
ref|WP_002310424.1|  glycogen synthase                                  192   4e-53    
ref|WP_019803025.1|  glycogen synthase                                  191   4e-53    
ref|WP_013903317.1|  glycogen synthase                                  191   5e-53    
emb|CFE12925.1|  glycogen synthase                                      191   5e-53    
emb|CFG18201.1|  glycogen synthase                                      191   5e-53    
ref|WP_000697287.1|  glycogen synthase                                  191   5e-53    
emb|CFG51165.1|  glycogen synthase                                      191   6e-53    
ref|WP_000697270.1|  glycogen synthase                                  191   7e-53    
ref|WP_023396897.1|  glycogen synthase                                  190   7e-53    
ref|WP_024786457.1|  glycogen synthase                                  191   7e-53    
emb|CFG77837.1|  glycogen synthase                                      190   8e-53    
ref|WP_026833767.1|  glycogen synthase                                  191   8e-53    
ref|WP_003017683.1|  glycogen synthase                                  191   9e-53    
ref|WP_028106872.1|  glycogen synthase                                  191   9e-53    
ref|WP_016569692.1|  glycogen synthase                                  191   9e-53    
emb|CRE50787.1|  glycogen synthase                                      191   9e-53    
ref|WP_024781775.1|  glycogen synthase                                  191   1e-52    
ref|WP_021887905.1|  glycogen synthase                                  191   1e-52    
ref|WP_012369575.1|  glycogen synthase                                  191   1e-52    
ref|WP_000697280.1|  glycogen synthase                                  191   1e-52    
ref|WP_003006424.1|  glycogen synthase                                  191   1e-52    
ref|WP_000697294.1|  glycogen synthase                                  191   1e-52    
ref|WP_012631591.1|  glycogen synthase                                  191   1e-52    
ref|WP_021152898.1|  Glycogen synthase, ADP-glucose transglucosylase    190   1e-52    
emb|CEN27758.1|  Glycogen synthase GlgA                                 191   1e-52    
emb|CEW42692.1|  glycogen synthase                                      190   1e-52    
ref|WP_000697290.1|  glycogen synthase                                  190   1e-52    
ref|WP_021166180.1|  glycogen synthase                                  190   1e-52    
ref|WP_021216073.1|  glycogen synthase                                  190   1e-52    
ref|WP_011980955.1|  glycogen synthase                                  191   2e-52    
ref|WP_003037387.1|  glycogen synthase                                  190   2e-52    
ref|WP_002929895.1|  glycogen synthase                                  190   2e-52    
dbj|BAJ95533.1|  predicted protein                                      181   2e-52    
ref|WP_044813499.1|  glycogen synthase                                  190   2e-52    
ref|WP_026829110.1|  glycogen synthase                                  190   2e-52    
ref|WP_000697314.1|  glycogen synthase                                  190   2e-52    
ref|WP_027129076.1|  glycogen synthase                                  190   2e-52    
ref|WP_000697302.1|  glycogen synthase                                  190   2e-52    
ref|WP_000697313.1|  glycogen synthase                                  190   2e-52    
ref|WP_000697301.1|  glycogen synthase                                  190   2e-52    
ref|WP_003695365.1|  glycogen synthase                                  190   2e-52    
ref|WP_041171783.1|  glycogen synthase                                  190   2e-52    
ref|WP_000697288.1|  glycogen synthase                                  190   2e-52    
ref|WP_000697298.1|  glycogen synthase                                  190   2e-52    
ref|WP_000697315.1|  glycogen synthase                                  190   2e-52    
gb|EFZ33808.1|  glycogen/starch synthase, ADP-glucose type              190   2e-52    
ref|WP_000697296.1|  glycogen synthase                                  190   2e-52    
ref|WP_023396646.1|  glycogen synthase                                  190   2e-52    
ref|WP_016147761.1|  glycogen/starch synthase, ADP-glucose type         190   2e-52    
ref|WP_000697295.1|  glycogen synthase                                  190   2e-52    
ref|WP_032951444.1|  glycogen synthase                                  190   2e-52    
ref|WP_044792066.1|  glycogen synthase                                  190   2e-52    
ref|WP_000697293.1|  glycogen synthase                                  190   2e-52    
ref|WP_003697220.1|  MULTISPECIES: glycogen synthase                    190   2e-52    
emb|CFG39347.1|  glycogen synthase                                      190   2e-52    
ref|WP_000697291.1|  glycogen synthase                                  190   2e-52    
ref|WP_000697300.1|  glycogen synthase                                  190   2e-52    
ref|WP_014808415.1|  glycogen/starch synthase, ADP-glucose type         190   2e-52    
ref|WP_021211620.1|  glycogen synthase                                  190   2e-52    
ref|WP_002285194.1|  glycogen synthase                                  189   3e-52    
ref|WP_000697285.1|  glycogen synthase                                  189   3e-52    
ref|WP_033631079.1|  glycogen synthase                                  189   3e-52    
ref|WP_015745093.1|  glycogen synthase                                  189   3e-52    
ref|WP_010764530.1|  glycogen/starch synthase, ADP-glucose type         189   3e-52    
emb|CFA01507.1|  glycogen synthase                                      189   4e-52    
ref|WP_002906939.1|  glycogen synthase                                  189   4e-52    
ref|WP_018375028.1|  glycogen synthase                                  189   4e-52    
ref|WP_002919364.1|  glycogen synthase                                  189   4e-52    
ref|WP_014735107.1|  glycogen synthase                                  189   4e-52    
emb|CAL98442.1|  GlgA protein                                           189   4e-52    
emb|CEW98061.1|  glycogen synthase                                      189   5e-52    
gb|KEY61430.1|  Glycogen synthase                                       189   5e-52    
ref|WP_002917497.1|  glycogen synthase                                  189   5e-52    
ref|WP_021036870.1|  glycogen synthase ADP-glucose type GlgA            189   5e-52    
ref|WP_023915988.1|  glycogen synthase                                  189   5e-52    
ref|WP_042748818.1|  glycogen synthase                                  189   5e-52    
ref|WP_043736428.1|  glycogen synthase                                  189   5e-52    
ref|WP_009660010.1|  glycogen synthase                                  189   5e-52    
gb|EDK65200.1|  glycogen synthase                                       181   6e-52    
ref|WP_000697309.1|  glycogen synthase                                  189   6e-52    
ref|WP_014713086.1|  glycogen synthase                                  189   6e-52    
ref|WP_026830949.1|  glycogen synthase                                  189   6e-52    
ref|WP_002915590.1|  glycogen synthase                                  189   6e-52    
ref|WP_011836716.1|  glycogen synthase                                  189   6e-52    
ref|WP_002900748.1|  glycogen synthase                                  189   6e-52    
ref|WP_044727460.1|  glycogen synthase                                  189   6e-52    
ref|WP_004187680.1|  glycogen synthase                                  189   6e-52    
emb|CRC60321.1|  glycogen synthase                                      189   6e-52    
ref|WP_014969664.1|  glycogen synthase                                  189   6e-52    
ref|WP_019893055.1|  glycogen synthase                                  189   6e-52    
ref|WP_000697312.1|  glycogen synthase                                  189   6e-52    
ref|WP_044927840.1|  glycogen synthase                                  189   7e-52    
ref|WP_042900712.1|  glycogen synthase                                  188   7e-52    
ref|WP_020999528.1|  glycogen synthase, ADP-glucose type                188   7e-52    
gb|ABJ72287.1|  glycogen synthase (ADP-glucose)                         189   8e-52    
ref|WP_000697304.1|  glycogen synthase                                  188   8e-52    
emb|CEV71296.1|  glycogen synthase                                      188   8e-52    
ref|WP_045763411.1|  glycogen synthase                                  188   8e-52    
ref|WP_044814455.1|  glycogen synthase                                  188   8e-52    
ref|WP_000697297.1|  glycogen synthase                                  188   9e-52    
emb|CEY55550.1|  glycogen synthase                                      188   9e-52    
ref|WP_000697284.1|  glycogen synthase                                  188   9e-52    
emb|CRE76501.1|  glycogen synthase                                      188   9e-52    
ref|WP_041167435.1|  glycogen synthase                                  188   9e-52    
ref|WP_045606915.1|  glycogen synthase                                  188   9e-52    
dbj|GAO03392.1|  glycogen synthase                                      188   1e-51    
ref|WP_038805215.1|  glycogen synthase                                  188   1e-51    
ref|WP_000697323.1|  glycogen synthase                                  188   1e-51    
gb|EGV10738.1|  glycogen/starch synthase, ADP-glucose type              184   1e-51    
ref|WP_023936811.1|  glycogen synthase                                  188   1e-51    
emb|CEW04432.1|  glycogen synthase                                      188   1e-51    
ref|WP_037614546.1|  glycogen synthase                                  188   1e-51    
gb|EEG93349.1|  glycogen/starch synthase, ADP-glucose type              189   1e-51    
ref|WP_021924214.1|  glycogen synthase                                  188   1e-51    
ref|WP_006302201.1|  glycogen synthase                                  188   1e-51    
ref|WP_033606415.1|  glycogen synthase                                  188   1e-51    
ref|WP_012524221.1|  glycogen synthase                                  187   1e-51    
ref|WP_036763813.1|  glycogen synthase                                  187   1e-51    
ref|WP_003080204.1|  glycogen synthase                                  187   1e-51    
emb|CFG12622.1|  glycogen synthase                                      187   1e-51    
ref|WP_000697306.1|  glycogen synthase                                  187   1e-51    
ref|WP_033685140.1|  glycogen synthase                                  187   1e-51    
ref|WP_000697319.1|  glycogen synthase                                  187   1e-51    
ref|WP_007521986.1|  glycogen synthase                                  187   1e-51    



>ref|XP_002531856.1| starch synthase, putative [Ricinus communis]
 gb|EEF30534.1| starch synthase, putative [Ricinus communis]
Length=754

 Score =   418 bits (1075),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 193/216 (89%), Positives = 209/216 (97%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            +YSLETL TGK +CKAALQKELGLPVRPDVPLIGFIGRLD+QKGVDLIAEAIPWMMG+DV
Sbjct  539  HYSLETLDTGKSQCKAALQKELGLPVRPDVPLIGFIGRLDHQKGVDLIAEAIPWMMGQDV  598

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQLLRQFE QH+DKVRGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  599  QLVMLGTGRPDLEQLLRQFESQHSDKVRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  658

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PFDP+NE+GLGWTFD AEA +LIHALGNCLL+YR+Y
Sbjct  659  QLYAMTYGTIPVVHAVGGLRDTVQPFDPFNESGLGWTFDSAEANKLIHALGNCLLSYREY  718

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ+RGMMQDLSWDHAA+ YEEVLVAAKYQW
Sbjct  719  KKSWEGLQRRGMMQDLSWDHAAEKYEEVLVAAKYQW  754



>ref|XP_002278470.2| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X2 [Vitis vinifera]
Length=777

 Score =   417 bits (1072),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 192/216 (89%), Positives = 209/216 (97%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL TGKP+CKAALQKELGLP+R DVPLIGFIGRLD+QKGVDLIAEA+PWM+G+DV
Sbjct  562  NYSLETLHTGKPQCKAALQKELGLPIREDVPLIGFIGRLDHQKGVDLIAEAVPWMVGQDV  621

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLEQ+LRQFE QH+DK+RGWVGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  622  QLVMLGTGRNDLEQMLRQFESQHHDKIRGWVGFSVKMAHRITAGADILLMPSRFEPCGLN  681

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PFDPYNE+GLGWTFDRAEA +LIHALGNCLLTYRQY
Sbjct  682  QLYAMNYGTIPVVHAVGGLRDTVQPFDPYNESGLGWTFDRAEANRLIHALGNCLLTYRQY  741

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGMMQDLSWDHAAQNYEEVLVAAKYQW
Sbjct  742  KQSWEGLQRRGMMQDLSWDHAAQNYEEVLVAAKYQW  777



>ref|XP_010661072.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X1 [Vitis vinifera]
 ref|XP_010661073.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X1 [Vitis vinifera]
 ref|XP_010661074.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X1 [Vitis vinifera]
Length=805

 Score =   417 bits (1072),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 192/216 (89%), Positives = 209/216 (97%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL TGKP+CKAALQKELGLP+R DVPLIGFIGRLD+QKGVDLIAEA+PWM+G+DV
Sbjct  590  NYSLETLHTGKPQCKAALQKELGLPIREDVPLIGFIGRLDHQKGVDLIAEAVPWMVGQDV  649

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLEQ+LRQFE QH+DK+RGWVGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  650  QLVMLGTGRNDLEQMLRQFESQHHDKIRGWVGFSVKMAHRITAGADILLMPSRFEPCGLN  709

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PFDPYNE+GLGWTFDRAEA +LIHALGNCLLTYRQY
Sbjct  710  QLYAMNYGTIPVVHAVGGLRDTVQPFDPYNESGLGWTFDRAEANRLIHALGNCLLTYRQY  769

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGMMQDLSWDHAAQNYEEVLVAAKYQW
Sbjct  770  KQSWEGLQRRGMMQDLSWDHAAQNYEEVLVAAKYQW  805



>ref|XP_004232219.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Solanum lycopersicum]
Length=768

 Score =   415 bits (1067),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 192/216 (89%), Positives = 207/216 (96%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL+TLQTGKP+CKAALQKELGLPVR DVPLIGFIGRLD QKGVDLIAEA+PWMMG+DV
Sbjct  553  NYSLDTLQTGKPQCKAALQKELGLPVRDDVPLIGFIGRLDPQKGVDLIAEAVPWMMGQDV  612

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+LRQFE QHNDK+RGWVGFSVKTSHRITAGADILLMPSRFEPCGLN
Sbjct  613  QLVMLGTGRPDLEQMLRQFECQHNDKIRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  672

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PFDP+NE+GLGWTF RAEA QLIHALGNCLLTYR+Y
Sbjct  673  QLYAMTYGTIPVVHAVGGLRDTVQPFDPFNESGLGWTFSRAEANQLIHALGNCLLTYREY  732

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEG+Q R M QDLSWD+AAQNYEEVL+AAKYQW
Sbjct  733  KKSWEGIQTRCMTQDLSWDNAAQNYEEVLIAAKYQW  768



>ref|XP_010257576.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
[Nelumbo nucifera]
Length=782

 Score =   412 bits (1058),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 191/216 (88%), Positives = 207/216 (96%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQTGKP+CKAALQKELGLPVR +VPLIGFIGRLD+QKGVDLIAEAIPWM+G+DV
Sbjct  567  NYSLETLQTGKPQCKAALQKELGLPVRENVPLIGFIGRLDHQKGVDLIAEAIPWMVGQDV  626

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+LRQFE QH+DKVRGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  627  QLVMLGTGRPDLEQMLRQFESQHHDKVRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  686

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGL DTV  FDP+NETG GWTFDRAEA +LIH LGNCLLTYR+Y
Sbjct  687  QLYAMNYGTVPVVHAVGGLGDTVQQFDPFNETGFGWTFDRAEAHKLIHTLGNCLLTYREY  746

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEG+Q+RGMMQDLSWD+AAQ YEEVLVAAKYQW
Sbjct  747  KKSWEGIQRRGMMQDLSWDNAAQKYEEVLVAAKYQW  782



>ref|NP_001274977.1| granule-bound starch synthase 2, chloroplastic/amyloplastic precursor 
[Solanum tuberosum]
 sp|Q43847.3|SSY2_SOLTU RecName: Full=Granule-bound starch synthase 2, chloroplastic/amyloplastic; 
AltName: Full=Granule-bound starch synthase II; 
Short=GBSS-II; Short=SS II; Flags: Precursor [Solanum tuberosum]
 emb|CAA61241.2| soluble starch synthase II precursor [Solanum tuberosum]
Length=767

 Score =   411 bits (1056),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 191/216 (88%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL+TLQTGKP+CKAALQKELGLPVR DVPLIGFIGRLD QKGVDLIAEA+PWMMG+DV
Sbjct  552  NYSLDTLQTGKPQCKAALQKELGLPVRDDVPLIGFIGRLDPQKGVDLIAEAVPWMMGQDV  611

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLEQ+LRQFE QHNDK+RGWVGFSVKTSHRITAGADILLMPSRFEPCGLN
Sbjct  612  QLVMLGTGRRDLEQMLRQFECQHNDKIRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  671

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV PFDP+NE+GLGWTF RAEA QLIHALGNCLLTYR+Y
Sbjct  672  QLYAMKYGTIPVVHAVGGLRDTVQPFDPFNESGLGWTFSRAEASQLIHALGNCLLTYREY  731

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEG+Q R M QDLSWD+AAQNYEEVL+AAKYQW
Sbjct  732  KKSWEGIQTRCMTQDLSWDNAAQNYEEVLIAAKYQW  767



>gb|ABV25894.1| starch synthase isoform II [Manihot esculenta]
Length=751

 Score =   410 bits (1053),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL TGKP+CKAALQKELGLP+RPDVP+IGFIGRLDYQKGVDLIAEAIPWM+G+DV
Sbjct  536  NYSLETLDTGKPQCKAALQKELGLPIRPDVPVIGFIGRLDYQKGVDLIAEAIPWMVGQDV  595

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE++LRQFE QH DKVRGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  596  QLVMLGTGRQDLEEMLRQFENQHRDKVRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  655

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV PFDP+NE+GLGWTFD AE+ +LIHALGNCLLTYR+Y
Sbjct  656  QLYAMMYGTIPVVHAVGGLRDTVQPFDPFNESGLGWTFDSAESHKLIHALGNCLLTYREY  715

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ+RGM Q+LSWDHAA+ YEE LVAAKYQW
Sbjct  716  KKSWEGLQRRGMTQNLSWDHAAEKYEETLVAAKYQW  751



>ref|XP_010551849.1| PREDICTED: starch synthase 2, chloroplastic/amyloplastic isoform 
X2 [Tarenaya hassleriana]
Length=787

 Score =   410 bits (1054),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/216 (88%), Positives = 206/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQTGK +CKAALQKELGLPVRPDVPLIGFIGRLD+QKGVDLIAEA+PWMMG+DV
Sbjct  572  NYSLETLQTGKSQCKAALQKELGLPVRPDVPLIGFIGRLDHQKGVDLIAEAVPWMMGQDV  631

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE++LRQ E Q+ DK RGWVGFSV+T+HRITAGADILLMPSRFEPCGLN
Sbjct  632  QLVMLGTGRQDLEEVLRQLENQYRDKARGWVGFSVRTAHRITAGADILLMPSRFEPCGLN  691

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAMSYGTVPVVHAVGGLRDTV PFDP+NETGLGWTFDRAEA +LIHALGNCLLTYR+Y
Sbjct  692  QLYAMSYGTVPVVHAVGGLRDTVQPFDPFNETGLGWTFDRAEAGKLIHALGNCLLTYREY  751

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ+RGMMQDLSWD+AA  YEEVLVAAKYQW
Sbjct  752  KKSWEGLQRRGMMQDLSWDNAAAKYEEVLVAAKYQW  787



>gb|AAY89383.1| starch synthase isoform 2 [Nicotiana langsdorffii x Nicotiana 
sanderae]
Length=207

 Score =   390 bits (1002),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -2

Query  836  GKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDVQVVMLGTGR  657
            GKP+CKAALQKELGLP+R DVPLIGFIGRLD QKGVDLIAEA+PWMMG+DVQ+VMLGTGR
Sbjct  1    GKPQCKAALQKELGLPIRDDVPLIGFIGRLDPQKGVDLIAEAVPWMMGQDVQLVMLGTGR  60

Query  656  PDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLNQLYAMSYGT  477
            PDLEQ+LRQFE Q+NDK+RGWVGFSVKT+HRITAGADILLMPSRFEPCGLNQLYAM YGT
Sbjct  61   PDLEQMLRQFECQYNDKIRGWVGFSVKTAHRITAGADILLMPSRFEPCGLNQLYAMKYGT  120

Query  476  VPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQYKKSWEGLQK  297
            VPVVHAVGGLRDTV PFDP+NE+GLGWTF RAEA QLIHALGNCLLTYR+YK+SWEGLQ+
Sbjct  121  VPVVHAVGGLRDTVQPFDPFNESGLGWTFSRAEANQLIHALGNCLLTYREYKQSWEGLQR  180

Query  296  RGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            RGM QDLSWD+AA NYEEVLVAAKYQW
Sbjct  181  RGMTQDLSWDNAAHNYEEVLVAAKYQW  207



>ref|XP_009628770.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Nicotiana tomentosiformis]
Length=790

 Score =   410 bits (1053),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 207/216 (96%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL+TLQTGKP+CK+ALQKELGLPVR DVPLIGFIGRLD QKGVDLIAEA+PWMMG+DV
Sbjct  575  NYSLDTLQTGKPQCKSALQKELGLPVRDDVPLIGFIGRLDPQKGVDLIAEAVPWMMGQDV  634

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+LRQFE Q+NDK+RGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  635  QLVMLGTGRPDLEQMLRQFECQYNDKIRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  694

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGL+DTV PFDP+NE+GLGWTF RAEA QLIHALGNCLLTYR+Y
Sbjct  695  QLYAMKYGTIPVVHAVGGLKDTVQPFDPFNESGLGWTFSRAEANQLIHALGNCLLTYREY  754

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM QDLSWD+AA NYEEV+VAAKYQW
Sbjct  755  KQSWEGLQRRGMTQDLSWDNAAHNYEEVVVAAKYQW  790



>ref|XP_009778986.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Nicotiana sylvestris]
Length=795

 Score =   409 bits (1052),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 206/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL+TLQTGK +CK+ALQKELGLP+R DVPLIGFIGRLD QKGVDLIAEA+PWMMG+DV
Sbjct  580  NYSLDTLQTGKAQCKSALQKELGLPIRDDVPLIGFIGRLDPQKGVDLIAEAVPWMMGQDV  639

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+LRQFE Q+NDK+RGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  640  QLVMLGTGRPDLEQMLRQFECQYNDKIRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  699

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV PFDP+NE+GLGWTF RAEA QLIHALGNCLLTYR+Y
Sbjct  700  QLYAMKYGTIPVVHAVGGLRDTVQPFDPFNESGLGWTFSRAEANQLIHALGNCLLTYREY  759

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM QDLSWD+AA NYEEVLVAAKYQW
Sbjct  760  KESWEGLQRRGMTQDLSWDNAAHNYEEVLVAAKYQW  795



>gb|AAC19119.1| starch synthase [Ipomoea batatas]
Length=630

 Score =   404 bits (1039),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 190/216 (88%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL+TLQTGKP+CKAALQKE+ LPVR DVPLIGFIGRLD+QKGVDLIAEAIPWMMG+DV
Sbjct  415  NYSLDTLQTGKPQCKAALQKEMNLPVRDDVPLIGFIGRLDHQKGVDLIAEAIPWMMGQDV  474

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+L+Q E Q+ DKVRGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  475  QLVMLGTGRPDLEQMLKQIEGQYGDKVRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  534

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAMSYGTVPVVHAVGGLRDTV PFDP+NE+G GWTF RAEA QLI ALGNCLLTYRQY
Sbjct  535  QLYAMSYGTVPVVHAVGGLRDTVQPFDPFNESGYGWTFGRAEANQLIDALGNCLLTYRQY  594

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGMMQDLSWDHAA+ YEEVLVAAKYQW
Sbjct  595  KQSWEGLQRRGMMQDLSWDHAAEKYEEVLVAAKYQW  630



>ref|XP_010551848.1| PREDICTED: starch synthase 2, chloroplastic/amyloplastic isoform 
X1 [Tarenaya hassleriana]
Length=846

 Score =   410 bits (1054),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 191/216 (88%), Positives = 206/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQTGK +CKAALQKELGLPVRPDVPLIGFIGRLD+QKGVDLIAEA+PWMMG+DV
Sbjct  631  NYSLETLQTGKSQCKAALQKELGLPVRPDVPLIGFIGRLDHQKGVDLIAEAVPWMMGQDV  690

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE++LRQ E Q+ DK RGWVGFSV+T+HRITAGADILLMPSRFEPCGLN
Sbjct  691  QLVMLGTGRQDLEEVLRQLENQYRDKARGWVGFSVRTAHRITAGADILLMPSRFEPCGLN  750

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAMSYGTVPVVHAVGGLRDTV PFDP+NETGLGWTFDRAEA +LIHALGNCLLTYR+Y
Sbjct  751  QLYAMSYGTVPVVHAVGGLRDTVQPFDPFNETGLGWTFDRAEAGKLIHALGNCLLTYREY  810

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ+RGMMQDLSWD+AA  YEEVLVAAKYQW
Sbjct  811  KKSWEGLQRRGMMQDLSWDNAAAKYEEVLVAAKYQW  846



>ref|XP_007214968.1| hypothetical protein PRUPE_ppa001734mg [Prunus persica]
 gb|EMJ16167.1| hypothetical protein PRUPE_ppa001734mg [Prunus persica]
Length=773

 Score =   406 bits (1044),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 208/216 (96%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL TLQTGKP+CKAALQKELGLP+R DVP+IGFIGRLD QKGVDLIAEAIPWMMG+DV
Sbjct  558  NYSLVTLQTGKPQCKAALQKELGLPIREDVPVIGFIGRLDQQKGVDLIAEAIPWMMGQDV  617

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLG+GRPDLEQ+L++FE+QH DKVRGWVGFSV+T+HRITAGADILLMPSRFEPCGLN
Sbjct  618  QLIMLGSGRPDLEQMLKEFEHQHRDKVRGWVGFSVQTAHRITAGADILLMPSRFEPCGLN  677

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PF+PY+E+GLGWTFD AEA +LIHALGNCLLTYR+Y
Sbjct  678  QLYAMNYGTIPVVHAVGGLRDTVQPFNPYDESGLGWTFDSAEAGKLIHALGNCLLTYREY  737

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEG+Q+RGM QDLSWDHAAQNYEEVLVAAKYQW
Sbjct  738  KKSWEGIQRRGMKQDLSWDHAAQNYEEVLVAAKYQW  773



>ref|XP_002324061.2| glycogen synthase family protein [Populus trichocarpa]
 gb|EEF04194.2| glycogen synthase family protein [Populus trichocarpa]
Length=742

 Score =   404 bits (1039),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL TGKP+CKAALQKELGLPVRPDVP+IGFIGRLD QKGVDLIAEA+PWM+G+DV
Sbjct  527  NYSLETLHTGKPQCKAALQKELGLPVRPDVPMIGFIGRLDQQKGVDLIAEAVPWMVGQDV  586

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLEQ+LRQFE QH+DK+RGWVGFSVK +HRITAG+D+LLMPSRFEPCGLN
Sbjct  587  QLVMLGTGRQDLEQMLRQFENQHHDKIRGWVGFSVKMAHRITAGSDVLLMPSRFEPCGLN  646

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV PFDP+NE+GLGWTFD AEA +LIHALGNCL TYR+Y
Sbjct  647  QLYAMMYGTIPVVHAVGGLRDTVQPFDPFNESGLGWTFDGAEANKLIHALGNCLFTYREY  706

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ+RGM QDLSWDHAA+ YEEVLVAAKYQW
Sbjct  707  KKSWEGLQRRGMTQDLSWDHAAEKYEEVLVAAKYQW  742



>ref|XP_011098636.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X4 [Sesamum indicum]
Length=768

 Score =   405 bits (1040),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL+TLQ+GKP+CKAALQKELGLPVR DVPLIGFIGRLD QKGVDLIAEA+PWMMG+DV
Sbjct  553  NYSLDTLQSGKPQCKAALQKELGLPVRADVPLIGFIGRLDQQKGVDLIAEAVPWMMGQDV  612

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+LRQFE Q+NDKVRGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  613  QLVMLGTGRPDLEQMLRQFEGQYNDKVRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  672

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV PF+P+ E+GLGWTF RA+  +L+HALGNCLLTY QY
Sbjct  673  QLYAMRYGTIPVVHAVGGLRDTVQPFNPFEESGLGWTFARADGNELMHALGNCLLTYHQY  732

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQKRGM+QDLSWD AAQNYEEVLVAAKYQW
Sbjct  733  KESWEGLQKRGMLQDLSWDSAAQNYEEVLVAAKYQW  768



>ref|XP_011098635.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X3 [Sesamum indicum]
Length=779

 Score =   405 bits (1040),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL+TLQ+GKP+CKAALQKELGLPVR DVPLIGFIGRLD QKGVDLIAEA+PWMMG+DV
Sbjct  564  NYSLDTLQSGKPQCKAALQKELGLPVRADVPLIGFIGRLDQQKGVDLIAEAVPWMMGQDV  623

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+LRQFE Q+NDKVRGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  624  QLVMLGTGRPDLEQMLRQFEGQYNDKVRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  683

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV PF+P+ E+GLGWTF RA+  +L+HALGNCLLTY QY
Sbjct  684  QLYAMRYGTIPVVHAVGGLRDTVQPFNPFEESGLGWTFARADGNELMHALGNCLLTYHQY  743

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQKRGM+QDLSWD AAQNYEEVLVAAKYQW
Sbjct  744  KESWEGLQKRGMLQDLSWDSAAQNYEEVLVAAKYQW  779



>emb|CDY37538.1| BnaA05g34030D [Brassica napus]
Length=677

 Score =   402 bits (1032),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQ GKP+CKAALQKELGLPVRPDVPLIGFIGRLD+QKGVDLIAEA+PWMM +DV
Sbjct  462  NYSLETLQIGKPQCKAALQKELGLPVRPDVPLIGFIGRLDHQKGVDLIAEAVPWMMSQDV  521

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE++LRQ E+Q+ DK RGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  522  QLVMLGTGRPDLEEVLRQMEHQYRDKARGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  581

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV  FDPY+ETGLGWTFD AEA +LIHALGNCLLTYR+Y
Sbjct  582  QLYAMNYGTIPVVHAVGGLRDTVQQFDPYSETGLGWTFDSAEAGKLIHALGNCLLTYREY  641

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM QDLSWD+AA+ YEEVLVAAKYQW
Sbjct  642  KESWEGLQRRGMTQDLSWDNAAEKYEEVLVAAKYQW  677



>ref|XP_011035764.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X2 [Populus euphratica]
Length=740

 Score =   403 bits (1036),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL TGKP+CKAALQKELGLPVRPDVP+IGFIGRLD QKGVDLIAEA+PWM+G+DV
Sbjct  525  NYSLETLHTGKPQCKAALQKELGLPVRPDVPMIGFIGRLDQQKGVDLIAEAVPWMVGQDV  584

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLEQ+LRQFE QH+DK+RGWVGFSVK +HRITAG+D+LLMPSRFEPCGLN
Sbjct  585  QLVMLGTGRQDLEQMLRQFENQHHDKIRGWVGFSVKMAHRITAGSDVLLMPSRFEPCGLN  644

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV PFDP++E+GLGWTFD AEA +LIHALGNCL TYR+Y
Sbjct  645  QLYAMMYGTIPVVHAVGGLRDTVQPFDPFSESGLGWTFDAAEAHKLIHALGNCLFTYREY  704

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ+RGM QDLSWDHAA+ YEEVLVAAKYQW
Sbjct  705  KKSWEGLQRRGMSQDLSWDHAAEKYEEVLVAAKYQW  740



>ref|XP_011035763.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X1 [Populus euphratica]
Length=755

 Score =   404 bits (1037),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL TGKP+CKAALQKELGLPVRPDVP+IGFIGRLD QKGVDLIAEA+PWM+G+DV
Sbjct  540  NYSLETLHTGKPQCKAALQKELGLPVRPDVPMIGFIGRLDQQKGVDLIAEAVPWMVGQDV  599

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLEQ+LRQFE QH+DK+RGWVGFSVK +HRITAG+D+LLMPSRFEPCGLN
Sbjct  600  QLVMLGTGRQDLEQMLRQFENQHHDKIRGWVGFSVKMAHRITAGSDVLLMPSRFEPCGLN  659

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV PFDP++E+GLGWTFD AEA +LIHALGNCL TYR+Y
Sbjct  660  QLYAMMYGTIPVVHAVGGLRDTVQPFDPFSESGLGWTFDAAEAHKLIHALGNCLFTYREY  719

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ+RGM QDLSWDHAA+ YEEVLVAAKYQW
Sbjct  720  KKSWEGLQRRGMSQDLSWDHAAEKYEEVLVAAKYQW  755



>ref|XP_011098633.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X1 [Sesamum indicum]
Length=794

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL+TLQ+GKP+CKAALQKELGLPVR DVPLIGFIGRLD QKGVDLIAEA+PWMMG+DV
Sbjct  579  NYSLDTLQSGKPQCKAALQKELGLPVRADVPLIGFIGRLDQQKGVDLIAEAVPWMMGQDV  638

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+LRQFE Q+NDKVRGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  639  QLVMLGTGRPDLEQMLRQFEGQYNDKVRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  698

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV PF+P+ E+GLGWTF RA+  +L+HALGNCLLTY QY
Sbjct  699  QLYAMRYGTIPVVHAVGGLRDTVQPFNPFEESGLGWTFARADGNELMHALGNCLLTYHQY  758

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQKRGM+QDLSWD AAQNYEEVLVAAKYQW
Sbjct  759  KESWEGLQKRGMLQDLSWDSAAQNYEEVLVAAKYQW  794



>ref|XP_011098634.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X2 [Sesamum indicum]
Length=792

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL+TLQ+GKP+CKAALQKELGLPVR DVPLIGFIGRLD QKGVDLIAEA+PWMMG+DV
Sbjct  577  NYSLDTLQSGKPQCKAALQKELGLPVRADVPLIGFIGRLDQQKGVDLIAEAVPWMMGQDV  636

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+LRQFE Q+NDKVRGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  637  QLVMLGTGRPDLEQMLRQFEGQYNDKVRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  696

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV PF+P+ E+GLGWTF RA+  +L+HALGNCLLTY QY
Sbjct  697  QLYAMRYGTIPVVHAVGGLRDTVQPFNPFEESGLGWTFARADGNELMHALGNCLLTYHQY  756

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQKRGM+QDLSWD AAQNYEEVLVAAKYQW
Sbjct  757  KESWEGLQKRGMLQDLSWDSAAQNYEEVLVAAKYQW  792



>ref|XP_008230773.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Prunus mume]
Length=773

 Score =   404 bits (1037),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 207/216 (96%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL TLQTGKP+CKAALQKELGLP+R DVP+IGFIGRLD QKGVDLIAEAIPWMMG+DV
Sbjct  558  NYSLATLQTGKPQCKAALQKELGLPIREDVPVIGFIGRLDQQKGVDLIAEAIPWMMGQDV  617

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLG+GRPDLEQ+L++FE+QH DKVRGWVGFSV+T+HRITAGADILLMPSRFEPCGLN
Sbjct  618  QLIMLGSGRPDLEQMLKEFEHQHRDKVRGWVGFSVQTAHRITAGADILLMPSRFEPCGLN  677

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PF+PY+E+GLGWTFD AEA +LIHAL NCLLTYR+Y
Sbjct  678  QLYAMNYGTVPVVHAVGGLRDTVQPFNPYDESGLGWTFDSAEAGKLIHALWNCLLTYREY  737

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEG+Q+RGM QDLSWDHAAQNYEEVLVAAKYQW
Sbjct  738  KKSWEGIQRRGMTQDLSWDHAAQNYEEVLVAAKYQW  773



>ref|XP_006297008.1| hypothetical protein CARUB_v10013000mg [Capsella rubella]
 gb|EOA29906.1| hypothetical protein CARUB_v10013000mg [Capsella rubella]
Length=804

 Score =   404 bits (1038),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS+ETL+ GKP+CKAALQKELGLPVRPDVPLIGFIGRLD+QKGVDLIAEA+PWMM +DV
Sbjct  589  NYSVETLEIGKPQCKAALQKELGLPVRPDVPLIGFIGRLDHQKGVDLIAEAVPWMMSQDV  648

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE+LLRQ E+Q+ DK RGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  649  QLVMLGTGRPDLEELLRQMEHQYRDKARGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  708

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV  FDPY+ETGLGWTFD AEA +LIHALGNCLLTYR+Y
Sbjct  709  QLYAMNYGTIPVVHAVGGLRDTVQQFDPYSETGLGWTFDSAEAGKLIHALGNCLLTYREY  768

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ+RGM QDLSWD+AA+ YEEVLVAAKYQW
Sbjct  769  KKSWEGLQRRGMTQDLSWDNAAEKYEEVLVAAKYQW  804



>ref|XP_006431165.1| hypothetical protein CICLE_v10011124mg [Citrus clementina]
 gb|ESR44405.1| hypothetical protein CICLE_v10011124mg [Citrus clementina]
Length=769

 Score =   403 bits (1035),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 207/216 (96%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL+TL+TGKP+CKAALQ+ELGLPVR DVP+IGFIGRLD+QKGVDLIAEAIPWMMG+DV
Sbjct  554  NYSLDTLRTGKPQCKAALQRELGLPVRDDVPVIGFIGRLDHQKGVDLIAEAIPWMMGQDV  613

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE++LR FE +H+DKVRGWVGFSVKT+HRITAGAD+LLMPSRFEPCGLN
Sbjct  614  QLVMLGTGRPDLEEMLRNFERKHHDKVRGWVGFSVKTAHRITAGADVLLMPSRFEPCGLN  673

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLR+TV PFDP++E+GLGWTFD A A +LIHALGNCLLT+R+Y
Sbjct  674  QLYAMKYGTIPVVHAVGGLRETVQPFDPFSESGLGWTFDGASAGKLIHALGNCLLTFREY  733

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ+RGMMQDLSWDHAAQ YEEVLVAAKYQW
Sbjct  734  KKSWEGLQRRGMMQDLSWDHAAQLYEEVLVAAKYQW  769



>ref|XP_008341578.1| PREDICTED: LOW QUALITY PROTEIN: granule-bound starch synthase 
2, chloroplastic/amyloplastic [Malus domestica]
Length=778

 Score =   403 bits (1035),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 206/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL+TGK +CKAALQKELGLP+R DVP+IGFIGRLD+QKGVDLIAEAIPWMMG+DV
Sbjct  563  NYSLETLKTGKAQCKAALQKELGLPLREDVPVIGFIGRLDHQKGVDLIAEAIPWMMGQDV  622

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG+GRPDLE++LR FE+QH DKVRGWVGFSV+T+HRITAGADILLMPSRFEPCGLN
Sbjct  623  QLVMLGSGRPDLEEMLRAFEHQHRDKVRGWVGFSVQTAHRITAGADILLMPSRFEPCGLN  682

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PF+PY E+GLGWTFD AE  +LIHALGNCL TYR+Y
Sbjct  683  QLYAMNYGTVPVVHAVGGLRDTVHPFNPYEESGLGWTFDSAEVGELIHALGNCLYTYREY  742

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEG+Q+RGMMQDLSWDHAAQNYEEVLVAAKYQW
Sbjct  743  KQSWEGIQRRGMMQDLSWDHAAQNYEEVLVAAKYQW  778



>ref|XP_012084711.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Jatropha curcas]
 gb|KDP27156.1| hypothetical protein JCGZ_19855 [Jatropha curcas]
Length=749

 Score =   401 bits (1031),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 203/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL+TGKP+CKAALQKELGLP+RPDVP+IGFIGRLD+QKGVDLIAEAIPWMM +DV
Sbjct  534  NYSLETLETGKPQCKAALQKELGLPIRPDVPVIGFIGRLDHQKGVDLIAEAIPWMMDQDV  593

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLEQ+L+QFE  +NDKVRGWVGFSVKT+HRITAG DILLMPSRFEPCGLN
Sbjct  594  QLVMLGTGRKDLEQMLKQFESHYNDKVRGWVGFSVKTAHRITAGVDILLMPSRFEPCGLN  653

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV PFDP+NE+G GWTFD AE  +LIHALGNCL TYR+Y
Sbjct  654  QLYAMMYGTVPVVHAVGGLRDTVQPFDPFNESGFGWTFDSAEGSKLIHALGNCLFTYREY  713

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW+GLQ+RGMMQDLSWDHAA+ YEEVL+AAKYQW
Sbjct  714  KESWKGLQRRGMMQDLSWDHAAEIYEEVLIAAKYQW  749



>ref|XP_009147403.1| PREDICTED: starch synthase 2, chloroplastic/amyloplastic [Brassica 
rapa]
Length=791

 Score =   402 bits (1034),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQ GKP+CKAALQKELGLPVRPDVPLIGFIGRLD+QKGVDLIAEA+PWMM +DV
Sbjct  576  NYSLETLQIGKPQCKAALQKELGLPVRPDVPLIGFIGRLDHQKGVDLIAEAVPWMMSQDV  635

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE++LRQ E+Q+ DK RGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  636  QLVMLGTGRPDLEEVLRQMEHQYRDKARGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  695

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV  FDPY+ETGLGWTFD AEA +LIHALGNCLLTYR+Y
Sbjct  696  QLYAMNYGTIPVVHAVGGLRDTVQQFDPYSETGLGWTFDSAEAGKLIHALGNCLLTYREY  755

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM QDLSWD+AA+ YEEVLVAAKYQW
Sbjct  756  KESWEGLQRRGMTQDLSWDNAAEKYEEVLVAAKYQW  791



>ref|XP_009376273.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
[Pyrus x bretschneideri]
Length=777

 Score =   402 bits (1033),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQTGK +CKAALQKELGLPVR DVP+IGFIGRLD+QKGVDLIAEAIPWMMG+DV
Sbjct  562  NYSLETLQTGKAQCKAALQKELGLPVREDVPVIGFIGRLDHQKGVDLIAEAIPWMMGQDV  621

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLG+GRPDLE++LR FE+QH DKVRGWVGFSV+T+HRITAGADILLMPSRFEPCGLN
Sbjct  622  QLIMLGSGRPDLEEMLRAFEHQHRDKVRGWVGFSVQTAHRITAGADILLMPSRFEPCGLN  681

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PF+PY E+GLGWTFD AE  +LIHALGNC  TYR Y
Sbjct  682  QLYAMNYGTIPVVHAVGGLRDTVHPFNPYEESGLGWTFDSAEVGKLIHALGNCFFTYRDY  741

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEG+Q+RGMMQDLSWDHAAQNYEEVLVAAKYQW
Sbjct  742  KQSWEGIQRRGMMQDLSWDHAAQNYEEVLVAAKYQW  777



>gb|KJB33541.1| hypothetical protein B456_006G016400 [Gossypium raimondii]
Length=756

 Score =   400 bits (1029),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 203/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQTGKPKCKAALQKELGLPVR DVPL+GFIGRLD QKGVDLIAEAIPWM+G+DV
Sbjct  541  NYSLETLQTGKPKCKAALQKELGLPVREDVPLLGFIGRLDQQKGVDLIAEAIPWMIGQDV  600

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+LRQFE +H DKVRGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  601  QLVMLGTGRPDLEQMLRQFENEHRDKVRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  660

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV  F+P+ E+G+GWTFD A+A +LIHALGNCLLTYRQY
Sbjct  661  QLYAMNYGTIPVVHAVGGLRDTVQQFNPFEESGVGWTFDSADASKLIHALGNCLLTYRQY  720

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGLQ RGM QDLSWD+AA+ YEEVLVAAKYQW
Sbjct  721  KTSWEGLQIRGMKQDLSWDNAAEKYEEVLVAAKYQW  756



>ref|XP_009360619.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
[Pyrus x bretschneideri]
Length=778

 Score =   400 bits (1029),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL+TGK +CKAALQKELGLP+R DVP+IGFIGRLD+QKGVDLIAEAIPWMMG+DV
Sbjct  563  NYSLETLKTGKAQCKAALQKELGLPIREDVPVIGFIGRLDHQKGVDLIAEAIPWMMGQDV  622

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLG+GRPDLE++LR FE+QH DKVRGWVGFSV+TSHRITAGADILLMPSRFEPCGLN
Sbjct  623  QLIMLGSGRPDLEEMLRAFEHQHQDKVRGWVGFSVQTSHRITAGADILLMPSRFEPCGLN  682

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PF+PY E+GLGWTFD AE  +LIHALGNCL TYR+Y
Sbjct  683  QLYAMNYGTVPVVHAVGGLRDTVHPFNPYEESGLGWTFDSAEVGKLIHALGNCLYTYREY  742

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEG+Q+RGMMQDLSWD AAQNYEEVLVAAKYQW
Sbjct  743  KQSWEGIQRRGMMQDLSWDRAAQNYEEVLVAAKYQW  778



>ref|XP_008365401.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
[Malus domestica]
Length=777

 Score =   400 bits (1028),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL+TGK +CKAALQKELGLPVR DVP+IGFIGRLD+QKGVDLIAEAIPWMMG+DV
Sbjct  562  NYSLETLKTGKAQCKAALQKELGLPVREDVPVIGFIGRLDHQKGVDLIAEAIPWMMGQDV  621

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLG+GRPDLE++LR FE+QH DKVRGWVGFSV+T+HRITAGADILLMPSRFEPCGLN
Sbjct  622  QLIMLGSGRPDLEEMLRAFEHQHRDKVRGWVGFSVQTAHRITAGADILLMPSRFEPCGLN  681

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PF+PY E+GLGWTFD AE  +LIHALGNC  TYR Y
Sbjct  682  QLYAMNYGTIPVVHAVGGLRDTVHPFNPYEESGLGWTFDSAEVGKLIHALGNCFYTYRDY  741

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEG+Q+RGMMQDLSWDHAAQNYEEVLVAAKYQW
Sbjct  742  KQSWEGIQRRGMMQDLSWDHAAQNYEEVLVAAKYQW  777



>gb|KHG22363.1| Granule-bound starch synthase 2, chloroplastic/amyloplastic [Gossypium 
arboreum]
Length=750

 Score =   399 bits (1026),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 203/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQTGKPKCKAALQKELGLPVR DVPL+GFIGRLD QKGVDLIAEAIPWM+G+DV
Sbjct  535  NYSLETLQTGKPKCKAALQKELGLPVREDVPLLGFIGRLDQQKGVDLIAEAIPWMIGQDV  594

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+LRQFE +H DKVRGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  595  QLVMLGTGRPDLEQMLRQFENEHRDKVRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  654

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV  F+P+ E+G+GWTFD A+A +LIHALGNCLLTYRQY
Sbjct  655  QLYAMNYGTIPVVHAVGGLRDTVQQFNPFEESGVGWTFDSADAGKLIHALGNCLLTYRQY  714

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGLQ RGM QDLSWD+AA+ YEEVLVAAKYQW
Sbjct  715  KTSWEGLQIRGMKQDLSWDNAAEKYEEVLVAAKYQW  750



>ref|XP_010258328.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
[Nelumbo nucifera]
Length=786

 Score =   400 bits (1029),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY +ETLQT KP+CKAALQ+ELGLP+R +VPLIGFIGRLD+QKGVDLIAE+IPWM+ +DV
Sbjct  571  NYFVETLQTSKPQCKAALQRELGLPLRENVPLIGFIGRLDHQKGVDLIAESIPWMVDQDV  630

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQLLR FE QH+DKVRGWVGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  631  QLVMLGTGRPDLEQLLRHFESQHHDKVRGWVGFSVKMAHRITAGADILLMPSRFEPCGLN  690

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAMSYGTVPVVHAVGGLRD+V PFDP+NE+G GWTFDRAEA +LIHALGNCLLTYR+Y
Sbjct  691  QLYAMSYGTVPVVHAVGGLRDSVQPFDPFNESGFGWTFDRAEAIKLIHALGNCLLTYREY  750

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEG+Q+RGMMQDL+WD AAQNYEEVLV+AKY W
Sbjct  751  KKSWEGIQRRGMMQDLTWDRAAQNYEEVLVSAKYHW  786



>gb|KJB61261.1| hypothetical protein B456_009G348800 [Gossypium raimondii]
Length=310

 Score =   384 bits (985),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQTGKPKCKAALQKELGLPV  DVPL+GFIGRLD QKGVDLI EAIPWM+G+DV
Sbjct  95   NYSLETLQTGKPKCKAALQKELGLPVHEDVPLLGFIGRLDQQKGVDLITEAIPWMIGQDV  154

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+LRQFE +H+DKVRGWVGFSVKT+HRITAGADILLMPSRFEPC LN
Sbjct  155  QLVMLGTGRPDLEQMLRQFENEHHDKVRGWVGFSVKTAHRITAGADILLMPSRFEPCCLN  214

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV  F+ + E+G+GWTFD A+A +LIHALGNCLLTY+QY
Sbjct  215  QLYAMNYGTIPVVHAVGGLRDTVQQFNLFEESGVGWTFDSADASKLIHALGNCLLTYQQY  274

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGLQ RGM QDLSWD+AA+ YEEVLVAAKYQW
Sbjct  275  KTSWEGLQIRGMKQDLSWDNAAEKYEEVLVAAKYQW  310



>ref|XP_007032555.1| Starch synthase 2 [Theobroma cacao]
 gb|EOY03481.1| Starch synthase 2 [Theobroma cacao]
Length=754

 Score =   399 bits (1024),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 203/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQTGK +CKAALQKELGLP R DVPLIGFIGRLD+QKGVDLIAEAIPWMMG+DV
Sbjct  539  NYSLETLQTGKAQCKAALQKELGLPGREDVPLIGFIGRLDHQKGVDLIAEAIPWMMGQDV  598

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTG+PDLE++LRQFE QH DKVRGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  599  QLVMLGTGQPDLEEMLRQFENQHRDKVRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  658

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PF PY E+GLGWTF  A+A +LIHALGNCLLTYR+Y
Sbjct  659  QLYAMNYGTIPVVHAVGGLRDTVQPFKPYEESGLGWTFGSADANKLIHALGNCLLTYREY  718

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ+R MMQDLSWD+AA+ YEEVLVAAKYQW
Sbjct  719  KKSWEGLQRRAMMQDLSWDNAAEKYEEVLVAAKYQW  754



>ref|XP_008443400.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Cucumis melo]
Length=796

 Score =   399 bits (1026),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 201/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQTGKP+CKAALQKELGLP+R DVPLIGFIGRLD QKGVD+IAEAIPWM+G+DV
Sbjct  581  NYSLETLQTGKPQCKAALQKELGLPIREDVPLIGFIGRLDQQKGVDIIAEAIPWMVGQDV  640

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLEQ+LR FE +H DKVRGWVGFS+K +HRITAG DILLMPSRFEPCGLN
Sbjct  641  QLVMLGTGRQDLEQMLRDFENKHRDKVRGWVGFSIKMAHRITAGIDILLMPSRFEPCGLN  700

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVH VGGLRDTV+PFDP+NE+G GWTFD AEA +LIHALGNCLLTYR+Y
Sbjct  701  QLYAMNYGTIPVVHRVGGLRDTVIPFDPFNESGYGWTFDSAEANKLIHALGNCLLTYREY  760

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ RGM QDLSWDHAA+ YEEVLVAAKYQW
Sbjct  761  KKSWEGLQIRGMTQDLSWDHAAEKYEEVLVAAKYQW  796



>ref|XP_004489397.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
[Cicer arietinum]
Length=761

 Score =   398 bits (1023),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 203/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+LETLQTGKP+CKAALQKELGLPVR DVP+I FIGRLD+QKG+DLIAEAIPWMM +DV
Sbjct  546  NYTLETLQTGKPQCKAALQKELGLPVREDVPIISFIGRLDHQKGIDLIAEAIPWMMDQDV  605

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+L QFE QHN+K+RGWVGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  606  QLVMLGTGRPDLEQMLTQFECQHNNKIRGWVGFSVKMAHRITAGADILLMPSRFEPCGLN  665

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PF+P+ E+GLGWTFD AEA +LIHALGNCL TYR+Y
Sbjct  666  QLYAMNYGTIPVVHAVGGLRDTVKPFNPFEESGLGWTFDSAEANRLIHALGNCLWTYREY  725

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ+RGM QDLSWD+AAQ YEEVLVAAKYQW
Sbjct  726  KKSWEGLQQRGMSQDLSWDNAAQQYEEVLVAAKYQW  761



>emb|CDY43274.1| BnaC05g48670D [Brassica napus]
Length=698

 Score =   396 bits (1018),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 202/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL  GKP+CKAALQKELGLPVRPDVPLIGFIGRLD QKGVDLIAEA+PWMM +DV
Sbjct  483  NYSLETLDVGKPQCKAALQKELGLPVRPDVPLIGFIGRLDQQKGVDLIAEAVPWMMSQDV  542

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE++LR+ E+Q+ DK RGWVGFSVKT+HRITAGAD+LLMPSRFEPCGLN
Sbjct  543  QLVMLGTGRPDLEEVLRRMEHQYRDKARGWVGFSVKTAHRITAGADVLLMPSRFEPCGLN  602

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  FDPY+ETGLGWTFD AEA +LIHALGNCLLTYR+Y
Sbjct  603  QLYAMKYGTVPVVHAVGGLRDTVQQFDPYSETGLGWTFDSAEAGKLIHALGNCLLTYREY  662

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM QDLSWD+AA+ YEEVLVAAKYQW
Sbjct  663  KESWEGLQRRGMTQDLSWDNAAEKYEEVLVAAKYQW  698



>ref|XP_006408470.1| hypothetical protein EUTSA_v10020091mg [Eutrema salsugineum]
 gb|ESQ49923.1| hypothetical protein EUTSA_v10020091mg [Eutrema salsugineum]
Length=805

 Score =   399 bits (1026),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL  GKP+CKAALQKELGLPVRPDVPLIGFIGRLD+QKGVDLIAEA+PWMM +DV
Sbjct  590  NYSLETLHIGKPQCKAALQKELGLPVRPDVPLIGFIGRLDHQKGVDLIAEAVPWMMSQDV  649

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE++LRQ E+Q+ DK RGWVGFSV+T+HRITAGADILLMPSRFEPCGLN
Sbjct  650  QLVMLGTGRPDLEEVLRQMEHQYRDKARGWVGFSVRTAHRITAGADILLMPSRFEPCGLN  709

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV  FDPY+ETGLGWTFD A+A +LIHALGNCLLTYR+Y
Sbjct  710  QLYAMNYGTIPVVHAVGGLRDTVQQFDPYSETGLGWTFDSAKAGKLIHALGNCLLTYREY  769

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM QDLSWD+AA+ YEEVLVAAKYQW
Sbjct  770  KESWEGLQRRGMTQDLSWDNAAEKYEEVLVAAKYQW  805



>ref|XP_006482606.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
[Citrus sinensis]
Length=769

 Score =   398 bits (1023),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY L+TL TGKP+CKAALQ+E GLPVR DVP+IGFIGRLD+QKGVDLIAEAIPWMMG+DV
Sbjct  554  NYCLDTLHTGKPQCKAALQREFGLPVRDDVPVIGFIGRLDHQKGVDLIAEAIPWMMGQDV  613

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGRPDLE++LR FE +H+DKVRGWVGFSVKT+HRITAGAD+LLMPSRFEPCGLN
Sbjct  614  QLIMLGTGRPDLEEMLRNFERKHHDKVRGWVGFSVKTAHRITAGADVLLMPSRFEPCGLN  673

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLR+TV PFDP++E+GLGWTFD A A +LIHALGNCLLT+++Y
Sbjct  674  QLYAMNYGTIPVVHAVGGLRETVQPFDPFSESGLGWTFDSASAGKLIHALGNCLLTFQEY  733

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ+RGMMQDLSWDHAAQ YEEVLVAAKYQW
Sbjct  734  KKSWEGLQRRGMMQDLSWDHAAQLYEEVLVAAKYQW  769



>ref|NP_186767.1| starch synthase 2 [Arabidopsis thaliana]
 sp|Q9MAC8.1|SSY2_ARATH RecName: Full=Starch synthase 2, chloroplastic/amyloplastic; 
Short=AtSS2; AltName: Full=Soluble starch synthase II; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF26156.1|AC008261_13 putative glycogen synthase [Arabidopsis thaliana]
 gb|AAK96659.1| putative glycogen synthase [Arabidopsis thaliana]
 gb|AAO00915.1| putative glycogen synthase [Arabidopsis thaliana]
 gb|AEE73621.1| starch synthase 2 [Arabidopsis thaliana]
 gb|AHL38788.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=792

 Score =   398 bits (1022),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 202/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLE L  GKP+CKAALQKELGLPVRPDVPLIGFIGRLD+QKGVDLIAEA+PWMM +DV
Sbjct  577  NYSLENLHIGKPQCKAALQKELGLPVRPDVPLIGFIGRLDHQKGVDLIAEAVPWMMSQDV  636

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE++LRQ E+Q+ DK RGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  637  QLVMLGTGRPDLEEVLRQMEHQYRDKARGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  696

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV  FDPY+ETGLGWTFD AEA +LIHALGNCLLTYR+Y
Sbjct  697  QLYAMNYGTIPVVHAVGGLRDTVQQFDPYSETGLGWTFDSAEAGKLIHALGNCLLTYREY  756

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM QDLSWD+AA+ YEEVLVAAKY W
Sbjct  757  KESWEGLQRRGMTQDLSWDNAAEKYEEVLVAAKYHW  792



>ref|XP_011467955.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Fragaria vesca subsp. vesca]
Length=783

 Score =   397 bits (1021),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL+TGKP+CKAALQKELGLP+R DVPLIGFIGRLD+QKGVDLIAEAIPWM+ +DV
Sbjct  568  NYSLETLKTGKPQCKAALQKELGLPIREDVPLIGFIGRLDHQKGVDLIAEAIPWMINQDV  627

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+LR+FE+QH DKVRGWVGFSV+T+HRITAG DILLMPSRFEPCGLN
Sbjct  628  QLVMLGTGRPDLEQMLREFEHQHRDKVRGWVGFSVQTAHRITAGVDILLMPSRFEPCGLN  687

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGL+DTV PF+PY E+GLGWTFD A+  +LIHALGNC+ TYR +
Sbjct  688  QLYAMNYGTVPVVHAVGGLKDTVHPFNPYEESGLGWTFDSADTGKLIHALGNCIYTYRDF  747

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEG+Q+RGMMQDLSWD AAQNYEEVLVAAKYQW
Sbjct  748  KQSWEGIQRRGMMQDLSWDKAAQNYEEVLVAAKYQW  783



>gb|KFK37580.1| hypothetical protein AALP_AA3G001700 [Arabis alpina]
Length=807

 Score =   398 bits (1023),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 202/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLE L  GKP+CKAALQKELGLPVRPDVPLIGFIGRLD+QKGVDLIAEA+PWMM +DV
Sbjct  592  NYSLENLHIGKPQCKAALQKELGLPVRPDVPLIGFIGRLDHQKGVDLIAEAVPWMMSQDV  651

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE++LRQ E+Q+ DK RGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  652  QLVMLGTGRPDLEEVLRQMEHQYRDKARGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  711

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV  FDPY+ETGLGWTFD AEA +LIHALGNCLLTYR+Y
Sbjct  712  QLYAMNYGTIPVVHAVGGLRDTVQQFDPYSETGLGWTFDSAEAGKLIHALGNCLLTYREY  771

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM QDLSWD+AA+ YEEVLVAAKY W
Sbjct  772  KESWEGLQRRGMTQDLSWDNAAEKYEEVLVAAKYHW  807



>gb|ACL98481.1| starch synthase IIa precursor [Lotus japonicus]
Length=792

 Score =   398 bits (1022),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 202/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+LETL +GK +CKAALQKELGLPVR DVPLIGFIGRLD+QKGVDLIAEAIPWMM +DV
Sbjct  577  NYTLETLHSGKRQCKAALQKELGLPVREDVPLIGFIGRLDHQKGVDLIAEAIPWMMDQDV  636

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGRPDLEQ+LRQFE QH DKVRGWVGFSVKT+HRITAG DILLMPSRFEPCGLN
Sbjct  637  QLIMLGTGRPDLEQMLRQFESQHRDKVRGWVGFSVKTAHRITAGVDILLMPSRFEPCGLN  696

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV  F+P+ E+GLGWTFD AEA++LIHALGNCL TYR+Y
Sbjct  697  QLYAMNYGTVPVVHAVGGLRDTVQAFNPFEESGLGWTFDSAEADKLIHALGNCLWTYREY  756

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQKRGM QDLSWD+AAQ YEEVLVAAKYQW
Sbjct  757  KKSWEGLQKRGMSQDLSWDNAAQQYEEVLVAAKYQW  792



>ref|XP_002882195.1| hypothetical protein ARALYDRAFT_477411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58454.1| hypothetical protein ARALYDRAFT_477411 [Arabidopsis lyrata subsp. 
lyrata]
Length=796

 Score =   397 bits (1020),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 202/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLE L  GKP+CKAALQKELGLPVRPDVPLIGFIGRLD+QKGVDLIAEA+PWMM +DV
Sbjct  581  NYSLENLHIGKPQCKAALQKELGLPVRPDVPLIGFIGRLDHQKGVDLIAEAVPWMMSQDV  640

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG+GRPDLE++LRQ E+Q+ DK RGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  641  QLVMLGSGRPDLEEVLRQMEHQYRDKARGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  700

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV  FDPY+ETGLGWTFD AEA +LIHALGNCLLTYR+Y
Sbjct  701  QLYAMNYGTIPVVHAVGGLRDTVQQFDPYSETGLGWTFDSAEAGKLIHALGNCLLTYREY  760

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM QDLSWD+AA+ YEEVLVAAKY W
Sbjct  761  KESWEGLQRRGMTQDLSWDNAAEKYEEVLVAAKYHW  796



>ref|XP_010485530.1| PREDICTED: starch synthase 2, chloroplastic/amyloplastic-like 
[Camelina sativa]
Length=804

 Score =   397 bits (1021),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS+ETL  GKP+CKAALQ+ELGLP+RPDVPLIGFIGRLD+QKGVDLIAEA+PWMM +DV
Sbjct  589  NYSVETLGIGKPQCKAALQRELGLPIRPDVPLIGFIGRLDHQKGVDLIAEAVPWMMSQDV  648

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE++LRQ E+Q+ DK RGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  649  QLVMLGTGRPDLEEVLRQMEHQYRDKARGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  708

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV  FDPY+ETGLGWTFD AEA +LIHALGNCLLTYR+Y
Sbjct  709  QLYAMNYGTIPVVHAVGGLRDTVQQFDPYSETGLGWTFDSAEAGKLIHALGNCLLTYREY  768

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM QDLSWD+AA+ YEEVLVAAKYQW
Sbjct  769  KQSWEGLQRRGMTQDLSWDNAAEKYEEVLVAAKYQW  804



>ref|XP_010463566.1| PREDICTED: starch synthase 2, chloroplastic/amyloplastic [Camelina 
sativa]
Length=805

 Score =   397 bits (1020),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS+ETL  GKP+CKAALQ+ELGLP+RPDVPLIGFIGRLD+QKGVDLIAEA+PWMM +DV
Sbjct  590  NYSVETLGIGKPQCKAALQRELGLPIRPDVPLIGFIGRLDHQKGVDLIAEAVPWMMSQDV  649

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE++LRQ E+Q+ DK RGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  650  QLVMLGTGRPDLEEVLRQMEHQYRDKARGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  709

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV  FDPY+ETGLGWTFD AEA +LIHALGNCLLTYR+Y
Sbjct  710  QLYAMNYGTIPVVHAVGGLRDTVQQFDPYSETGLGWTFDSAEAGKLIHALGNCLLTYREY  769

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM QDLSWD+AA+ YEEVLVAAKYQW
Sbjct  770  KQSWEGLQRRGMTQDLSWDNAAEKYEEVLVAAKYQW  805



>gb|KGN59559.1| hypothetical protein Csa_3G825040 [Cucumis sativus]
Length=234

 Score =   377 bits (969),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -2

Query  842  QTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDVQVVMLGT  663
            +TGK +CKAALQKELGLP+R D+PLIGFIGRLD QKGVD+IAEAIPWM+G++VQ+VMLGT
Sbjct  26   KTGKAQCKAALQKELGLPIREDIPLIGFIGRLDQQKGVDIIAEAIPWMVGQNVQLVMLGT  85

Query  662  GRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLNQLYAMSY  483
            GR DLEQ+LR FE +H DK+RGWVGFS+K +HRITAG DILLMPSRFEPCGLNQLYAM+Y
Sbjct  86   GRQDLEQMLRDFENKHRDKIRGWVGFSIKMAHRITAGIDILLMPSRFEPCGLNQLYAMNY  145

Query  482  GTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQYKKSWEGL  303
            GT+PVVH VGGLRDTV+PFDP+NE+G GWTFD AEA +LIHALGNCLLTY+QYKKSWEGL
Sbjct  146  GTIPVVHRVGGLRDTVIPFDPFNESGYGWTFDSAEANKLIHALGNCLLTYKQYKKSWEGL  205

Query  302  QKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            Q+RGM QDLSWDHAA+ YEEVLVAAKYQW
Sbjct  206  QRRGMTQDLSWDHAAEKYEEVLVAAKYQW  234



>ref|XP_011652235.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Cucumis sativus]
Length=816

 Score =   397 bits (1019),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 201/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQTGK +CKAALQKELGLP+R D+PLIGFIGRLD QKGVD+IAEAIPWM+G++V
Sbjct  601  NYSLETLQTGKAQCKAALQKELGLPIREDIPLIGFIGRLDQQKGVDIIAEAIPWMVGQNV  660

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLEQ+LR FE +H DK+RGWVGFS+K +HRITAG DILLMPSRFEPCGLN
Sbjct  661  QLVMLGTGRQDLEQMLRDFENKHRDKIRGWVGFSIKMAHRITAGIDILLMPSRFEPCGLN  720

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVH VGGLRDTV+PFDP+NE+G GWTFD AEA +LIHALGNCLLTY+QY
Sbjct  721  QLYAMNYGTIPVVHRVGGLRDTVIPFDPFNESGYGWTFDSAEANKLIHALGNCLLTYKQY  780

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ+RGM QDLSWDHAA+ YEEVLVAAKYQW
Sbjct  781  KKSWEGLQRRGMTQDLSWDHAAEKYEEVLVAAKYQW  816



>emb|CDP02238.1| unnamed protein product [Coffea canephora]
Length=768

 Score =   395 bits (1014),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL+TL+TGKP+CK ALQKELGLPVR +VPLIGFIGRLD+QKGVDLIAEAIPWMMG+DV
Sbjct  553  NYSLDTLKTGKPQCKEALQKELGLPVRDNVPLIGFIGRLDHQKGVDLIAEAIPWMMGQDV  612

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+LRQFE Q+++K+RGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  613  QLVMLGTGRPDLEQMLRQFEGQYSNKIRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  672

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  F+PYNE+GLGWTF RAEA QLI+ALGNC LTYR+Y
Sbjct  673  QLYAMCYGTVPVVHAVGGLRDTVQSFNPYNESGLGWTFQRAEANQLINALGNCFLTYREY  732

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEG+Q+RGM+Q+LSWD+AA+ YE++LVAAKYQW
Sbjct  733  KNSWEGIQRRGMLQNLSWDNAAEKYEDILVAAKYQW  768



>gb|ACL98482.1| starch synthase IIb precursor [Lotus japonicus]
Length=800

 Score =   395 bits (1014),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 201/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL  GK +CKAALQKELGLPV  DVP+IGFIGRLD QKGVD+I EAIPWMMG+DV
Sbjct  585  NYSLETLPVGKAQCKAALQKELGLPVNEDVPVIGFIGRLDNQKGVDIIGEAIPWMMGQDV  644

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE +LRQFE QHNDK+RGWVGFSVK +HRITAG DILLMPSRFEPCGLN
Sbjct  645  QLVMLGTGRPDLEHMLRQFENQHNDKIRGWVGFSVKMAHRITAGVDILLMPSRFEPCGLN  704

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+NE+GLGWTFD A++ +LIHALGNCLLTYR++
Sbjct  705  QLYAMNYGTVPVVHAVGGLRDTVQPFDPFNESGLGWTFDSADSGKLIHALGNCLLTYREH  764

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEG+Q+RGMMQDLSWD+AAQ YEEVLVAAKYQW
Sbjct  765  KKSWEGIQRRGMMQDLSWDNAAQLYEEVLVAAKYQW  800



>ref|XP_010414882.1| PREDICTED: starch synthase 2, chloroplastic/amyloplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010415549.1| PREDICTED: starch synthase 2, chloroplastic/amyloplastic-like 
isoform X2 [Camelina sativa]
Length=802

 Score =   395 bits (1014),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS+ETL  GKP+CKAALQ+ELGLP+RPDVPLIGFIGRLD+QKGVDLIAEA+PWMM +DV
Sbjct  587  NYSVETLGIGKPQCKAALQRELGLPIRPDVPLIGFIGRLDHQKGVDLIAEAVPWMMSQDV  646

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE++LRQ E+Q+ DK RGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  647  QLVMLGTGRPDLEEVLRQMEHQYRDKARGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  706

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLR+TV  FDPY+ETGLGWTFD AEA +LIHALGNCLLTYR+Y
Sbjct  707  QLYAMNYGTIPVVHAVGGLRETVQQFDPYSETGLGWTFDSAEAGKLIHALGNCLLTYREY  766

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM QDLSWD+AA+ YEEVLVAAKYQW
Sbjct  767  KQSWEGLQRRGMTQDLSWDNAAEKYEEVLVAAKYQW  802



>gb|KJB11066.1| hypothetical protein B456_001G239200 [Gossypium raimondii]
Length=731

 Score =   392 bits (1008),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 203/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS+ETLQ GK +CKAALQKELGLPVR DVPLIGFIGRLD+QKGVD+IAEAIPWMM +DV
Sbjct  516  NYSIETLQPGKAQCKAALQKELGLPVREDVPLIGFIGRLDHQKGVDIIAEAIPWMMDQDV  575

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE+LLRQFE QH+DKVRGWVGFSV+T+HRITAGADILLMPSRFEPCGLN
Sbjct  576  QLVMLGTGRQDLEELLRQFEGQHHDKVRGWVGFSVETAHRITAGADILLMPSRFEPCGLN  635

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV PF+P+ E+G GWTFD A+A +LIHALGNCLLTYR+Y
Sbjct  636  QLYAMCYGTIPVVHAVGGLRDTVQPFNPFAESGFGWTFDSADASKLIHALGNCLLTYREY  695

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW+GL++RGMMQDLSWD+AAQ YEEVLVAAKYQW
Sbjct  696  KESWDGLRRRGMMQDLSWDNAAQKYEEVLVAAKYQW  731



>gb|AAF13168.1|AF173900_1 granule bound starch synthase II precursor [Manihot esculenta]
Length=751

 Score =   393 bits (1009),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 198/216 (92%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL TGKP+CK ALQ EL   + PDVP+IGFIGRLDYQKGVDLIAEAIPWM+G+DV
Sbjct  536  NYSLETLDTGKPQCKTALQNELRFAIPPDVPVIGFIGRLDYQKGVDLIAEAIPWMVGQDV  595

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE++LRQFE QH DKVRGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  596  QLVMLGTGRQDLEEMLRQFENQHRDKVRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  655

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV PFDP+NE+GLGWTFD AE+ +LIHALGNCLLTYR+Y
Sbjct  656  QLYAMMYGTIPVVHAVGGLRDTVQPFDPFNESGLGWTFDSAESHKLIHALGNCLLTYREY  715

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ+RGM  +LSWDHAA+ YEE LVAAKYQW
Sbjct  716  KKSWEGLQRRGMTPNLSWDHAAEKYEETLVAAKYQW  751



>gb|KHF99320.1| Granule-bound starch synthase 2, chloroplastic/amyloplastic [Gossypium 
arboreum]
Length=694

 Score =   390 bits (1002),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 202/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS+ETLQ GK +CKAALQKELGLPVR DVPLIGFIGRLD+QKGVD+IAEAIPWMM +DV
Sbjct  479  NYSIETLQPGKAQCKAALQKELGLPVREDVPLIGFIGRLDHQKGVDIIAEAIPWMMDQDV  538

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LGTGR DLE+LLRQFE QHNDKVRGWVGFSV+T+HRITAGADILLMPSRFEPCGLN
Sbjct  539  QLVLLGTGRQDLEELLRQFEDQHNDKVRGWVGFSVQTAHRITAGADILLMPSRFEPCGLN  598

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV PF+P+ E+G GWTFD A+A +LIHALGNCLLTY +Y
Sbjct  599  QLYAMCYGTIPVVHAVGGLRDTVQPFNPFEESGFGWTFDSADASKLIHALGNCLLTYCEY  658

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW+GL++RGMMQDLSWD+AAQ YEEVLVAAKYQW
Sbjct  659  KESWDGLRRRGMMQDLSWDNAAQKYEEVLVAAKYQW  694



>gb|KHN13221.1| Granule-bound starch synthase 2, chloroplastic/amyloplastic [Glycine 
soja]
Length=776

 Score =   392 bits (1008),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 202/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+LETLQ+GK +CKAALQKELGLPVR DVPL+GFIGRLD QKG+DLIAEAIPW++G+DV
Sbjct  561  NYTLETLQSGKRQCKAALQKELGLPVREDVPLLGFIGRLDQQKGIDLIAEAIPWIVGQDV  620

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE +LRQFE QH DKVRGWVGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  621  QLVMLGTGRPDLEDMLRQFESQHRDKVRGWVGFSVKMAHRITAGADILLMPSRFEPCGLN  680

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PF+P+ E+GLGWTFD AE  +LI+ALGNCLLT+RQY
Sbjct  681  QLYAMNYGTIPVVHAVGGLRDTVKPFNPFEESGLGWTFDSAETNKLINALGNCLLTFRQY  740

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM QDLSWD+AAQ YEEVLVAAKYQW
Sbjct  741  KQSWEGLQRRGMTQDLSWDNAAQQYEEVLVAAKYQW  776



>gb|KCW51890.1| hypothetical protein EUGRSUZ_J01349 [Eucalyptus grandis]
Length=455

 Score =   382 bits (980),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLE LQTGK +CK A Q+ELGLPV P+VPL+GFIGRLD+QKGVDLIAEA+PW+MG+DV
Sbjct  240  NYSLENLQTGKAQCKEAFQRELGLPVHPNVPLLGFIGRLDHQKGVDLIAEAVPWLMGQDV  299

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLEQ+LRQFE QH DK+RGWVGFSVK +HRITA +DILLMPSRFEPCGLN
Sbjct  300  QLVMLGTGRQDLEQMLRQFEGQHRDKIRGWVGFSVKMAHRITAASDILLMPSRFEPCGLN  359

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAMSYGT+PVVHAVGGLRDTV PFDP+N TGLGWTFD AEA +LI+ALG CL+TYRQY
Sbjct  360  QLYAMSYGTIPVVHAVGGLRDTVEPFDPFNNTGLGWTFDSAEANKLINALGYCLMTYRQY  419

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEG+Q+RGM +DLSWD+AA+NYEEVLVAAKYQW
Sbjct  420  KESWEGIQRRGMTKDLSWDNAARNYEEVLVAAKYQW  455



>ref|XP_010693244.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010693245.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Beta vulgaris subsp. vulgaris]
Length=801

 Score =   391 bits (1005),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 201/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL+T++ GK +CKAALQKELGLPVR DVPL+GFIGRLD QKGVD+IA++IPW+MG DV
Sbjct  586  NYSLKTIKPGKAQCKAALQKELGLPVREDVPLMGFIGRLDDQKGVDIIADSIPWLMGLDV  645

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQLLRQFE Q++DK+RGWVGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  646  QLVMLGTGRPDLEQLLRQFESQYHDKIRGWVGFSVKMAHRITAGADILLMPSRFEPCGLN  705

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PFDPYN TGLGWTFDRAEA +LIHALGNCLLT+RQY
Sbjct  706  QLYAMNYGTIPVVHAVGGLRDTVQPFDPYNNTGLGWTFDRAEAHRLIHALGNCLLTFRQY  765

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWE LQ RGM QDLSWDHAA+ YEEVLVAAKYQW
Sbjct  766  KDSWEALQTRGMTQDLSWDHAAEIYEEVLVAAKYQW  801



>ref|XP_006827270.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Amborella trichopoda]
 gb|ERM94507.1| hypothetical protein AMTR_s00010p00263000 [Amborella trichopoda]
Length=763

 Score =   389 bits (999),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL TL TGKP+CKAALQ+ELGLPVR DVPLIGFIGRLD+QKGVDLIAEA+PWM+ +D+
Sbjct  548  NYSLNTLTTGKPQCKAALQRELGLPVRKDVPLIGFIGRLDHQKGVDLIAEAMPWMVSQDL  607

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +LRQFE Q+ DKVRGWVGFSVKT+HRITAGAD++LMPSRFEPCGLN
Sbjct  608  QLVMLGTGRADLENMLRQFEGQYRDKVRGWVGFSVKTAHRITAGADVILMPSRFEPCGLN  667

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV PFDP+NE GLGWTFD A++ +LIHALGNCL TYR Y
Sbjct  668  QLYAMRYGTIPVVHAVGGLRDTVQPFDPFNERGLGWTFDSADSGRLIHALGNCLWTYRDY  727

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEG+Q+RGMMQDLSWD+AAQ YEEVLVAAKYQW
Sbjct  728  KKSWEGIQRRGMMQDLSWDNAAQQYEEVLVAAKYQW  763



>gb|KCW51889.1| hypothetical protein EUGRSUZ_J01349 [Eucalyptus grandis]
Length=732

 Score =   388 bits (996),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLE LQTGK +CK A Q+ELGLPV P+VPL+GFIGRLD+QKGVDLIAEA+PW+MG+DV
Sbjct  517  NYSLENLQTGKAQCKEAFQRELGLPVHPNVPLLGFIGRLDHQKGVDLIAEAVPWLMGQDV  576

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLEQ+LRQFE QH DK+RGWVGFSVK +HRITA +DILLMPSRFEPCGLN
Sbjct  577  QLVMLGTGRQDLEQMLRQFEGQHRDKIRGWVGFSVKMAHRITAASDILLMPSRFEPCGLN  636

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAMSYGT+PVVHAVGGLRDTV PFDP+N TGLGWTFD AEA +LI+ALG CL+TYRQY
Sbjct  637  QLYAMSYGTIPVVHAVGGLRDTVEPFDPFNNTGLGWTFDSAEANKLINALGYCLMTYRQY  696

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEG+Q+RGM +DLSWD+AA+NYEEVLVAAKYQW
Sbjct  697  KESWEGIQRRGMTKDLSWDNAARNYEEVLVAAKYQW  732



>ref|XP_010088149.1| Granule-bound starch synthase 2 [Morus notabilis]
 gb|EXB31961.1| Granule-bound starch synthase 2 [Morus notabilis]
Length=946

 Score =   392 bits (1007),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 198/212 (93%), Gaps = 0/212 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQTGKP+CKAALQKEL LPVR DVP+IGFIGRLD QKGVDLI EAIPWMMG+DV
Sbjct  624  NYSLETLQTGKPQCKAALQKELVLPVRDDVPVIGFIGRLDQQKGVDLIGEAIPWMMGQDV  683

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGRPDLEQ+LR FE Q++DKVRGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  684  QLIMLGTGRPDLEQMLRNFESQYHDKVRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  743

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV PF+P+ E+GLGWTFD A+A +LIHALGNCL TYR Y
Sbjct  744  QLYAMKYGTIPVVHAVGGLRDTVQPFNPFEESGLGWTFDSADANKLIHALGNCLYTYRDY  803

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAA  228
            KKSWEGLQ+RGMMQDLSWD AAQNYEEVLVAA
Sbjct  804  KKSWEGLQRRGMMQDLSWDKAAQNYEEVLVAA  835



>ref|NP_001235811.1| starch synthase IIa-2 [Glycine max]
 gb|ACL98480.1| starch synthase IIa-2 precursor [Glycine max]
 gb|KHN45503.1| Granule-bound starch synthase 2, chloroplastic/amyloplastic [Glycine 
soja]
Length=774

 Score =   387 bits (995),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+LETLQ+GK +CKAALQKELG PVR DVPL+GFIGRLD QKG+DLIAE+IPW++ +DV
Sbjct  559  NYTLETLQSGKRRCKAALQKELGFPVREDVPLLGFIGRLDQQKGIDLIAESIPWIVSQDV  618

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE +LRQFE QH DKVRGWVGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  619  QLVMLGTGRPDLEDMLRQFESQHRDKVRGWVGFSVKMAHRITAGADILLMPSRFEPCGLN  678

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PF+P+ E+GLGWTFD AE  +LI+A+GNCLLT+RQY
Sbjct  679  QLYAMNYGTIPVVHAVGGLRDTVKPFNPFEESGLGWTFDSAETNKLINAIGNCLLTFRQY  738

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM QDLSWD+AAQ YEEVLVAAKYQW
Sbjct  739  KQSWEGLQRRGMTQDLSWDNAAQQYEEVLVAAKYQW  774



>gb|AHA51126.1| granule bound starch synthase [Musa acuminata AAA Group]
Length=301

 Score =   371 bits (953),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS+ETLQ GKP+CKAALQKELGLPVR DVPLIGFIGRLD+QKGVDLIA A+PW++G+D+
Sbjct  86   NYSIETLQAGKPQCKAALQKELGLPVREDVPLIGFIGRLDHQKGVDLIAGAMPWIVGQDL  145

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE++LR+F+ +H++KVR WVGFSVK +HRITAGAD+LLMPSRFEPCGLN
Sbjct  146  QLVMLGTGRADLEEMLRKFDREHHNKVRAWVGFSVKMAHRITAGADVLLMPSRFEPCGLN  205

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV+PFDP+ E+G GWTFDRAEA +LI+ALGNCL TYR  
Sbjct  206  QLYAMKYGTVPVVHAVGGLRDTVIPFDPFRESGFGWTFDRAEANKLINALGNCLNTYRNQ  265

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K++W+GLQ RGM QDLSWD+AA++YEEVLV+AKYQW
Sbjct  266  KENWKGLQTRGMAQDLSWDNAAKHYEEVLVSAKYQW  301



>ref|XP_010032498.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Eucalyptus grandis]
 gb|KCW51888.1| hypothetical protein EUGRSUZ_J01349 [Eucalyptus grandis]
Length=790

 Score =   387 bits (993),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLE LQTGK +CK A Q+ELGLPV P+VPL+GFIGRLD+QKGVDLIAEA+PW+MG+DV
Sbjct  575  NYSLENLQTGKAQCKEAFQRELGLPVHPNVPLLGFIGRLDHQKGVDLIAEAVPWLMGQDV  634

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLEQ+LRQFE QH DK+RGWVGFSVK +HRITA +DILLMPSRFEPCGLN
Sbjct  635  QLVMLGTGRQDLEQMLRQFEGQHRDKIRGWVGFSVKMAHRITAASDILLMPSRFEPCGLN  694

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAMSYGT+PVVHAVGGLRDTV PFDP+N TGLGWTFD AEA +LI+ALG CL+TYRQY
Sbjct  695  QLYAMSYGTIPVVHAVGGLRDTVEPFDPFNNTGLGWTFDSAEANKLINALGYCLMTYRQY  754

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEG+Q+RGM +DLSWD+AA+NYEEVLVAAKYQW
Sbjct  755  KESWEGIQRRGMTKDLSWDNAARNYEEVLVAAKYQW  790



>ref|NP_001235796.1| starch synthase IIa-1 [Glycine max]
 gb|ACL98479.1| starch synthase IIa-1 precursor [Glycine max]
Length=757

 Score =   385 bits (990),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 201/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+LETLQ+GK +CKAALQKELGLPVR DVPL+GFIGRLD QKG+DLIAEAIPW++G+DV
Sbjct  542  NYTLETLQSGKRQCKAALQKELGLPVREDVPLLGFIGRLDQQKGIDLIAEAIPWIVGQDV  601

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE +LRQFE QH DKVRGWVGFSVK +HRITAGADILLMPSRFEPCGL+
Sbjct  602  QLVMLGTGRPDLEDMLRQFESQHRDKVRGWVGFSVKMAHRITAGADILLMPSRFEPCGLS  661

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PF+P+ E+GLG TFD AE  +LI+ALGNCLLT+RQY
Sbjct  662  QLYAMNYGTIPVVHAVGGLRDTVKPFNPFEESGLGRTFDSAETNKLINALGNCLLTFRQY  721

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM QDLSWD+AAQ YEEVLVAAKYQW
Sbjct  722  KQSWEGLQRRGMTQDLSWDNAAQQYEEVLVAAKYQW  757



>ref|XP_009415589.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
[Musa acuminata subsp. malaccensis]
Length=334

 Score =   371 bits (953),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS+ETLQ GKP+CKAALQKELGLPVR DVPLIGFIGRLD+QKGVDLIA A+PW++G+D+
Sbjct  119  NYSIETLQAGKPQCKAALQKELGLPVREDVPLIGFIGRLDHQKGVDLIAGAMPWIVGQDL  178

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE++LR+F+ +H++KVR WVGFSVK +HRITAGAD+LLMPSRFEPCGLN
Sbjct  179  QLVMLGTGRADLEEMLRKFDREHHNKVRAWVGFSVKMAHRITAGADVLLMPSRFEPCGLN  238

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV+PFDP+ E+G GWTFDRAEA +LI+ALGNCL TYR  
Sbjct  239  QLYAMKYGTVPVVHAVGGLRDTVIPFDPFRESGFGWTFDRAEANKLINALGNCLNTYRNQ  298

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K++W+GLQ RGM QDLSWD+AA++YEEVLV+AKYQW
Sbjct  299  KENWKGLQTRGMAQDLSWDNAAKHYEEVLVSAKYQW  334



>gb|AES74718.2| granule bound starch synthase [Medicago truncatula]
Length=758

 Score =   385 bits (989),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+LETLQTGK +CKAALQKELGLPVR DVP+I FIGRLD QKGVDLI EAIPWMM  DV
Sbjct  543  NYTLETLQTGKRQCKAALQKELGLPVREDVPIIAFIGRLDQQKGVDLIGEAIPWMMSHDV  602

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGRPDLE++LRQFE+QH+DK+RGWVGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  603  QLIMLGTGRPDLEEMLRQFEWQHHDKIRGWVGFSVKMAHRITAGADILLMPSRFEPCGLN  662

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PF+P++E+G+GWTFDRAEA +L  AL NC+LTYR Y
Sbjct  663  QLYAMNYGTVPVVHAVGGLRDTVQPFNPFDESGVGWTFDRAEANKLKAALWNCILTYRDY  722

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEG+Q+RGM QDLSWD+AA+ YEEVLVAAKYQW
Sbjct  723  KKSWEGIQRRGMSQDLSWDNAAEQYEEVLVAAKYQW  758



>gb|ABA64552.1| starch synthase II [Amaranthus cruentus]
Length=809

 Score =   387 bits (993),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 198/216 (92%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL+ GK +CKAALQ ELGLPVR DVPLIGFIGRLD QKGVD+IAE+IPW+ G+DV
Sbjct  594  NYSLETLKPGKAQCKAALQNELGLPVREDVPLIGFIGRLDGQKGVDIIAESIPWLSGQDV  653

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLEQ+LR+ E ++ DK+RGWVGFSVKT+HRITAG DILLMPSRFEPCGLN
Sbjct  654  QLVMLGTGRPDLEQMLRECESRYPDKIRGWVGFSVKTAHRITAGVDILLMPSRFEPCGLN  713

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PFDPYN TG GWTFDRAEA +LI ALGNCLLTYRQY
Sbjct  714  QLYAMNYGTIPVVHAVGGLRDTVQPFDPYNNTGYGWTFDRAEANRLIDALGNCLLTYRQY  773

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ RGM QDLSWDHAA+ YEEVLVAAKYQW
Sbjct  774  KESWEGLQTRGMTQDLSWDHAAEIYEEVLVAAKYQW  809



>ref|XP_010939803.1| PREDICTED: soluble starch synthase 2-2, chloroplastic/amyloplastic-like 
[Elaeis guineensis]
Length=782

 Score =   381 bits (979),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 197/216 (91%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQ GKP+CKAALQ+ELGLPVR DVP++ FIGRLD QKGVDLIAEAIPW++G+DV
Sbjct  567  NYSLETLQAGKPQCKAALQRELGLPVRDDVPILAFIGRLDQQKGVDLIAEAIPWIVGQDV  626

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE +LR+FE Q+ DKVRGWVGFSVKT+HRITAGADILLMPSRFEPCGLN
Sbjct  627  QLVMLGTGRPDLEDMLRRFESQYCDKVRGWVGFSVKTAHRITAGADILLMPSRFEPCGLN  686

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PV HAVGGLRDTV+ FDPY E+G GWTFDRAEA +LI ALGNCL TY  Y
Sbjct  687  QLYAMMYGTIPVAHAVGGLRDTVIQFDPYKESGYGWTFDRAEAHKLIDALGNCLNTYWNY  746

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGMMQDLSWD+AAQ+YEEVLVAAKYQW
Sbjct  747  KESWRGLQTRGMMQDLSWDNAAQHYEEVLVAAKYQW  782



>ref|XP_007139519.1| hypothetical protein PHAVU_008G036600g [Phaseolus vulgaris]
 gb|ESW11513.1| hypothetical protein PHAVU_008G036600g [Phaseolus vulgaris]
Length=724

 Score =   379 bits (974),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 198/216 (92%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL +GK +CK ALQ+ELGLP+R +VPLIGFIGRLD QKGVDLIAEAIPW+M +DV
Sbjct  509  NYSLETLSSGKRQCKTALQRELGLPIREEVPLIGFIGRLDPQKGVDLIAEAIPWLMSQDV  568

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG+GRPDLE +LRQFE QH DK+RGWVGFSVK +HRITAG+DILLMPSRFEPCGLN
Sbjct  569  QLVMLGSGRPDLENMLRQFESQHRDKIRGWVGFSVKMAHRITAGSDILLMPSRFEPCGLN  628

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGL+DTV PFDP++E+GLGWTF+ A++ +L HALGNCLLTYR+Y
Sbjct  629  QLYAMNYGTVPVVHAVGGLKDTVQPFDPFSESGLGWTFESADSGKLSHALGNCLLTYREY  688

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQKRGM  DLSWD AAQ YEEVL+AAKYQW
Sbjct  689  KKSWEGLQKRGMTLDLSWDSAAQQYEEVLLAAKYQW  724



>gb|ACL98484.1| starch synthase IIb precursor [Vigna unguiculata]
Length=698

 Score =   378 bits (971),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 199/216 (92%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL +GK +CK ALQKELGLP+R DVPLIGFIGRLD QKGVD+IAEAIPW+M +DV
Sbjct  483  NYSLETLSSGKLQCKTALQKELGLPIREDVPLIGFIGRLDPQKGVDIIAEAIPWLMSQDV  542

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG+GRPDLE +LRQFE QHNDK+RGWVGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  543  QLVMLGSGRPDLEHMLRQFESQHNDKIRGWVGFSVKMAHRITAGADILLMPSRFEPCGLN  602

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP++E+GLGWTF+ A++ +L +ALGNCL TYR+Y
Sbjct  603  QLYAMNYGTVPVVHAVGGLRDTVQPFDPFSESGLGWTFESADSGKLSNALGNCLWTYREY  662

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSW+GLQ+RGM QDLSWD+AA  YEEVL+AAKYQW
Sbjct  663  KKSWQGLQRRGMTQDLSWDNAALQYEEVLLAAKYQW  698



>gb|ACL98485.1| starch synthase IIa precursor [Vigna radiata]
Length=742

 Score =   379 bits (974),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 199/216 (92%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS+ETLQ+GK +CKAALQ+ELGLPVR DVPL+GFIGRLD+QKG+DLIAEAIPW+MG+DV
Sbjct  527  NYSIETLQSGKRQCKAALQRELGLPVREDVPLLGFIGRLDHQKGIDLIAEAIPWLMGQDV  586

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+ MLGTGRPDLE ++++   QH DK++GWVGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  587  QLAMLGTGRPDLEDMVKELMAQHGDKIKGWVGFSVKMAHRITAGADILLMPSRFEPCGLN  646

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PF+P+ E+GLGWTFD AE  +LI++LGNCL+T+RQ+
Sbjct  647  QLYAMNYGTIPVVHAVGGLRDTVTPFNPFEESGLGWTFDSAETYKLINSLGNCLMTFRQF  706

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGLQKRGMMQDLSWD AA+ YEEVLVAAKYQW
Sbjct  707  KHSWEGLQKRGMMQDLSWDKAAEQYEEVLVAAKYQW  742



>gb|ACL98486.1| starch synthase IIb precursor [Vigna radiata]
Length=720

 Score =   377 bits (969),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 198/216 (92%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY LETL +GK +CK ALQKELGLP+R DVPLIGFIGRLD QKGVD+IAEAIPW+M +DV
Sbjct  505  NYFLETLSSGKRQCKTALQKELGLPIREDVPLIGFIGRLDPQKGVDIIAEAIPWLMSQDV  564

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG+GRPDLE +LRQFE QHNDK+RGWVGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  565  QLVMLGSGRPDLEHMLRQFESQHNDKIRGWVGFSVKMAHRITAGADILLMPSRFEPCGLN  624

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP++E+GLGWTF+ A++ +L +ALGNCL TYR+Y
Sbjct  625  QLYAMNYGTVPVVHAVGGLRDTVQPFDPFSESGLGWTFESADSGKLSNALGNCLWTYREY  684

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQ+RGM QDLSWD+AA  YEEVL+AAKYQW
Sbjct  685  KKSWEGLQRRGMTQDLSWDNAALQYEEVLLAAKYQW  720



>dbj|BAD18846.1| starch synthase II precursor [Phaseolus vulgaris]
Length=724

 Score =   377 bits (969),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 197/216 (91%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL +GK +CK ALQ+ELGLP+R +VPLIGFIGRLD QKGVDLIAEAIPW+M +DV
Sbjct  509  NYSLETLSSGKRQCKTALQRELGLPIREEVPLIGFIGRLDPQKGVDLIAEAIPWLMSQDV  568

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG+GRPDLE +LRQFE QH DK+RGWVGFSVK +HRITAG+DILLMPSRFEPCGLN
Sbjct  569  QLVMLGSGRPDLENMLRQFESQHRDKIRGWVGFSVKMAHRITAGSDILLMPSRFEPCGLN  628

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGL+DTV PFDP++E+GLGWTF+ A++ +  HALGNCLLTYR+Y
Sbjct  629  QLYAMNYGTVPVVHAVGGLKDTVQPFDPFSESGLGWTFESADSGKSSHALGNCLLTYREY  688

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGLQKRGM  DLSWD AAQ YEEVL+AAKYQW
Sbjct  689  KKSWEGLQKRGMTLDLSWDSAAQQYEEVLLAAKYQW  724



>sp|Q43093.1|SSG2_PEA RecName: Full=Granule-bound starch synthase 2, chloroplastic/amyloplastic; 
AltName: Full=Granule-bound starch synthase II; 
Short=GBSS-II; Flags: Precursor [Pisum sativum]
 emb|CAA61269.1| glycogen (starch) synthase [Pisum sativum]
Length=752

 Score =   378 bits (971),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 198/216 (92%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+L+TLQTGK +CKAALQ+ELGLPVR DVP+I FIGRLD+QKGVDLIAEAIPWMM  DV
Sbjct  537  NYNLKTLQTGKRQCKAALQRELGLPVREDVPIISFIGRLDHQKGVDLIAEAIPWMMSHDV  596

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLEQ+L++FE QH DK+R WVGFSVK +HRITAG+DILLMPSRFEPCGLN
Sbjct  597  QLVMLGTGRADLEQMLKEFEAQHCDKIRSWVGFSVKMAHRITAGSDILLMPSRFEPCGLN  656

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAMSYGTVPVVH VGGLRDTV PF+P++E+G+GWTFDRAEA +L+ AL NCLLTY+ Y
Sbjct  657  QLYAMSYGTVPVVHGVGGLRDTVQPFNPFDESGVGWTFDRAEANKLMAALWNCLLTYKDY  716

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEG+Q+RGM QDLSWD+AAQ YEEVLVAAKYQW
Sbjct  717  KKSWEGIQERGMSQDLSWDNAAQQYEEVLVAAKYQW  752



>gb|AAB26592.1| granule-bound starch synthase isoform II, GBSSII [Pisum sativum=peas, 
BC1/9RR, Peptide, 752 aa]
Length=752

 Score =   378 bits (970),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 198/216 (92%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+L+TLQTGK +CKAALQ+ELGLPVR DVP+I FIGRLD+QKGVDLIAEAIPWMM  DV
Sbjct  537  NYNLKTLQTGKRQCKAALQRELGLPVREDVPIISFIGRLDHQKGVDLIAEAIPWMMSHDV  596

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLEQ+L++FE QH DK+R WVGFSVK +HRITAG+DILLMPSRFEPCGLN
Sbjct  597  QLVMLGTGRADLEQMLKEFEAQHCDKIRSWVGFSVKMAHRITAGSDILLMPSRFEPCGLN  656

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAMSYGTVPVVH VGGLRDTV PF+P++E+G+GWTFDRAEA +L+ AL NCLLTY+ Y
Sbjct  657  QLYAMSYGTVPVVHGVGGLRDTVQPFNPFDESGVGWTFDRAEANKLMAALWNCLLTYKDY  716

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEG+Q+RGM QDLSWD+AAQ YEEVLVAAKYQW
Sbjct  717  KKSWEGIQERGMSQDLSWDNAAQQYEEVLVAAKYQW  752



>ref|XP_007151233.1| hypothetical protein PHAVU_004G029100g [Phaseolus vulgaris]
 gb|ESW23227.1| hypothetical protein PHAVU_004G029100g [Phaseolus vulgaris]
Length=757

 Score =   377 bits (969),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS+ETLQ+GK +CKAALQKELG PVR DVPLIGFIGRLD+QKG+D+IAEAIPWM+G+D+
Sbjct  542  NYSVETLQSGKRQCKAALQKELGFPVREDVPLIGFIGRLDHQKGIDIIAEAIPWMVGQDM  601

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+ +LGTGRPDLE +L+Q   QHNDK++G +GFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  602  QLALLGTGRPDLEDMLKQIVSQHNDKIKGLIGFSVKMAHRITAGADILLMPSRFEPCGLN  661

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PF+P+ E+GLGWTFD AE  +L++ALGNCL+T++Q+
Sbjct  662  QLYAMNYGTIPVVHAVGGLRDTVTPFNPFEESGLGWTFDSAEPNKLVNALGNCLMTFKQF  721

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEG+Q+RGMMQDLSWD+AAQ YEEVLVAAKYQW
Sbjct  722  KQSWEGIQRRGMMQDLSWDNAAQQYEEVLVAAKYQW  757



>dbj|BAD18847.1| starch synthase II-2 precursor [Phaseolus vulgaris]
Length=738

 Score =   376 bits (966),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS+ETLQ+GK +CKAALQKELG PVR DVPLIGFIGRLD+QKG+D+IAEAIPWM+G+D+
Sbjct  523  NYSVETLQSGKRQCKAALQKELGFPVREDVPLIGFIGRLDHQKGIDIIAEAIPWMVGQDM  582

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+ +LGTGRPDLE +L+Q   QHNDK++G +GFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  583  QLALLGTGRPDLEDMLKQIVSQHNDKIKGLIGFSVKMAHRITAGADILLMPSRFEPCGLN  642

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PF+P+ E+GLGWTFD AE  +L++ALGNCL+T++Q+
Sbjct  643  QLYAMNYGTIPVVHAVGGLRDTVTPFNPFEESGLGWTFDSAEPNKLVNALGNCLMTFKQF  702

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEG+Q+RGMMQDLSWD+AAQ YEEVLVAAKYQW
Sbjct  703  KQSWEGIQRRGMMQDLSWDNAAQQYEEVLVAAKYQW  738



>gb|ACL98483.1| starch synthase IIa precursor [Vigna unguiculata]
Length=779

 Score =   377 bits (969),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 198/216 (92%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY++ETLQ GK +CKAALQ+ELGLPVR DVPL+GFIGRLD+QKG+DLIAEAIPW+MG+DV
Sbjct  564  NYTIETLQHGKRQCKAALQRELGLPVREDVPLLGFIGRLDHQKGIDLIAEAIPWLMGQDV  623

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+ MLGTGRPDLE +++Q   QH+DK+RG VGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  624  QLAMLGTGRPDLEDMVKQLVSQHSDKIRGCVGFSVKMAHRITAGADILLMPSRFEPCGLN  683

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PF+P+ E+GLGWTFD AE  +LI+ALGNCL+T++Q+
Sbjct  684  QLYAMNYGTIPVVHAVGGLRDTVTPFNPFEESGLGWTFDCAETNKLINALGNCLMTFKQF  743

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGLQ+RGMMQDLSWD AAQ YEEVLVAAKYQW
Sbjct  744  KHSWEGLQRRGMMQDLSWDKAAQQYEEVLVAAKYQW  779



>emb|CBI22230.3| unnamed protein product [Vitis vinifera]
Length=788

 Score =   377 bits (969),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 194/216 (90%), Gaps = 17/216 (8%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL TGKP+CKAALQKELGLP+R DVPLIGFIGRLD+QKGVDLIAEA+PWM+G+DV
Sbjct  590  NYSLETLHTGKPQCKAALQKELGLPIREDVPLIGFIGRLDHQKGVDLIAEAVPWMVGQDV  649

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+                 QH+DK+RGWVGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  650  QLVI-----------------QHHDKIRGWVGFSVKMAHRITAGADILLMPSRFEPCGLN  692

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PFDPYNE+GLGWTFDRAEA +LIHALGNCLLTYRQY
Sbjct  693  QLYAMNYGTIPVVHAVGGLRDTVQPFDPYNESGLGWTFDRAEANRLIHALGNCLLTYRQY  752

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGMMQDLSWDHAAQNYEEVLVAAKYQW
Sbjct  753  KQSWEGLQRRGMMQDLSWDHAAQNYEEVLVAAKYQW  788



>ref|XP_009395950.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=657

 Score =   372 bits (956),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 199/216 (92%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS ET++TGK  CKAALQKELGLPVR +VP+IGFIGRLD+QKGVDLIAEA+PWM+ +DV
Sbjct  442  NYSSETVKTGKLHCKAALQKELGLPVRRNVPVIGFIGRLDHQKGVDLIAEAMPWMVAQDV  501

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE++LR+FE +++DKVRGWVGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  502  QLVMLGTGRPDLEEMLRKFERENHDKVRGWVGFSVKMAHRITAGADILLMPSRFEPCGLN  561

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTVVPFDP+ ETG GWTF+RAE+  L+HALGNCL TY  +
Sbjct  562  QLYAMKYGTVPVVHAVGGLRDTVVPFDPFKETGYGWTFERAESGMLVHALGNCLNTYWNH  621

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWEGL+ RGM QDLSWD+AA++YEEVLVAAKYQW
Sbjct  622  KKSWEGLRTRGMTQDLSWDNAAKHYEEVLVAAKYQW  657



>dbj|BAD15539.1| putative soluble starch synthase 2 [Oryza sativa Japonica Group]
 dbj|BAD16123.1| putative soluble starch synthase 2 [Oryza sativa Japonica Group]
Length=492

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CK ALQ++LGL VR DVPLIGFIGRLD+QKGVD+I +A+PW+ G+DV
Sbjct  277  NYTFETLDTGKKQCKEALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIGDAMPWIAGQDV  336

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            QVVMLGTGRPDLE++LR+FE +HNDKVRGWVGFSV+ +HRITAGAD+LLMPSRFEPCGLN
Sbjct  337  QVVMLGTGRPDLEEMLRRFESEHNDKVRGWVGFSVQLAHRITAGADVLLMPSRFEPCGLN  396

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ +TGLGWTFDRAEA ++I ALG+CL TYR Y
Sbjct  397  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFADTGLGWTFDRAEANRMIDALGHCLNTYRNY  456

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  457  KESWRGLQARGMAQDLSWDHAAELYEDVLVKAKYQW  492



>ref|XP_003618500.1| Starch synthase II [Medicago truncatula]
Length=1014

 Score =   381 bits (979),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 199/215 (93%), Gaps = 0/215 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+LETLQTGK +CKAALQKELGLPVR DVP+I FIGRLD QKGVDLI EAIPWMM  DV
Sbjct  553  NYTLETLQTGKRQCKAALQKELGLPVREDVPIIAFIGRLDQQKGVDLIGEAIPWMMSHDV  612

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGRPDLE++LRQFE+QH+DK+RGWVGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  613  QLIMLGTGRPDLEEMLRQFEWQHHDKIRGWVGFSVKMAHRITAGADILLMPSRFEPCGLN  672

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PF+P++E+G+GWTFDRAEA +L  AL NC+LTYR Y
Sbjct  673  QLYAMNYGTVPVVHAVGGLRDTVQPFNPFDESGVGWTFDRAEANKLKAALWNCILTYRDY  732

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQ  219
            KKSWEG+Q+RGM QDLSWD+AA+ YEEVLVAAKYQ
Sbjct  733  KKSWEGIQRRGMSQDLSWDNAAEQYEEVLVAAKYQ  767



>emb|CAC59826.1| soluble starch synthase 2 [Oryza sativa]
Length=637

 Score =   371 bits (953),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CK ALQ++LGL VR DVPLIGFIGRLD+QKGVD+I +A+PW+ G+DV
Sbjct  422  NYTFETLDTGKKQCKEALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIGDAMPWIAGQDV  481

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            QVVMLGTGRPDLE++LR+FE +HNDKVRGWVGFSV+ +HRITAGAD+LLMPSRFEPCGLN
Sbjct  482  QVVMLGTGRPDLEEMLRRFESEHNDKVRGWVGFSVQLAHRITAGADVLLMPSRFEPCGLN  541

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ +TGLGWTFDRAEA ++I ALG+CL TYR Y
Sbjct  542  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFADTGLGWTFDRAEANRMIDALGHCLNTYRNY  601

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  602  KESWRGLQARGMAQDLSWDHAAELYEDVLVKAKYQW  637



>ref|XP_002982595.1| starch synthase [Selaginella moellendorffii]
 gb|EFJ16348.1| starch synthase [Selaginella moellendorffii]
Length=743

 Score =   374 bits (961),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 192/215 (89%), Gaps = 0/215 (0%)
 Frame = -2

Query  860  YSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDVQ  681
            YS  +L+TGK  CKAALQKELGLPVRPDVPL+GFIGRLDYQKGVD+IAEAIPWMMG DVQ
Sbjct  529  YSSASLETGKAACKAALQKELGLPVRPDVPLLGFIGRLDYQKGVDIIAEAIPWMMGHDVQ  588

Query  680  VVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLNQ  501
            +V+LGTGRPDLE+LLR FE +H DKVRGWVGFSVKT+HRITAG DILLMPSRFEPCGLNQ
Sbjct  589  LVLLGTGRPDLEELLRSFEAKHRDKVRGWVGFSVKTAHRITAGVDILLMPSRFEPCGLNQ  648

Query  500  LYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQYK  321
            LYAM YGTVPVVHAVGGLRDTV PFDP+  +GLGWTFDRAEA  + HA+GN + TY+ YK
Sbjct  649  LYAMRYGTVPVVHAVGGLRDTVTPFDPFTNSGLGWTFDRAEASAMTHAIGNAMWTYKDYK  708

Query  320  KSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            +SW G+Q RGM QDLSWDHAAQ YEEVL+AAK+QW
Sbjct  709  ESWRGIQLRGMKQDLSWDHAAQQYEEVLLAAKFQW  743



>gb|EPS68296.1| hypothetical protein M569_06471, partial [Genlisea aurea]
Length=520

 Score =   367 bits (942),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 198/216 (92%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS++TL+TGK +CK+ALQ+ELGL V P+ PLIGFIGRLD+QKGVDLIAEAIPWMM ++V
Sbjct  305  NYSIDTLRTGKARCKSALQRELGLRVSPETPLIGFIGRLDHQKGVDLIAEAIPWMMSQNV  364

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG+GR DLE +LR+FE ++ +KVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN
Sbjct  365  QLVMLGSGREDLENMLRRFEAEYREKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  424

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVH VGGLRDTV+PF+P+ ETG GW+F RAE  ++IHALGNC+LT+R Y
Sbjct  425  QLYAMRYGTIPVVHGVGGLRDTVIPFNPFEETGYGWSFGRAETNEMIHALGNCVLTFRDY  484

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGMMQDLSWD+AA+ YE+VLVAAKYQW
Sbjct  485  KESWEGLQRRGMMQDLSWDNAAELYEQVLVAAKYQW  520



>ref|XP_008802589.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
[Phoenix dactylifera]
Length=779

 Score =   374 bits (961),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 196/216 (91%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL TLQTGKP+CKAALQ+ELGLPVR +VP++ FIGRLD+QKGVDLIAEAIPW++G+DV
Sbjct  564  NYSLATLQTGKPQCKAALQQELGLPVRDNVPILAFIGRLDHQKGVDLIAEAIPWIVGQDV  623

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG GRPDLE +LR+FE Q++DKVRGWVGFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  624  QLVMLGAGRPDLEDMLRRFESQYHDKVRGWVGFSVKMAHRITAGADILLMPSRFEPCGLN  683

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+PVVHAVGGLRDTV+ FDPY E+G GWTFDRAEA +L  ALGNCL TY  Y
Sbjct  684  QLYAMMYGTIPVVHAVGGLRDTVIQFDPYKESGYGWTFDRAEAHKLKDALGNCLNTYWNY  743

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGMMQDLSWD+AAQ YEEVLVAAKYQW
Sbjct  744  KESWRGLQIRGMMQDLSWDNAAQRYEEVLVAAKYQW  779



>gb|EYU34066.1| hypothetical protein MIMGU_mgv1a002012mg [Erythranthe guttata]
Length=726

 Score =   372 bits (956),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 171/216 (79%), Positives = 199/216 (92%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            +YSL+TL+TGKP+CK ALQ ELGLPVR D+PLIGFIGRLD QKGVDLIAEA+PW+M +DV
Sbjct  511  SYSLDTLKTGKPQCKRALQNELGLPVREDIPLIGFIGRLDDQKGVDLIAEAVPWLMDQDV  570

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG+GRPDLE LLR+FE ++ D+ RGWVGFSVKT+HRITAGAD+LLMPSRFEPCGLN
Sbjct  571  QLVMLGSGRPDLEDLLRRFEGEYYDRARGWVGFSVKTAHRITAGADVLLMPSRFEPCGLN  630

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  FDP++ETGLGWTF RA+  ++IHALGNCL TYR++
Sbjct  631  QLYAMRYGTVPVVHAVGGLRDTVRAFDPFSETGLGWTFGRADVGEMIHALGNCLWTYREF  690

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEG+Q+RGM QDLSWD+AAQNYEEVL+AAKYQW
Sbjct  691  KQSWEGIQRRGMEQDLSWDNAAQNYEEVLLAAKYQW  726



>ref|NP_001048104.1| Os02g0744700 [Oryza sativa Japonica Group]
 dbj|BAF10018.1| Os02g0744700, partial [Oryza sativa Japonica Group]
Length=677

 Score =   370 bits (951),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CK ALQ++LGL VR DVPLIGFIGRLD+QKGVD+I +A+PW+ G+DV
Sbjct  462  NYTFETLDTGKKQCKEALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIGDAMPWIAGQDV  521

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            QVVMLGTGRPDLE++LR+FE +HNDKVRGWVGFSV+ +HRITAGAD+LLMPSRFEPCGLN
Sbjct  522  QVVMLGTGRPDLEEMLRRFESEHNDKVRGWVGFSVQLAHRITAGADVLLMPSRFEPCGLN  581

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ +TGLGWTFDRAEA ++I ALG+CL TYR Y
Sbjct  582  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFADTGLGWTFDRAEANRMIDALGHCLNTYRNY  641

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  642  KESWRGLQARGMAQDLSWDHAAELYEDVLVKAKYQW  677



>gb|ACY56195.1| soluble starch synthase II-2 [Oryza sativa Indica Group]
Length=694

 Score =   371 bits (952),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CK ALQ++LGL VR DVPLIGFIGRLD+QKGVD+I +A+PW+ G+DV
Sbjct  479  NYTFETLDTGKKQCKEALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIGDAMPWIAGQDV  538

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            QVVMLGTGRPDLE++LR+FE +HNDKVRGWVGFSV+ +HRITAGAD+LLMPSRFEPCGLN
Sbjct  539  QVVMLGTGRPDLEEMLRRFESEHNDKVRGWVGFSVQLAHRITAGADVLLMPSRFEPCGLN  598

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ +TGLGWTFDRAEA ++I ALG+CL TYR Y
Sbjct  599  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFADTGLGWTFDRAEANRMIDALGHCLNTYRNY  658

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  659  KESWRGLQARGMAQDLSWDHAAELYEDVLVKAKYQW  694



>sp|Q6Z2T8.2|SSY22_ORYSJ RecName: Full=Soluble starch synthase 2-2, chloroplastic/amyloplastic; 
AltName: Full=Soluble starch synthase II-2; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|ACY56184.1| soluble starch synthase II-2 [Oryza sativa Japonica Group]
 gb|ACY56185.1| soluble starch synthase II-2 [Oryza sativa Japonica Group]
 gb|ACY56186.1| soluble starch synthase II-2 [Oryza sativa Japonica Group]
 gb|ACY56187.1| soluble starch synthase II-2 [Oryza sativa Japonica Group]
 gb|ACY56188.1| soluble starch synthase II-2 [Oryza sativa Japonica Group]
 gb|ACY56189.1| soluble starch synthase II-2 [Oryza sativa Japonica Group]
Length=694

 Score =   371 bits (952),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CK ALQ++LGL VR DVPLIGFIGRLD+QKGVD+I +A+PW+ G+DV
Sbjct  479  NYTFETLDTGKKQCKEALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIGDAMPWIAGQDV  538

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            QVVMLGTGRPDLE++LR+FE +HNDKVRGWVGFSV+ +HRITAGAD+LLMPSRFEPCGLN
Sbjct  539  QVVMLGTGRPDLEEMLRRFESEHNDKVRGWVGFSVQLAHRITAGADVLLMPSRFEPCGLN  598

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ +TGLGWTFDRAEA ++I ALG+CL TYR Y
Sbjct  599  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFADTGLGWTFDRAEANRMIDALGHCLNTYRNY  658

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  659  KESWRGLQARGMAQDLSWDHAAELYEDVLVKAKYQW  694



>gb|EEC73999.1| hypothetical protein OsI_08916 [Oryza sativa Indica Group]
 gb|ACY56190.1| soluble starch synthase II-2 [Oryza sativa Indica Group]
 gb|ACY56191.1| soluble starch synthase II-2 [Oryza sativa Indica Group]
 gb|ACY56192.1| soluble starch synthase II-2 [Oryza sativa Indica Group]
 gb|ACY56193.1| soluble starch synthase II-2 [Oryza sativa Indica Group]
 gb|ACY56194.1| soluble starch synthase II-2 [Oryza sativa Indica Group]
 gb|ACY56196.1| soluble starch synthase II-2 [Oryza sativa Indica Group]
 gb|ACY56197.1| soluble starch synthase II-2 [Oryza sativa Indica Group]
Length=694

 Score =   371 bits (952),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CK ALQ++LGL VR DVPLIGFIGRLD+QKGVD+I +A+PW+ G+DV
Sbjct  479  NYTFETLDTGKKQCKEALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIGDAMPWIAGQDV  538

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            QVVMLGTGRPDLE++LR+FE +HNDKVRGWVGFSV+ +HRITAGAD+LLMPSRFEPCGLN
Sbjct  539  QVVMLGTGRPDLEEMLRRFESEHNDKVRGWVGFSVQLAHRITAGADVLLMPSRFEPCGLN  598

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ +TGLGWTFDRAEA ++I ALG+CL TYR Y
Sbjct  599  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFADTGLGWTFDRAEANRMIDALGHCLNTYRNY  658

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  659  KESWRGLQARGMAQDLSWDHAAELYEDVLVKAKYQW  694



>ref|XP_010917861.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
isoform X3 [Elaeis guineensis]
Length=749

 Score =   371 bits (953),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLE+LQTGK +CKAALQ+ELGLPVR ++P++ FIGRLD+QKGVDLIAEA+ W+ G+DV
Sbjct  534  NYSLESLQTGKARCKAALQRELGLPVRDNIPVLAFIGRLDHQKGVDLIAEAMHWIAGQDV  593

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LGTGRPDLE +LR FE QH DKVRGWVGFSVK +HRITAGAD+LLMPSRFEPCGLN
Sbjct  594  QLVLLGTGRPDLEDMLRNFERQHYDKVRGWVGFSVKMAHRITAGADVLLMPSRFEPCGLN  653

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  FDPY ETGLGW F+RAEA +LI ALGNCL TYR Y
Sbjct  654  QLYAMMYGTVPVVHAVGGLRDTVHQFDPYAETGLGWAFERAEANRLIDALGNCLKTYRNY  713

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGLQKRGMMQDLSWD+AA  YEE+LVAAK+QW
Sbjct  714  KSSWEGLQKRGMMQDLSWDNAAYRYEEILVAAKHQW  749



>ref|XP_010917860.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
isoform X2 [Elaeis guineensis]
Length=767

 Score =   372 bits (954),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLE+LQTGK +CKAALQ+ELGLPVR ++P++ FIGRLD+QKGVDLIAEA+ W+ G+DV
Sbjct  552  NYSLESLQTGKARCKAALQRELGLPVRDNIPVLAFIGRLDHQKGVDLIAEAMHWIAGQDV  611

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LGTGRPDLE +LR FE QH DKVRGWVGFSVK +HRITAGAD+LLMPSRFEPCGLN
Sbjct  612  QLVLLGTGRPDLEDMLRNFERQHYDKVRGWVGFSVKMAHRITAGADVLLMPSRFEPCGLN  671

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  FDPY ETGLGW F+RAEA +LI ALGNCL TYR Y
Sbjct  672  QLYAMMYGTVPVVHAVGGLRDTVHQFDPYAETGLGWAFERAEANRLIDALGNCLKTYRNY  731

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGLQKRGMMQDLSWD+AA  YEE+LVAAK+QW
Sbjct  732  KSSWEGLQKRGMMQDLSWDNAAYRYEEILVAAKHQW  767



>gb|AAK81729.1|AF395537_1 soluble starch synthase II-2 [Oryza sativa]
Length=694

 Score =   369 bits (946),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/216 (78%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CK ALQ++LGL VR DVPLIGFIGRLD+QKGVD+I +A+PW+ G+DV
Sbjct  479  NYTFETLDTGKKQCKEALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIGDAMPWIAGQDV  538

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            QVVMLGTGRPDLE++LR+FE +HNDKVRGWVGFSV+ +HRITAGAD+LLMPSRFEPCGLN
Sbjct  539  QVVMLGTGRPDLEEMLRRFESEHNDKVRGWVGFSVQLAHRITAGADVLLMPSRFEPCGLN  598

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+Y TVPVVHAVGGLRDTV PFDP+ +TGLGWTFDRAEA ++I ALG+CL TYR Y
Sbjct  599  QLYAMAYSTVPVVHAVGGLRDTVAPFDPFADTGLGWTFDRAEANRMIDALGHCLNTYRNY  658

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  659  KESWRGLQARGMAQDLSWDHAAELYEDVLVKAKYQW  694



>gb|ACY41545.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41553.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41560.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41561.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41563.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41572.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41583.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41584.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41592.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41595.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
Length=219

 Score =   352 bits (903),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 191/215 (89%), Gaps = 0/215 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY++ +L +GKP+CKAALQ+ELGL VR DVPLIGFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  5    NYTVASLDSGKPRCKAALQRELGLEVRDDVPLIGFIGRLDGQKGVDIIGDAMPWIAGQDV  64

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LG+GR DLE +L++FE QHN KVRGWVGFSVK +HRITAGAD+L+MPSRFEPCGLN
Sbjct  65   QLVLLGSGRRDLEVMLQRFEAQHNSKVRGWVGFSVKMAHRITAGADVLVMPSRFEPCGLN  124

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV  FDP+ +TGLGWTFDRAE  +LI ALG+CL TYR+Y
Sbjct  125  QLYAMAYGTVPVVHAVGGLRDTVSAFDPFEDTGLGWTFDRAEPHKLIEALGHCLETYRKY  184

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQ  219
            K+SW GLQ RGM QDLSWDHAA+ YEEVLV AKYQ
Sbjct  185  KESWRGLQVRGMSQDLSWDHAAELYEEVLVKAKYQ  219



>ref|XP_010917859.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
isoform X1 [Elaeis guineensis]
Length=801

 Score =   371 bits (953),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLE+LQTGK +CKAALQ+ELGLPVR ++P++ FIGRLD+QKGVDLIAEA+ W+ G+DV
Sbjct  586  NYSLESLQTGKARCKAALQRELGLPVRDNIPVLAFIGRLDHQKGVDLIAEAMHWIAGQDV  645

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LGTGRPDLE +LR FE QH DKVRGWVGFSVK +HRITAGAD+LLMPSRFEPCGLN
Sbjct  646  QLVLLGTGRPDLEDMLRNFERQHYDKVRGWVGFSVKMAHRITAGADVLLMPSRFEPCGLN  705

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  FDPY ETGLGW F+RAEA +LI ALGNCL TYR Y
Sbjct  706  QLYAMMYGTVPVVHAVGGLRDTVHQFDPYAETGLGWAFERAEANRLIDALGNCLKTYRNY  765

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGLQKRGMMQDLSWD+AA  YEE+LVAAK+QW
Sbjct  766  KSSWEGLQKRGMMQDLSWDNAAYRYEEILVAAKHQW  801



>ref|XP_008789818.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
isoform X1 [Phoenix dactylifera]
Length=801

 Score =   370 bits (949),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQ+GK +CKAALQ+ELGLPVR ++P++ FIGRLD+QKGVDLIAEA+ W++G+DV
Sbjct  586  NYSLETLQSGKAQCKAALQQELGLPVRDNIPVLAFIGRLDHQKGVDLIAEAMHWIVGQDV  645

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LGTGRPDLE++L+ F+ QH D VRGWVGFSVK +HRITAGAD+LLMPSRFEPCGLN
Sbjct  646  QLVLLGTGRPDLEEMLKNFQRQHGDNVRGWVGFSVKMAHRITAGADVLLMPSRFEPCGLN  705

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  FDPY ETGLGW F+RAEA +LI ALGNCL TYR Y
Sbjct  706  QLYAMMYGTVPVVHAVGGLRDTVHQFDPYGETGLGWAFERAEANRLIDALGNCLRTYRTY  765

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGLQKRGM QDLSWD+AA  YEE+LVAAKYQW
Sbjct  766  KSSWEGLQKRGMTQDLSWDNAAHRYEEILVAAKYQW  801



>ref|XP_008789825.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
isoform X2 [Phoenix dactylifera]
Length=799

 Score =   369 bits (948),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQ+GK +CKAALQ+ELGLPVR ++P++ FIGRLD+QKGVDLIAEA+ W++G+DV
Sbjct  584  NYSLETLQSGKAQCKAALQQELGLPVRDNIPVLAFIGRLDHQKGVDLIAEAMHWIVGQDV  643

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LGTGRPDLE++L+ F+ QH D VRGWVGFSVK +HRITAGAD+LLMPSRFEPCGLN
Sbjct  644  QLVLLGTGRPDLEEMLKNFQRQHGDNVRGWVGFSVKMAHRITAGADVLLMPSRFEPCGLN  703

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  FDPY ETGLGW F+RAEA +LI ALGNCL TYR Y
Sbjct  704  QLYAMMYGTVPVVHAVGGLRDTVHQFDPYGETGLGWAFERAEANRLIDALGNCLRTYRTY  763

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGLQKRGM QDLSWD+AA  YEE+LVAAKYQW
Sbjct  764  KSSWEGLQKRGMTQDLSWDNAAHRYEEILVAAKYQW  799



>gb|ACY41555.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41558.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41576.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41593.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
Length=219

 Score =   350 bits (898),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 190/215 (88%), Gaps = 0/215 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY++ +L + KP+CKAALQ+ELGL VR DVPLIGFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  5    NYTVASLDSSKPRCKAALQRELGLEVRDDVPLIGFIGRLDGQKGVDIIGDAMPWIAGQDV  64

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LG+GR DLE +L++FE QHN KVRGWVGFSVK +HRITAGAD+L+MPSRFEPCGLN
Sbjct  65   QLVLLGSGRRDLEVMLQRFEAQHNSKVRGWVGFSVKMAHRITAGADVLVMPSRFEPCGLN  124

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV  FDP+ +TGLGWTFDRAE  +LI ALG+CL TYR+Y
Sbjct  125  QLYAMAYGTVPVVHAVGGLRDTVSAFDPFEDTGLGWTFDRAEPHKLIEALGHCLETYRKY  184

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQ  219
            K+SW GLQ RGM QDLSWDHAA+ YEEVLV AKYQ
Sbjct  185  KESWRGLQVRGMSQDLSWDHAAELYEEVLVKAKYQ  219



>ref|XP_009405801.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=748

 Score =   368 bits (944),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQ GK +CKAALQ+ELGLPVR +VP+I FIGRLD QKGVDLIA+A+ W++ +D+
Sbjct  533  NYSLETLQMGKSQCKAALQRELGLPVRDNVPIISFIGRLDDQKGVDLIADAMSWLVDQDL  592

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGRPDLE +LR+FE +H+DKVRGWVGFSVK +HR TAGAD+LLMPSRFEPCGLN
Sbjct  593  QLIMLGTGRPDLEDMLRKFESEHHDKVRGWVGFSVKMAHRFTAGADVLLMPSRFEPCGLN  652

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  FDP+NETGLGWTF RAEA ++I ALG+CL TYR Y
Sbjct  653  QLYAMMYGTVPVVHAVGGLRDTVKQFDPFNETGLGWTFKRAEANKMIEALGHCLNTYRNY  712

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGLQ+RGMMQDLSWD+AAQ YE+VLVAAKYQW
Sbjct  713  KDSWEGLQRRGMMQDLSWDNAAQRYEDVLVAAKYQW  748



>ref|XP_009405800.1| PREDICTED: soluble starch synthase 2-2, chloroplastic/amyloplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=774

 Score =   368 bits (944),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 195/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETLQ GK +CKAALQ+ELGLPVR +VP+I FIGRLD QKGVDLIA+A+ W++ +D+
Sbjct  559  NYSLETLQMGKSQCKAALQRELGLPVRDNVPIISFIGRLDDQKGVDLIADAMSWLVDQDL  618

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGRPDLE +LR+FE +H+DKVRGWVGFSVK +HR TAGAD+LLMPSRFEPCGLN
Sbjct  619  QLIMLGTGRPDLEDMLRKFESEHHDKVRGWVGFSVKMAHRFTAGADVLLMPSRFEPCGLN  678

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  FDP+NETGLGWTF RAEA ++I ALG+CL TYR Y
Sbjct  679  QLYAMMYGTVPVVHAVGGLRDTVKQFDPFNETGLGWTFKRAEANKMIEALGHCLNTYRNY  738

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGLQ+RGMMQDLSWD+AAQ YE+VLVAAKYQW
Sbjct  739  KDSWEGLQRRGMMQDLSWDNAAQRYEDVLVAAKYQW  774



>gb|ACY41546.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41547.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41548.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41549.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41550.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41551.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41552.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41556.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41557.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41559.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41562.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41564.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41565.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41566.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41567.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41568.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41569.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41570.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41571.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41573.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41574.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41575.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41577.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41578.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41579.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41582.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41585.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41586.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41587.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41588.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41589.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41590.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41591.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41594.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41596.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41597.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
 gb|ACY41598.1| soluble starch synthase II-3, partial [Oryza sativa Indica Group]
Length=219

 Score =   348 bits (894),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY++ +L + KP+CKAALQ+ELGL VR DVPLIGFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  5    NYTVASLDSSKPRCKAALQRELGLEVRDDVPLIGFIGRLDGQKGVDIIGDAMPWIAGQDV  64

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LG+GR DLE +L++FE QHN KVRGWVGFSVK +HRITAGAD+L+MPSRFEPCGLN
Sbjct  65   QLVLLGSGRRDLEVMLQRFEAQHNSKVRGWVGFSVKMAHRITAGADVLVMPSRFEPCGLN  124

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV  FDP+ +TGLGWTFDRAE  +LI ALG+CL TYR+Y
Sbjct  125  QLYAMAYGTVPVVHAVGGLRDTVSAFDPFEDTGLGWTFDRAEPHKLIEALGHCLETYRKY  184

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQ  219
            K+SW G Q RGM QDLSWDHAA+ YEEVLV AKYQ
Sbjct  185  KESWRGFQVRGMSQDLSWDHAAELYEEVLVKAKYQ  219



>gb|ACY41554.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41580.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
 gb|ACY41581.1| soluble starch synthase II-3, partial [Oryza sativa Japonica 
Group]
Length=219

 Score =   348 bits (894),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 190/215 (88%), Gaps = 0/215 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY++ +L + KP+CKAALQ+ELGL VR DVPLIGFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  5    NYTVASLDSSKPRCKAALQRELGLEVRDDVPLIGFIGRLDGQKGVDIIGDAMPWIAGQDV  64

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LG+GR DLE +L++FE QHN KVRGWVGFSVK +HRITAGAD+L+MPSRFEPCGLN
Sbjct  65   QLVLLGSGRRDLEVMLQRFEAQHNSKVRGWVGFSVKMAHRITAGADVLVMPSRFEPCGLN  124

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDT+  FDP+ +TGLGWTFDRAE  +LI ALG+CL TYR+Y
Sbjct  125  QLYAMAYGTVPVVHAVGGLRDTMSAFDPFEDTGLGWTFDRAEPHKLIEALGHCLETYRKY  184

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQ  219
            K+SW GLQ RGM QDLSWDHAA+ YEEVLV AKYQ
Sbjct  185  KESWRGLQVRGMSQDLSWDHAAELYEEVLVKAKYQ  219



>gb|ACF87565.1| unknown [Zea mays]
Length=334

 Score =   351 bits (901),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 192/216 (89%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+QTGK +CK ALQKELGLPVR DVP+I FIGRLD+QKGVDLIAEA+PW+ G+DV
Sbjct  119  NYSLETVQTGKAQCKEALQKELGLPVRGDVPVIAFIGRLDHQKGVDLIAEAMPWIAGQDV  178

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGR DLE  LR+ E QH D+VRGWVGFSV+ +HR+TAGADILLMPSRFEPCGLN
Sbjct  179  QLIMLGTGRQDLEDTLRRLESQHYDRVRGWVGFSVRLAHRMTAGADILLMPSRFEPCGLN  238

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E G+GWTF++AEA ++I ALG+CL TYR Y
Sbjct  239  QLYAMMYGTVPVVHAVGGLRDTVQHYNPYEEVGVGWTFEKAEANRMIDALGHCLNTYRNY  298

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
              SWEG+Q+RGMMQDLSWD+AA+ YEEVL+AAKYQW
Sbjct  299  WSSWEGIQRRGMMQDLSWDNAAKLYEEVLLAAKYQW  334



>gb|AAP41030.1| soluble starch synthase II [Colocasia esculenta]
Length=804

 Score =   366 bits (940),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/216 (78%), Positives = 192/216 (89%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL  GKP+CKAALQKELGLPVRP+VP++ FIGRLD+QKGVD+IAEAIPWM+ +D+
Sbjct  589  NYSLETLNMGKPQCKAALQKELGLPVRPEVPVVAFIGRLDHQKGVDIIAEAIPWMVSQDM  648

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +LR F+  H  KVR WVGFSVK +HRITAGAD+LLMPSRFEPCGLN
Sbjct  649  QLVMLGTGRSDLEDMLRSFQGNHCGKVRSWVGFSVKMAHRITAGADVLLMPSRFEPCGLN  708

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGT+P+VHAVGGLRDTVVPF+PY E+G GWTFDRA+A +LI AL NC  T+  Y
Sbjct  709  QLYAMMYGTIPLVHAVGGLRDTVVPFNPYEESGFGWTFDRAKAGKLIDALRNCFNTFWNY  768

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SWEGLQ+RGM+QDLSWDHAAQ YEEVLVAAKYQW
Sbjct  769  KESWEGLQRRGMLQDLSWDHAAQLYEEVLVAAKYQW  804



>ref|XP_006647881.1| PREDICTED: soluble starch synthase 2-2, chloroplastic/amyloplastic-like 
[Oryza brachyantha]
Length=686

 Score =   362 bits (928),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CKAALQ++LGL VR DVPLIGFIGRLD+QKGVD+I +A+PW+ G+DV
Sbjct  471  NYTFETLDTGKRQCKAALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIGDAMPWIAGQDV  530

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE++LR+FE +H+DKVRGWVGFSV  +HRITAGAD++LMPSRFEPCGLN
Sbjct  531  QLVMLGTGRPDLEEMLRRFESEHHDKVRGWVGFSVPLAHRITAGADVILMPSRFEPCGLN  590

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ +TGLGWTFDRAEA Q+I ALG+CL TYR Y
Sbjct  591  QLYAMAYGTVPVVHAVGGLRDTVPPFDPFADTGLGWTFDRAEANQMIDALGHCLNTYRNY  650

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+S+  LQ RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  651  KESFRALQARGMAQDLSWDHAAELYEDVLVKAKYQW  686



>ref|XP_006662378.1| PREDICTED: soluble starch synthase 2-1, chloroplastic/amyloplastic-like 
[Oryza brachyantha]
Length=705

 Score =   361 bits (926),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+QTGK +CKAALQKELGLPVR D P+I FIGRLD+QKGVDLIAEA+PW+ G+DV
Sbjct  490  NYSLETVQTGKQQCKAALQKELGLPVRGDAPVIAFIGRLDHQKGVDLIAEAMPWIAGQDV  549

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGR DLE  LR+ E QH D+VRGWVGFSV+ +HR+TAGADILLMPSRFEPCGLN
Sbjct  550  QLIMLGTGRQDLEDTLRRLESQHYDRVRGWVGFSVRLAHRMTAGADILLMPSRFEPCGLN  609

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E+GLGWTF++AEA ++I ALG+CL TYR Y
Sbjct  610  QLYAMMYGTVPVVHAVGGLRDTVEHYNPYEESGLGWTFEKAEANRMIDALGHCLNTYRNY  669

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGLQKRGMMQDLSWD+AA+ YEEVL+AAKYQW
Sbjct  670  KSSWEGLQKRGMMQDLSWDNAAKLYEEVLLAAKYQW  705



>gb|ACN31779.1| unknown [Zea mays]
Length=698

 Score =   360 bits (925),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/216 (78%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CKAALQ++LGL VR DVPLIGFIGRLD+QKGVD+IA+AI W+ G+DV
Sbjct  483  NYTFETLDTGKRQCKAALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIADAIHWIAGQDV  542

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +LR+FE +H+DKVR WVGFSV  +HRITAGADILLMPSRFEPCGLN
Sbjct  543  QLVMLGTGRADLEDMLRRFESEHSDKVRAWVGFSVPLAHRITAGADILLMPSRFEPCGLN  602

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+N+TGLGWTFDRAEA ++I AL +CL TYR Y
Sbjct  603  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFNDTGLGWTFDRAEANRMIDALSHCLTTYRNY  662

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA  YE+VLV AKYQW
Sbjct  663  KESWRGLQARGMAQDLSWDHAAVLYEDVLVKAKYQW  698



>gb|ACN39858.1| unknown [Picea sitchensis]
Length=760

 Score =   361 bits (926),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 193/216 (89%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS+ET++TGK  CK ALQ+ELGLPVR DVP+IGFIGRLD QKGVD+IAE++PWM+ +D+
Sbjct  545  NYSIETIETGKTTCKTALQRELGLPVRSDVPVIGFIGRLDPQKGVDIIAESMPWMVQQDI  604

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +LR FE QH  KVRGWVGFSV+T+HRITAG DILLMPSRFEPCGLN
Sbjct  605  QLVMLGTGRSDLENMLRSFEGQHQAKVRGWVGFSVRTAHRITAGCDILLMPSRFEPCGLN  664

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGL+DTV PFDP++ETGLGWTF+ AE+ +LIHALGN L TYR +
Sbjct  665  QLYAMRYGTVPVVHAVGGLKDTVKPFDPFSETGLGWTFECAESSRLIHALGNALWTYRDF  724

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW G+QKRGM QDLSWD+AA+ YEEVL+AAKYQW
Sbjct  725  KQSWLGIQKRGMSQDLSWDNAAKQYEEVLLAAKYQW  760



>ref|XP_002467190.1| hypothetical protein SORBIDRAFT_01g021190 [Sorghum bicolor]
 gb|EER94188.1| hypothetical protein SORBIDRAFT_01g021190 [Sorghum bicolor]
Length=506

 Score =   353 bits (905),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 193/216 (89%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+QTGK +CK ALQKELGLPVR DVP+I FIGRLD+QKGVDLIAEA+PW+ G+DV
Sbjct  291  NYSLETVQTGKAQCKEALQKELGLPVRADVPVIAFIGRLDHQKGVDLIAEAMPWIAGQDV  350

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+++LGTGR DLE  LR+ E QH D+VRGWVGFSV+ +HR+TAGADILLMPSRFEPCGLN
Sbjct  351  QLILLGTGRQDLEDTLRRLESQHYDRVRGWVGFSVRLAHRMTAGADILLMPSRFEPCGLN  410

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E G+GWTF++AEA ++I ALG+CL T+R Y
Sbjct  411  QLYAMMYGTVPVVHAVGGLRDTVAHYNPYEEVGVGWTFEKAEANRMIDALGHCLNTFRNY  470

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + SWEG+Q+RGMMQDLSWD+AA+ YEEVL+AAKYQW
Sbjct  471  RSSWEGIQRRGMMQDLSWDNAAKLYEEVLLAAKYQW  506



>gb|ABK97467.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97468.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97469.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97470.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97476.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97477.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97478.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97479.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97480.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97483.1| putative starch synthase IIa, partial [Sorghum bicolor]
Length=232

 Score =   343 bits (879),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 186/216 (86%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL  GK +CKAALQ+ELGL VR DVPL+GFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  17   NYSLETLDAGKRQCKAALQRELGLEVRDDVPLLGFIGRLDGQKGVDIIGDAMPWIAGQDV  76

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE++L+  E +H  KVRGWVGFSV  +HRITAGAD+L+MPSRFEPCGLN
Sbjct  77   QLVMLGTGRADLERMLQHLEREHPSKVRGWVGFSVPMAHRITAGADVLVMPSRFEPCGLN  136

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ + GLGWTFDRAEA +LI AL +CL TYR Y
Sbjct  137  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFGDAGLGWTFDRAEANKLIEALRHCLDTYRNY  196

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
             +SW+ +Q RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  197  GESWKSIQARGMAQDLSWDHAAELYEDVLVKAKYQW  232



>gb|EEE51014.1| hypothetical protein OsJ_31644 [Oryza sativa Japonica Group]
Length=763

 Score =   360 bits (924),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/216 (78%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+Q GK +CKAALQKELGLPVR DVP+I FIGRLD+QKGVDLIAEA+PW+ G+DV
Sbjct  548  NYSLETVQAGKQQCKAALQKELGLPVRGDVPVIAFIGRLDHQKGVDLIAEAMPWIAGQDV  607

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGR DLE  LR+ E QH D+VRGWVGFS++ +HR+TAGADILLMPSRFEPCGLN
Sbjct  608  QLIMLGTGRQDLEDTLRRLESQHYDRVRGWVGFSIRLAHRMTAGADILLMPSRFEPCGLN  667

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E+GLGWTF++AEA +LI ALG+CL TYR Y
Sbjct  668  QLYAMMYGTVPVVHAVGGLRDTVEHYNPYEESGLGWTFEKAEANRLIDALGHCLNTYRNY  727

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + SWEGLQKRGMMQDLSWD+AA+ YEEVL+AAKYQW
Sbjct  728  RTSWEGLQKRGMMQDLSWDNAAKLYEEVLLAAKYQW  763



>gb|ABK97462.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97463.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97464.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97465.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97471.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97472.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97473.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97474.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97475.1| putative starch synthase IIa, partial [Sorghum bicolor]
Length=232

 Score =   342 bits (878),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 186/216 (86%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL  GK +CKAALQ+ELGL VR DVPL+GFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  17   NYSLETLDAGKRQCKAALQRELGLEVRDDVPLLGFIGRLDGQKGVDIIGDAMPWIAGQDV  76

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE++L+  E +H  KVRGWVGFSV  +HRITAGAD+L+MPSRFEPCGLN
Sbjct  77   QLVMLGTGRADLERMLQHLEREHPSKVRGWVGFSVPMAHRITAGADVLVMPSRFEPCGLN  136

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ + GLGWTFDRAEA +LI AL +CL TYR Y
Sbjct  137  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFGDAGLGWTFDRAEANKLIEALRHCLDTYRNY  196

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
             +SW+ +Q RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  197  GESWKSIQARGMAQDLSWDHAAELYEDVLVKAKYQW  232



>ref|XP_004953871.1| PREDICTED: soluble starch synthase 2-2, chloroplastic/amyloplastic-like 
[Setaria italica]
Length=706

 Score =   358 bits (920),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CKAALQ++LGL VR DVPLIGFIGRLD+QKGVD+IA+AI W+ G+DV
Sbjct  491  NYTFETLDTGKRQCKAALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIADAIHWIAGQDV  550

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE++LR+ E +H DKVR WVGFSV  +HRITAGAD+LLMPSRFEPCGLN
Sbjct  551  QLVMLGTGRPDLEEMLRRCEAEHGDKVRAWVGFSVPMAHRITAGADVLLMPSRFEPCGLN  610

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ + GLGWTFDRAEA ++I ALG+CL TYR Y
Sbjct  611  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFADAGLGWTFDRAEANRMIDALGHCLNTYRNY  670

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  671  KESWRGLQARGMAQDLSWDHAAELYEDVLVKAKYQW  706



>ref|XP_002452556.1| hypothetical protein SORBIDRAFT_04g028060 [Sorghum bicolor]
 gb|EES05532.1| hypothetical protein SORBIDRAFT_04g028060 [Sorghum bicolor]
Length=704

 Score =   358 bits (919),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CKAALQ++LGL VR DVPLIGFIGRLD QKGVDLI +AI W+ G+DV
Sbjct  489  NYTFETLDTGKRQCKAALQRQLGLQVRDDVPLIGFIGRLDGQKGVDLIGDAIHWIAGQDV  548

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE +LR+ E +HNDKVR WVGFSV  +HRITAGAD+LLMPSRFEPCGLN
Sbjct  549  QLVMLGTGRPDLEDMLRRCEAEHNDKVRAWVGFSVPLAHRITAGADVLLMPSRFEPCGLN  608

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+N+TGLGWTFDRAEA ++I AL +CL TYR +
Sbjct  609  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFNDTGLGWTFDRAEANRMIDALHHCLNTYRNF  668

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ+RGM QDLSWDHAA  YE+VLV AKYQW
Sbjct  669  KESWRGLQERGMAQDLSWDHAAVLYEDVLVKAKYQW  704



>gb|ACC86845.1| starch synthase IIb precursor [Sorghum bicolor]
Length=704

 Score =   358 bits (919),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CKAALQ++LGL VR DVPLIGFIGRLD QKGVDLI +AI W+ G+DV
Sbjct  489  NYTFETLDTGKRQCKAALQRQLGLQVRDDVPLIGFIGRLDGQKGVDLIGDAIHWIAGQDV  548

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE +LR+ E +HNDKVR WVGFSV  +HRITAGAD+LLMPSRFEPCGLN
Sbjct  549  QLVMLGTGRPDLEDMLRRCEAEHNDKVRAWVGFSVPLAHRITAGADVLLMPSRFEPCGLN  608

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+N+TGLGWTFDRAEA ++I AL +CL TYR +
Sbjct  609  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFNDTGLGWTFDRAEANRMIDALHHCLNTYRNF  668

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ+RGM QDLSWDHAA  YE+VLV AKYQW
Sbjct  669  KESWRGLQERGMAQDLSWDHAAVLYEDVLVKAKYQW  704



>gb|EEC67024.1| hypothetical protein OsI_33746 [Oryza sativa Indica Group]
Length=743

 Score =   359 bits (921),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+Q GK +CKAALQKELGLPVR DVP+I FIGRLD+QKGVDLIAEA+PW+ G+DV
Sbjct  528  NYSLETVQAGKQQCKAALQKELGLPVRGDVPVIAFIGRLDHQKGVDLIAEAMPWIAGQDV  587

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGR DLE  LR+ E QH D+VRGWVGFS++ +HR+TAGADILLMPSRFEPCGLN
Sbjct  588  QLIMLGTGRQDLEDTLRRLESQHYDRVRGWVGFSIRLAHRMTAGADILLMPSRFEPCGLN  647

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E+G+GWTF++AEA +LI ALG+CL TYR Y
Sbjct  648  QLYAMMYGTVPVVHAVGGLRDTVEHYNPYEESGIGWTFEKAEANRLIDALGHCLNTYRNY  707

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + SWEGLQKRGMMQDLSWD+AA+ YEEVL+AAKYQW
Sbjct  708  RTSWEGLQKRGMMQDLSWDNAAKLYEEVLLAAKYQW  743



>gb|AAK64284.1|AF383878_1 soluble starch synthase II-1 [Oryza sativa]
 gb|ACY56179.1| soluble starch synthase II-1 [Oryza sativa Indica Group]
Length=749

 Score =   359 bits (922),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/216 (78%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+Q GK +CKAALQKELGLPVR DVP+I FIGRLD+QKGVDLIAEA+PW+ G+DV
Sbjct  534  NYSLETVQAGKQQCKAALQKELGLPVRGDVPVIAFIGRLDHQKGVDLIAEAMPWIAGQDV  593

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGR DLE  LR+ E QH D+VRGWVGFS++ +HR+TAGADILLMPSRFEPCGLN
Sbjct  594  QLIMLGTGRQDLEDTLRRLESQHYDRVRGWVGFSIRLAHRMTAGADILLMPSRFEPCGLN  653

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E+GLGWTF++AEA +LI ALG+CL TYR Y
Sbjct  654  QLYAMMYGTVPVVHAVGGLRDTVEHYNPYEESGLGWTFEKAEANRLIDALGHCLNTYRNY  713

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + SWEGLQKRGMMQDLSWD+AA+ YEEVL+AAKYQW
Sbjct  714  RTSWEGLQKRGMMQDLSWDNAAKLYEEVLLAAKYQW  749



>gb|ACY56170.1| soluble starch synthase II-1 [Oryza sativa Japonica Group]
 gb|ACY56172.1| soluble starch synthase II-1 [Oryza sativa Japonica Group]
 gb|ACY56174.1| soluble starch synthase II-1 [Oryza sativa Japonica Group]
Length=749

 Score =   359 bits (921),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/216 (78%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+Q GK +CKAALQKELGLPVR DVP+I FIGRLD+QKGVDLIAEA+PW+ G+DV
Sbjct  534  NYSLETVQAGKQQCKAALQKELGLPVRGDVPVIAFIGRLDHQKGVDLIAEAMPWIAGQDV  593

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGR DLE  LR+ E QH D+VRGWVGFS++ +HR+TAGADILLMPSRFEPCGLN
Sbjct  594  QLIMLGTGRQDLEDTLRRLESQHYDRVRGWVGFSIRLAHRMTAGADILLMPSRFEPCGLN  653

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E+GLGWTF++AEA +LI ALG+CL TYR Y
Sbjct  654  QLYAMMYGTVPVVHAVGGLRDTVEHYNPYEESGLGWTFEKAEANRLIDALGHCLNTYRNY  713

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + SWEGLQKRGMMQDLSWD+AA+ YEEVL+AAKYQW
Sbjct  714  RTSWEGLQKRGMMQDLSWDNAAKLYEEVLLAAKYQW  749



>ref|NP_001064678.1| Os10g0437600 [Oryza sativa Japonica Group]
 sp|Q7XE48.2|SSY21_ORYSJ RecName: Full=Soluble starch synthase 2-1, chloroplastic/amyloplastic; 
AltName: Full=Soluble starch synthase II-1; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|ABG66094.1| Soluble starch synthase 2-1, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF26592.1| Os10g0437600 [Oryza sativa Japonica Group]
 gb|ACY56171.1| soluble starch synthase II-1 [Oryza sativa Japonica Group]
 gb|ACY56173.1| soluble starch synthase II-1 [Oryza sativa Japonica Group]
 gb|ACY56175.1| soluble starch synthase II-1 [Oryza sativa Japonica Group]
 gb|AII21925.1| soluble starch synthase iic [Oryza sativa Japonica Group]
Length=749

 Score =   359 bits (921),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/216 (78%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+Q GK +CKAALQKELGLPVR DVP+I FIGRLD+QKGVDLIAEA+PW+ G+DV
Sbjct  534  NYSLETVQAGKQQCKAALQKELGLPVRGDVPVIAFIGRLDHQKGVDLIAEAMPWIAGQDV  593

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGR DLE  LR+ E QH D+VRGWVGFS++ +HR+TAGADILLMPSRFEPCGLN
Sbjct  594  QLIMLGTGRQDLEDTLRRLESQHYDRVRGWVGFSIRLAHRMTAGADILLMPSRFEPCGLN  653

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E+GLGWTF++AEA +LI ALG+CL TYR Y
Sbjct  654  QLYAMMYGTVPVVHAVGGLRDTVEHYNPYEESGLGWTFEKAEANRLIDALGHCLNTYRNY  713

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + SWEGLQKRGMMQDLSWD+AA+ YEEVL+AAKYQW
Sbjct  714  RTSWEGLQKRGMMQDLSWDNAAKLYEEVLLAAKYQW  749



>ref|XP_008680930.1| PREDICTED: starch synthase IIb-2 precursor isoform X1 [Zea mays]
 gb|AFW73399.1| hypothetical protein ZEAMMB73_764516 [Zea mays]
Length=706

 Score =   357 bits (917),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CKAALQ++LGL VR DVPLIGFIGRLD+QKGVD+IA+AI W+ G+DV
Sbjct  491  NYTFETLDTGKRQCKAALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIADAIHWIAGQDV  550

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE +LR+ E +H+DKVR WVGFSV  +HRITAGAD+LLMPSRFEPCGLN
Sbjct  551  QLVMLGTGRPDLEDMLRRCEAEHSDKVRAWVGFSVPLAHRITAGADVLLMPSRFEPCGLN  610

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+N+TGLGWTFDRAEA ++I AL +CL T+R Y
Sbjct  611  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFNDTGLGWTFDRAEANRMIDALSHCLNTFRNY  670

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GL+ RGM QDLSWDHAA  YE+VLV AKYQW
Sbjct  671  KESWRGLEARGMAQDLSWDHAAVLYEDVLVKAKYQW  706



>ref|NP_001106014.1| starch synthase IIb-2 precursor [Zea mays]
 gb|ABP35814.1| starch synthase IIb-2 precursor [Zea mays]
 gb|AFW73398.1| starch synthase IIb-2 [Zea mays]
Length=704

 Score =   357 bits (917),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CKAALQ++LGL VR DVPLIGFIGRLD+QKGVD+IA+AI W+ G+DV
Sbjct  489  NYTFETLDTGKRQCKAALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIADAIHWIAGQDV  548

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE +LR+ E +H+DKVR WVGFSV  +HRITAGAD+LLMPSRFEPCGLN
Sbjct  549  QLVMLGTGRPDLEDMLRRCEAEHSDKVRAWVGFSVPLAHRITAGADVLLMPSRFEPCGLN  608

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+N+TGLGWTFDRAEA ++I AL +CL T+R Y
Sbjct  609  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFNDTGLGWTFDRAEANRMIDALSHCLNTFRNY  668

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GL+ RGM QDLSWDHAA  YE+VLV AKYQW
Sbjct  669  KESWRGLEARGMAQDLSWDHAAVLYEDVLVKAKYQW  704



>gb|ACY56176.1| soluble starch synthase II-1 [Oryza sativa Indica Group]
 gb|ACY56177.1| soluble starch synthase II-1 [Oryza sativa Indica Group]
 gb|ACY56178.1| soluble starch synthase II-1 [Oryza sativa Indica Group]
 gb|ACY56180.1| soluble starch synthase II-1 [Oryza sativa Indica Group]
 gb|ACY56181.1| soluble starch synthase II-1 [Oryza sativa Indica Group]
 gb|ACY56182.1| soluble starch synthase II-1 [Oryza sativa Indica Group]
 gb|ACY56183.1| soluble starch synthase II-1 [Oryza sativa Indica Group]
Length=749

 Score =   358 bits (920),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+Q GK +CKAALQKELGLPVR DVP+I FIGRLD+QKGVDLIAEA+PW+ G+DV
Sbjct  534  NYSLETVQAGKQQCKAALQKELGLPVRGDVPVIAFIGRLDHQKGVDLIAEAMPWIAGQDV  593

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGR DLE  LR+ E QH D+VRGWVGFS++ +HR+TAGADILLMPSRFEPCGLN
Sbjct  594  QLIMLGTGRQDLEDTLRRLESQHYDRVRGWVGFSIRLAHRMTAGADILLMPSRFEPCGLN  653

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E+G+GWTF++AEA +LI ALG+CL TYR Y
Sbjct  654  QLYAMMYGTVPVVHAVGGLRDTVEHYNPYEESGIGWTFEKAEANRLIDALGHCLNTYRNY  713

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + SWEGLQKRGMMQDLSWD+AA+ YEEVL+AAKYQW
Sbjct  714  RTSWEGLQKRGMMQDLSWDNAAKLYEEVLLAAKYQW  749



>gb|AII21929.1| soluble starch synthase iic [Oryza sativa Indica Group]
Length=749

 Score =   358 bits (919),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 194/216 (90%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+Q GK +CKAALQKELGLPVR DVP+I FIGRLD+QKGVDLIAEA+PW+ G+DV
Sbjct  534  NYSLETVQAGKQQCKAALQKELGLPVRGDVPVIAFIGRLDHQKGVDLIAEAMPWIAGQDV  593

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGR DLE  LR+ E QH D+VRGWVGFS++ +HR+TAGADILLMPSRFEPCGLN
Sbjct  594  QLIMLGTGRQDLEDTLRRLESQHYDRVRGWVGFSIRLAHRMTAGADILLMPSRFEPCGLN  653

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E+G+GWTF++AEA +LI ALG+CL TYR Y
Sbjct  654  QLYAMMYGTVPVVHAVGGLRDTVEHYNPYEESGIGWTFEKAEANRLIDALGHCLNTYRNY  713

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + SWEGLQKRGMMQDLSWD+AA+ YEEVL+AAKYQW
Sbjct  714  RTSWEGLQKRGMMQDLSWDNAAKLYEEVLLAAKYQW  749



>gb|ABK97461.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97466.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97481.1| putative starch synthase IIa, partial [Sorghum bicolor]
 gb|ABK97482.1| putative starch synthase IIa, partial [Sorghum bicolor]
Length=232

 Score =   341 bits (875),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 185/216 (86%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL  GK +CKAALQ+ELGL VR DVPL+GFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  17   NYSLETLDAGKRQCKAALQRELGLEVRDDVPLLGFIGRLDGQKGVDIIGDAMPWIAGQDV  76

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE++L+  E +H  KVRGWVGFSV  +HRITAGAD+L+MPSRFEPCGLN
Sbjct  77   QLVMLGTGRADLERMLQHLEREHPSKVRGWVGFSVPMAHRITAGADVLVMPSRFEPCGLN  136

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ + GLGWTFDRAE  +LI AL +CL TYR Y
Sbjct  137  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFGDAGLGWTFDRAEVNKLIEALRHCLDTYRNY  196

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
             +SW+ +Q RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  197  GESWKSIQARGMAQDLSWDHAAELYEDVLVKAKYQW  232



>ref|XP_003573954.1| PREDICTED: soluble starch synthase 2-1, chloroplastic/amyloplastic-like 
isoform X3 [Brachypodium distachyon]
Length=763

 Score =   358 bits (920),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+QTGK +CKAALQKELGLPVR DVP+I FIGRLD QKGVDLIAEA+PW+ G+ V
Sbjct  548  NYSLETVQTGKAQCKAALQKELGLPVRSDVPVIAFIGRLDNQKGVDLIAEAMPWIAGQGV  607

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            QV++LGTGR DLE  LR+ E QH D+VRGWVGFSV+ +HR+TAGADILLMPSRFEPCGLN
Sbjct  608  QVILLGTGRQDLEDTLRRLESQHYDRVRGWVGFSVRLAHRMTAGADILLMPSRFEPCGLN  667

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E GLGWTF+ AEA ++I ALG+CL TYR Y
Sbjct  668  QLYAMMYGTVPVVHAVGGLRDTVQHYNPYEEAGLGWTFEMAEANRMIDALGHCLTTYRNY  727

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + SWEGLQ+RGMMQDLSWD+AA++YEEVLV AKYQW
Sbjct  728  RTSWEGLQRRGMMQDLSWDNAAKSYEEVLVTAKYQW  763



>ref|XP_010234757.1| PREDICTED: soluble starch synthase 2-1, chloroplastic/amyloplastic-like 
isoform X2 [Brachypodium distachyon]
Length=766

 Score =   358 bits (919),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+QTGK +CKAALQKELGLPVR DVP+I FIGRLD QKGVDLIAEA+PW+ G+ V
Sbjct  551  NYSLETVQTGKAQCKAALQKELGLPVRSDVPVIAFIGRLDNQKGVDLIAEAMPWIAGQGV  610

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            QV++LGTGR DLE  LR+ E QH D+VRGWVGFSV+ +HR+TAGADILLMPSRFEPCGLN
Sbjct  611  QVILLGTGRQDLEDTLRRLESQHYDRVRGWVGFSVRLAHRMTAGADILLMPSRFEPCGLN  670

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E GLGWTF+ AEA ++I ALG+CL TYR Y
Sbjct  671  QLYAMMYGTVPVVHAVGGLRDTVQHYNPYEEAGLGWTFEMAEANRMIDALGHCLTTYRNY  730

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + SWEGLQ+RGMMQDLSWD+AA++YEEVLV AKYQW
Sbjct  731  RTSWEGLQRRGMMQDLSWDNAAKSYEEVLVTAKYQW  766



>gb|ABY27639.1| starch synthase IIc precursor [Triticum aestivum]
Length=742

 Score =   357 bits (917),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 168/216 (78%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET++TGK +CKAALQKELGLPVR DVP+I FIGRLD QKGVDLIAEA+PW+ G+DV
Sbjct  527  NYSLETVETGKAQCKAALQKELGLPVRGDVPVIAFIGRLDNQKGVDLIAEAMPWIAGQDV  586

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            QV++LGTGR DLE  LR+ E QH D+VRGWVGFSV+ +HR+TAGADILLMPSRFEPCGLN
Sbjct  587  QVILLGTGRQDLEDTLRRLESQHYDRVRGWVGFSVRLAHRMTAGADILLMPSRFEPCGLN  646

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E GLGWTF+ AEA ++I ALG+CL TYR Y
Sbjct  647  QLYAMMYGTVPVVHAVGGLRDTVQHYNPYEEVGLGWTFENAEANRMIDALGHCLNTYRNY  706

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGL++RGMMQDLSWD AA+ YEEVLVAAKYQW
Sbjct  707  KSSWEGLRRRGMMQDLSWDTAAKRYEEVLVAAKYQW  742



>ref|XP_010234756.1| PREDICTED: soluble starch synthase 2-1, chloroplastic/amyloplastic-like 
isoform X1 [Brachypodium distachyon]
Length=789

 Score =   358 bits (919),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+QTGK +CKAALQKELGLPVR DVP+I FIGRLD QKGVDLIAEA+PW+ G+ V
Sbjct  574  NYSLETVQTGKAQCKAALQKELGLPVRSDVPVIAFIGRLDNQKGVDLIAEAMPWIAGQGV  633

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            QV++LGTGR DLE  LR+ E QH D+VRGWVGFSV+ +HR+TAGADILLMPSRFEPCGLN
Sbjct  634  QVILLGTGRQDLEDTLRRLESQHYDRVRGWVGFSVRLAHRMTAGADILLMPSRFEPCGLN  693

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E GLGWTF+ AEA ++I ALG+CL TYR Y
Sbjct  694  QLYAMMYGTVPVVHAVGGLRDTVQHYNPYEEAGLGWTFEMAEANRMIDALGHCLTTYRNY  753

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + SWEGLQ+RGMMQDLSWD+AA++YEEVLV AKYQW
Sbjct  754  RTSWEGLQRRGMMQDLSWDNAAKSYEEVLVTAKYQW  789



>ref|XP_010236121.1| PREDICTED: soluble starch synthase 2-2, chloroplastic/amyloplastic-like 
[Brachypodium distachyon]
Length=674

 Score =   355 bits (910),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CKAALQ+ELGL VR DVP+IGFIGRLD QKGVDLIAEA+PW+  +DV
Sbjct  459  NYTFETLDTGKRQCKAALQRELGLQVRDDVPVIGFIGRLDRQKGVDLIAEAMPWITQQDV  518

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +LR+FE +H DKVRGWVGFSVK +HRITAGAD+LLMPS FEPCGLN
Sbjct  519  QLVMLGTGRADLEDMLRRFEGEHRDKVRGWVGFSVKMAHRITAGADVLLMPSLFEPCGLN  578

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+  TGLGWTFDRA+A ++I ALG+CL TY  Y
Sbjct  579  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFGGTGLGWTFDRADAGRMIDALGHCLNTYWNY  638

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ+RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  639  KESWRGLQQRGMSQDLSWDHAAELYEDVLVKAKYQW  674



>ref|XP_001757452.1| predicted protein [Physcomitrella patens]
 gb|EDQ77937.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 184/216 (85%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+L +L TGK  CKAALQ+ELGLPVR DVPL+GFIGRLD+QKG+D+I +A+PWMM +D+
Sbjct  277  NYNLHSLDTGKAACKAALQRELGLPVRADVPLLGFIGRLDHQKGIDIIGQAMPWMMDQDI  336

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR D E +LR FE  H DKVRGWVGFSV TSHRITAG DILLMPSRFEPCGLN
Sbjct  337  QLVMLGTGRKDYEDMLRHFEGSHRDKVRGWVGFSVTTSHRITAGVDILLMPSRFEPCGLN  396

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGL+DTV  F+P+NE+GLGWTF+    +  IHALGN + TYR +
Sbjct  397  QLYAMRYGTVPVVHAVGGLKDTVQSFNPFNESGLGWTFETLHVDAFIHALGNAIWTYRDF  456

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SW+G+Q+RGM QDLSWDHAAQ YEEVL+AAKY W
Sbjct  457  KSSWKGIQQRGMSQDLSWDHAAQQYEEVLLAAKYTW  492



>ref|XP_004983043.1| PREDICTED: soluble starch synthase 2-1, chloroplastic/amyloplastic-like 
isoform X2 [Setaria italica]
Length=777

 Score =   356 bits (914),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 193/216 (89%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+QTGK +CK ALQKELGLPVR DVP+I FIGRLD+QKGVDLIAEA+PW+ G+DV
Sbjct  562  NYSLETVQTGKAQCKEALQKELGLPVRGDVPVIAFIGRLDHQKGVDLIAEAMPWIAGQDV  621

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGR DLE  LR+ E QH D+VRGWVGFSV+ +HR+TAGAD+LLMPSRFEPCGLN
Sbjct  622  QLIMLGTGRQDLEDTLRRLESQHYDRVRGWVGFSVQLAHRMTAGADVLLMPSRFEPCGLN  681

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E G+GWTF++AEA ++I ALG+CL TYR Y
Sbjct  682  QLYAMMYGTVPVVHAVGGLRDTVQHYNPYEEVGVGWTFEKAEANRMIDALGHCLNTYRNY  741

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + SWEG+Q+RGMMQDLSWD+AA+ YEEVLVAAKYQW
Sbjct  742  RNSWEGIQRRGMMQDLSWDNAAKLYEEVLVAAKYQW  777



>ref|NP_001104880.1| starch synthase homolog1 [Zea mays]
 gb|AAD13342.1| starch synthase isoform zSTSII-2 [Zea mays]
Length=698

 Score =   354 bits (908),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 189/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CKAALQ++LGL VR DVPLIGFIGRLD+QKGVD+IA+AI W+ G+DV
Sbjct  483  NYTFETLDTGKRQCKAALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIADAIHWIAGQDV  542

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +LR+FE +H+DKVR WVGFSV  +HRITAGADILLMPSRFEPCGLN
Sbjct  543  QLVMLGTGRADLEDMLRRFESEHSDKVRAWVGFSVPLAHRITAGADILLMPSRFEPCGLN  602

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+N+TGLGWTFDRAEA ++I AL +CL TYR Y
Sbjct  603  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFNDTGLGWTFDRAEANRMIDALSHCLTTYRNY  662

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW   + RGM +DLSWDHAA  YE+VLV AKYQW
Sbjct  663  KESWRACRARGMAEDLSWDHAAVLYEDVLVKAKYQW  698



>gb|ABY27640.1| starch synthase IIc precursor [Sorghum bicolor]
Length=765

 Score =   355 bits (912),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 193/216 (89%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+QTGK +CK ALQKELGLPVR DVP+I FIGRLD+QKGVDLIAEA+PW+ G+DV
Sbjct  550  NYSLETVQTGKAQCKEALQKELGLPVRADVPVIAFIGRLDHQKGVDLIAEAMPWIAGQDV  609

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+++LGTGR DLE  LR+ E QH D+VRGWVGFSV+ +HR+TAGADILLMPSRFEPCGLN
Sbjct  610  QLILLGTGRQDLEDTLRRLESQHYDRVRGWVGFSVRLAHRMTAGADILLMPSRFEPCGLN  669

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E G+GWTF++AEA ++I ALG+CL T+R Y
Sbjct  670  QLYAMMYGTVPVVHAVGGLRDTVAHYNPYEEVGVGWTFEKAEANRMIDALGHCLNTFRNY  729

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + SWEG+Q+RGMMQDLSWD+AA+ YEEVL+AAKYQW
Sbjct  730  RSSWEGIQRRGMMQDLSWDNAAKLYEEVLLAAKYQW  765



>dbj|BAK03612.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=742

 Score =   354 bits (909),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET++ GK +CKAALQ+ELGLPVR DVP+I FIGRL+ QKGVDLIAEA+PW+ G+DV
Sbjct  527  NYSLETVEAGKAQCKAALQRELGLPVRGDVPVIAFIGRLENQKGVDLIAEAMPWITGQDV  586

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            QV++LGTGR DLE  LR+ E QH D+VRGWVGFSV+ +HR+TAGAD+LLMPSRFEPCGLN
Sbjct  587  QVILLGTGRQDLEDTLRRLESQHYDRVRGWVGFSVRLAHRMTAGADVLLMPSRFEPCGLN  646

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV P++PY E GLGWTF+ AEA ++I ALG+CL TYR Y
Sbjct  647  QLYAMMYGTVPVVHAVGGLRDTVQPYNPYEEAGLGWTFENAEANRMIDALGHCLNTYRNY  706

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGL++RGM+QDLSWD AA+ YEEVLVAAKYQW
Sbjct  707  KSSWEGLRRRGMVQDLSWDTAAKRYEEVLVAAKYQW  742



>ref|XP_009395949.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 gb|AHA51125.1| granule bound starch synthase [Musa acuminata AAA Group]
Length=754

 Score =   354 bits (908),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  833  KPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDVQVVMLGTGRP  654
             P+  AALQKELGLPVR +VP+IGFIGRLD+QKGVDLIAEA+PWM+ +DVQ+VMLGTGRP
Sbjct  549  NPELDAALQKELGLPVRRNVPVIGFIGRLDHQKGVDLIAEAMPWMVAQDVQLVMLGTGRP  608

Query  653  DLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLNQLYAMSYGTV  474
            DLE++LR+FE +++DKVRGWVGFSVK +HRITAGADILLMPSRFEPCGLNQLYAM YGTV
Sbjct  609  DLEEMLRKFERENHDKVRGWVGFSVKMAHRITAGADILLMPSRFEPCGLNQLYAMKYGTV  668

Query  473  PVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQYKKSWEGLQKR  294
            PVVHAVGGLRDTVVPFDP+ ETG GWTF+RAE+  L+HALGNCL TY  +KKSWEGL+ R
Sbjct  669  PVVHAVGGLRDTVVPFDPFKETGYGWTFERAESGMLVHALGNCLNTYWNHKKSWEGLRTR  728

Query  293  GMMQDLSWDHAAQNYEEVLVAAKYQW  216
            GM QDLSWD+AA++YEEVLVAAKYQW
Sbjct  729  GMTQDLSWDNAAKHYEEVLVAAKYQW  754



>gb|AAQ99280.1| soluble starch synthase II [Oryza sativa Indica Group]
Length=803

 Score =   355 bits (911),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 192/216 (89%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY++ +L +GKP+CKAALQ+ELGL VR DVPLIGFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  588  NYTVASLDSGKPRCKAALQRELGLEVRDDVPLIGFIGRLDGQKGVDIIGDAMPWIAGQDV  647

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LG+GR DLE +L++FE QHN KVRGWVGFSVK +HRITAGAD+L+MPSRFEPCGLN
Sbjct  648  QLVLLGSGRRDLEVMLQRFEAQHNSKVRGWVGFSVKMAHRITAGADVLVMPSRFEPCGLN  707

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV  FDP+ +TGLGWTFDRAE  +LI ALG+CL TYR+Y
Sbjct  708  QLYAMAYGTVPVVHAVGGLRDTVSAFDPFEDTGLGWTFDRAEPHKLIEALGHCLETYRKY  767

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YEEVLV AKYQW
Sbjct  768  KESWRGLQVRGMSQDLSWDHAAELYEEVLVKAKYQW  803



>gb|AAB17085.1| starch synthase, partial [Triticum aestivum]
Length=491

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            N+SL TL +GK +CK ALQ+ELGL VR DVPL+GFIGRLD QKGV++IA+A+PW++ +DV
Sbjct  276  NFSLRTLDSGKRQCKEALQRELGLQVRADVPLLGFIGRLDGQKGVEIIADAMPWIVSQDV  335

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +L+ FE +H+DKVRGWVGFSV+ +HRITAGAD LLMPSRFEPCGLN
Sbjct  336  QLVMLGTGRHDLESMLQHFEREHHDKVRGWVGFSVRLAHRITAGADALLMPSRFEPCGLN  395

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+N +GLGWTFDRAEA +LI ALG+CL TYR +
Sbjct  396  QLYAMAYGTVPVVHAVGGLRDTVPPFDPFNHSGLGWTFDRAEAHKLIEALGHCLRTYRDF  455

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW  LQ+RGM QD SW+HAA+ YE+VLV AKYQW
Sbjct  456  KESWRALQERGMSQDFSWEHAAKLYEDVLVKAKYQW  491



>sp|P0C586.1|SSY23_ORYSI RecName: Full=Soluble starch synthase 2-3, chloroplastic/amyloplastic; 
AltName: Full=Soluble starch synthase II-3; AltName: 
Full=Starch synthase IIa; Flags: Precursor [Oryza sativa 
Indica Group]
 dbj|BAD90593.1| starch synthase IIa [Oryza sativa Indica Group]
 dbj|BAD90594.1| starch synthase IIa [Oryza sativa Indica Group]
 gb|ACY56205.1| soluble starch synthase II-3 [Oryza sativa Indica Group]
 gb|ACY56207.1| soluble starch synthase II-3 [Oryza sativa Indica Group]
 gb|ACY56209.1| soluble starch synthase II-3 [Oryza sativa Indica Group]
 gb|ACY56211.1| soluble starch synthase II-3 [Oryza sativa Indica Group]
Length=810

 Score =   355 bits (910),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 192/216 (89%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY++ +L +GKP+CKAALQ+ELGL VR DVPLIGFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  595  NYTVASLDSGKPRCKAALQRELGLEVRDDVPLIGFIGRLDGQKGVDIIGDAMPWIAGQDV  654

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LG+GR DLE +L++FE QHN KVRGWVGFSVK +HRITAGAD+L+MPSRFEPCGLN
Sbjct  655  QLVLLGSGRRDLEVMLQRFEAQHNSKVRGWVGFSVKMAHRITAGADVLVMPSRFEPCGLN  714

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV  FDP+ +TGLGWTFDRAE  +LI ALG+CL TYR+Y
Sbjct  715  QLYAMAYGTVPVVHAVGGLRDTVSAFDPFEDTGLGWTFDRAEPHKLIEALGHCLETYRKY  774

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YEEVLV AKYQW
Sbjct  775  KESWRGLQVRGMSQDLSWDHAAELYEEVLVKAKYQW  810



>ref|XP_010227825.1| PREDICTED: soluble starch synthase 2-2, chloroplastic/amyloplastic-like 
[Brachypodium distachyon]
Length=838

 Score =   355 bits (912),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSL TL  GK +CKA+LQ+ELGL VR DVPLIGFIGRLD QKGV++I +A+PW++ +DV
Sbjct  623  NYSLRTLDAGKRQCKASLQRELGLQVRDDVPLIGFIGRLDGQKGVEIIGDAMPWIVSQDV  682

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLEQ+L+ FE+QH DKVRGWVGFSV  +HRITAG D+L+MPSRFEPCGLN
Sbjct  683  QLVMLGTGRSDLEQMLQHFEWQHKDKVRGWVGFSVPMAHRITAGVDVLVMPSRFEPCGLN  742

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ ++GLGWTFDRAEA +LI ALG+CL TYR Y
Sbjct  743  QLYAMAYGTVPVVHAVGGLRDTVSPFDPFGDSGLGWTFDRAEAHKLIEALGHCLDTYRNY  802

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            ++SW GLQ+RGM QD SWDHAAQ YE+VLV AKYQW
Sbjct  803  RESWRGLQQRGMSQDFSWDHAAQLYEDVLVKAKYQW  838



>ref|XP_004983042.1| PREDICTED: soluble starch synthase 2-1, chloroplastic/amyloplastic-like 
isoform X1 [Setaria italica]
Length=855

 Score =   356 bits (913),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 193/216 (89%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+QTGK +CK ALQKELGLPVR DVP+I FIGRLD+QKGVDLIAEA+PW+ G+DV
Sbjct  640  NYSLETVQTGKAQCKEALQKELGLPVRGDVPVIAFIGRLDHQKGVDLIAEAMPWIAGQDV  699

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGR DLE  LR+ E QH D+VRGWVGFSV+ +HR+TAGAD+LLMPSRFEPCGLN
Sbjct  700  QLIMLGTGRQDLEDTLRRLESQHYDRVRGWVGFSVQLAHRMTAGADVLLMPSRFEPCGLN  759

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E G+GWTF++AEA ++I ALG+CL TYR Y
Sbjct  760  QLYAMMYGTVPVVHAVGGLRDTVQHYNPYEEVGVGWTFEKAEANRMIDALGHCLNTYRNY  819

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + SWEG+Q+RGMMQDLSWD+AA+ YEEVLVAAKYQW
Sbjct  820  RNSWEGIQRRGMMQDLSWDNAAKLYEEVLVAAKYQW  855



>gb|AFW68716.1| starch synthase IIc [Zea mays]
Length=774

 Score =   353 bits (905),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 192/216 (89%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+QTGK +CK ALQKELGLPVR DVP+I FIGRLD+QKGVDLIAEA+PW+ G+DV
Sbjct  559  NYSLETVQTGKAQCKEALQKELGLPVRGDVPVIAFIGRLDHQKGVDLIAEAMPWIAGQDV  618

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGR DLE  LR+ E QH D+VRGWVGFSV+ +HR+TAGADILLMPSRFEPCGLN
Sbjct  619  QLIMLGTGRQDLEDTLRRLESQHYDRVRGWVGFSVRLAHRMTAGADILLMPSRFEPCGLN  678

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E G+GWTF++AEA ++I ALG+CL TYR Y
Sbjct  679  QLYAMMYGTVPVVHAVGGLRDTVQHYNPYEEVGVGWTFEKAEANRMIDALGHCLNTYRNY  738

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
              SWEG+Q+RGMMQDLSWD+AA+ YEEVL+AAKYQW
Sbjct  739  WSSWEGIQRRGMMQDLSWDNAAKLYEEVLLAAKYQW  774



>gb|EMT20525.1| Soluble starch synthase 2-1, chloroplastic/amyloplastic [Aegilops 
tauschii]
Length=953

 Score =   357 bits (916),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/216 (78%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET++TGK +CKAALQKELGLPVR DVP+I FIGRLD QKGVDLIAEA+PW+ G+DV
Sbjct  504  NYSLETVETGKAQCKAALQKELGLPVRGDVPVIAFIGRLDNQKGVDLIAEAMPWIAGQDV  563

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            QV++LGTGR DLE  LR+ E QH D+VRGWVGFSV+ +HR+TAGADILLMPSRFEPCGLN
Sbjct  564  QVILLGTGRQDLEDTLRRLESQHYDRVRGWVGFSVRLAHRMTAGADILLMPSRFEPCGLN  623

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E GLGWTF+ AEA ++I ALG+CL TYR Y
Sbjct  624  QLYAMMYGTVPVVHAVGGLRDTVQHYNPYEEVGLGWTFENAEANRMIDALGHCLNTYRNY  683

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SWEGL++RGMMQDLSWD AA+ YEEVLVAAKYQW
Sbjct  684  KSSWEGLRRRGMMQDLSWDTAAKRYEEVLVAAKYQW  719



>gb|ACY56200.1| soluble starch synthase II-3 [Oryza sativa Japonica Group]
Length=810

 Score =   352 bits (904),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY++ +L + KP+CKAALQ+ELGL VR DVPLIGFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  595  NYTVASLDSSKPRCKAALQRELGLEVRDDVPLIGFIGRLDGQKGVDIIGDAMPWIAGQDV  654

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LG+GR DLE +L++FE QHN KVRGWVGFSVK +HRITAGAD+L+MPSRFEPCGLN
Sbjct  655  QLVLLGSGRRDLEVMLQRFEAQHNSKVRGWVGFSVKMAHRITAGADVLVMPSRFEPCGLN  714

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV  FDP+ +TGLGWTFDRAE  +LI ALG+CL TYR+Y
Sbjct  715  QLYAMAYGTVPVVHAVGGLRDTVSAFDPFEDTGLGWTFDRAEPHKLIEALGHCLETYRKY  774

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YEEVLV AKYQW
Sbjct  775  KESWRGLQVRGMSQDLSWDHAAELYEEVLVKAKYQW  810



>ref|XP_001778218.1| predicted protein [Physcomitrella patens]
 gb|EDQ57000.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   343 bits (879),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 182/216 (84%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+  TL TGK  CKAALQ+ELGLP R DVPL+GFIGRLD QKG+D++A+A+PW+M +D+
Sbjct  277  NYNSATLDTGKAACKAALQRELGLPERSDVPLLGFIGRLDSQKGIDILAQAMPWLMSQDI  336

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR D E +L+ FE  H DKVRGWVGFSVKT+HRITAG DILLMPSRFEPCGLN
Sbjct  337  QLVMLGTGRKDYEDMLQHFESAHRDKVRGWVGFSVKTAHRITAGVDILLMPSRFEPCGLN  396

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGL+DTV  F+P+NETGLGWTF+   A+  IHALGN + TY  +
Sbjct  397  QLYAMRYGTVPVVHAVGGLKDTVQSFNPFNETGLGWTFETLNADAFIHALGNAMWTYHDF  456

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SW G+Q+RGM QDLSWDHAAQ YEEVL+AAKY W
Sbjct  457  KTSWRGIQQRGMSQDLSWDHAAQQYEEVLLAAKYTW  492



>gb|EAZ00249.1| hypothetical protein OsI_22256 [Oryza sativa Indica Group]
 gb|EAZ36363.1| hypothetical protein OsJ_20690 [Oryza sativa Japonica Group]
Length=803

 Score =   352 bits (902),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY++ +L + KP+CKAALQ+ELGL VR DVPLIGFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  588  NYTVASLDSSKPRCKAALQRELGLEVRDDVPLIGFIGRLDGQKGVDIIGDAMPWIAGQDV  647

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LG+GR DLE +L++FE QHN KVRGWVGFSVK +HRITAGAD+L+MPSRFEPCGLN
Sbjct  648  QLVLLGSGRRDLEVMLQRFEAQHNSKVRGWVGFSVKMAHRITAGADVLVMPSRFEPCGLN  707

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV  FDP+ +TGLGWTFDRAE  +LI ALG+CL TYR+Y
Sbjct  708  QLYAMAYGTVPVVHAVGGLRDTVSAFDPFEDTGLGWTFDRAEPHKLIEALGHCLETYRKY  767

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW G Q RGM QDLSWDHAA+ YEEVLV AKYQW
Sbjct  768  KESWRGFQVRGMSQDLSWDHAAELYEEVLVKAKYQW  803



>emb|CAB96627.1| starch synthase IIa-3 [Triticum aestivum]
 dbj|BAE48799.1| starch synthase II-B [Triticum aestivum]
Length=798

 Score =   352 bits (902),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 192/216 (89%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            N+SL TL +GK +CK ALQ+ELGL VR DVPL+GFIGRLD QKGV++IA+A+PW++ +DV
Sbjct  583  NFSLGTLDSGKRQCKEALQRELGLQVRGDVPLLGFIGRLDGQKGVEIIADAMPWIVSQDV  642

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +LR FE +H+DKVRGWVGFSV+ +HRITAGAD LLMPSRFEPCGLN
Sbjct  643  QLVMLGTGRHDLEGMLRHFEREHHDKVRGWVGFSVRLAHRITAGADALLMPSRFEPCGLN  702

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+N +GLGWTFDRAEA++LI ALG+CL TYR Y
Sbjct  703  QLYAMAYGTVPVVHAVGGLRDTVPPFDPFNHSGLGWTFDRAEAQKLIEALGHCLRTYRDY  762

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ+RGM QD SW+HAA+ YE+VLV AKYQW
Sbjct  763  KESWRGLQERGMSQDFSWEHAAKLYEDVLVKAKYQW  798



>emb|CDI68214.1| starch synthase IIa-A [Triticum monococcum subsp. monococcum]
Length=799

 Score =   351 bits (901),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            N+SL TL +GK +CK ALQ+ELGL VR DVPL+GFIGRLD QKGV++IA+A+PW++ +DV
Sbjct  584  NFSLSTLDSGKRQCKEALQRELGLQVRADVPLLGFIGRLDGQKGVEIIADAMPWIVSQDV  643

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +LR FE +H+DKVRGWVGFSV+ +HRITAGAD LLMPSRFEPCGLN
Sbjct  644  QLVMLGTGRHDLESMLRHFEREHHDKVRGWVGFSVRLAHRITAGADALLMPSRFEPCGLN  703

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+N +GLGWTFDRAEA +LI ALG+CL TYR Y
Sbjct  704  QLYAMAYGTVPVVHAVGGLRDTVPPFDPFNHSGLGWTFDRAEAHKLIEALGHCLRTYRDY  763

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ+RGM QD SW+HAA+ YE+VL+ AKYQW
Sbjct  764  KESWRGLQERGMSQDFSWEHAAKLYEDVLLKAKYQW  799



>gb|ABY56824.3| starch synthase IIb precursor [Triticum aestivum]
Length=674

 Score =   348 bits (892),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 188/216 (87%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ +TL  GK +CKAALQ+ELGL VR DVPLIGFIGRLD+QKGVD+IA A+PW+  +DV
Sbjct  459  NYTRDTLDIGKRQCKAALQRELGLQVRDDVPLIGFIGRLDHQKGVDIIAAAMPWIAQQDV  518

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE +LR+FE +H DKVRGWVGFSV+ +HRITAGAD+LLMPS FEPCGLN
Sbjct  519  QLVMLGTGRPDLEDMLRRFEGEHRDKVRGWVGFSVRMAHRITAGADVLLMPSLFEPCGLN  578

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYA++YGTVPVVHAVGGLRDTV PFDP+  TGLGWTFDRA+A ++I ALG+CL TY  Y
Sbjct  579  QLYAVAYGTVPVVHAVGGLRDTVAPFDPFGGTGLGWTFDRADAGRMIDALGHCLNTYWNY  638

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YE VLV AKYQW
Sbjct  639  KESWRGLQVRGMSQDLSWDHAAELYENVLVKAKYQW  674



>ref|XP_009416022.1| PREDICTED: soluble starch synthase 2-2, chloroplastic/amyloplastic-like 
[Musa acuminata subsp. malaccensis]
Length=819

 Score =   352 bits (902),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 187/216 (87%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            N+SLETLQ GK +CKAALQ+ELGLPV  DVP+I FIGRLDYQKGVDLIAEA PW++G+D+
Sbjct  604  NFSLETLQLGKAQCKAALQRELGLPVLGDVPIIAFIGRLDYQKGVDLIAEARPWLVGQDL  663

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE ++R  E  H DK R W+GFSVK +HRITAGADILLMPSRFEPCGLN
Sbjct  664  QIVMLGTGRRDLEDMIRGIESAHRDKARAWIGFSVKMAHRITAGADILLMPSRFEPCGLN  723

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVH+VGGLRDTV  FDP N+ GLGWTF+RAEA ++I AL +CL TYR +
Sbjct  724  QLYAMMYGTVPVVHSVGGLRDTVQQFDPLNDVGLGWTFERAEANRMIQALQHCLDTYRNH  783

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            KKSWE LQ RGM+QDLSWD+AAQ YEEVL+AAKYQW
Sbjct  784  KKSWERLQVRGMIQDLSWDNAAQRYEEVLIAAKYQW  819



>dbj|BAD90592.1| starch synthase IIa [Oryza sativa Japonica Group]
 gb|ACY56198.1| soluble starch synthase II-3 [Oryza sativa Japonica Group]
 gb|ACY56199.1| soluble starch synthase II-3 [Oryza sativa Japonica Group]
 gb|ACY56201.1| soluble starch synthase II-3 [Oryza sativa Japonica Group]
 gb|ACY56203.1| soluble starch synthase II-3 [Oryza sativa Japonica Group]
 gb|ACY56204.1| soluble starch synthase II-3 [Oryza sativa Indica Group]
 gb|ACY56206.1| soluble starch synthase II-3 [Oryza sativa Indica Group]
 gb|ACY56208.1| soluble starch synthase II-3 [Oryza sativa Indica Group]
 gb|ACY56210.1| soluble starch synthase II-3 [Oryza sativa Indica Group]
Length=810

 Score =   351 bits (901),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY++ +L + KP+CKAALQ+ELGL VR DVPLIGFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  595  NYTVASLDSSKPRCKAALQRELGLEVRDDVPLIGFIGRLDGQKGVDIIGDAMPWIAGQDV  654

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LG+GR DLE +L++FE QHN KVRGWVGFSVK +HRITAGAD+L+MPSRFEPCGLN
Sbjct  655  QLVLLGSGRRDLEVMLQRFEAQHNSKVRGWVGFSVKMAHRITAGADVLVMPSRFEPCGLN  714

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV  FDP+ +TGLGWTFDRAE  +LI ALG+CL TYR+Y
Sbjct  715  QLYAMAYGTVPVVHAVGGLRDTVSAFDPFEDTGLGWTFDRAEPHKLIEALGHCLETYRKY  774

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW G Q RGM QDLSWDHAA+ YEEVLV AKYQW
Sbjct  775  KESWRGFQVRGMSQDLSWDHAAELYEEVLVKAKYQW  810



>emb|CAB96626.1| starch synthase IIa-2 [Triticum aestivum]
 dbj|BAE48798.1| starch synthase II-A [Triticum aestivum]
Length=799

 Score =   351 bits (900),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            N+SL TL +GK +CK ALQ+ELGL VR DVPL+GFIGRLD QKGV++IA+A+PW++ +DV
Sbjct  584  NFSLSTLDSGKRQCKEALQRELGLQVRADVPLLGFIGRLDGQKGVEIIADAMPWIVSQDV  643

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +LR FE +H+DKVRGWVGFSV+ +HRITAGAD LLMPSRFEPCGLN
Sbjct  644  QLVMLGTGRHDLESMLRHFEREHHDKVRGWVGFSVRLAHRITAGADALLMPSRFEPCGLN  703

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+N +GLGWTFDRAEA +LI ALG+CL TYR Y
Sbjct  704  QLYAMAYGTVPVVHAVGGLRDTVPPFDPFNHSGLGWTFDRAEAHKLIEALGHCLRTYRDY  763

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ+RGM QD SW+HAA+ YE+VL+ AKYQW
Sbjct  764  KESWRGLQERGMSQDFSWEHAAKLYEDVLLKAKYQW  799



>ref|NP_001057216.1| Os06g0229800 [Oryza sativa Japonica Group]
 sp|Q0DDE3.1|SSY23_ORYSJ RecName: Full=Soluble starch synthase 2-3, chloroplastic/amyloplastic; 
AltName: Full=Soluble starch synthase II-3; AltName: 
Full=Starch synthase IIa; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|AAL16661.1|AF419099_1 putative soluble starch synthase II-3 [Oryza sativa]
 dbj|BAD37272.1| soluble starch synthase II [Oryza sativa Japonica Group]
 dbj|BAD90591.1| starch synthase IIa [Oryza sativa Japonica Group]
 dbj|BAF19130.1| Os06g0229800 [Oryza sativa Japonica Group]
 dbj|BAG95322.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACY56202.1| soluble starch synthase II-3 [Oryza sativa Japonica Group]
Length=810

 Score =   351 bits (901),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY++ +L + KP+CKAALQ+ELGL VR DVPLIGFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  595  NYTVASLDSSKPRCKAALQRELGLEVRDDVPLIGFIGRLDGQKGVDIIGDAMPWIAGQDV  654

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LG+GR DLE +L++FE QHN KVRGWVGFSVK +HRITAGAD+L+MPSRFEPCGLN
Sbjct  655  QLVLLGSGRRDLEVMLQRFEAQHNSKVRGWVGFSVKMAHRITAGADVLVMPSRFEPCGLN  714

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDT+  FDP+ +TGLGWTFDRAE  +LI ALG+CL TYR+Y
Sbjct  715  QLYAMAYGTVPVVHAVGGLRDTMSAFDPFEDTGLGWTFDRAEPHKLIEALGHCLETYRKY  774

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YEEVLV AKYQW
Sbjct  775  KESWRGLQVRGMSQDLSWDHAAELYEEVLVKAKYQW  810



>emb|CDI68213.1| starch synthase IIa-A [Triticum urartu]
Length=799

 Score =   350 bits (899),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            N+SL TL +GK  CK ALQ+ELGL VR DVPL+GFIGRLD QKGV++IA+A+PW++ +DV
Sbjct  584  NFSLSTLDSGKRHCKEALQRELGLQVRADVPLLGFIGRLDGQKGVEIIADAMPWIVSQDV  643

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +LR FE +H+DKVRGWVGFSV+ +HRITAGAD LLMPSRFEPCGLN
Sbjct  644  QLVMLGTGRHDLESMLRHFEREHHDKVRGWVGFSVRLAHRITAGADALLMPSRFEPCGLN  703

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+N +GLGWTFDRAEA +LI ALG+CL TYR Y
Sbjct  704  QLYAMAYGTVPVVHAVGGLRDTVPPFDPFNHSGLGWTFDRAEAHKLIEALGHCLRTYRDY  763

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ+RGM QD SW+HAA+ YE+VL+ AKYQW
Sbjct  764  KESWRGLQERGMSQDFSWEHAAKLYEDVLLKAKYQW  799



>ref|NP_001108120.1| starch synthase IIc precursor [Zea mays]
 gb|ABX76967.1| starch synthase IIc precursor [Zea mays]
Length=775

 Score =   350 bits (897),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLET+QTG+ +CK ALQKELGLPVR DVP+I FIGRLD QKGVDLIAEA+PW+ G+D 
Sbjct  560  NYSLETVQTGRAQCKEALQKELGLPVRGDVPVIAFIGRLDRQKGVDLIAEAMPWIAGQDA  619

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q++MLGTGR DLE  LR+ E QH D+VRGWVGFSV+ +HR+TAGADILLMPSRFEPCGLN
Sbjct  620  QLIMLGTGRQDLEDTLRRLESQHYDRVRGWVGFSVRLAHRMTAGADILLMPSRFEPCGLN  679

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGLRDTV  ++PY E G+GWTF++AEA ++I ALG+CL TYR Y
Sbjct  680  QLYAMMYGTVPVVHAVGGLRDTVQHYNPYEEVGVGWTFEKAEANRMIDALGHCLNTYRNY  739

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
              SWEG+Q+RGMMQDLSWD+AA+ YEEVL+AAKYQW
Sbjct  740  WSSWEGIQRRGMMQDLSWDNAAKLYEEVLLAAKYQW  775



>ref|XP_001754221.1| predicted protein [Physcomitrella patens]
 gb|EDQ81122.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 185/216 (86%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY +ETL +GK  CKAALQKELG PVRP+VPL+GFIGRLD QKG+D+IA+A+PW++ +D+
Sbjct  277  NYDIETLDSGKAACKAALQKELGFPVRPEVPLLGFIGRLDSQKGIDIIAQAMPWLVTQDI  336

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR D E +LR FE  + DKVRGWVGFSV+T+HRITAG DILLMPSRFEPCGLN
Sbjct  337  QLVMLGTGRKDYEDMLRHFEGAYRDKVRGWVGFSVQTAHRITAGVDILLMPSRFEPCGLN  396

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM YGTVPVVHAVGGL+DTV  F+P+NE+GLGWTFD   A+  IHALGN + TY  +
Sbjct  397  QLYAMRYGTVPVVHAVGGLKDTVQQFNPFNESGLGWTFDGLNADAFIHALGNAMWTYLDF  456

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K SW+G+Q+RGM Q+LSWDHAAQ YEEVL+AAKY W
Sbjct  457  KTSWKGIQQRGMSQNLSWDHAAQQYEEVLLAAKYTW  492



>gb|EMT13996.1| Soluble starch synthase 2-3, chloroplastic/amyloplastic [Aegilops 
tauschii]
Length=744

 Score =   348 bits (893),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            N+SL TL +GK +CK ALQ+ELGL VR DVPL+GFIGRLD QKGV++IA+A+PW++ +DV
Sbjct  529  NFSLRTLDSGKRQCKEALQRELGLQVRADVPLLGFIGRLDGQKGVEIIADAMPWIVSQDV  588

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +LR FE +H+DKVRGWVGFSV+ +HRITAGAD LLMPSRFEPCGLN
Sbjct  589  QLVMLGTGRHDLESMLRHFEREHHDKVRGWVGFSVRLAHRITAGADALLMPSRFEPCGLN  648

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+N +GLGWTFDRAEA +LI ALG+CL TYR +
Sbjct  649  QLYAMAYGTVPVVHAVGGLRDTVPPFDPFNHSGLGWTFDRAEAHKLIEALGHCLRTYRDF  708

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW  LQ+RGM QD SW+HAA+ YE+VLV AKYQW
Sbjct  709  KESWRALQERGMSQDFSWEHAAKLYEDVLVKAKYQW  744



>gb|EMT23057.1| Soluble starch synthase 2-2, chloroplastic/amyloplastic [Aegilops 
tauschii]
Length=765

 Score =   348 bits (894),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 188/216 (87%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ +TL TGK +CKAALQ+ELGL VR  VPLIGFIGRLD+QKGVD+IA A+PW+  +DV
Sbjct  550  NYTRDTLDTGKRQCKAALQRELGLQVRDGVPLIGFIGRLDHQKGVDIIAAAMPWIAQQDV  609

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDLE +LR+FE +H DKVRGWVGFSV+ +HRITAGAD+LLMPS FEPCGLN
Sbjct  610  QLVMLGTGRPDLEDMLRRFEGEHRDKVRGWVGFSVRMAHRITAGADVLLMPSLFEPCGLN  669

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+  TGLGWTFDRA+A ++I ALG+CL TY  Y
Sbjct  670  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFGGTGLGWTFDRADAGRMIDALGHCLNTYWNY  729

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YE VLV AKYQW
Sbjct  730  KESWRGLQVRGMSQDLSWDHAAELYENVLVKAKYQW  765



>gb|AAN28307.1| starch synthase II [Hordeum vulgare subsp. vulgare]
Length=802

 Score =   350 bits (897),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 192/216 (89%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            N+SL+TL +GK +CK ALQ+ELGL VR DVPL+GFIGRLD QKGV++IA+A+PW++ +DV
Sbjct  587  NFSLKTLDSGKRQCKEALQRELGLQVRGDVPLLGFIGRLDGQKGVEIIADAMPWIVSQDV  646

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +L+ FE +H+DKVRGWVGFSV+ +HRITAGAD LLMPSRFEPCGLN
Sbjct  647  QLVMLGTGRHDLESMLQHFEREHHDKVRGWVGFSVRLAHRITAGADALLMPSRFEPCGLN  706

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PFDP+N +GLGWTFDRAEA +LI ALG+CL TYR +
Sbjct  707  QLYAMAYGTIPVVHAVGGLRDTVPPFDPFNHSGLGWTFDRAEAHKLIEALGHCLRTYRDH  766

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ+RGM QD SW+HAA+ YE+VLV AKYQW
Sbjct  767  KESWRGLQERGMSQDFSWEHAAKLYEDVLVQAKYQW  802



>gb|AAN28309.1| starch synthase II [Hordeum vulgare subsp. vulgare]
Length=802

 Score =   350 bits (897),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 192/216 (89%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            N+SL+TL +GK +CK ALQ+ELGL VR DVPL+GFIGRLD QKGV++IA+A+PW++ +DV
Sbjct  587  NFSLKTLDSGKRQCKEALQRELGLQVRGDVPLLGFIGRLDGQKGVEIIADAMPWIVSQDV  646

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +L+ FE +H+DKVRGWVGFSV+ +HRITAGAD LLMPSRFEPCGLN
Sbjct  647  QLVMLGTGRHDLESMLQHFEREHHDKVRGWVGFSVRLAHRITAGADALLMPSRFEPCGLN  706

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PFDP+N +GLGWTFDRAEA +LI ALG+CL TYR +
Sbjct  707  QLYAMAYGTIPVVHAVGGLRDTVPPFDPFNHSGLGWTFDRAEAHKLIEALGHCLRTYRDH  766

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ+RGM QD SW+HAA+ YE+VLV AKYQW
Sbjct  767  KESWRGLQERGMSQDFSWEHAAKLYEDVLVQAKYQW  802



>gb|AAD53263.1|AF155217_1 starch synthase IIA [Triticum aestivum]
Length=799

 Score =   348 bits (894),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            N+SL TL +GK +CK ALQ+ELGL VR DVPL+GFIGRLD QKGV++IA+A+PW++ +DV
Sbjct  584  NFSLGTLDSGKRQCKEALQRELGLQVRADVPLLGFIGRLDGQKGVEIIADAMPWIVSQDV  643

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +LR FE +H+DKVRGWVGFSV+ +HRITAGAD LLMPSRFEPCGLN
Sbjct  644  QLVMLGTGRHDLESMLRHFEREHHDKVRGWVGFSVRLAHRITAGADALLMPSRFEPCGLN  703

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGG+RDTV PFDP+N +GLGWTFDRAEA +LI ALG+CL TYR Y
Sbjct  704  QLYAMAYGTVPVVHAVGGVRDTVPPFDPFNHSGLGWTFDRAEAHKLIEALGHCLRTYRDY  763

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ+RGM QD SW+HAA+ YE+VL+ AKYQW
Sbjct  764  KESWRGLQERGMSQDFSWEHAAKLYEDVLLKAKYQW  799



>gb|AAN28308.1| starch synthase II [Aegilops tauschii]
Length=799

 Score =   348 bits (894),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            N+SL TL +GK +CK ALQ+ELGL VR DVPL+GFIGRLD QKGV++IA+A+PW++ +DV
Sbjct  584  NFSLRTLDSGKRQCKEALQRELGLQVRADVPLLGFIGRLDGQKGVEIIADAMPWIVSQDV  643

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +LR FE +H+DKVRGWVGFSV+ +HRITAGAD LLMPSRFEPCGLN
Sbjct  644  QLVMLGTGRHDLESMLRHFEREHHDKVRGWVGFSVRLAHRITAGADALLMPSRFEPCGLN  703

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+N +GLGWTFDRAEA +LI ALG+CL TYR +
Sbjct  704  QLYAMAYGTVPVVHAVGGLRDTVPPFDPFNHSGLGWTFDRAEAHKLIEALGHCLRTYRDF  763

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW  LQ+RGM QD SW+HAA+ YE+VLV AKYQW
Sbjct  764  KESWRALQERGMSQDFSWEHAAKLYEDVLVKAKYQW  799



>gb|AFW76788.1| sugary2 [Zea mays]
Length=764

 Score =   347 bits (891),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 189/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL  GK +CKAALQ+ELGL VR DVPL+GFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  549  NYSLETLDAGKRQCKAALQRELGLEVRDDVPLLGFIGRLDGQKGVDIIGDAMPWIAGQDV  608

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE++L+  E +H +KVRGWVGFSV  +HRITAGAD+L+MPSRFEPCGLN
Sbjct  609  QLVMLGTGRADLERMLQHLEREHPNKVRGWVGFSVPMAHRITAGADVLVMPSRFEPCGLN  668

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+++ GLGWTFDRAEA +LI AL +CL TYR Y
Sbjct  669  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFSDAGLGWTFDRAEANKLIEALRHCLDTYRNY  728

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            ++SW+ LQ RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  729  EESWKSLQARGMSQDLSWDHAAELYEDVLVKAKYQW  764



>ref|NP_001288582.1| soluble starch synthase 2-3, chloroplastic/amyloplastic [Zea 
mays]
 gb|ACR34914.1| unknown [Zea mays]
Length=732

 Score =   346 bits (887),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 189/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL  GK +CKAALQ+ELGL VR DVPL+GFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  517  NYSLETLDAGKRQCKAALQRELGLEVRDDVPLLGFIGRLDGQKGVDIIGDAMPWIAGQDV  576

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE++L+  E +H +KVRGWVGFSV  +HRITAGAD+L+MPSRFEPCGLN
Sbjct  577  QLVMLGTGRADLERMLQHLEREHPNKVRGWVGFSVPMAHRITAGADVLVMPSRFEPCGLN  636

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+++ GLGWTFDRAEA +LI AL +CL TYR Y
Sbjct  637  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFSDAGLGWTFDRAEANKLIEALRHCLDTYRNY  696

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            ++SW+ LQ RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  697  EESWKSLQARGMSQDLSWDHAAELYEDVLVKAKYQW  732



>ref|XP_006656809.1| PREDICTED: soluble starch synthase 2-3, chloroplastic/amyloplastic-like 
[Oryza brachyantha]
Length=791

 Score =   347 bits (891),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 187/216 (87%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+L +L  GK +CKAALQ+ELGL VR DVPLIGFIGRLD QKGVD+I +A+PW++G+DV
Sbjct  576  NYTLSSLDAGKRQCKAALQRELGLEVRDDVPLIGFIGRLDGQKGVDIIGDAVPWIVGQDV  635

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG+GR DLE +L++ E QH  KVRGWVGFSV  +HRITAGAD+LLMPSRFEPCGLN
Sbjct  636  QLVMLGSGRRDLEVMLQRLEAQHGSKVRGWVGFSVPMAHRITAGADVLLMPSRFEPCGLN  695

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV  FDP+ ++GLGWTFDRAE  +LI ALG+CL TYR Y
Sbjct  696  QLYAMAYGTVPVVHAVGGLRDTVTAFDPFGDSGLGWTFDRAEPHKLIEALGHCLDTYRSY  755

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YEEVLV AKYQW
Sbjct  756  KESWRGLQVRGMSQDLSWDHAAELYEEVLVKAKYQW  791



>gb|AAS77569.1| starch synthase IIa [Zea mays]
Length=729

 Score =   345 bits (886),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 189/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL  GK +CKAALQ+ELGL VR DVPL+GFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  514  NYSLETLDAGKRQCKAALQRELGLEVRDDVPLLGFIGRLDGQKGVDIIGDAMPWIAGQDV  573

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE++L+  E +H +KVRGWVGFSV  +HRITAGAD+L+MPSRFEPCGLN
Sbjct  574  QLVMLGTGRADLERMLQHLEREHPNKVRGWVGFSVPMAHRITAGADVLVMPSRFEPCGLN  633

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+++ GLGWTFDRAEA +LI AL +CL TYR Y
Sbjct  634  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFSDAGLGWTFDRAEANKLIEALRHCLDTYRNY  693

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            ++SW+ LQ RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  694  EESWKSLQARGMSQDLSWDHAAELYEDVLVKAKYQW  729



>dbj|BAE48800.1| starch synthase II-D [Triticum aestivum]
Length=799

 Score =   347 bits (890),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            N+SL TL +GK +CK ALQ+ELGL VR DVPL+GFIGRLD QKGV++IA+A+PW++ +DV
Sbjct  584  NFSLRTLDSGKRQCKEALQRELGLQVRADVPLLGFIGRLDGQKGVEIIADAMPWIVSQDV  643

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +L+ FE +H+DKVRGWVGFSV+ +HRITAGAD LLMPSRFEPCGLN
Sbjct  644  QLVMLGTGRHDLESMLQHFEREHHDKVRGWVGFSVRLAHRITAGADALLMPSRFEPCGLN  703

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+N +GLGWTFDRAEA +LI ALG+CL TYR +
Sbjct  704  QLYAMAYGTVPVVHAVGGLRDTVPPFDPFNHSGLGWTFDRAEAHKLIEALGHCLRTYRDF  763

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW  LQ+RGM QD SW+HAA+ YE+VLV AKYQW
Sbjct  764  KESWRALQERGMSQDFSWEHAAKLYEDVLVKAKYQW  799



>emb|CAB86618.1| starch synthase IIa-1 [Triticum aestivum]
Length=799

 Score =   347 bits (889),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            N+SL TL +GK +CK ALQ+ELGL VR DVPL+GFIGRLD QKGV++IA+A+PW++ +DV
Sbjct  584  NFSLRTLDSGKRQCKEALQRELGLQVRADVPLLGFIGRLDGQKGVEIIADAMPWIVSQDV  643

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +L+ FE +H+DKVRGWVGFSV+ +HRITAGAD LLMPSRFEPCGLN
Sbjct  644  QLVMLGTGRHDLESMLQHFEREHHDKVRGWVGFSVRLAHRITAGADALLMPSRFEPCGLN  703

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+N +GLGWTFDRAEA +LI ALG+CL TYR +
Sbjct  704  QLYAMAYGTVPVVHAVGGLRDTVPPFDPFNHSGLGWTFDRAEAHKLIEALGHCLRTYRDF  763

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW  LQ+RGM QD SW+HAA+ YE+VLV AKYQW
Sbjct  764  KESWRALQERGMSQDFSWEHAAKLYEDVLVKAKYQW  799



>gb|AAD13341.1| starch synthase isoform zSTSII-1, partial [Zea mays]
Length=732

 Score =   345 bits (884),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 188/216 (87%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL  GK +CKAALQ+ELGL VR DVPL+GFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  517  NYSLETLDAGKRQCKAALQRELGLEVRDDVPLLGFIGRLDGQKGVDIIGDAMPWIAGQDV  576

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE++L+  E +H +KVRGWVGFSV  +HRITAGAD+L+MPSRFEPCGLN
Sbjct  577  QLVMLGTGRADLERMLQHLEREHPNKVRGWVGFSVPMAHRITAGADVLVMPSRFEPCGLN  636

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ + GLGWTFDRAEA +LI AL +CL TYR+Y
Sbjct  637  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFGDAGLGWTFDRAEANKLIEALRHCLDTYRKY  696

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
             +SW+ LQ RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  697  GESWKSLQARGMSQDLSWDHAAELYEDVLVKAKYQW  732



>ref|XP_004965048.1| PREDICTED: soluble starch synthase 2-3, chloroplastic/amyloplastic-like 
[Setaria italica]
Length=747

 Score =   345 bits (884),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 185/216 (86%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY L TL  GK +CKAALQ+ELGL VR DVPL+GFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  532  NYGLRTLDAGKRQCKAALQRELGLEVRDDVPLLGFIGRLDGQKGVDIIGDAMPWLAGQDV  591

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG GR DLE++L+  E  H DKVRGWVGFSV  +HRITAGAD+LLMPSRFEPCGLN
Sbjct  592  QLVMLGAGRGDLERMLQHLERMHQDKVRGWVGFSVPMAHRITAGADVLLMPSRFEPCGLN  651

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTVVPFDP+ + GLGWTFDRAE  +LI ALG+CL TYR Y
Sbjct  652  QLYAMAYGTVPVVHAVGGLRDTVVPFDPFGDAGLGWTFDRAEPNKLIEALGHCLDTYRNY  711

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            ++SW  +Q+RGM QDLSWDHAA+ YEEVLV AKYQW
Sbjct  712  RESWRRIQERGMSQDLSWDHAAELYEEVLVKAKYQW  747



>dbj|BAK03716.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=813

 Score =   346 bits (887),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            N+SL+TL +GK +CK ALQ+ELGL VR DVPL+GFIGRLD QKGV++IA+A+PW++ +DV
Sbjct  598  NFSLKTLDSGKRQCKEALQRELGLQVRGDVPLLGFIGRLDGQKGVEIIADAMPWIVSQDV  657

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE +L+ FE +H+DKVRGWVGFSV+ +HRITAGAD LLMPSRFEPCGLN
Sbjct  658  QLVMLGTGRHDLESMLQHFEREHHDKVRGWVGFSVRLAHRITAGADALLMPSRFEPCGLN  717

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGT+PVVHAVGGLRDTV PFDP+N +GLGWTFDRAEA +LI ALG+CL TYR +
Sbjct  718  QLYAMAYGTIPVVHAVGGLRDTVPPFDPFNHSGLGWTFDRAEAHKLIEALGHCLRTYRDH  777

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ+RGM QD SW+HAA+  E+VLV AKYQW
Sbjct  778  KESWRGLQERGMSQDFSWEHAAKLCEDVLVQAKYQW  813



>gb|ACC86844.1| starch synthase IIa precursor [Sorghum bicolor]
Length=743

 Score =   342 bits (876),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 185/216 (86%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL  GK +CKAALQ+ELGL VR DVPL+GFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  528  NYSLETLDAGKRQCKAALQRELGLEVRDDVPLLGFIGRLDGQKGVDIIGDAMPWIAGQDV  587

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE++L+  E +H  KVRGWVGFSV  +HRITAGAD+L+MPSRFEPCGLN
Sbjct  588  QLVMLGTGRADLERMLQHLEREHPSKVRGWVGFSVPMAHRITAGADVLVMPSRFEPCGLN  647

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ + GLGWTFDRAE  +LI AL +CL TYR Y
Sbjct  648  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFGDAGLGWTFDRAEVNKLIEALRHCLDTYRNY  707

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
             +SW+ +Q RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  708  GESWKSIQARGMAQDLSWDHAAELYEDVLVKAKYQW  743



>ref|XP_002436755.1| hypothetical protein SORBIDRAFT_10g008200 [Sorghum bicolor]
 gb|EER88122.1| hypothetical protein SORBIDRAFT_10g008200 [Sorghum bicolor]
Length=763

 Score =   342 bits (877),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 185/216 (86%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYSLETL  GK +CKAALQ+ELGL VR DVPL+GFIGRLD QKGVD+I +A+PW+ G+DV
Sbjct  548  NYSLETLDAGKRQCKAALQRELGLEVRDDVPLLGFIGRLDGQKGVDIIGDAMPWIAGQDV  607

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGR DLE++L+  E +H  KVRGWVGFSV  +HRITAGAD+L+MPSRFEPCGLN
Sbjct  608  QLVMLGTGRADLERMLQHLEREHPSKVRGWVGFSVPMAHRITAGADVLVMPSRFEPCGLN  667

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ + GLGWTFDRAE  +LI AL +CL TYR Y
Sbjct  668  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFGDAGLGWTFDRAEVNKLIEALRHCLDTYRNY  727

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
             +SW+ +Q RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  728  GESWKSIQARGMAQDLSWDHAAELYEDVLVKAKYQW  763



>ref|XP_001697289.1| hypothetical protein CHLREDRAFT_109372 [Chlamydomonas reinhardtii]
 gb|EDO96030.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=275

 Score =   309 bits (791),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            +Y ++TL  GK KCKAALQKELGLPV PD P++GFIGRLDYQKGVDLI +   ++MGE  
Sbjct  60   HYDVDTLAEGKAKCKAALQKELGLPVDPDAPMLGFIGRLDYQKGVDLIRDNYDYIMGEKC  119

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG+GR DLE  LR  E ++ ++ RGWVGFS K +HRITA ADILLMPSRFEPCGLN
Sbjct  120  QLVMLGSGRQDLEDALRDMENRNKNQCRGWVGFSNKMAHRITAAADILLMPSRFEPCGLN  179

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVP+VH+VGGLRDTV  + P+   G GW F+RAEA +L  ++ N L TYRQ+
Sbjct  180  QLYAMAYGTVPIVHSVGGLRDTVKQYSPFENVGTGWVFERAEANKLRESINNALYTYRQF  239

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + S+ G+Q+RGM QDL+WD+AA  YEEVLVAAKYQW
Sbjct  240  RDSFRGIQRRGMEQDLTWDNAASIYEEVLVAAKYQW  275



>ref|XP_002946924.1| hypothetical protein VOLCADRAFT_103172 [Volvox carteri f. nagariensis]
 gb|EFJ52150.1| hypothetical protein VOLCADRAFT_103172 [Volvox carteri f. nagariensis]
Length=704

 Score =   315 bits (807),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 177/216 (82%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            N++L+T+  GK  CK ALQKELGLPV PD PL+GFIGRLDYQKGVDLI +   ++MGE  
Sbjct  489  NFTLDTMVEGKRACKMALQKELGLPVDPDAPLLGFIGRLDYQKGVDLIRDTYDYIMGEKC  548

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG+GR DLE  LR  E ++ ++ RGWVGFSVK +HRITA ADILLMPSRFEPCGLN
Sbjct  549  QLVMLGSGRQDLEDALRDMENRNKNQCRGWVGFSVKMAHRITAAADILLMPSRFEPCGLN  608

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVP+VHAVGGLRDTV  ++PY+  G GW FDRAEA +L  ++ N L TYRQ+
Sbjct  609  QLYAMAYGTVPIVHAVGGLRDTVKQYNPYDNVGTGWCFDRAEANKLRESINNALYTYRQF  668

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            ++S+ G+Q+RGM QDL+WD+AA  YEEVLVAAKYQW
Sbjct  669  RESFHGIQRRGMEQDLTWDNAASIYEEVLVAAKYQW  704



>gb|AAC17970.2| soluble starch synthase [Chlamydomonas reinhardtii]
Length=576

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            +Y ++TL  GK KCKAALQKELGLPV PD P++GFIGRLDYQKGVDLI +   ++MGE  
Sbjct  361  HYDVDTLAEGKAKCKAALQKELGLPVDPDAPMLGFIGRLDYQKGVDLIRDNYDYIMGEKC  420

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG+GR DLE  LR  E ++ ++ RGWVGFS K +HRITA ADILLMPSRFEPCGLN
Sbjct  421  QLVMLGSGRQDLEDALRDMENRNKNQCRGWVGFSNKMAHRITAAADILLMPSRFEPCGLN  480

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVP+VH+VGGLRDTV  + P+   G GW F+RAEA +L  ++ N L TYRQ+
Sbjct  481  QLYAMAYGTVPIVHSVGGLRDTVKQYSPFENVGTGWVFERAEANKLRESINNALYTYRQF  540

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + S+ G+Q+RGM QDL+WD+AA  YEEVLVAAKYQW
Sbjct  541  RDSFRGIQRRGMEQDLTWDNAASIYEEVLVAAKYQW  576



>ref|XP_001691829.1| soluble starch synthase II [Chlamydomonas reinhardtii]
 gb|EDP04319.1| soluble starch synthase II [Chlamydomonas reinhardtii]
Length=707

 Score =   308 bits (790),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            +Y ++TL  GK KCKAALQKELGLPV PD P++GFIGRLDYQKGVDLI +   ++MGE  
Sbjct  492  HYDVDTLAEGKAKCKAALQKELGLPVDPDAPMLGFIGRLDYQKGVDLIRDNYDYIMGEKC  551

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG+GR DLE  LR  E ++ ++ RGWVGFS K +HRITA ADILLMPSRFEPCGLN
Sbjct  552  QLVMLGSGRQDLEDALRDMENRNKNQCRGWVGFSNKMAHRITAAADILLMPSRFEPCGLN  611

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVP+VH+VGGLRDTV  + P+   G GW F+RAEA +L  ++ N L TYRQ+
Sbjct  612  QLYAMAYGTVPIVHSVGGLRDTVKQYSPFENVGTGWVFERAEANKLRESINNALYTYRQF  671

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + S+ G+Q+RGM QDL+WD+AA  YEEVLVAAKYQW
Sbjct  672  RDSFRGIQRRGMEQDLTWDNAASIYEEVLVAAKYQW  707



>ref|XP_005852072.1| hypothetical protein CHLNCDRAFT_6734, partial [Chlorella variabilis]
 gb|EFN59970.1| hypothetical protein CHLNCDRAFT_6734, partial [Chlorella variabilis]
Length=513

 Score =   297 bits (760),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 177/216 (82%), Gaps = 1/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY + +L   K +CK ALQ+ELGLPV   +P++GFIGRLDYQKGVDLI +   W+M E V
Sbjct  299  NYDVASLDK-KRQCKEALQRELGLPVDASIPMMGFIGRLDYQKGVDLIRDNYDWLMSEGV  357

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LG+GR DLE  LR  E +++DK RGWVGFSVK +HRITAG D+LLMPSRFEPCGLN
Sbjct  358  QLVLLGSGREDLEAALRDMEARNHDKCRGWVGFSVKMAHRITAGVDLLLMPSRFEPCGLN  417

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVH+VGGLRDTV PF+P+ ++G GWTF+ A+A +  +ALG+ L T+R++
Sbjct  418  QLYAMAYGTVPVVHSVGGLRDTVKPFNPFEKSGTGWTFEMADAGRFRNALGDALYTFREH  477

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            + S+ GLQ+RGM QDLSW+HAA+ YE+VL+ AK+QW
Sbjct  478  RDSFRGLQERGMEQDLSWEHAAEQYEDVLLQAKFQW  513



>ref|XP_011400772.1| Granule-bound starch synthase 2, chloroplastic/amyloplastic [Auxenochlorella 
protothecoides]
 gb|KFM27785.1| Granule-bound starch synthase 2, chloroplastic/amyloplastic [Auxenochlorella 
protothecoides]
Length=491

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 169/216 (78%), Gaps = 1/216 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY L+ +  GK  CKAALQKELGLPV    PL+GFIGRLDYQKGVDLI +   W+MGE V
Sbjct  277  NYGLQDM-AGKAACKAALQKELGLPVDARRPLLGFIGRLDYQKGVDLIRDNYEWLMGEGV  335

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLG+GR DLE  LR  E +++DK RGWVGFS   +HRITAGADILLMPSRFEPCGLN
Sbjct  336  QLVMLGSGREDLEASLRDMESRNHDKCRGWVGFSAAMAHRITAGADILLMPSRFEPCGLN  395

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV  +DPY   G G+ F+ ++A    +ALG+ L T R+Y
Sbjct  396  QLYAMAYGTVPVVHAVGGLRDTVQAYDPYANAGTGFVFEWSDAGAFRNALGDALYTLREY  455

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
              S+ G+Q+RGM QDL+WDHAA  YE+VL+ AKYQW
Sbjct  456  PDSFAGIQRRGMEQDLTWDHAAAQYEDVLLQAKYQW  491



>gb|EEE57801.1| hypothetical protein OsJ_08360 [Oryza sativa Japonica Group]
Length=676

 Score =   298 bits (762),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 169/216 (78%), Gaps = 18/216 (8%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY+ ETL TGK +CK ALQ++LGL VR DVPLIGFIGRLD+QKGVD+I +A+PW+ G+DV
Sbjct  479  NYTFETLDTGKKQCKEALQRQLGLQVRDDVPLIGFIGRLDHQKGVDIIGDAMPWIAGQDV  538

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            QVVMLGTG                         +   +HRITAGAD+LLMPSRFEPCGLN
Sbjct  539  QVVMLGTGAAGPGGD------------------AAALAHRITAGADVLLMPSRFEPCGLN  580

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVPVVHAVGGLRDTV PFDP+ +TGLGWTFDRAEA ++I ALG+CL TYR Y
Sbjct  581  QLYAMAYGTVPVVHAVGGLRDTVAPFDPFADTGLGWTFDRAEANRMIDALGHCLNTYRNY  640

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            K+SW GLQ RGM QDLSWDHAA+ YE+VLV AKYQW
Sbjct  641  KESWRGLQARGMAQDLSWDHAAELYEDVLVKAKYQW  676



>ref|XP_005851974.1| hypothetical protein CHLNCDRAFT_6787, partial [Chlorella variabilis]
 gb|EFN59872.1| hypothetical protein CHLNCDRAFT_6787, partial [Chlorella variabilis]
Length=503

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 164/215 (76%), Gaps = 0/215 (0%)
 Frame = -2

Query  860  YSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDVQ  681
            Y  ETL  GK +CKAALQ+ELGLPV   VPL+GFIGRLD QKGVDLIA    W+M +  Q
Sbjct  289  YDAETLDVGKTRCKAALQQELGLPVDLSVPLLGFIGRLDEQKGVDLIAANCDWLMEQGAQ  348

Query  680  VVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLNQ  501
            +V+LG+GRPDLE+ LR+ E +H  + R WVGFSVK +HRITAGAD+LLMPSRFEPCGLNQ
Sbjct  349  LVLLGSGRPDLEEALRKMEARHPQQCRAWVGFSVKLAHRITAGADMLLMPSRFEPCGLNQ  408

Query  500  LYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQYK  321
            LY M+YGT PVVHAVGGL DTV PF+P+   G GWTF+ A+      AL   LLTY Q+ 
Sbjct  409  LYGMAYGTPPVVHAVGGLADTVKPFNPFENVGTGWTFEGADPGTFRSALRFALLTYSQHP  468

Query  320  KSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            +S+  +Q RGM QDLSWD AAQ YE VL+AAKYQW
Sbjct  469  ESFRCMQLRGMEQDLSWDQAAQQYEAVLLAAKYQW  503



>gb|AFB74094.1| starch synthase I-1, partial [Triticum aestivum]
Length=218

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 160/212 (75%), Gaps = 4/212 (2%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            +YS++ L +GK KCKA LQKELGLPVR DVPLIGFIGRLDYQKG+DLI  AIP +M EDV
Sbjct  8    HYSVDDL-SGKAKCKAELQKELGLPVREDVPLIGFIGRLDYQKGIDLIKMAIPELMREDV  66

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILLMPSRFEPCGLN
Sbjct  67   QFVMLGSGDPIFEGWMRSTESSYKDKFRGWVGFSVPVSHRITAGCDILLMPSRFEPCGLN  126

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQLIHALGNCLLTY  333
            QLYAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     ++++ AL   + T+
Sbjct  127  QLYAMQYGTVPVVHGTGGLRDTVETFNPFGAKGEEGTGWAFSPLTVDKMLWALRTAMSTF  186

Query  332  RQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            R++K SWEGL KRGM +D +WDHAA+ YE++ 
Sbjct  187  REHKPSWEGLMKRGMTKDNTWDHAAEQYEQIF  218



>gb|ACN36715.1| unknown [Zea mays]
Length=369

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 165/224 (74%), Gaps = 9/224 (4%)
 Frame = -2

Query  878  RMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWM  699
            + +  +YS++ L +GK KCK ALQKELGLP+RPDVPLIGFIGRLDYQKG+DLI   IP +
Sbjct  143  KCIPCHYSVDDL-SGKAKCKGALQKELGLPIRPDVPLIGFIGRLDYQKGIDLIQLIIPDL  201

Query  698  MGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFE  519
            M EDVQ VMLG+G P+LE  +R  E    DK RGWVGFSV  SHRITAG DILLMPSRFE
Sbjct  202  MREDVQFVMLGSGDPELEDWMRSTESIFKDKFRGWVGFSVPVSHRITAGCDILLMPSRFE  261

Query  518  PCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNET---GLGWTFDRAEAEQLIHALGN  348
            PCGLNQLYAM YGTVPVVHA GGLRDTV  F+P+ E    G GW F     E ++  L  
Sbjct  262  PCGLNQLYAMQYGTVPVVHATGGLRDTVENFNPFGENGEQGTGWAFAPLTTENMLWTLRT  321

Query  347  CLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
             + TYR++K SWEGL KRGM +D +WDHAA+ YE++     +QW
Sbjct  322  AISTYREHKSSWEGLMKRGMSKDFTWDHAAEQYEQI-----FQW  360



>ref|XP_005649059.1| hypothetical protein COCSUDRAFT_14487 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24515.1| hypothetical protein COCSUDRAFT_14487 [Coccomyxa subellipsoidea 
C-169]
Length=486

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 164/208 (79%), Gaps = 0/208 (0%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NY  + +  GK +CKAALQ+ELGLP  P+VPL+GFIGRLDYQKGVDLI +   W+M E  
Sbjct  277  NYGPDDIAAGKARCKAALQRELGLPEDPNVPLLGFIGRLDYQKGVDLIRDNFDWLMHEGA  336

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+V+LG+GR DLE  LR+ E   + + RGWVGF+V+ +HRITAG D+LLMPSRFEPCGLN
Sbjct  337  QLVLLGSGRDDLENSLREMEASRHQQCRGWVGFNVRLAHRITAGCDMLLMPSRFEPCGLN  396

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQY  324
            QLYAM+YGTVP+VHAVGGLRDTV P++PY  TG GWTFD A+A     A+GN + TYR++
Sbjct  397  QLYAMAYGTVPIVHAVGGLRDTVHPYNPYENTGTGWTFDWADAGSFRDAMGNAIYTYREF  456

Query  323  KKSWEGLQKRGMMQDLSWDHAAQNYEEV  240
            + S+  +Q RGM QDLSWDHAA+ YE+V
Sbjct  457  RDSFRAVQLRGMRQDLSWDHAAELYEQV  484



>ref|XP_003083728.1| soluble starch synthase II (IC), partial [Ostreococcus tauri]
 emb|CAL58277.1| Glycosyl transferase, family 1, partial [Ostreococcus tauri]
Length=528

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 165/212 (78%), Gaps = 0/212 (0%)
 Frame = -2

Query  851  ETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDVQVVM  672
            +  + GK  CK ALQ+ELGLP R DVP++ FIGRLD QKGVDLI +A  W+ G+DVQ++M
Sbjct  317  DAFEAGKLACKRALQRELGLPERDDVPVLAFIGRLDDQKGVDLITQAEGWLAGQDVQLIM  376

Query  671  LGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLNQLYA  492
            LG+GR DLE  LR  E ++ DK+R W+GFSVK +HRITAGADILLMPSRFEPCGLNQLYA
Sbjct  377  LGSGRGDLEDALRGMEERNRDKIRSWIGFSVKMAHRITAGADILLMPSRFEPCGLNQLYA  436

Query  491  MSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQYKKSW  312
            + YGTVPVVHAVGGLRDTV  +DP+   G GWTFD AE  +LI A+G+ + TYR +++S+
Sbjct  437  LRYGTVPVVHAVGGLRDTVQQYDPFTNAGTGWTFDSAETHKLIDAMGHAIGTYRDHRESF  496

Query  311  EGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
             G+Q RG  +D+SW HAA+ YE+  + AKY W
Sbjct  497  RGIQARGFERDVSWTHAAELYEDRFIDAKYSW  528



>ref|NP_001104892.1| starch synthase I, chloroplastic precursor [Zea mays]
 gb|AAB99957.2| plastid starch synthase I precursor [Zea mays]
Length=640

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 166/230 (72%), Gaps = 9/230 (4%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W     + +  +YS++ L +GK KCK ALQKELGLP+RPDVPLIGFIGRLDYQKG+DLI 
Sbjct  408  WNPATDKCIPCHYSVDDL-SGKAKCKGALQKELGLPIRPDVPLIGFIGRLDYQKGIDLIQ  466

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
              IP +M EDVQ VMLG+G P+LE  +R  E    DK RGWVGFSV  SHRITAG DILL
Sbjct  467  LIIPDLMREDVQFVMLGSGDPELEDWMRSTESIFKDKFRGWVGFSVPVSHRITAGCDILL  526

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNET---GLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVHA GGLRDTV  F+P+ E    G GW F     E +
Sbjct  527  MPSRFEPCGLNQLYAMQYGTVPVVHATGGLRDTVENFNPFGENGEQGTGWAFAPLTTENM  586

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            +  L   + TYR++K SWEGL KRGM +D +WDHAA+ YE++     +QW
Sbjct  587  LWTLRTAISTYREHKSSWEGLMKRGMSKDFTWDHAAEQYEQI-----FQW  631



>gb|AFW85727.1| starch synthase I [Zea mays]
Length=640

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 166/230 (72%), Gaps = 9/230 (4%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W     + +  +YS++ L +GK KCK ALQKELGLP+RPDVPLIGFIGRLDYQKG+DLI 
Sbjct  408  WNPATDKCIPCHYSVDDL-SGKAKCKGALQKELGLPIRPDVPLIGFIGRLDYQKGIDLIQ  466

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
              IP +M EDVQ VMLG+G P+LE  +R  E    DK RGWVGFSV  SHRITAG DILL
Sbjct  467  LIIPDLMREDVQFVMLGSGDPELEDWMRSTESIFKDKFRGWVGFSVPVSHRITAGCDILL  526

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNET---GLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVHA GGLRDTV  F+P+ E    G GW F     E +
Sbjct  527  MPSRFEPCGLNQLYAMQYGTVPVVHATGGLRDTVENFNPFGENGEQGTGWAFAPLTTENM  586

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            +  L   + TYR++K SWEGL KRGM +D +WDHAA+ YE++     +QW
Sbjct  587  LWTLRTAISTYREHKSSWEGLMKRGMSKDFTWDHAAEQYEQI-----FQW  631



>ref|XP_002506460.1| glycosyltransferase family 5 protein [Micromonas sp. RCC299]
 gb|ACO67718.1| glycosyltransferase family 5 protein [Micromonas sp. RCC299]
Length=501

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 161/207 (78%), Gaps = 0/207 (0%)
 Frame = -2

Query  836  GKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDVQVVMLGTGR  657
            GK +CK ALQ++LGLP R DVPL+GFIGRLD+QKGVDLI +A  W+MG+DVQ+VMLG+GR
Sbjct  295  GKLECKRALQRQLGLPERDDVPLLGFIGRLDHQKGVDLITDARHWLMGQDVQLVMLGSGR  354

Query  656  PDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLNQLYAMSYGT  477
             DLEQ LR  E  H DK R WVGFSV+ +HRITAG DILLMPSRFEPCGLNQLYAM YGT
Sbjct  355  EDLEQSLRSMENDHKDKCRCWVGFSVEMAHRITAGCDILLMPSRFEPCGLNQLYAMRYGT  414

Query  476  VPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQYKKSWEGLQK  297
            VPVVHAVGGLR+TV P++P+ + G GW FD A   +   A+G  L TYR+ K +++ +Q 
Sbjct  415  VPVVHAVGGLRETVRPYNPHTKEGTGWQFDEALTNKFQEAVGWALGTYREDKDTFKKIQL  474

Query  296  RGMMQDLSWDHAAQNYEEVLVAAKYQW  216
             GM QDLSW  AA+ YEE L+ AKY W
Sbjct  475  SGMQQDLSWGLAAERYEEKLIEAKYSW  501



>emb|CAX51357.1| soluble starch synthase [Hordeum vulgare subsp. vulgare]
Length=515

 Score =   278 bits (712),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 164/223 (74%), Gaps = 4/223 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  T  + +  +YS++ L +GK KCKA LQ+ELGLPVR DVPLIGFIGRLDYQKG+DLI 
Sbjct  283  WNPTTDKCLPHHYSVDDL-SGKAKCKAELQRELGLPVREDVPLIGFIGRLDYQKGIDLIK  341

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M EDVQ VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILL
Sbjct  342  MAIPDLMREDVQFVMLGSGDPVFEGWMRSTESSYKDKFRGWVGFSVPVSHRITAGCDILL  401

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     E++
Sbjct  402  MPSRFEPCGLNQLYAMQYGTVPVVHGTGGLRDTVETFNPFGAKGEEGTGWAFSPLTVEKM  461

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            + AL   + T+R++K SWEGL KRGM +D +WDHAA+ YE++ 
Sbjct  462  LWALRTAISTFREHKPSWEGLMKRGMTKDHTWDHAAEQYEQIF  504



>gb|EPS62751.1| soluble starch synthase 1, chloroplastic/amyloplastic, partial 
[Genlisea aurea]
Length=554

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 162/224 (72%), Gaps = 5/224 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +  + +  NYS+++L  GK KCK ALQKELGLPVRPD PLIGFIGRLDYQKGVD++ 
Sbjct  321  WNPSTDKHIACNYSIDSL-PGKVKCKMALQKELGLPVRPDCPLIGFIGRLDYQKGVDILL  379

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             A+P +M EDVQ+VMLG+G    E  +R  E  + DK RGWVGF+V  SHRITAG DIL+
Sbjct  380  SAVPDIMQEDVQLVMLGSGERQYEDWMRHLECIYRDKYRGWVGFNVPISHRITAGCDILI  439

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY----NETGLGWTFDRAEAEQ  369
            MPSRFEPCGLNQLYAM YG+VPVVH  GGLRDTV  F+PY     E G GW F   E E 
Sbjct  440  MPSRFEPCGLNQLYAMRYGSVPVVHNTGGLRDTVQSFNPYARGEEEEGTGWAFSPLERES  499

Query  368  LIHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            LI ALG  + TY+QYK SWE L KRGM +D SWD AA  YE+V 
Sbjct  500  LIEALGMAMGTYKQYKGSWERLMKRGMGRDCSWDSAAAQYEQVF  543



>gb|AEB33739.1| soluble starch synthase 1 [Oryza sativa Japonica Group]
 gb|AEB33740.1| soluble starch synthase 1 [Oryza sativa Japonica Group]
 gb|AEB33741.1| soluble starch synthase 1 [Oryza sativa Japonica Group]
 gb|AEB33742.1| soluble starch synthase 1 [Oryza sativa Japonica Group]
 gb|AEB33743.1| soluble starch synthase 1 [Oryza sativa Japonica Group]
 gb|AEB33744.1| soluble starch synthase 1 [Oryza sativa Japonica Group]
 gb|AEB33745.1| soluble starch synthase 1 [Oryza sativa Japonica Group]
 gb|AEB33746.1| soluble starch synthase 1 [Oryza sativa Japonica Group]
Length=541

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 163/223 (73%), Gaps = 4/223 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +  + +  +YS++ L +GK KCKA LQKELGLP+RPDVPLIGFIGRLDYQKG+DLI 
Sbjct  309  WNPSTDKFLPYHYSVDDL-SGKAKCKAELQKELGLPIRPDVPLIGFIGRLDYQKGIDLIK  367

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M +++Q VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILL
Sbjct  368  LAIPDLMRDNIQFVMLGSGDPGFEGWMRSTESGYRDKFRGWVGFSVPVSHRITAGCDILL  427

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     E++
Sbjct  428  MPSRFEPCGLNQLYAMQYGTVPVVHGTGGLRDTVENFNPFAEKGEQGTGWAFSPLTIEKM  487

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            + AL   + TYR++K SWEGL KRGM  D +WDHAA  YE++ 
Sbjct  488  LWALRMAISTYREHKSSWEGLMKRGMSSDFTWDHAASQYEQIF  530



>ref|XP_006656668.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic-like 
[Oryza brachyantha]
Length=659

 Score =   281 bits (718),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 164/223 (74%), Gaps = 4/223 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +  + +  +Y+++ L +GK KCKA LQKELGLP+RPDVPLIGFIGRLDYQKG+DLI 
Sbjct  427  WNPSTDKFLPCHYTVDDL-SGKAKCKAELQKELGLPIRPDVPLIGFIGRLDYQKGIDLIK  485

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             A+P +M ED+Q VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILL
Sbjct  486  LAMPDLMQEDIQFVMLGSGDPGFEGWMRSTESSYRDKFRGWVGFSVPVSHRITAGCDILL  545

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     E++
Sbjct  546  MPSRFEPCGLNQLYAMQYGTVPVVHGTGGLRDTVENFNPFAEKGEQGTGWAFSPLTIEKM  605

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            + AL   + TYR++K SWEGL KRGM +D +WDHAA  YE++ 
Sbjct  606  LWALRMAISTYREHKSSWEGLMKRGMSRDFTWDHAASQYEQIF  648



>sp|Q43654.2|SSY1_WHEAT RecName: Full=Starch synthase 1, chloroplastic/amyloplastic; 
AltName: Full=Starch synthase I-2; Short=SS I; Short=SS I-2; 
Flags: Precursor [Triticum aestivum]
 emb|CAB99210.1| starch synthase I-2 [Triticum aestivum]
Length=647

 Score =   280 bits (716),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 164/223 (74%), Gaps = 4/223 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  T  + +  +YS++ L +GK KCKA LQKELGLPVR DVPLIGFIGRLDYQKG+DLI 
Sbjct  415  WNPTTDKCLPHHYSVDDL-SGKAKCKAELQKELGLPVREDVPLIGFIGRLDYQKGIDLIK  473

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M EDVQ VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILL
Sbjct  474  MAIPELMREDVQFVMLGSGDPIFEGWMRSTESSYKDKFRGWVGFSVPVSHRITAGCDILL  533

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     +++
Sbjct  534  MPSRFEPCGLNQLYAMQYGTVPVVHGTGGLRDTVETFNPFGAKGEEGTGWAFSPLTVDKM  593

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            + AL   + T+R++K SWEGL KRGM +D +WDHAA+ YE++ 
Sbjct  594  LWALRTAMSTFREHKPSWEGLMKRGMTKDHTWDHAAEQYEQIF  636



>ref|XP_004964777.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic-like 
[Setaria italica]
Length=642

 Score =   280 bits (715),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 164/230 (71%), Gaps = 9/230 (4%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W     + +  +YS + L +GK KCKA LQKELGLP+RPDVPLIGFIGRLDYQKG+DLI 
Sbjct  410  WNPATDKHIPCHYSADDL-SGKAKCKAELQKELGLPIRPDVPLIGFIGRLDYQKGIDLIK  468

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
              +P +M ED+Q  MLG+G P+LE  +R  E    DK RGWVGFSV  SHRITAG DILL
Sbjct  469  LIMPDLMREDIQFAMLGSGDPELEDWMRSTESNFRDKFRGWVGFSVPVSHRITAGCDILL  528

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVHA GGLRDTV  F+P+    E G GW F     E +
Sbjct  529  MPSRFEPCGLNQLYAMQYGTVPVVHATGGLRDTVENFNPFGDNGEQGTGWAFAPLTTENM  588

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            +  L   + TYR++K SWEGL KRGM +D +WDHAA+ YE++     +QW
Sbjct  589  LWTLRTAISTYREHKSSWEGLMKRGMSKDFTWDHAAEQYEQI-----FQW  633



>gb|AAF03557.1| starch synthase I [Aegilops tauschii]
Length=647

 Score =   280 bits (715),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 164/223 (74%), Gaps = 4/223 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  T  + +  +YS++ L +GK KCKA LQKELGLPVR DVPLIGFIGRLDYQKG+DLI 
Sbjct  415  WNPTTDKCLPHHYSVDDL-SGKAKCKAELQKELGLPVREDVPLIGFIGRLDYQKGIDLIK  473

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M EDVQ VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILL
Sbjct  474  MAIPELMREDVQFVMLGSGDPIFEGWMRSTESSYKDKFRGWVGFSVPVSHRITAGCDILL  533

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     +++
Sbjct  534  MPSRFEPCGLNQLYAMQYGTVPVVHGTGGLRDTVETFNPFGAKGEEGTGWAFSPLTVDKM  593

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            + AL   + T+R++K SWEGL KRGM +D +WDHAA+ YE++ 
Sbjct  594  LWALRTAMSTFREHKPSWEGLMKRGMTKDHTWDHAAEQYEQIF  636



>emb|CAB99209.1| starch synthase I-1 [Triticum aestivum]
Length=647

 Score =   280 bits (715),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 164/223 (74%), Gaps = 4/223 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  T  + +  +YS++ L +GK KCKA LQKELGLPVR DVPLIGFIGRLDYQKG+DLI 
Sbjct  415  WNPTTDKCLPHHYSVDDL-SGKAKCKAELQKELGLPVREDVPLIGFIGRLDYQKGIDLIK  473

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M EDVQ VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILL
Sbjct  474  MAIPELMREDVQFVMLGSGDPIFEGWMRSTESSYKDKFRGWVGFSVPVSHRITAGCDILL  533

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     +++
Sbjct  534  MPSRFEPCGLNQLYAMQYGTVPVVHGTGGLRDTVETFNPFGAKGEEGTGWAFSPLTVDKM  593

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            + AL   + T+R++K SWEGL KRGM +D +WDHAA+ YE++ 
Sbjct  594  LWALRTAMSTFREHKPSWEGLMKRGMTKDHTWDHAAEQYEQIF  636



>gb|AAD54661.1| starch synthase I [Triticum aestivum]
Length=647

 Score =   279 bits (714),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 164/223 (74%), Gaps = 4/223 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  T  + +  +YS++ L +GK KCKA LQKELGLPVR DVPLIGFIGRLDYQKG+DLI 
Sbjct  415  WNPTTDKCLPHHYSVDDL-SGKAKCKAELQKELGLPVREDVPLIGFIGRLDYQKGIDLIK  473

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M EDVQ VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILL
Sbjct  474  MAIPELMREDVQFVMLGSGDPIFEGWMRSTESSYKDKFRGWVGFSVPVSHRITAGCDILL  533

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     +++
Sbjct  534  MPSRFEPCGLNQLYAMQYGTVPVVHGTGGLRDTVETFNPFGAKGEEGTGWAFSPLTVDKM  593

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            + AL   + T+R++K SWEGL KRGM +D +WDHAA+ YE++ 
Sbjct  594  LWALRTAMSTFREHKPSWEGLMKRGMTKDHTWDHAAEQYEQIF  636



>pdb|4HLN|A Chain A, Structure Of Barley Starch Synthase I In Complex With 
Maltooligosaccharide
Length=633

 Score =   279 bits (713),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 164/223 (74%), Gaps = 4/223 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  T  + +  +YS++ L +GK KCKA LQ+ELGLPVR DVPLIGFIGRLDYQKG+DLI 
Sbjct  401  WNPTTDKCLPHHYSVDDL-SGKAKCKAELQRELGLPVREDVPLIGFIGRLDYQKGIDLIK  459

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M EDVQ VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILL
Sbjct  460  MAIPDLMREDVQFVMLGSGDPVFEGWMRSTESSYKDKFRGWVGFSVPVSHRITAGCDILL  519

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     E++
Sbjct  520  MPSRFEPCGLNQLYAMQYGTVPVVHGTGGLRDTVETFNPFGAKGEEGTGWAFSPLTVEKM  579

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            + AL   + T+R++K SWEGL KRGM +D +WDHAA+ YE++ 
Sbjct  580  LWALRTAISTFREHKPSWEGLMKRGMTKDHTWDHAAEQYEQIF  622



>ref|XP_003561063.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic [Brachypodium 
distachyon]
Length=656

 Score =   279 bits (714),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 166/223 (74%), Gaps = 4/223 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  T  + +  +YS++ L +GK KCKA LQKELGLP+RPD+PLIGFIGRLDYQKG+DLI 
Sbjct  424  WNPTMDKCLPYHYSVDDL-SGKAKCKAELQKELGLPIRPDIPLIGFIGRLDYQKGIDLIK  482

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M +DVQ VMLG+G P  E  +R  E  + DK RGWVGFS+  SHRITAG DILL
Sbjct  483  LAIPDLMRDDVQFVMLGSGDPVFEGWMRSTESSYKDKFRGWVGFSIPVSHRITAGCDILL  542

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNET---GLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  F+P+ +T   G GW F     +++
Sbjct  543  MPSRFEPCGLNQLYAMQYGTVPVVHETGGLRDTVQTFNPFGKTGEEGTGWAFSPLTVDKM  602

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            + AL   + T+R++K SWEGL KRGM +D +WDHAA+ YE++ 
Sbjct  603  LWALRTAMTTFREHKPSWEGLMKRGMSKDHTWDHAAEQYEQIF  645



>gb|AAF37876.1|AF234163_1 starch synthase I [Hordeum vulgare subsp. vulgare]
Length=643

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 164/223 (74%), Gaps = 4/223 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  T  + +  +YS++ L +GK KCKA LQ+ELGLPVR DVPLIGFIGRLDYQKG+DLI 
Sbjct  411  WNPTTDKCLPHHYSVDDL-SGKAKCKAELQRELGLPVREDVPLIGFIGRLDYQKGIDLIK  469

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M EDVQ VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILL
Sbjct  470  MAIPDLMREDVQFVMLGSGDPVFEGWMRSTESSYKDKFRGWVGFSVPVSHRITAGCDILL  529

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     E++
Sbjct  530  MPSRFEPCGLNQLYAMQYGTVPVVHGTGGLRDTVETFNPFGAKGEEGTGWAFSPLTVEKM  589

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            + AL   + T+R++K SWEGL KRGM +D +WDHAA+ YE++ 
Sbjct  590  LWALRTAISTFREHKPSWEGLMKRGMTKDHTWDHAAEQYEQIF  632



>gb|EAZ35910.1| hypothetical protein OsJ_20213 [Oryza sativa Japonica Group]
Length=641

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 163/223 (73%), Gaps = 4/223 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +  + +  +YS++ L +GK KCKA LQKELGLP+RPDVPLIGFIGRLDYQKG+DLI 
Sbjct  409  WNPSTDKFLPYHYSVDDL-SGKAKCKAELQKELGLPIRPDVPLIGFIGRLDYQKGIDLIK  467

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M +++Q VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILL
Sbjct  468  LAIPDLMRDNIQFVMLGSGDPGFEGWMRSTESGYRDKFRGWVGFSVPVSHRITAGCDILL  527

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     E++
Sbjct  528  MPSRFEPCGLNQLYAMQYGTVPVVHGTGGLRDTVENFNPFAEKGEQGTGWAFSPLTIEKM  587

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            + AL   + TYR++K SWEGL KRGM  D +WDHAA  YE++ 
Sbjct  588  LWALRMAISTYREHKSSWEGLMKRGMSSDFTWDHAASQYEQIF  630



>sp|Q0DEC8.1|SSY1_ORYSJ RecName: Full=Soluble starch synthase 1, chloroplastic/amyloplastic; 
AltName: Full=SSS 1; AltName: Full=Starch synthase I; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD67625.1| soluble starch synthase I precursor [Oryza sativa Japonica Group]
 dbj|BAG98759.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACY26076.1| starch synthase [Oryza sativa]
 gb|ACY56156.1| soluble starch synthase I [Oryza sativa Japonica Group]
 gb|ACY56157.1| soluble starch synthase I [Oryza sativa Japonica Group]
 gb|ACY56158.1| soluble starch synthase I [Oryza sativa Japonica Group]
 gb|ACY56159.1| soluble starch synthase I [Oryza sativa Japonica Group]
 gb|ACY56160.1| soluble starch synthase I [Oryza sativa Japonica Group]
 gb|ACY56161.1| soluble starch synthase I [Oryza sativa Japonica Group]
 gb|ACY56163.1| soluble starch synthase I [Oryza sativa Indica Group]
 gb|ACY56167.1| soluble starch synthase I [Oryza sativa Indica Group]
Length=641

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 163/223 (73%), Gaps = 4/223 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +  + +  +YS++ L +GK KCKA LQKELGLP+RPDVPLIGFIGRLDYQKG+DLI 
Sbjct  409  WNPSTDKFLPYHYSVDDL-SGKAKCKAELQKELGLPIRPDVPLIGFIGRLDYQKGIDLIK  467

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M +++Q VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILL
Sbjct  468  LAIPDLMRDNIQFVMLGSGDPGFEGWMRSTESGYRDKFRGWVGFSVPVSHRITAGCDILL  527

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     E++
Sbjct  528  MPSRFEPCGLNQLYAMQYGTVPVVHGTGGLRDTVENFNPFAEKGEQGTGWAFSPLTIEKM  587

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            + AL   + TYR++K SWEGL KRGM  D +WDHAA  YE++ 
Sbjct  588  LWALRMAISTYREHKSSWEGLMKRGMSSDFTWDHAASQYEQIF  630



>gb|ACY56162.1| soluble starch synthase I [Oryza sativa Indica Group]
 gb|ACY56165.1| soluble starch synthase I [Oryza sativa Indica Group]
 gb|ACY56166.1| soluble starch synthase I [Oryza sativa Indica Group]
 gb|ACY56169.1| soluble starch synthase I [Oryza sativa Indica Group]
Length=641

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 158/211 (75%), Gaps = 4/211 (2%)
 Frame = -2

Query  860  YSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDVQ  681
            YS++ L +GK KCKA LQKELGLP+RPDVPLIGFIGRLDYQKG+DLI  AIP +M +++Q
Sbjct  421  YSVDDL-SGKAKCKAELQKELGLPIRPDVPLIGFIGRLDYQKGIDLIKLAIPDLMRDNIQ  479

Query  680  VVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLNQ  501
             VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILLMPSRFEPCGLNQ
Sbjct  480  FVMLGSGDPGFEGWMRSTESGYRDKFRGWVGFSVPVSHRITAGCDILLMPSRFEPCGLNQ  539

Query  500  LYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQLIHALGNCLLTYR  330
            LYAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     E+++ AL   + TYR
Sbjct  540  LYAMQYGTVPVVHGTGGLRDTVENFNPFAEKGEQGTGWAFSPLTIEKMLWALRMAISTYR  599

Query  329  QYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            ++K SWEGL KRGM  D +WDHAA  YE++ 
Sbjct  600  EHKSSWEGLMKRGMSSDFTWDHAASQYEQIF  630



>sp|A2Y9M4.1|SSY1_ORYSI RecName: Full=Soluble starch synthase 1, chloroplastic/amyloplastic; 
AltName: Full=SSS 1; AltName: Full=Starch synthase I; 
Flags: Precursor [Oryza sativa Indica Group]
 gb|AAP56350.1| soluble starch synthase I precursor [Oryza sativa Indica Group]
 gb|EAY99784.1| hypothetical protein OsI_21771 [Oryza sativa Indica Group]
 gb|ACY56164.1| soluble starch synthase I [Oryza sativa Indica Group]
 gb|ACY56168.1| soluble starch synthase I [Oryza sativa Indica Group]
Length=641

 Score =   277 bits (708),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 163/223 (73%), Gaps = 4/223 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +  + +  +YS++ L +GK KCKA LQ+ELGLP+RPDVPLIGFIGRLDYQKG+DLI 
Sbjct  409  WNPSTDKFLPYHYSVDDL-SGKAKCKAELQEELGLPIRPDVPLIGFIGRLDYQKGIDLIK  467

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M +++Q VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILL
Sbjct  468  LAIPDLMRDNIQFVMLGSGDPGFEGWMRSTESGYRDKFRGWVGFSVPVSHRITAGCDILL  527

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     E++
Sbjct  528  MPSRFEPCGLNQLYAMQYGTVPVVHGTGGLRDTVENFNPFAEKGEQGTGWAFSPLTIEKM  587

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            + AL   + TYR++K SWEGL KRGM  D +WDHAA  YE++ 
Sbjct  588  LWALRMAISTYREHKSSWEGLMKRGMSSDFTWDHAASQYEQIF  630



>ref|XP_010671436.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic [Beta 
vulgaris subsp. vulgaris]
Length=705

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 161/218 (74%), Gaps = 7/218 (3%)
 Frame = -2

Query  872  VMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMG  693
            V  +YS++ L +GK +CKAALQKELGLP++PD PLIGFIGRLDYQKG+D+I EA+P +MG
Sbjct  479  VAASYSIDDL-SGKAQCKAALQKELGLPLKPDCPLIGFIGRLDYQKGIDIIQEAMPELMG  537

Query  692  EDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPC  513
            +D+Q VMLG+G    E  +R  E  + DK RGWVGFSV  SHRITAG DILLMPSRFEPC
Sbjct  538  DDLQFVMLGSGDSRYESWMRAAEIIYKDKFRGWVGFSVPISHRITAGCDILLMPSRFEPC  597

Query  512  GLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY------NETGLGWTFDRAEAEQLIHALG  351
            GLNQLYAM YGT+PVVHA GGLRDTV  ++PY      + TG GW F     E ++  L 
Sbjct  598  GLNQLYAMRYGTIPVVHATGGLRDTVETYNPYAVGPDGSGTGTGWAFSPLAKESMLTGLR  657

Query  350  NCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            N + TYR+YK SW GL KRGM QD +WD AA  YE+V 
Sbjct  658  NAMKTYREYKPSWVGLMKRGMQQDFTWDSAAALYEQVF  695



>ref|XP_008783180.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
isoform X3 [Phoenix dactylifera]
Length=463

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 159/218 (73%), Gaps = 5/218 (2%)
 Frame = -2

Query  878  RMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWM  699
            + +  +YS++ L +GK +CKAALQKELGL +RPD PLIGFIGRLDYQKG DLI  A+P +
Sbjct  236  KFIPFHYSIDDL-SGKAQCKAALQKELGLAIRPDCPLIGFIGRLDYQKGTDLIKLALPEL  294

Query  698  MGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFE  519
            + +D+Q +MLG+G PD E  +R  E  + +K RGWVGF+V  SHRITAG DILLMPSRFE
Sbjct  295  LQDDIQFIMLGSGDPDTEDWMRSAESTYREKFRGWVGFNVSISHRITAGCDILLMPSRFE  354

Query  518  PCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNET----GLGWTFDRAEAEQLIHALG  351
            PCGLNQLYAM YGTVPVVH  GGLRDTV  F P+ E     G GWTF     + ++ AL 
Sbjct  355  PCGLNQLYAMRYGTVPVVHCTGGLRDTVEDFHPFAEEGSGQGSGWTFSPLSKDSMLGALM  414

Query  350  NCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
              + T+R++K SWEGL KRGM +D +WD AA  YE++ 
Sbjct  415  MAIETFREHKSSWEGLMKRGMSRDFTWDSAAAQYEQIF  452



>ref|XP_010245296.1| PREDICTED: LOW QUALITY PROTEIN: granule-bound starch synthase 
2, chloroplastic/amyloplastic-like [Nelumbo nucifera]
Length=327

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 144/157 (92%), Gaps = 3/157 (2%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS+ETLQTGKP+CKAALQ+ELGLP++ +VPLIGFIG+LD+QKGVDLIAE+IPWM+ +DV
Sbjct  167  NYSVETLQTGKPQCKAALQRELGLPLQENVPLIGFIGKLDHQKGVDLIAESIPWMVDQDV  226

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q+VMLGTGRPDL+QLLR FE QH+DKVRGWVGFSVK +HRITAGA+ILLMPSRFEPCGLN
Sbjct  227  QLVMLGTGRPDLKQLLRYFESQHHDKVRGWVGFSVKMAHRITAGANILLMPSRFEPCGLN  286

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE---TGL  402
            QLYA SYGTVPVVH VGGLRD+V PFDP  E   TGL
Sbjct  287  QLYATSYGTVPVVHDVGGLRDSVQPFDPLAEFQATGL  323



>ref|XP_002321996.2| hypothetical protein POPTR_0015s01470g [Populus trichocarpa]
 gb|EEF06123.2| hypothetical protein POPTR_0015s01470g [Populus trichocarpa]
Length=649

 Score =   272 bits (696),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 166/224 (74%), Gaps = 5/224 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +  + +  NYS++ L +GK +CK ALQKELGLP++PD PLIGFIGRLDYQKG+DLI 
Sbjct  416  WNPSSDKHIASNYSVDDL-SGKVQCKIALQKELGLPIKPDCPLIGFIGRLDYQKGIDLIR  474

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             A P ++ +DVQ VMLG+G P  E  +R  E  + DK RGWVGF++  SH+ITAGADILL
Sbjct  475  WATPELLEDDVQFVMLGSGDPLYEDWMRATESTYKDKFRGWVGFNIPISHKITAGADILL  534

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGL----GWTFDRAEAEQ  369
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  FDPY++ GL    GW F     E 
Sbjct  535  MPSRFEPCGLNQLYAMRYGTVPVVHGTGGLRDTVQAFDPYSKGGLGEGTGWIFSPLSKES  594

Query  368  LIHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            ++ AL   ++TYR +K SWEG+ KRGM++D +W++AA +YE+V 
Sbjct  595  MLAALRVAIMTYRDHKSSWEGIMKRGMVKDSTWENAAVHYEQVF  638



>ref|XP_011044647.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic isoform 
X1 [Populus euphratica]
Length=645

 Score =   271 bits (694),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 165/224 (74%), Gaps = 5/224 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +  + +  NYS++ L +GK +CK ALQKELGLP++PD P+IGFIGRLDYQKG+DLI 
Sbjct  412  WNPSSDKHIASNYSVDDL-SGKVQCKIALQKELGLPIKPDCPMIGFIGRLDYQKGIDLIR  470

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             A P ++ +DVQ VMLG+G P  E  +R  E  + DK RGWVGF++  SH+ITAGADILL
Sbjct  471  WATPELLEDDVQFVMLGSGDPLYEDWMRATESTYKDKFRGWVGFNIPISHKITAGADILL  530

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGL----GWTFDRAEAEQ  369
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  FDPY++ GL    GW F     E 
Sbjct  531  MPSRFEPCGLNQLYAMRYGTVPVVHGTGGLRDTVQAFDPYSKGGLGEGTGWIFSPLSKES  590

Query  368  LIHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            ++ AL   ++TYR +K SWEG+ KRGM++D +W++AA  YE+V 
Sbjct  591  MLAALRVAIMTYRDHKSSWEGIMKRGMVRDSTWENAAVQYEQVF  634



>gb|AJG44455.1| soluble starch synthase [Lilium davidii var. unicolor]
Length=473

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 158/213 (74%), Gaps = 5/213 (2%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            +YS++ L +GK +CKAALQKELGLPVR D PLIGFIGRLDYQKG+D+I   +P +M +DV
Sbjct  251  HYSVDDL-SGKARCKAALQKELGLPVRNDCPLIGFIGRLDYQKGIDIIRLGMPELMQDDV  309

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q VMLG+G  D E  +R  E  + DK RGWVGF+V  SHRITAG DILLMPSRFEPCGLN
Sbjct  310  QFVMLGSGDSDTENWMRSAEAIYRDKFRGWVGFNVPVSHRITAGCDILLMPSRFEPCGLN  369

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE----TGLGWTFDRAEAEQLIHALGNCLLT  336
            QLYAM YGT+P+VH  GGLRDTV  F+P+       G GWTF     E ++ AL   + T
Sbjct  370  QLYAMRYGTIPIVHCTGGLRDTVENFNPFANGGEGQGTGWTFSPLSKESMLGALWLAIQT  429

Query  335  YRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            YR++K SWEGL KRGM QD +W+ AA +YE+V+
Sbjct  430  YREHKTSWEGLMKRGMSQDFTWNTAASHYEQVI  462



>gb|AAB02197.1| soluble starch synthase [Triticum aestivum]
Length=610

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 158/215 (73%), Gaps = 4/215 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  T  + +  +YS++ L +GK KCKA LQKELGLPVR DVPLIGFIGRLDYQKG+DLI 
Sbjct  269  WNPTTDKCLPHHYSVDDL-SGKAKCKAELQKELGLPVREDVPLIGFIGRLDYQKGIDLIK  327

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M EDVQ VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILL
Sbjct  328  MAIPELMREDVQFVMLGSGDPIFEGWMRSTESSYKDKFRGWVGFSVPVSHRITAGCDILL  387

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     +++
Sbjct  388  MPSRFEPCGLNQLYAMQYGTVPVVHGTGGLRDTVETFNPFGAKGEEGTGWAFSPLTVDKM  447

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHA  261
            + AL   + T+R++K SWEGL KRGM +D +WDHA
Sbjct  448  LWALRTAMSTFREHKPSWEGLMKRGMTKDHTWDHA  482



>ref|XP_009624828.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
isoform X4 [Nicotiana tomentosiformis]
Length=616

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 156/213 (73%), Gaps = 5/213 (2%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            +YS+  L +GK KCK ALQKELGLP+RPD PLIGFIGRLDYQKGVD+I  AIP +M +DV
Sbjct  394  HYSIRDL-SGKVKCKTALQKELGLPIRPDCPLIGFIGRLDYQKGVDIILSAIPELMQDDV  452

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q VMLG+G    E  +R  E    DK RGWVGF+V  SHRITAG DILLMPSRFEPCGLN
Sbjct  453  QFVMLGSGEKQYEDWMRHTENLFKDKFRGWVGFNVPVSHRITAGCDILLMPSRFEPCGLN  512

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE----TGLGWTFDRAEAEQLIHALGNCLLT  336
            QLYAM YGT+PVVH+ GGLRDTV  F+PY +     G GWTF     E+L+  L   + T
Sbjct  513  QLYAMRYGTIPVVHSTGGLRDTVKDFNPYAQEGEGEGTGWTFSPLSREKLLDTLKVAIST  572

Query  335  YRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            Y ++K SWEGL KRGM +D SW++AA  YE+V 
Sbjct  573  YIEHKSSWEGLMKRGMERDYSWENAAIQYEQVF  605



>gb|KEH35457.1| starch synthase 2/amyloplastic protein [Medicago truncatula]
Length=478

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 158/221 (71%), Gaps = 10/221 (5%)
 Frame = -2

Query  872  VMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMG  693
            +  +YS + L +GK KCK ALQKELGLPVRPD P+IGF+GRLDYQKG+DLI +AIP +M 
Sbjct  249  IASSYSADDL-SGKVKCKIALQKELGLPVRPDCPVIGFVGRLDYQKGIDLIRQAIPELMQ  307

Query  692  EDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPC  513
            +DVQ VMLG+G P  E  +R  E  + DK RGWVGF+V  SHRITAG DILLMPS FEPC
Sbjct  308  DDVQFVMLGSGNPIYEDWMRATESLYKDKFRGWVGFNVPVSHRITAGCDILLMPSTFEPC  367

Query  512  GLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---------NETGLGWTFDRAEAEQLIH  360
            GLNQLYAM YGT+PVVH  GGLRDTV  F+P+         N  G GWTF     E ++ 
Sbjct  368  GLNQLYAMRYGTIPVVHETGGLRDTVQNFNPFAGGSGAEGCNAEGTGWTFSPLTKESMLV  427

Query  359  ALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            AL   + TY ++K SWEGL KRGM +D +W+ AA  YE+++
Sbjct  428  ALRYAIQTYNEHKSSWEGLMKRGMTRDYTWEKAAAQYEQII  468



>ref|XP_010266555.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
[Nelumbo nucifera]
Length=775

 Score =   273 bits (697),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 158/212 (75%), Gaps = 5/212 (2%)
 Frame = -2

Query  860  YSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDVQ  681
            YS+  L  GK +CK+ALQKELGLPVRP+ P+IGFIGRLD QKG+DLI  AIP +M +D+Q
Sbjct  554  YSVHDL-AGKAQCKSALQKELGLPVRPECPMIGFIGRLDNQKGIDLIQSAIPELMQDDIQ  612

Query  680  VVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLNQ  501
             VMLG+G P  E  ++  E  + DK RGWVGF+V  SHRITAG DILLMPSRFEPCGLNQ
Sbjct  613  FVMLGSGDPQYEDWMKATESTYRDKFRGWVGFNVPISHRITAGCDILLMPSRFEPCGLNQ  672

Query  500  LYAMSYGTVPVVHAVGGLRDTVVPFDPY----NETGLGWTFDRAEAEQLIHALGNCLLTY  333
            LYAM YGTVPVVH+ GGLRDTV  F+PY    N+ G GWTF     E ++ AL   + TY
Sbjct  673  LYAMRYGTVPVVHSTGGLRDTVKNFNPYAKEGNDQGTGWTFSPLSKENMLAALRVAIRTY  732

Query  332  RQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            R++K SWEGL KRGM +D +WD+AA  YE+V 
Sbjct  733  REHKSSWEGLMKRGMERDCTWDNAAVQYEQVF  764



>ref|XP_009352031.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic-like 
[Pyrus x bretschneideri]
Length=644

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 157/213 (74%), Gaps = 5/213 (2%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            +YS + L +GK +CK ALQKELGLP+RPD PLIGF+GRLDYQKG+DLI   +P +M +DV
Sbjct  422  HYSADDL-SGKVQCKLALQKELGLPLRPDCPLIGFVGRLDYQKGIDLIQSGMPLLMEDDV  480

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q VMLG+G P  E  +R  E  + DK RGWVGF+V  SHRITAG DILLMPSRFEPCGLN
Sbjct  481  QFVMLGSGDPVCEDWMRAAEATYKDKFRGWVGFNVPVSHRITAGCDILLMPSRFEPCGLN  540

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE----TGLGWTFDRAEAEQLIHALGNCLLT  336
            QLYAM YGTVPVVH+ GGLRDTVV F+PY +     G GWTF     E ++ AL     T
Sbjct  541  QLYAMRYGTVPVVHSTGGLRDTVVNFNPYAQGGKGDGTGWTFSPLTKESMLAALKLACRT  600

Query  335  YRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            +R+YK SWEGL KRGM +D +W+ AA  YE+V 
Sbjct  601  FREYKPSWEGLMKRGMERDFTWESAAIKYEQVF  633



>ref|XP_011075969.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
[Sesamum indicum]
Length=647

 Score =   269 bits (688),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 162/231 (70%), Gaps = 7/231 (3%)
 Frame = -2

Query  911  SGTHC--WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQ  738
            +G  C  W  +    +   YS+  L +GK +CK +LQKELGLPVR D PLIGFIGRLDYQ
Sbjct  407  NGIDCNEWNPSRDEHIASQYSVHDL-SGKLECKISLQKELGLPVRSDCPLIGFIGRLDYQ  465

Query  737  KGVDLIAEAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRIT  558
            KG+D++  A+P +M ED+Q+VMLG+G    E  +R  E  + DK RGWVGF+V  SHRIT
Sbjct  466  KGIDILLSAVPDLMHEDIQLVMLGSGEKQYEDWMRHLEGIYKDKFRGWVGFNVPISHRIT  525

Query  557  AGADILLMPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGL----GWTF  390
            AG DIL+MPSRFEPCGLNQLYAM YGT+PVVH  GGLRDTV  FDPY   G+    GWTF
Sbjct  526  AGCDILIMPSRFEPCGLNQLYAMRYGTIPVVHHTGGLRDTVQNFDPYANEGIGEGTGWTF  585

Query  389  DRAEAEQLIHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
                 E L+ AL   + TY+++K SWEGL KRGM +D SWD AA  YE+V+
Sbjct  586  SPLTKENLLAALRTAVWTYKEHKSSWEGLMKRGMERDFSWDSAATQYEQVI  636



>ref|XP_004307998.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic [Fragaria 
vesca subsp. vesca]
Length=645

 Score =   269 bits (688),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 160/223 (72%), Gaps = 4/223 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +  + +  +YS   L +GK +CK ALQKELGLP+RPD PLIGFIGRLDYQKG+DLI 
Sbjct  413  WDPSTDKHIASHYSANDL-SGKVECKIALQKELGLPIRPDCPLIGFIGRLDYQKGIDLIQ  471

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
              IP +M EDVQ VMLG+G    +  +R  E  + DK RGWVGF+V  SHRITAG DILL
Sbjct  472  SGIPELMNEDVQFVMLGSGDVQCQDWMRLAEATYKDKFRGWVGFNVPVSHRITAGCDILL  531

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQL  366
            MPSRFEPCGLNQLYAM YGTVPVVH+ GGLRDTVV F+PY      G GWTF     E +
Sbjct  532  MPSRFEPCGLNQLYAMRYGTVPVVHSTGGLRDTVVNFNPYAPGGGEGTGWTFSPLTKESM  591

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            + AL   + TY++YK SW+GL KRGM +D +W+ AA  YE+V+
Sbjct  592  LAALRLAIRTYKEYKPSWDGLVKRGMEKDFTWESAAIQYEQVI  634



>ref|XP_009782631.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
[Nicotiana sylvestris]
Length=650

 Score =   269 bits (687),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 156/213 (73%), Gaps = 5/213 (2%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            +YS+  L +GK KCK ALQKELGLP+RPD PLIGFIGRLDYQKGVD+I  AIP +M +DV
Sbjct  428  HYSINDL-SGKVKCKTALQKELGLPIRPDCPLIGFIGRLDYQKGVDIILSAIPELMQDDV  486

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q VMLG+G    E  +R  E    DK RGWVGF+V  SHRITAG DILLMPSRFEPCGLN
Sbjct  487  QFVMLGSGEKQYENWMRHTENLFKDKFRGWVGFNVPVSHRITAGCDILLMPSRFEPCGLN  546

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE----TGLGWTFDRAEAEQLIHALGNCLLT  336
            QLYAM YGT+PVVH+ GGLRDTV  F+PY +     G GWTF     E+L+  L   + T
Sbjct  547  QLYAMRYGTIPVVHSTGGLRDTVKDFNPYAQEGEGEGTGWTFSPLSKEKLLDTLKVAIST  606

Query  335  YRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            Y ++K SWEGL KRGM +D SW++AA  YE+V 
Sbjct  607  YIEHKSSWEGLMKRGMERDYSWENAAIQYEQVF  639



>ref|XP_008380770.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic [Malus 
domestica]
Length=644

 Score =   269 bits (687),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 156/213 (73%), Gaps = 5/213 (2%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            +YS + L +GK +CK ALQKELGLP+RPD PLIGF+GRLDYQKG+DLI   +P +M +DV
Sbjct  422  HYSADDL-SGKVQCKLALQKELGLPLRPDCPLIGFVGRLDYQKGIDLIQSGMPQLMEDDV  480

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q VMLG+G P  E  +R  E  + DK RGWVGF+V  SHRITAG DILLMPSRFEPCGLN
Sbjct  481  QFVMLGSGDPVCEDWMRATEATYKDKFRGWVGFNVPVSHRITAGCDILLMPSRFEPCGLN  540

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE----TGLGWTFDRAEAEQLIHALGNCLLT  336
            QLYAM YGTVPVVH+ GGLRDTVV F+PY +     G GWTF     E ++ AL     T
Sbjct  541  QLYAMRYGTVPVVHSTGGLRDTVVNFNPYAQGGKGDGTGWTFSPLTKESMLAALKLACRT  600

Query  335  YRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            +R+YK SWEGL KRGM +D +W+ AA  YE V 
Sbjct  601  FREYKPSWEGLMKRGMERDFTWESAAIKYERVF  633



>ref|XP_008783179.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
isoform X2 [Phoenix dactylifera]
Length=620

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 159/218 (73%), Gaps = 5/218 (2%)
 Frame = -2

Query  878  RMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWM  699
            + +  +YS++ L +GK +CKAALQKELGL +RPD PLIGFIGRLDYQKG DLI  A+P +
Sbjct  393  KFIPFHYSIDDL-SGKAQCKAALQKELGLAIRPDCPLIGFIGRLDYQKGTDLIKLALPEL  451

Query  698  MGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFE  519
            + +D+Q +MLG+G PD E  +R  E  + +K RGWVGF+V  SHRITAG DILLMPSRFE
Sbjct  452  LQDDIQFIMLGSGDPDTEDWMRSAESTYREKFRGWVGFNVSISHRITAGCDILLMPSRFE  511

Query  518  PCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNET----GLGWTFDRAEAEQLIHALG  351
            PCGLNQLYAM YGTVPVVH  GGLRDTV  F P+ E     G GWTF     + ++ AL 
Sbjct  512  PCGLNQLYAMRYGTVPVVHCTGGLRDTVEDFHPFAEEGSGQGSGWTFSPLSKDSMLGALM  571

Query  350  NCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
              + T+R++K SWEGL KRGM +D +WD AA  YE++ 
Sbjct  572  MAIETFREHKSSWEGLMKRGMSRDFTWDSAAAQYEQIF  609



>gb|EMS47550.1| Starch synthase 1, chloroplastic/amyloplastic [Triticum urartu]
Length=549

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 153/210 (73%), Gaps = 7/210 (3%)
 Frame = -2

Query  845  LQTGKPKCKAALQKELGLPVRPDVPL----IGFIGRLDYQKGVDLIAEAIPWMMGEDVQV  678
            +   + KCKA LQKELGLPVR DVPL    IGFIGRLDYQKG+DLI  AIP +M EDVQ 
Sbjct  329  VTVSQAKCKAELQKELGLPVREDVPLLDSQIGFIGRLDYQKGIDLIKMAIPDLMREDVQF  388

Query  677  VMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLNQL  498
            VMLG+G P  E  +R  E  + DK RGWVGFSV  SHRITAG DILLMPSRFEPCGLNQL
Sbjct  389  VMLGSGDPVFEGWMRSTESSYKDKFRGWVGFSVPVSHRITAGCDILLMPSRFEPCGLNQL  448

Query  497  YAMSYGTVPVVHAVGGLRDTVVPFDPY---NETGLGWTFDRAEAEQLIHALGNCLLTYRQ  327
            YAM YGTVPVVH  GGLRDTV  F+P+    E G GW F     ++++ AL   + T+R+
Sbjct  449  YAMQYGTVPVVHGTGGLRDTVETFNPFGAKGEEGTGWAFSPLTVDKMLWALRTAMSTFRE  508

Query  326  YKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            +K SWEGL KRGM +D +WDHAA+ YE++ 
Sbjct  509  HKPSWEGLMKRGMTKDHTWDHAAEQYEQIF  538



>ref|XP_008783178.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
isoform X1 [Phoenix dactylifera]
Length=623

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 159/218 (73%), Gaps = 5/218 (2%)
 Frame = -2

Query  878  RMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWM  699
            + +  +YS++ L +GK +CKAALQKELGL +RPD PLIGFIGRLDYQKG DLI  A+P +
Sbjct  396  KFIPFHYSIDDL-SGKAQCKAALQKELGLAIRPDCPLIGFIGRLDYQKGTDLIKLALPEL  454

Query  698  MGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFE  519
            + +D+Q +MLG+G PD E  +R  E  + +K RGWVGF+V  SHRITAG DILLMPSRFE
Sbjct  455  LQDDIQFIMLGSGDPDTEDWMRSAESTYREKFRGWVGFNVSISHRITAGCDILLMPSRFE  514

Query  518  PCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNET----GLGWTFDRAEAEQLIHALG  351
            PCGLNQLYAM YGTVPVVH  GGLRDTV  F P+ E     G GWTF     + ++ AL 
Sbjct  515  PCGLNQLYAMRYGTVPVVHCTGGLRDTVEDFHPFAEEGSGQGSGWTFSPLSKDSMLGALM  574

Query  350  NCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
              + T+R++K SWEGL KRGM +D +WD AA  YE++ 
Sbjct  575  MAIETFREHKSSWEGLMKRGMSRDFTWDSAAAQYEQIF  612



>ref|XP_009624826.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009624827.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
isoform X3 [Nicotiana tomentosiformis]
Length=638

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 156/213 (73%), Gaps = 5/213 (2%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            +YS+  L +GK KCK ALQKELGLP+RPD PLIGFIGRLDYQKGVD+I  AIP +M +DV
Sbjct  416  HYSIRDL-SGKVKCKTALQKELGLPIRPDCPLIGFIGRLDYQKGVDIILSAIPELMQDDV  474

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q VMLG+G    E  +R  E    DK RGWVGF+V  SHRITAG DILLMPSRFEPCGLN
Sbjct  475  QFVMLGSGEKQYEDWMRHTENLFKDKFRGWVGFNVPVSHRITAGCDILLMPSRFEPCGLN  534

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE----TGLGWTFDRAEAEQLIHALGNCLLT  336
            QLYAM YGT+PVVH+ GGLRDTV  F+PY +     G GWTF     E+L+  L   + T
Sbjct  535  QLYAMRYGTIPVVHSTGGLRDTVKDFNPYAQEGEGEGTGWTFSPLSREKLLDTLKVAIST  594

Query  335  YRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            Y ++K SWEGL KRGM +D SW++AA  YE+V 
Sbjct  595  YIEHKSSWEGLMKRGMERDYSWENAAIQYEQVF  627



>ref|XP_009624825.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
isoform X2 [Nicotiana tomentosiformis]
Length=648

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 156/213 (73%), Gaps = 5/213 (2%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            +YS+  L +GK KCK ALQKELGLP+RPD PLIGFIGRLDYQKGVD+I  AIP +M +DV
Sbjct  426  HYSIRDL-SGKVKCKTALQKELGLPIRPDCPLIGFIGRLDYQKGVDIILSAIPELMQDDV  484

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q VMLG+G    E  +R  E    DK RGWVGF+V  SHRITAG DILLMPSRFEPCGLN
Sbjct  485  QFVMLGSGEKQYEDWMRHTENLFKDKFRGWVGFNVPVSHRITAGCDILLMPSRFEPCGLN  544

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE----TGLGWTFDRAEAEQLIHALGNCLLT  336
            QLYAM YGT+PVVH+ GGLRDTV  F+PY +     G GWTF     E+L+  L   + T
Sbjct  545  QLYAMRYGTIPVVHSTGGLRDTVKDFNPYAQEGEGEGTGWTFSPLSREKLLDTLKVAIST  604

Query  335  YRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            Y ++K SWEGL KRGM +D SW++AA  YE+V 
Sbjct  605  YIEHKSSWEGLMKRGMERDYSWENAAIQYEQVF  637



>ref|XP_009624824.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=650

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 156/213 (73%), Gaps = 5/213 (2%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            +YS+  L +GK KCK ALQKELGLP+RPD PLIGFIGRLDYQKGVD+I  AIP +M +DV
Sbjct  428  HYSIRDL-SGKVKCKTALQKELGLPIRPDCPLIGFIGRLDYQKGVDIILSAIPELMQDDV  486

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q VMLG+G    E  +R  E    DK RGWVGF+V  SHRITAG DILLMPSRFEPCGLN
Sbjct  487  QFVMLGSGEKQYEDWMRHTENLFKDKFRGWVGFNVPVSHRITAGCDILLMPSRFEPCGLN  546

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE----TGLGWTFDRAEAEQLIHALGNCLLT  336
            QLYAM YGT+PVVH+ GGLRDTV  F+PY +     G GWTF     E+L+  L   + T
Sbjct  547  QLYAMRYGTIPVVHSTGGLRDTVKDFNPYAQEGEGEGTGWTFSPLSREKLLDTLKVAIST  606

Query  335  YRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            Y ++K SWEGL KRGM +D SW++AA  YE+V 
Sbjct  607  YIEHKSSWEGLMKRGMERDYSWENAAIQYEQVF  639



>ref|XP_006350536.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic-like 
isoform X2 [Solanum tuberosum]
Length=641

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 159/227 (70%), Gaps = 5/227 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +    +  +YS+  L +GK +CK  LQKELGLP+RPD PLIGFIGRLDYQKGVD+I 
Sbjct  408  WNPSTDEHIASHYSINDL-SGKVQCKTDLQKELGLPIRPDCPLIGFIGRLDYQKGVDIIL  466

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M  DVQVVMLG+G    E  +R  E    DK R WVGF+V  SHRITAG DILL
Sbjct  467  SAIPELMQNDVQVVMLGSGEKQYEDWMRHTENLFKDKFRAWVGFNVPVSHRITAGCDILL  526

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY----NETGLGWTFDRAEAEQ  369
            MPSRFEPCGLNQLYAM YGT+P+VH+ GGLRDTV  F+PY    N  G GWTF    +E+
Sbjct  527  MPSRFEPCGLNQLYAMRYGTIPIVHSTGGLRDTVKDFNPYAQEGNGEGTGWTFSPLTSEK  586

Query  368  LIHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAA  228
            L+  L   + TY ++K SWEGL KRGM +D SW++AA  YE+V   A
Sbjct  587  LLDTLKLAIGTYTEHKSSWEGLMKRGMGRDYSWENAAVQYEQVFTWA  633



>ref|XP_010109255.1| hypothetical protein L484_011877 [Morus notabilis]
 gb|EXC21435.1| hypothetical protein L484_011877 [Morus notabilis]
Length=640

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 159/224 (71%), Gaps = 5/224 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +    +  +YS E L +GK +CK ALQKELGLPVRPD PLIGFIGRLDYQKG+DLI 
Sbjct  407  WNPSSDEHIAFHYSAEDL-SGKAQCKIALQKELGLPVRPDCPLIGFIGRLDYQKGIDLIQ  465

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
            +AIP +M +D+Q VMLG+G P  E+ +R  E  + DK RGWV F+V  SHRITAG DILL
Sbjct  466  QAIPELMQDDIQFVMLGSGDPRFEEWMRATESAYRDKFRGWVEFNVPISHRITAGCDILL  525

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY----NETGLGWTFDRAEAEQ  369
            MPSRFEPCGLNQLYAM YGT+PVVH  GGL DTV  F+PY    N  G GWTF     E 
Sbjct  526  MPSRFEPCGLNQLYAMRYGTIPVVHCTGGLGDTVETFNPYAQDGNGEGTGWTFSPLVKEN  585

Query  368  LIHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            ++ AL   + TYR++K SW+GL KR M +D +W+ AA  YE+V 
Sbjct  586  MLWALRVAISTYREHKSSWKGLMKRAMQKDFTWETAAMQYEQVF  629



>ref|XP_007220640.1| hypothetical protein PRUPE_ppa002686mg [Prunus persica]
 gb|EMJ21839.1| hypothetical protein PRUPE_ppa002686mg [Prunus persica]
Length=645

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 157/216 (73%), Gaps = 5/216 (2%)
 Frame = -2

Query  872  VMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMG  693
            +  +YS + L +GK +CK ALQKELGLP+RPD PLIGFIGRLDYQKG+DLI   +P +M 
Sbjct  420  IASHYSADDL-SGKVQCKLALQKELGLPIRPDCPLIGFIGRLDYQKGIDLIQSGMPQLME  478

Query  692  EDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPC  513
            +DVQ VMLG+G P  E  +R  E  + DK RGWVGF+V  SHRITAG DILLMPSRFEPC
Sbjct  479  DDVQFVMLGSGDPLCEDWMRAAEATYKDKFRGWVGFNVPVSHRITAGCDILLMPSRFEPC  538

Query  512  GLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE----TGLGWTFDRAEAEQLIHALGNC  345
            GLNQLYAM YGTVPVVH+ GGLRDTV+ F+PY +     G GWTF     E ++ AL   
Sbjct  539  GLNQLYAMRYGTVPVVHSTGGLRDTVLNFNPYAQGGQGDGTGWTFSPLTKESMLAALRLA  598

Query  344  LLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
              T+ +YK SWEGL KRGM +D +W+ AA  YE+V 
Sbjct  599  CRTFTEYKPSWEGLMKRGMERDFTWESAAVKYEQVF  634



>gb|KDO54223.1| hypothetical protein CISIN_1g006091mg [Citrus sinensis]
Length=576

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 160/216 (74%), Gaps = 5/216 (2%)
 Frame = -2

Query  872  VMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMG  693
            +  +YS++ L +GK +CK ALQKELGLP+RPD PLIGFIGRLDYQKG+DLI  A P ++ 
Sbjct  351  IASHYSIDDL-SGKVQCKIALQKELGLPIRPDCPLIGFIGRLDYQKGIDLIRLAAPEILA  409

Query  692  EDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPC  513
            +D+Q VMLG+G P  E  +R  E  + DK RGWVGF+V  SHRITAG DILLMPSRFEPC
Sbjct  410  DDIQFVMLGSGDPQFESWMRDTEATYKDKYRGWVGFNVPISHRITAGCDILLMPSRFEPC  469

Query  512  GLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY----NETGLGWTFDRAEAEQLIHALGNC  345
            GLNQLYAM YGT+PVVHA GGLRDTV  F+P+    +  G GW+F     E ++ AL   
Sbjct  470  GLNQLYAMRYGTIPVVHATGGLRDTVENFNPFAREGSGEGTGWSFLPLSEESMLTALRFA  529

Query  344  LLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            + TYR++K SWEGL +RGM +D +W++AA  YE+V 
Sbjct  530  IRTYREHKSSWEGLMRRGMEKDYTWENAAIQYEQVF  565



>ref|XP_004502658.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic-like 
isoform X2 [Cicer arietinum]
Length=648

 Score =   267 bits (683),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 158/221 (71%), Gaps = 10/221 (5%)
 Frame = -2

Query  872  VMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMG  693
            +  NYS + L +GK KCK ALQKELGLPVRPD PLIGF+GRLDYQKG+DLI +AIP +M 
Sbjct  419  IACNYSADDL-SGKVKCKIALQKELGLPVRPDCPLIGFVGRLDYQKGIDLIRQAIPELMQ  477

Query  692  EDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPC  513
            +DVQ VMLG+G P  E  +R  E  + D+ RGWVGF+V  SHRITAG DILLMPS FEPC
Sbjct  478  DDVQFVMLGSGNPIYEDWMRATELAYKDQFRGWVGFNVPVSHRITAGCDILLMPSTFEPC  537

Query  512  GLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---------NETGLGWTFDRAEAEQLIH  360
            GLNQLYAM YGT+PVVH  GGLRDTV  F+PY         N  G GWTF     E ++ 
Sbjct  538  GLNQLYAMRYGTIPVVHETGGLRDTVQTFNPYAEGSNAEGSNAEGTGWTFSPLTKESMLV  597

Query  359  ALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            AL   + T+ ++K SWEGL KRGM +D +W +AA  YE+++
Sbjct  598  ALRYAIQTFNEHKPSWEGLMKRGMTRDYTWVNAATQYEQII  638



>ref|XP_007508676.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20293.1| predicted protein [Bathycoccus prasinos]
Length=705

 Score =   268 bits (686),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 155/210 (74%), Gaps = 0/210 (0%)
 Frame = -2

Query  845  LQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDVQVVMLG  666
            +  GK +CK ALQ+ELGLP   +  L+GFIGRLD QKGVDLI ++  W     VQ+VMLG
Sbjct  496  IDGGKKQCKLALQRELGLPEDENALLMGFIGRLDDQKGVDLITDSEGWFRDNHVQLVMLG  555

Query  665  TGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLNQLYAMS  486
            +GR DLE  LR  E ++ DK+RGWVGFSVK +HRITA  D LLMPSRFEPCGLNQLYAM 
Sbjct  556  SGRDDLENALRGMEERNKDKIRGWVGFSVKMAHRITAACDCLLMPSRFEPCGLNQLYAMR  615

Query  485  YGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQLIHALGNCLLTYRQYKKSWEG  306
            YGTVP+VH+VGGLRDTV P+DP+N  G GW FD AE+  L   +G  L T+R +++S+ G
Sbjct  616  YGTVPIVHSVGGLRDTVQPYDPFNNAGTGWRFDSAESHLLRETMGYALGTFRDHRESFRG  675

Query  305  LQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            +Q RGM +D +WD AA+ YE+  + AKY W
Sbjct  676  IQMRGMEKDYTWDGAAEKYEDRFIDAKYSW  705



>ref|XP_004502657.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic-like 
isoform X1 [Cicer arietinum]
Length=642

 Score =   267 bits (682),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 158/221 (71%), Gaps = 10/221 (5%)
 Frame = -2

Query  872  VMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMG  693
            +  NYS + L +GK KCK ALQKELGLPVRPD PLIGF+GRLDYQKG+DLI +AIP +M 
Sbjct  413  IACNYSADDL-SGKVKCKIALQKELGLPVRPDCPLIGFVGRLDYQKGIDLIRQAIPELMQ  471

Query  692  EDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPC  513
            +DVQ VMLG+G P  E  +R  E  + D+ RGWVGF+V  SHRITAG DILLMPS FEPC
Sbjct  472  DDVQFVMLGSGNPIYEDWMRATELAYKDQFRGWVGFNVPVSHRITAGCDILLMPSTFEPC  531

Query  512  GLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---------NETGLGWTFDRAEAEQLIH  360
            GLNQLYAM YGT+PVVH  GGLRDTV  F+PY         N  G GWTF     E ++ 
Sbjct  532  GLNQLYAMRYGTIPVVHETGGLRDTVQTFNPYAEGSNAEGSNAEGTGWTFSPLTKESMLV  591

Query  359  ALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            AL   + T+ ++K SWEGL KRGM +D +W +AA  YE+++
Sbjct  592  ALRYAIQTFNEHKPSWEGLMKRGMTRDYTWVNAATQYEQII  632



>ref|XP_003602259.1| Soluble starch synthase [Medicago truncatula]
 gb|AES72510.1| starch synthase 2/amyloplastic protein [Medicago truncatula]
Length=655

 Score =   267 bits (682),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 158/221 (71%), Gaps = 10/221 (5%)
 Frame = -2

Query  872  VMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMG  693
            +  +YS + L +GK KCK ALQKELGLPVRPD P+IGF+GRLDYQKG+DLI +AIP +M 
Sbjct  426  IASSYSADDL-SGKVKCKIALQKELGLPVRPDCPVIGFVGRLDYQKGIDLIRQAIPELMQ  484

Query  692  EDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPC  513
            +DVQ VMLG+G P  E  +R  E  + DK RGWVGF+V  SHRITAG DILLMPS FEPC
Sbjct  485  DDVQFVMLGSGNPIYEDWMRATESLYKDKFRGWVGFNVPVSHRITAGCDILLMPSTFEPC  544

Query  512  GLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY---------NETGLGWTFDRAEAEQLIH  360
            GLNQLYAM YGT+PVVH  GGLRDTV  F+P+         N  G GWTF     E ++ 
Sbjct  545  GLNQLYAMRYGTIPVVHETGGLRDTVQNFNPFAGGSGAEGCNAEGTGWTFSPLTKESMLV  604

Query  359  ALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            AL   + TY ++K SWEGL KRGM +D +W+ AA  YE+++
Sbjct  605  ALRYAIQTYNEHKSSWEGLMKRGMTRDYTWEKAAAQYEQII  645



>ref|XP_012067140.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic [Jatropha 
curcas]
 gb|KDP42052.1| hypothetical protein JCGZ_03263 [Jatropha curcas]
Length=645

 Score =   267 bits (682),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 159/216 (74%), Gaps = 5/216 (2%)
 Frame = -2

Query  872  VMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMG  693
            +  +YS + L +GK +CK ALQKELGLPVRPD PLIGFIGRLDYQKG+DLI  A+P +M 
Sbjct  420  IAFHYSADDL-SGKVQCKIALQKELGLPVRPDCPLIGFIGRLDYQKGIDLIRWAVPELME  478

Query  692  EDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPC  513
            +D+Q VMLG+G    E+ +R  E  + DK RGWVGF+V  SHRITAG DILLMPSRFEPC
Sbjct  479  DDIQFVMLGSGDRLYEEWMRVSESTYRDKFRGWVGFNVPISHRITAGCDILLMPSRFEPC  538

Query  512  GLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE----TGLGWTFDRAEAEQLIHALGNC  345
            GLNQLYAM YGTVPVVH  GGLRDTV  FDP+ +     G GWTF     E ++ AL   
Sbjct  539  GLNQLYAMRYGTVPVVHGTGGLRDTVQTFDPFAQGGAGEGTGWTFSPLSKESMLSALRLA  598

Query  344  LLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            +LTYR +K SW+G+ KRGM +D +W++AA  YE+V 
Sbjct  599  ILTYRDHKASWDGIMKRGMQRDYTWENAAIQYEQVF  634



>gb|KDO54222.1| hypothetical protein CISIN_1g006091mg [Citrus sinensis]
Length=662

 Score =   267 bits (682),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 162/224 (72%), Gaps = 5/224 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +    +  +YS++ L +GK +CK ALQKELGLP+RPD PLIGFIGRLDYQKG+DLI 
Sbjct  429  WNPSSDEHIASHYSIDDL-SGKVQCKIALQKELGLPIRPDCPLIGFIGRLDYQKGIDLIR  487

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             A P ++ +D+Q VMLG+G P  E  +R  E  + DK RGWVGF+V  SHRITAG DILL
Sbjct  488  LAAPEILADDIQFVMLGSGDPQFESWMRDTEATYKDKYRGWVGFNVPISHRITAGCDILL  547

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY----NETGLGWTFDRAEAEQ  369
            MPSRFEPCGLNQLYAM YGT+PVVHA GGLRDTV  F+P+    +  G GW+F     E 
Sbjct  548  MPSRFEPCGLNQLYAMRYGTIPVVHATGGLRDTVENFNPFAREGSGEGTGWSFLPLSEES  607

Query  368  LIHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            ++ AL   + TYR++K SWEGL +RGM +D +W++AA  YE+V 
Sbjct  608  MLTALRFAIRTYREHKSSWEGLMRRGMEKDYTWENAAIQYEQVF  651



>ref|XP_006493328.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic-like 
[Citrus sinensis]
 ref|XP_006494844.1| PREDICTED: starch synthase 1, chloroplastic/amyloplastic-like 
[Citrus sinensis]
Length=662

 Score =   266 bits (681),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 162/224 (72%), Gaps = 5/224 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +    +  +YS++ L +GK +CK ALQKELGLP+RPD PLIGFIGRLD+QKG+DLI 
Sbjct  429  WNPSSDEHIASHYSIDDL-SGKVQCKIALQKELGLPIRPDCPLIGFIGRLDHQKGIDLIR  487

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             A P ++ +DVQ VMLG+G P  E  +R  E  + DK RGWVGF+V  SHRITAG DILL
Sbjct  488  LAAPEILADDVQFVMLGSGDPQFESWMRDTEATYKDKYRGWVGFNVPISHRITAGCDILL  547

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY----NETGLGWTFDRAEAEQ  369
            MPSRFEPCGLNQLYAM YGT+PVVHA GGLRDTV  F+P+    +  G GW+F     E 
Sbjct  548  MPSRFEPCGLNQLYAMRYGTIPVVHATGGLRDTVENFNPFAREGSGEGTGWSFSPLSEES  607

Query  368  LIHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            ++ AL   + TYR++K SWEGL +RGM +D +W++AA  YE+V 
Sbjct  608  MLTALRFAIRTYREHKSSWEGLMRRGMEKDYTWENAAIQYEQVF  651



>ref|NP_001275074.1| soluble starch synthase 1, chloroplastic/amyloplastic [Solanum 
tuberosum]
 sp|P93568.1|SSY1_SOLTU RecName: Full=Soluble starch synthase 1, chloroplastic/amyloplastic; 
AltName: Full=Soluble starch synthase I; Short=SS I; 
Flags: Precursor [Solanum tuberosum]
 emb|CAA71442.1| soluble starch (bacterial glycogen) synthase [Solanum tuberosum]
Length=641

 Score =   266 bits (680),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 160/227 (70%), Gaps = 5/227 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +    +  +YS+  L +GK +CK  LQKELGLP+RPD PLIGFIGRLDYQKGVD+I 
Sbjct  408  WNPSTDEHIASHYSINDL-SGKVQCKTDLQKELGLPIRPDCPLIGFIGRLDYQKGVDIIL  466

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M  DVQVVMLG+G    E  +R  E    DK R WVGF+V  SHRITAG DILL
Sbjct  467  SAIPELMQNDVQVVMLGSGEKQYEDWMRHTENLFKDKFRAWVGFNVPVSHRITAGCDILL  526

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGL----GWTFDRAEAEQ  369
            MPSRFEPCGLNQLYAM YGT+P+VH+ GGLRDTV  F+PY + G+    GWTF    +E+
Sbjct  527  MPSRFEPCGLNQLYAMRYGTIPIVHSTGGLRDTVKDFNPYAQEGIGEGTGWTFSPLTSEK  586

Query  368  LIHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAA  228
            L+  L   + TY ++K SWEGL +RGM +D SW++AA  YE+V   A
Sbjct  587  LLDTLKLAIGTYTEHKSSWEGLMRRGMGRDYSWENAAIQYEQVFTWA  633



>ref|XP_006852610.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
[Amborella trichopoda]
 gb|ERN14077.1| hypothetical protein AMTR_s00021p00224370 [Amborella trichopoda]
Length=634

 Score =   266 bits (679),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 161/231 (70%), Gaps = 10/231 (4%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W     R +   YS+  L +GK +CK ALQKELGL VRPDVPL+GFIGRLDYQKGVDLI 
Sbjct  399  WNPVSDRHISCQYSVIDL-SGKAECKLALQKELGLAVRPDVPLVGFIGRLDYQKGVDLIR  457

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             ++  +M +DVQ +MLG+G PD+EQ +R  E  + DK RGWVGFSV  SHR+TAG DILL
Sbjct  458  SSLDELMQDDVQFIMLGSGDPDIEQWMRTAECNYRDKFRGWVGFSVPVSHRVTAGCDILL  517

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE----TGLGWTFDRAEAEQ  369
            MPSRFEPCGLNQLYAM YGTVPVVH  GGL+DTV  FDP+       G GW+F     E 
Sbjct  518  MPSRFEPCGLNQLYAMRYGTVPVVHGTGGLKDTVENFDPFANGGEGRGTGWSFSPLSKEA  577

Query  368  LIHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAKYQW  216
            ++  L     TYR+YK SWEG+ +RGM +D +W+ AA  YE+V     +QW
Sbjct  578  MLGTLRIATQTYREYKNSWEGIMRRGMERDYTWEKAAAQYEQV-----FQW  623



>gb|KJB37357.1| hypothetical protein B456_006G201600 [Gossypium raimondii]
Length=656

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 161/224 (72%), Gaps = 5/224 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +    +  +YS + L +GK +CK ALQ+ELGLP+RP+ PLIGFIGRLDYQKG+DLI 
Sbjct  423  WDSSSDEHISFHYSADDL-SGKARCKTALQQELGLPIRPECPLIGFIGRLDYQKGIDLIR  481

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP +M E+VQ VMLG+G P  E  +R  E  + DK RGWVGF+V  SHRITAG DILL
Sbjct  482  WAIPELMEENVQFVMLGSGDPLYEDWMRAAEKTYRDKFRGWVGFNVPISHRITAGCDILL  541

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY----NETGLGWTFDRAEAEQ  369
            MPSRFEPCGLNQL+AM YGTVPVVHA GGLRDTV  F+PY    +  G GWTF     E 
Sbjct  542  MPSRFEPCGLNQLFAMRYGTVPVVHATGGLRDTVENFNPYAGDRSGEGTGWTFSPLTKES  601

Query  368  LIHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            ++ AL   ++TYR +K +WE L +RGM +D +W+ AA +YE+V 
Sbjct  602  MLEALRTAIMTYRDHKSTWEALMRRGMQRDFTWETAAIHYEQVF  645



>dbj|BAL41367.1| soluble starch synthase I [Amaranthus cruentus]
Length=649

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 157/219 (72%), Gaps = 7/219 (3%)
 Frame = -2

Query  875  MVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMM  696
            ++   YS++ L +GK +CKAALQKELGLP++PD PLIGFIGRLDYQKG+D+I EA P +M
Sbjct  422  LIAAPYSVDDL-SGKAECKAALQKELGLPIKPDCPLIGFIGRLDYQKGIDVIQEAFPQLM  480

Query  695  GEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEP  516
             +DVQ VMLG+G    E  +R  E    DK RGWVGFSV  SHRITAG DILLMPSRFEP
Sbjct  481  EDDVQFVMLGSGDSRYESWMRAAEGACKDKFRGWVGFSVPISHRITAGCDILLMPSRFEP  540

Query  515  CGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY------NETGLGWTFDRAEAEQLIHAL  354
            CGLNQLYAM YGT+P+VH  GGLRDTV  ++P+        TG GW F     E ++ AL
Sbjct  541  CGLNQLYAMRYGTIPIVHNTGGLRDTVETYNPFAVGPDGTGTGTGWAFSPLTKESMLSAL  600

Query  353  GNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
             N + TYR YK+SW GL KRGM QD +WD AA  YE+V 
Sbjct  601  SNAVRTYRDYKESWAGLMKRGMQQDFTWDTAAAQYEQVF  639



>ref|XP_005644873.1| hypothetical protein COCSUDRAFT_30877 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20329.1| hypothetical protein COCSUDRAFT_30877 [Coccomyxa subellipsoidea 
C-169]
Length=596

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 158/227 (70%), Gaps = 0/227 (0%)
 Frame = -2

Query  905  THCWMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVD  726
             H W     + +   +S+     GK   KAALQKEL LP RP+VPLIGFIGRLDYQKG D
Sbjct  363  NHDWNPQHDKHLAQKFSVSNFSRGKAANKAALQKELDLPERPEVPLIGFIGRLDYQKGAD  422

Query  725  LIAEAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGAD  546
            L+   +PW+M +DVQ+V LGTG   LE  +R  E  + D+ RGWVGF+V  SH+ITA AD
Sbjct  423  LVLGVLPWLMEQDVQLVCLGTGDVSLEAGMRWMENTYPDRARGWVGFNVPMSHKITAAAD  482

Query  545  ILLMPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNETGLGWTFDRAEAEQL  366
            ILLMPSRFEPCGLNQLYAM+YGTVPV HA GGLRDTV+PF+P++ TG GWTF     +  
Sbjct  483  ILLMPSRFEPCGLNQLYAMAYGTVPVAHATGGLRDTVLPFNPWDGTGTGWTFSPCTTDAF  542

Query  365  IHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAAK  225
              AL N L T+R++  S++ LQ+RGM ++ +WD AA  YE +   AK
Sbjct  543  TGALRNTLETFREHPDSFKALQQRGMERNSTWDKAAAEYETIFGWAK  589



>ref|XP_010915976.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
isoform X5 [Elaeis guineensis]
Length=455

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 157/218 (72%), Gaps = 5/218 (2%)
 Frame = -2

Query  878  RMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWM  699
            + +  +YS++ L +GK  CKAALQKELGL +RPD PL+GFIGRLDYQKG DLI  A+P +
Sbjct  228  KYIPFHYSIDDL-SGKAPCKAALQKELGLAIRPDCPLVGFIGRLDYQKGTDLIRLALPEL  286

Query  698  MGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFE  519
            + +D+Q +MLG+G PD E  +R  E  + +K RGWVGF+V  SHRITAG DI LMPSRFE
Sbjct  287  LQDDIQFIMLGSGDPDTEDWMRSAESTYREKFRGWVGFNVPISHRITAGCDIFLMPSRFE  346

Query  518  PCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNET----GLGWTFDRAEAEQLIHALG  351
            PCGLNQLYAM YGTVPVVH  GGLRDTV  F P+ +     G GWTF     + ++ AL 
Sbjct  347  PCGLNQLYAMRYGTVPVVHCTGGLRDTVENFHPFAKEDSGQGTGWTFFPLSKDSMLGALR  406

Query  350  NCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
              + T+R+++ SWEGL KRGM +D +WD AA  YE++ 
Sbjct  407  FAIQTFREHRSSWEGLMKRGMSRDFTWDSAAAQYEQIF  444



>gb|AHW50660.1| starch synthase I [Lens culinaris]
Length=657

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 157/218 (72%), Gaps = 10/218 (5%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            NYS E L +GK KCK ALQKELGLPVRPD P+IGF+GRLDYQKG++LI +AIP +M +DV
Sbjct  431  NYSAEDL-SGKVKCKVALQKELGLPVRPDCPMIGFVGRLDYQKGIELIRQAIPELMQDDV  489

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q VMLG+G P  E  +R  E  + DK RGWVGF+V  SHRITAG DILLMPS FEPCGLN
Sbjct  490  QFVMLGSGNPIYEDWMRATESIYKDKFRGWVGFNVPVSHRITAGCDILLMPSTFEPCGLN  549

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPY---------NETGLGWTFDRAEAEQLIHALG  351
            QLYAM YGT+PVVH  GGLRDTV  F+P+         N  G GWTF     E ++ AL 
Sbjct  550  QLYAMRYGTIPVVHETGGLRDTVQNFNPFAVGSNAEGCNAEGTGWTFTPLTKESMLVALR  609

Query  350  NCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
              + T+ ++K SWEGL KRGM +D +W +AA  YE+++
Sbjct  610  YAIQTFNEHKSSWEGLIKRGMTRDYTWGNAATQYEQII  647



>gb|KHG22522.1| hypothetical protein F383_00713 [Gossypium arboreum]
Length=656

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 158/216 (73%), Gaps = 5/216 (2%)
 Frame = -2

Query  872  VMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMG  693
            V  +YS + L +GK +CK ALQ+ELGLP+RP+ PLIGFIGRLDYQKG+DLI  AIP +M 
Sbjct  431  VSFHYSADDL-SGKARCKTALQQELGLPIRPECPLIGFIGRLDYQKGIDLIRWAIPELME  489

Query  692  EDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPC  513
            ++VQ VMLG+G P  E  +R  E  + DK RGWVGF+V  SHRITAG DILLMPSRFEPC
Sbjct  490  DNVQFVMLGSGDPLYEDWMRAAEKTYRDKFRGWVGFNVPISHRITAGCDILLMPSRFEPC  549

Query  512  GLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPY----NETGLGWTFDRAEAEQLIHALGNC  345
            GLNQLYAM YGTVPVVH  GGLRDTV  F+PY    +  G GWTF     E ++ AL   
Sbjct  550  GLNQLYAMRYGTVPVVHTTGGLRDTVENFNPYAGDGSGEGTGWTFSPLTKESMLEALRTA  609

Query  344  LLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            ++TYR +K +WE L +RGM +D +W+ AA +YE+V 
Sbjct  610  IMTYRDHKSTWEALMRRGMQRDFTWETAAIHYEQVF  645



>gb|EYU25238.1| hypothetical protein MIMGU_mgv1a005697mg [Erythranthe guttata]
Length=474

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 153/213 (72%), Gaps = 5/213 (2%)
 Frame = -2

Query  863  NYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMGEDV  684
            +YS+  L + K +CK ALQKELGLPVR D PLIGFIGRLDYQKGVD+I   IP ++ +DV
Sbjct  252  HYSIHDL-SAKVQCKIALQKELGLPVRSDCPLIGFIGRLDYQKGVDIILTGIPELLQDDV  310

Query  683  QVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPCGLN  504
            Q VMLG+G    E  +RQ E  + DK RGWVGF+V  SHRITAG DIL+MPSRFEPCGLN
Sbjct  311  QFVMLGSGEKQYEDWMRQLEEVYKDKFRGWVGFNVPISHRITAGCDILVMPSRFEPCGLN  370

Query  503  QLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE----TGLGWTFDRAEAEQLIHALGNCLLT  336
            QLYAM YGT+PVVH+ GGLRDTV  FDPY +     G GW F     E L+  L   + T
Sbjct  371  QLYAMRYGTIPVVHSTGGLRDTVQTFDPYAKEGSGEGTGWAFSPLSKESLLATLRIAVGT  430

Query  335  YRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
            Y+++K SWEGL KRGM +D SWD AA  YE+V 
Sbjct  431  YKEHKPSWEGLMKRGMERDSSWDKAATQYEQVF  463



>ref|XP_008234756.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
[Prunus mume]
Length=643

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 156/216 (72%), Gaps = 5/216 (2%)
 Frame = -2

Query  872  VMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIAEAIPWMMG  693
            +  +YS + L +GK +CK ALQKELGLP+RPD PLIGFIGRLDYQKG+DLI   +P +M 
Sbjct  418  IASHYSADDL-SGKVQCKLALQKELGLPIRPDCPLIGFIGRLDYQKGIDLIQSGMPQLME  476

Query  692  EDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILLMPSRFEPC  513
            +DVQ VMLG+G P  E  +R  E  + DK RGWVGF+V  SHRITAG DILLMPSRFEPC
Sbjct  477  DDVQFVMLGSGDPLCEDWMRAAEATYKDKFRGWVGFNVPVSHRITAGCDILLMPSRFEPC  536

Query  512  GLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE----TGLGWTFDRAEAEQLIHALGNC  345
            GLNQLYAM YGTVPVVH+ GGLRDTV+ F+PY +     G GWTF     E ++ AL   
Sbjct  537  GLNQLYAMRYGTVPVVHSTGGLRDTVLNFNPYAQGGQGDGTGWTFSPLTKESMLAALRLA  596

Query  344  LLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVL  237
              T+ +YK SWEGL KR M +D +W+ AA  YE+V 
Sbjct  597  CRTFTEYKPSWEGLMKRCMERDFTWESAAVKYEQVF  632



>ref|XP_004234971.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
isoform X1 [Solanum lycopersicum]
 ref|XP_010318023.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
isoform X1 [Solanum lycopersicum]
Length=641

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 159/227 (70%), Gaps = 5/227 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +    +  +YS+  L +GK +CK  LQKELGLP+RPD PLIGFIGRLDYQKGVD+I 
Sbjct  408  WNPSTDEHIASHYSINDL-SGKAQCKTDLQKELGLPIRPDCPLIGFIGRLDYQKGVDIIL  466

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP ++ +DVQ VMLG+G    E  +R  E    DK R WVGF+V  SHRITAG DILL
Sbjct  467  SAIPELLQKDVQFVMLGSGEKQYEDWMRHTENLFKDKFRAWVGFNVPVSHRITAGCDILL  526

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE----TGLGWTFDRAEAEQ  369
            MPSRFEPCGLNQLYAM YGT+PVVH+ GGLRDTV  F+PY +     G GWTF    +E+
Sbjct  527  MPSRFEPCGLNQLYAMRYGTIPVVHSTGGLRDTVKDFNPYAQEGKGEGTGWTFSPLTSEK  586

Query  368  LIHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAA  228
            L+  L   + TY ++K SWEGL KRGM +D SW++AA  YE+V   A
Sbjct  587  LLDTLKLAIGTYTEHKSSWEGLMKRGMGRDYSWENAAIQYEQVFTWA  633



>ref|XP_010318024.1| PREDICTED: soluble starch synthase 1, chloroplastic/amyloplastic 
isoform X2 [Solanum lycopersicum]
Length=639

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 159/227 (70%), Gaps = 5/227 (2%)
 Frame = -2

Query  896  WMFT*SRMVMXNYSLETLQTGKPKCKAALQKELGLPVRPDVPLIGFIGRLDYQKGVDLIA  717
            W  +    +  +YS+  L +GK +CK  LQKELGLP+RPD PLIGFIGRLDYQKGVD+I 
Sbjct  406  WNPSTDEHIASHYSINDL-SGKAQCKTDLQKELGLPIRPDCPLIGFIGRLDYQKGVDIIL  464

Query  716  EAIPWMMGEDVQVVMLGTGRPDLEQLLRQFEYQHNDKVRGWVGFSVKTSHRITAGADILL  537
             AIP ++ +DVQ VMLG+G    E  +R  E    DK R WVGF+V  SHRITAG DILL
Sbjct  465  SAIPELLQKDVQFVMLGSGEKQYEDWMRHTENLFKDKFRAWVGFNVPVSHRITAGCDILL  524

Query  536  MPSRFEPCGLNQLYAMSYGTVPVVHAVGGLRDTVVPFDPYNE----TGLGWTFDRAEAEQ  369
            MPSRFEPCGLNQLYAM YGT+PVVH+ GGLRDTV  F+PY +     G GWTF    +E+
Sbjct  525  MPSRFEPCGLNQLYAMRYGTIPVVHSTGGLRDTVKDFNPYAQEGKGEGTGWTFSPLTSEK  584

Query  368  LIHALGNCLLTYRQYKKSWEGLQKRGMMQDLSWDHAAQNYEEVLVAA  228
            L+  L   + TY ++K SWEGL KRGM +D SW++AA  YE+V   A
Sbjct  585  LLDTLKLAIGTYTEHKSSWEGLMKRGMGRDYSWENAAIQYEQVFTWA  631



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2159265676996