BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8475

Length=646
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KCW68995.1|  hypothetical protein EUGRSUZ_F02555                     287   4e-93   Eucalyptus grandis [rose gum]
ref|XP_010061947.1|  PREDICTED: serine-threonine kinase receptor-...    286   3e-92   Eucalyptus grandis [rose gum]
ref|XP_008785422.1|  PREDICTED: serine-threonine kinase receptor-...    286   3e-92   Phoenix dactylifera
ref|XP_011040004.1|  PREDICTED: serine-threonine kinase receptor-...    285   8e-92   Populus euphratica
gb|EYU21599.1|  hypothetical protein MIMGU_mgv1a009096mg                285   9e-92   Erythranthe guttata [common monkey flower]
ref|XP_010688097.1|  PREDICTED: serine-threonine kinase receptor-...    284   2e-91   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006854996.1|  PREDICTED: serine-threonine kinase receptor-...    283   3e-91   Amborella trichopoda
ref|XP_010098976.1|  Serine-threonine kinase receptor-associated ...    283   3e-91   Morus notabilis
ref|XP_002303265.1|  transducin family protein                          283   6e-91   Populus trichocarpa [western balsam poplar]
ref|XP_011035638.1|  PREDICTED: serine-threonine kinase receptor-...    282   1e-90   Populus euphratica
ref|XP_002529368.1|  serine-threonine kinase receptor-associated ...    281   2e-90   Ricinus communis
gb|KHN27398.1|  Serine-threonine kinase receptor-associated protein     281   2e-90   Glycine soja [wild soybean]
ref|XP_003524526.1|  PREDICTED: serine-threonine kinase receptor-...    281   2e-90   Glycine max [soybeans]
ref|XP_002298116.1|  transducin family protein                          281   2e-90   Populus trichocarpa [western balsam poplar]
ref|XP_002517562.1|  serine-threonine kinase receptor-associated ...    281   2e-90   Ricinus communis
ref|XP_004287375.1|  PREDICTED: serine-threonine kinase receptor-...    281   2e-90   Fragaria vesca subsp. vesca
ref|XP_002284993.1|  PREDICTED: serine-threonine kinase receptor-...    281   2e-90   Vitis vinifera
ref|XP_007154947.1|  hypothetical protein PHAVU_003G160500g             281   3e-90   Phaseolus vulgaris [French bean]
ref|XP_011081111.1|  PREDICTED: serine-threonine kinase receptor-...    280   3e-90   Sesamum indicum [beniseed]
ref|XP_007202311.1|  hypothetical protein PRUPE_ppa008052mg             281   3e-90   Prunus persica
ref|XP_011072259.1|  PREDICTED: serine-threonine kinase receptor-...    280   6e-90   Sesamum indicum [beniseed]
gb|KJB70541.1|  hypothetical protein B456_011G079800                    276   7e-90   Gossypium raimondii
ref|XP_010545787.1|  PREDICTED: serine-threonine kinase receptor-...    280   7e-90   Tarenaya hassleriana [spider flower]
ref|XP_008385948.1|  PREDICTED: serine-threonine kinase receptor-...    280   8e-90   
ref|XP_010925262.1|  PREDICTED: serine-threonine kinase receptor-...    280   9e-90   Elaeis guineensis
ref|XP_008343948.1|  PREDICTED: serine-threonine kinase receptor-...    280   9e-90   
gb|ACU23446.1|  unknown                                                 280   9e-90   Glycine max [soybeans]
ref|XP_009347464.1|  PREDICTED: serine-threonine kinase receptor-...    279   1e-89   Pyrus x bretschneideri [bai li]
ref|XP_008337419.1|  PREDICTED: serine-threonine kinase receptor-...    275   2e-89   
ref|XP_008242709.1|  PREDICTED: serine-threonine kinase receptor-...    278   2e-89   Prunus mume [ume]
ref|XP_003549786.1|  PREDICTED: serine-threonine kinase receptor-...    278   3e-89   Glycine max [soybeans]
ref|XP_002885098.1|  transducin family protein                          278   3e-89   
ref|XP_006451011.1|  hypothetical protein CICLE_v10008796mg             278   3e-89   Citrus clementina [clementine]
gb|AFK46987.1|  unknown                                                 278   4e-89   Lotus japonicus
ref|XP_010254304.1|  PREDICTED: serine-threonine kinase receptor-...    278   6e-89   Nelumbo nucifera [Indian lotus]
ref|XP_010654727.1|  PREDICTED: serine-threonine kinase receptor-...    278   6e-89   Vitis vinifera
ref|XP_010249966.1|  PREDICTED: serine-threonine kinase receptor-...    277   7e-89   Nelumbo nucifera [Indian lotus]
ref|XP_008792113.1|  PREDICTED: serine-threonine kinase receptor-...    277   7e-89   Phoenix dactylifera
ref|XP_007013329.1|  Transducin/WD40 repeat-like superfamily prot...    277   7e-89   
ref|XP_008464982.1|  PREDICTED: serine-threonine kinase receptor-...    277   8e-89   Cucumis melo [Oriental melon]
ref|XP_004515599.1|  PREDICTED: serine-threonine kinase receptor-...    277   9e-89   Cicer arietinum [garbanzo]
gb|KJB70542.1|  hypothetical protein B456_011G079800                    275   9e-89   Gossypium raimondii
ref|XP_010487393.1|  PREDICTED: serine-threonine kinase receptor-...    277   1e-88   Camelina sativa [gold-of-pleasure]
ref|XP_002285272.1|  PREDICTED: serine-threonine kinase receptor-...    277   1e-88   Vitis vinifera
emb|CDY61819.1|  BnaC06g41840D                                          276   1e-88   Brassica napus [oilseed rape]
ref|XP_010465533.1|  PREDICTED: serine-threonine kinase receptor-...    276   1e-88   Camelina sativa [gold-of-pleasure]
gb|KEH37967.1|  Serine/Threonine kinase receptor-associated-like ...    277   1e-88   Medicago truncatula
gb|KHG15168.1|  Serine-threonine kinase receptor-associated             276   2e-88   Gossypium arboreum [tree cotton]
ref|XP_012078706.1|  PREDICTED: serine-threonine kinase receptor-...    276   2e-88   Jatropha curcas
ref|XP_007013330.1|  Transducin/WD40 repeat-like superfamily prot...    275   2e-88   
ref|XP_004146293.1|  PREDICTED: serine-threonine kinase receptor-...    276   2e-88   Cucumis sativus [cucumbers]
gb|KJB13091.1|  hypothetical protein B456_002G056400                    275   2e-88   Gossypium raimondii
ref|NP_566519.1|  transducin/WD40 domain-containing protein             276   3e-88   Arabidopsis thaliana [mouse-ear cress]
gb|KGN65408.1|  hypothetical protein Csa_1G418250                       276   3e-88   Cucumis sativus [cucumbers]
gb|KDO52915.1|  hypothetical protein CISIN_1g018784mg                   276   3e-88   Citrus sinensis [apfelsine]
gb|KHG01497.1|  Serine-threonine kinase receptor-associated             276   3e-88   Gossypium arboreum [tree cotton]
ref|XP_006465394.1|  PREDICTED: serine-threonine kinase receptor-...    276   4e-88   Citrus sinensis [apfelsine]
gb|KJB70540.1|  hypothetical protein B456_011G079800                    275   4e-88   Gossypium raimondii
gb|KJB54108.1|  hypothetical protein B456_009G020900                    275   4e-88   Gossypium raimondii
ref|XP_012073264.1|  PREDICTED: serine-threonine kinase receptor-...    275   5e-88   Jatropha curcas
ref|XP_006427175.1|  hypothetical protein CICLE_v10025975mg             275   6e-88   Citrus clementina [clementine]
ref|XP_009144818.1|  PREDICTED: serine-threonine kinase receptor-...    274   7e-88   Brassica rapa
ref|XP_009402893.1|  PREDICTED: serine-threonine kinase receptor-...    274   1e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006298067.1|  hypothetical protein CARUB_v10014111mg             274   1e-87   Capsella rubella
gb|KJB13093.1|  hypothetical protein B456_002G056400                    274   1e-87   Gossypium raimondii
gb|KFK38907.1|  hypothetical protein AALP_AA3G176400                    274   1e-87   Arabis alpina [alpine rockcress]
ref|XP_010542265.1|  PREDICTED: serine-threonine kinase receptor-...    273   2e-87   Tarenaya hassleriana [spider flower]
emb|CDX89958.1|  BnaA10g01240D                                          273   2e-87   
ref|XP_008337340.1|  PREDICTED: serine-threonine kinase receptor-...    273   2e-87   
ref|XP_009374067.1|  PREDICTED: serine-threonine kinase receptor-...    273   3e-87   Pyrus x bretschneideri [bai li]
gb|AFK34417.1|  unknown                                                 273   3e-87   Medicago truncatula
gb|KHG21144.1|  Serine-threonine kinase receptor-associated             273   3e-87   Gossypium arboreum [tree cotton]
ref|XP_010503217.1|  PREDICTED: serine-threonine kinase receptor-...    273   3e-87   Camelina sativa [gold-of-pleasure]
emb|CDY40132.1|  BnaC06g05570D                                          272   5e-87   Brassica napus [oilseed rape]
emb|CDY62165.1|  BnaA05g35670D                                          272   5e-87   Brassica napus [oilseed rape]
ref|XP_006406945.1|  hypothetical protein EUTSA_v10021071mg             272   7e-87   Eutrema salsugineum [saltwater cress]
ref|XP_009602512.1|  PREDICTED: serine-threonine kinase receptor-...    272   1e-86   Nicotiana tomentosiformis
ref|XP_007023961.1|  Transducin/WD40 repeat-like superfamily protein    272   1e-86   
ref|XP_009147669.1|  PREDICTED: serine-threonine kinase receptor-...    271   1e-86   Brassica rapa
ref|XP_006341669.1|  PREDICTED: serine-threonine kinase receptor-...    272   1e-86   Solanum tuberosum [potatoes]
emb|CDP03398.1|  unnamed protein product                                271   1e-86   Coffea canephora [robusta coffee]
gb|AGT15994.1|  hypothetical protein SHCRBa_159_J23_F_580               271   2e-86   Saccharum hybrid cultivar R570
ref|XP_004965966.1|  PREDICTED: serine-threonine kinase receptor-...    271   2e-86   Setaria italica
ref|XP_006392876.1|  hypothetical protein EUTSA_v10011626mg             271   2e-86   Eutrema salsugineum [saltwater cress]
ref|XP_010914940.1|  PREDICTED: serine-threonine kinase receptor-...    271   2e-86   Elaeis guineensis
ref|XP_002891712.1|  transducin family protein                          270   4e-86   
ref|XP_009770768.1|  PREDICTED: serine-threonine kinase receptor-...    268   5e-86   Nicotiana sylvestris
ref|NP_849800.1|  transducin/WD-40 repeat-containing protein            270   5e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500889.1|  PREDICTED: serine-threonine kinase receptor-...    270   5e-86   Camelina sativa [gold-of-pleasure]
ref|XP_004235719.1|  PREDICTED: serine-threonine kinase receptor-...    270   1e-85   Solanum lycopersicum
ref|XP_006305259.1|  hypothetical protein CARUB_v10009632mg             269   1e-85   Capsella rubella
ref|XP_009770767.1|  PREDICTED: serine-threonine kinase receptor-...    267   1e-85   Nicotiana sylvestris
ref|XP_002438635.1|  hypothetical protein SORBIDRAFT_10g023300          268   2e-85   Sorghum bicolor [broomcorn]
gb|EPS74468.1|  hypothetical protein M569_00279                         267   2e-85   Genlisea aurea
ref|XP_009760123.1|  PREDICTED: serine-threonine kinase receptor-...    269   2e-85   Nicotiana sylvestris
ref|NP_001142332.1|  LOC100274502                                       268   3e-85   Zea mays [maize]
gb|KJB64820.1|  hypothetical protein B456_010G066700                    267   7e-85   Gossypium raimondii
ref|NP_001046249.1|  Os02g0205400                                       266   9e-85   
ref|XP_009596073.1|  PREDICTED: serine-threonine kinase receptor-...    266   1e-84   Nicotiana tomentosiformis
ref|XP_002451748.1|  hypothetical protein SORBIDRAFT_04g007180          266   1e-84   Sorghum bicolor [broomcorn]
ref|NP_001288531.1|  uncharacterized protein LOC103629787               266   2e-84   Zea mays [maize]
ref|XP_009596074.1|  PREDICTED: serine-threonine kinase receptor-...    266   2e-84   Nicotiana tomentosiformis
gb|ACG31749.1|  serine-threonine kinase receptor-associated protein     266   2e-84   Zea mays [maize]
ref|XP_009388533.1|  PREDICTED: serine-threonine kinase receptor-...    265   3e-84   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS49047.1|  Serine-threonine kinase receptor-associated protein     265   3e-84   Triticum urartu
ref|XP_003563679.1|  PREDICTED: serine-threonine kinase receptor-...    265   3e-84   Brachypodium distachyon [annual false brome]
dbj|BAE46565.1|  putative WD-40 repeat protein                          264   6e-84   Nicotiana glutinosa
emb|CDO98105.1|  unnamed protein product                                264   1e-83   Coffea canephora [robusta coffee]
gb|EYU24671.1|  hypothetical protein MIMGU_mgv1a010043mg                263   1e-83   Erythranthe guttata [common monkey flower]
ref|XP_004951509.1|  PREDICTED: serine-threonine kinase receptor-...    264   1e-83   Setaria italica
dbj|BAJ97958.1|  predicted protein                                      264   1e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW87112.1|  serine-threonine kinase receptor-associated protein     268   2e-83   
ref|XP_006647058.1|  PREDICTED: serine-threonine kinase receptor-...    263   2e-83   Oryza brachyantha
emb|CCW03293.1|  similar to serine-threonine kinase receptor-asso...    263   3e-83   Lupinus angustifolius
ref|XP_006656206.1|  PREDICTED: serine-threonine kinase receptor-...    263   3e-83   Oryza brachyantha
ref|NP_001057997.1|  Os06g0598900                                       263   3e-83   
gb|EEC80916.1|  hypothetical protein OsI_23591                          261   4e-83   Oryza sativa Indica Group [Indian rice]
gb|KFK35774.1|  hypothetical protein AALP_AA4G034300                    262   5e-83   Arabis alpina [alpine rockcress]
dbj|BAJ92707.1|  predicted protein                                      262   5e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD32940.1|  putative WD-40 repeat protein                          262   5e-83   Oryza sativa Japonica Group [Japonica rice]
gb|EMT15935.1|  hypothetical protein F775_06783                         263   6e-83   
ref|XP_010537966.1|  PREDICTED: serine-threonine kinase receptor-...    258   1e-82   Tarenaya hassleriana [spider flower]
gb|EMT09457.1|  hypothetical protein F775_27621                         259   4e-82   
ref|XP_010537963.1|  PREDICTED: serine-threonine kinase receptor-...    258   6e-82   Tarenaya hassleriana [spider flower]
ref|XP_006305313.1|  hypothetical protein CARUB_v10009691mg             259   8e-82   Capsella rubella
ref|NP_563978.1|  transducin/WD40 repeat-like superfamily protein       256   7e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148941.1|  PREDICTED: serine-threonine kinase receptor-...    256   7e-81   Brassica rapa
emb|CDY39650.1|  BnaC05g11790D                                          256   9e-81   Brassica napus [oilseed rape]
ref|XP_010497185.1|  PREDICTED: serine-threonine kinase receptor-...    256   1e-80   Camelina sativa [gold-of-pleasure]
ref|XP_002890105.1|  transducin family protein                          256   1e-80   Arabidopsis lyrata subsp. lyrata
ref|XP_010476637.1|  PREDICTED: serine-threonine kinase receptor-...    255   2e-80   Camelina sativa [gold-of-pleasure]
gb|KJB27111.1|  hypothetical protein B456_004G278600                    254   2e-80   Gossypium raimondii
emb|CDY55992.1|  BnaA09g56870D                                          255   2e-80   Brassica napus [oilseed rape]
gb|KHG29669.1|  Serine-threonine kinase receptor-associated             254   3e-80   Gossypium arboreum [tree cotton]
ref|XP_009117826.1|  PREDICTED: serine-threonine kinase receptor-...    254   5e-80   Brassica rapa
ref|XP_006416902.1|  hypothetical protein EUTSA_v10008159mg             254   7e-80   Eutrema salsugineum [saltwater cress]
emb|CDX81717.1|  BnaC08g38840D                                          252   4e-79   
ref|XP_009596072.1|  PREDICTED: serine-threonine kinase receptor-...    252   1e-78   Nicotiana tomentosiformis
ref|XP_010459083.1|  PREDICTED: serine-threonine kinase receptor-...    251   1e-78   Camelina sativa [gold-of-pleasure]
ref|XP_009596070.1|  PREDICTED: serine-threonine kinase receptor-...    251   4e-78   Nicotiana tomentosiformis
ref|XP_009596071.1|  PREDICTED: serine-threonine kinase receptor-...    250   6e-78   Nicotiana tomentosiformis
ref|XP_008785435.1|  PREDICTED: serine-threonine kinase receptor-...    245   1e-76   Phoenix dactylifera
gb|KEH23437.1|  3-ketoacyl-CoA synthase                                 253   2e-75   Medicago truncatula
ref|XP_001756882.1|  predicted protein                                  226   8e-69   
ref|XP_008385958.1|  PREDICTED: serine-threonine kinase receptor-...    222   3e-68   
gb|AFK43194.1|  unknown                                                 218   5e-68   Medicago truncatula
gb|KCW68994.1|  hypothetical protein EUGRSUZ_F02555                     221   5e-68   Eucalyptus grandis [rose gum]
gb|KCW68993.1|  hypothetical protein EUGRSUZ_F02555                     220   4e-67   Eucalyptus grandis [rose gum]
ref|XP_001777192.1|  predicted protein                                  221   8e-67   
ref|XP_002977277.1|  hypothetical protein SELMODRAFT_151778             220   8e-67   Selaginella moellendorffii
ref|XP_002992164.1|  hypothetical protein SELMODRAFT_186588             220   8e-67   Selaginella moellendorffii
gb|KDO52917.1|  hypothetical protein CISIN_1g018784mg                   215   8e-66   Citrus sinensis [apfelsine]
gb|KDO52916.1|  hypothetical protein CISIN_1g018784mg                   214   4e-65   Citrus sinensis [apfelsine]
ref|XP_006465395.1|  PREDICTED: serine-threonine kinase receptor-...    213   6e-65   
emb|CAN67314.1|  hypothetical protein VITISV_014120                     217   1e-64   Vitis vinifera
ref|XP_006427174.1|  hypothetical protein CICLE_v10025975mg             213   1e-64   
gb|ABR25578.1|  serine-threonine kinase receptor-associated protein     200   5e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_006385489.1|  hypothetical protein POPTR_0003s05820g             177   1e-50   
ref|XP_005650326.1|  WD40 repeat-like protein                           170   1e-47   Coccomyxa subellipsoidea C-169
ref|XP_001419915.1|  predicted protein                                  169   1e-47   Ostreococcus lucimarinus CCE9901
emb|CEF99303.1|  G-protein beta WD-40 repeat                            169   2e-47   Ostreococcus tauri
ref|XP_007023909.1|  Transducin/WD40 repeat-like superfamily protein    162   1e-46   
ref|XP_007510202.1|  predicted protein                                  167   2e-46   Bathycoccus prasinos
ref|XP_003081517.1|  WD40 repeat protein (ISS)                          169   3e-45   
ref|XP_003055628.1|  predicted protein                                  159   1e-43   Micromonas pusilla CCMP1545
ref|XP_002503507.1|  predicted protein                                  156   2e-42   Micromonas commoda
ref|XP_637742.1|  WD40 repeat-containing protein                        149   1e-39   Dictyostelium discoideum AX4
ref|XP_005849411.1|  hypothetical protein CHLNCDRAFT_143924             145   6e-38   Chlorella variabilis
gb|KIZ04267.1|  serine-threonine kinase receptor-associated protein     143   2e-37   Monoraphidium neglectum
gb|AFK49343.1|  unknown                                                 138   2e-37   Lotus japonicus
ref|XP_001691265.1|  hypothetical protein CHLREDRAFT_128295             142   3e-37   Chlamydomonas reinhardtii
gb|EFA79493.1|  WD40 repeat-containing protein                          139   1e-35   Heterostelium album PN500
gb|ACO09706.1|  Serine-threonine kinase receptor-associated protein     139   1e-35   Osmerus mordax
gb|ESA22835.1|  hypothetical protein GLOINDRAFT_342473                  139   2e-35   
ref|XP_007577214.1|  PREDICTED: serine-threonine kinase receptor-...    138   2e-35   Poecilia formosa
ref|XP_008399465.1|  PREDICTED: serine-threonine kinase receptor-...    137   4e-35   Poecilia reticulata
ref|XP_002949849.1|  hypothetical protein VOLCADRAFT_80852              137   4e-35   Volvox carteri f. nagariensis
ref|XP_004564827.1|  PREDICTED: serine-threonine kinase receptor-...    137   5e-35   Maylandia zebra
ref|XP_010882092.1|  PREDICTED: serine-threonine kinase receptor-...    137   8e-35   Esox lucius
ref|XP_008314236.1|  PREDICTED: serine-threonine kinase receptor-...    137   8e-35   Cynoglossus semilaevis [half-smooth tongue sole]
ref|NP_956598.1|  serine-threonine kinase receptor-associated pro...    136   9e-35   Danio rerio [leopard danio]
ref|XP_006633224.1|  PREDICTED: serine-threonine kinase receptor-...    136   1e-34   Lepisosteus oculatus
ref|XP_010740062.1|  PREDICTED: serine-threonine kinase receptor-...    135   2e-34   Larimichthys crocea [croceine croaker]
ref|XP_005454109.1|  PREDICTED: serine-threonine kinase receptor-...    135   3e-34   
gb|EXX68237.1|  Tif34p                                                  134   4e-34   Rhizophagus irregularis DAOM 197198w
emb|CDQ67406.1|  unnamed protein product                                134   5e-34   Oncorhynchus mykiss
ref|XP_003487985.1|  PREDICTED: serine-threonine kinase receptor-...    134   5e-34   Bombus impatiens
ref|XP_003402993.1|  PREDICTED: serine-threonine kinase receptor-...    134   6e-34   Bombus terrestris [large earth bumblebee]
ref|XP_011270254.1|  hypothetical protein CAOG_08643                    134   6e-34   Capsaspora owczarzaki ATCC 30864
ref|XP_008288513.1|  PREDICTED: serine-threonine kinase receptor-...    134   6e-34   Stegastes partitus
ref|XP_008288505.1|  PREDICTED: serine-threonine kinase receptor-...    134   9e-34   Stegastes partitus
gb|AAK01368.1|  serine-threonine kinase receptor-associated protein     133   1e-33   Carassius gibelio [gibel carp]
ref|XP_004082930.1|  PREDICTED: serine-threonine kinase receptor-...    133   2e-33   Oryzias latipes [Japanese rice fish]
ref|XP_010773038.1|  PREDICTED: serine-threonine kinase receptor-...    132   3e-33   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_004360523.1|  WD40 repeat-containing protein                     132   4e-33   Cavenderia fasciculata
dbj|GAM26537.1|  hypothetical protein SAMD00019534_097120               131   5e-33   Acytostelium subglobosum LB1
ref|XP_010885258.1|  PREDICTED: serine-threonine kinase receptor-...    132   5e-33   Esox lucius
ref|NP_001279558.1|  serine/threonine kinase receptor associated ...    131   8e-33   Callorhinchus milii [Australian ghost shark]
ref|XP_396504.1|  PREDICTED: serine-threonine kinase receptor-ass...    131   1e-32   Apis mellifera [bee]
ref|XP_011873479.1|  PREDICTED: serine-threonine kinase receptor-...    129   2e-32   Vollenhovia emeryi
ref|XP_003294375.1|  WD40 repeat-containing protein                     129   2e-32   Dictyostelium purpureum
ref|XP_001624518.1|  predicted protein                                  127   2e-32   Nematostella vectensis
ref|XP_003972671.1|  PREDICTED: serine-threonine kinase receptor-...    130   2e-32   Takifugu rubripes [tiger puffer]
ref|NP_001090526.1|  serine/threonine kinase receptor associated ...    129   2e-32   Xenopus laevis [clawed frog]
ref|XP_011700897.1|  PREDICTED: serine-threonine kinase receptor-...    129   2e-32   Wasmannia auropunctata
ref|XP_006006111.1|  PREDICTED: serine-threonine kinase receptor-...    130   3e-32   Latimeria chalumnae
ref|XP_011873478.1|  PREDICTED: serine-threonine kinase receptor-...    130   3e-32   Vollenhovia emeryi
ref|XP_012145976.1|  PREDICTED: serine-threonine kinase receptor-...    129   4e-32   Megachile rotundata
ref|XP_011642000.1|  PREDICTED: serine-threonine kinase receptor-...    129   5e-32   Pogonomyrmex barbatus
ref|XP_011700896.1|  PREDICTED: serine-threonine kinase receptor-...    129   5e-32   Wasmannia auropunctata
ref|XP_011335793.1|  PREDICTED: serine-threonine kinase receptor-...    129   6e-32   Ooceraea biroi
ref|XP_007527681.1|  PREDICTED: serine-threonine kinase receptor-...    129   6e-32   Erinaceus europaeus [common hedgehog]
ref|XP_005805514.1|  PREDICTED: serine-threonine kinase receptor-...    129   6e-32   
ref|XP_008544371.1|  PREDICTED: serine-threonine kinase receptor-...    129   6e-32   Microplitis demolitor
gb|EPQ08116.1|  Serine-threonine kinase receptor-associated protein     128   8e-32   Myotis brandtii
ref|XP_003705564.1|  PREDICTED: serine-threonine kinase receptor-...    128   9e-32   Megachile rotundata
ref|XP_011052618.1|  PREDICTED: serine-threonine kinase receptor-...    128   1e-31   Acromyrmex echinatior
gb|KDR13003.1|  Serine-threonine kinase receptor-associated protein     129   1e-31   Zootermopsis nevadensis
ref|XP_012056282.1|  PREDICTED: serine-threonine kinase receptor-...    128   1e-31   Atta cephalotes
ref|XP_001361095.1|  GA17804                                            128   1e-31   Drosophila pseudoobscura pseudoobscura
ref|XP_011498271.1|  PREDICTED: serine-threonine kinase receptor-...    128   1e-31   Ceratosolen solmsi marchali
ref|XP_006084353.1|  PREDICTED: serine-threonine kinase receptor-...    128   2e-31   Myotis lucifugus
ref|XP_005866835.1|  PREDICTED: serine-threonine kinase receptor-...    128   2e-31   
gb|EMP35054.1|  Serine-threonine kinase receptor-associated protein     125   2e-31   Chelonia mydas [green seaturtle]
ref|NP_001087814.1|  serine/threonine kinase receptor associated ...    127   2e-31   Xenopus laevis [clawed frog]
ref|XP_004564826.1|  PREDICTED: serine-threonine kinase receptor-...    128   2e-31   Maylandia zebra
gb|KFH62158.1|  hypothetical protein MVEG_11797                         127   2e-31   Mortierella verticillata NRRL 6337
ref|XP_007942645.1|  PREDICTED: serine-threonine kinase receptor-...    126   2e-31   Orycteropus afer afer
ref|XP_002732021.1|  PREDICTED: serine-threonine kinase receptor-...    127   2e-31   Saccoglossus kowalevskii
ref|XP_969569.1|  PREDICTED: serine-threonine kinase receptor-ass...    127   2e-31   Tribolium castaneum [rust-red flour beetle]
ref|XP_004460359.1|  PREDICTED: serine-threonine kinase receptor-...    127   3e-31   Dasypus novemcinctus
ref|XP_007060631.1|  PREDICTED: serine-threonine kinase receptor-...    126   3e-31   
ref|XP_011560266.1|  PREDICTED: serine-threonine kinase receptor-...    127   3e-31   Plutella xylostella [cabbage moth]
ref|XP_004460360.1|  PREDICTED: serine-threonine kinase receptor-...    127   3e-31   Dasypus novemcinctus
ref|XP_005179105.1|  PREDICTED: serine-threonine kinase receptor-...    126   3e-31   Musca domestica
ref|XP_011150584.1|  PREDICTED: serine-threonine kinase receptor-...    127   3e-31   Harpegnathos saltator
ref|XP_001959831.1|  GF11838                                            127   3e-31   Drosophila ananassae
ref|NP_001120495.1|  serine/threonine kinase receptor associated ...    127   4e-31   Xenopus tropicalis [western clawed frog]
ref|XP_005253351.1|  PREDICTED: serine-threonine kinase receptor-...    125   4e-31   Homo sapiens [man]
ref|XP_006773325.1|  PREDICTED: serine-threonine kinase receptor-...    127   4e-31   Myotis davidii
ref|XP_005761541.1|  hypothetical protein EMIHUDRAFT_428205             126   4e-31   Emiliania huxleyi CCMP1516
ref|XP_004611421.1|  PREDICTED: serine-threonine kinase receptor-...    126   6e-31   Sorex araneus [Eurasian shrew]
ref|XP_007196086.1|  PREDICTED: serine-threonine kinase receptor-...    126   7e-31   Balaenoptera acutorostrata scammoni
ref|XP_005072957.1|  PREDICTED: serine-threonine kinase receptor-...    124   7e-31   
ref|XP_005179104.1|  PREDICTED: serine-threonine kinase receptor-...    126   8e-31   Musca domestica
ref|XP_007196085.1|  PREDICTED: serine-threonine kinase receptor-...    126   8e-31   Balaenoptera acutorostrata scammoni
gb|KFM64458.1|  Serine-threonine kinase receptor-associated protein     126   8e-31   Stegodyphus mimosarum
ref|XP_004693302.1|  PREDICTED: serine-threonine kinase receptor-...    126   1e-30   Condylura cristata
ref|XP_010212611.1|  PREDICTED: serine-threonine kinase receptor-...    125   1e-30   Tinamus guttatus
ref|XP_006866087.1|  PREDICTED: serine-threonine kinase receptor-...    126   1e-30   Chrysochloris asiatica
gb|KGL77017.1|  Serine-threonine kinase receptor-associated protein     125   1e-30   Tinamus guttatus
ref|XP_007105804.1|  PREDICTED: serine-threonine kinase receptor-...    125   1e-30   
ref|XP_004900757.1|  PREDICTED: serine-threonine kinase receptor-...    125   1e-30   
ref|NP_035629.2|  serine-threonine kinase receptor-associated pro...    125   1e-30   Mus musculus [mouse]
gb|AAC98300.1|  serine-threonine kinase receptor-associated protein     125   1e-30   Mus musculus [mouse]
ref|XP_007105805.1|  PREDICTED: serine-threonine kinase receptor-...    125   1e-30   
gb|EHB13154.1|  Serine-threonine kinase receptor-associated protein     126   1e-30   Heterocephalus glaber [naked mole rat]
ref|XP_011301387.1|  PREDICTED: serine-threonine kinase receptor-...    125   2e-30   Fopius arisanus
ref|XP_003934620.1|  PREDICTED: serine-threonine kinase receptor-...    125   2e-30   Saimiri boliviensis boliviensis
ref|XP_001986592.1|  GH20440                                            125   2e-30   Drosophila grimshawi
ref|XP_008854253.1|  PREDICTED: serine-threonine kinase receptor-...    125   2e-30   Nannospalax galili
ref|XP_008138676.1|  PREDICTED: serine-threonine kinase receptor-...    125   2e-30   Eptesicus fuscus
ref|NP_001011969.1|  serine-threonine kinase receptor-associated ...    125   2e-30   Rattus norvegicus [brown rat]
ref|XP_011263567.1|  PREDICTED: serine-threonine kinase receptor-...    125   2e-30   Camponotus floridanus
ref|XP_003405722.1|  PREDICTED: serine-threonine kinase receptor-...    125   2e-30   Loxodonta africana [African bush elephant]
ref|XP_005287566.1|  PREDICTED: serine-threonine kinase receptor-...    125   2e-30   Chrysemys picta bellii
ref|XP_004387406.1|  PREDICTED: serine-threonine kinase receptor-...    125   2e-30   Trichechus manatus latirostris
ref|XP_007942644.1|  PREDICTED: serine-threonine kinase receptor-...    125   3e-30   Orycteropus afer afer
ref|XP_006738772.1|  PREDICTED: serine-threonine kinase receptor-...    124   3e-30   Leptonychotes weddellii
gb|EFB27992.1|  hypothetical protein PANDA_007277                       124   3e-30   Ailuropoda melanoleuca
ref|XP_005207035.1|  PREDICTED: serine-threonine kinase receptor-...    124   3e-30   Bos taurus [bovine]
ref|XP_002918764.1|  PREDICTED: serine-threonine kinase receptor-...    124   3e-30   Ailuropoda melanoleuca
ref|XP_002712677.1|  PREDICTED: serine-threonine kinase receptor-...    124   3e-30   Oryctolagus cuniculus [domestic rabbit]
ref|XP_008065722.1|  PREDICTED: serine-threonine kinase receptor-...    124   3e-30   Carlito syrichta
ref|XP_009423197.1|  PREDICTED: serine-threonine kinase receptor-...    124   3e-30   Pan troglodytes
gb|EFZ20290.1|  hypothetical protein SINV_00798                         124   3e-30   
ref|XP_004713826.1|  PREDICTED: serine-threonine kinase receptor-...    124   3e-30   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_012030684.1|  PREDICTED: serine-threonine kinase receptor-...    124   3e-30   
ref|XP_003355612.1|  PREDICTED: serine-threonine kinase receptor-...    124   3e-30   Sus scrofa [pigs]
ref|XP_011156221.1|  PREDICTED: serine-threonine kinase receptor-...    124   4e-30   
ref|NP_001015567.1|  serine-threonine kinase receptor-associated ...    124   4e-30   
gb|AAV38848.1|  unr-interacting protein                                 124   4e-30   
ref|XP_543790.1|  PREDICTED: serine-threonine kinase receptor-ass...    124   4e-30   
ref|XP_006192161.1|  PREDICTED: serine-threonine kinase receptor-...    124   4e-30   
ref|XP_001497523.3|  PREDICTED: serine-threonine kinase receptor-...    124   4e-30   
ref|XP_010614344.1|  PREDICTED: serine-threonine kinase receptor-...    124   4e-30   
ref|XP_004435470.1|  PREDICTED: serine-threonine kinase receptor-...    124   4e-30   
ref|XP_008513820.1|  PREDICTED: serine-threonine kinase receptor-...    124   4e-30   
gb|ETE62118.1|  Serine-threonine kinase receptor-associated protein     125   4e-30   
ref|XP_005954904.1|  PREDICTED: serine-threonine kinase receptor-...    124   4e-30   
ref|XP_002752244.1|  PREDICTED: serine-threonine kinase receptor-...    124   4e-30   
emb|CAB66626.1|  hypothetical protein                                   124   4e-30   
ref|XP_008588001.1|  PREDICTED: serine-threonine kinase receptor-...    124   4e-30   
gb|AAX32050.1|  serine/threonine kinase receptor associated protein     124   4e-30   
gb|ELR47822.1|  Serine-threonine kinase receptor-associated protein     124   4e-30   
ref|XP_003906114.1|  PREDICTED: serine-threonine kinase receptor-...    124   4e-30   
ref|NP_009109.3|  serine-threonine kinase receptor-associated pro...    124   4e-30   
ref|XP_002823033.1|  PREDICTED: serine-threonine kinase receptor-...    124   4e-30   
ref|NP_001272106.1|  uncharacterized protein LOC101926115               124   4e-30   
dbj|BAA75544.1|  WD-40 repeat protein                                   124   4e-30   
ref|XP_003265599.1|  PREDICTED: serine-threonine kinase receptor-...    124   4e-30   
ref|XP_006130331.1|  PREDICTED: serine-threonine kinase receptor-...    124   4e-30   
ref|XP_001976425.1|  GG20020                                            124   4e-30   
ref|XP_005379078.1|  PREDICTED: serine-threonine kinase receptor-...    124   5e-30   
ref|XP_004281156.1|  PREDICTED: serine-threonine kinase receptor-...    124   5e-30   
ref|XP_007965964.1|  PREDICTED: serine-threonine kinase receptor-...    124   5e-30   
gb|AAX36803.1|  serine/threonine kinase receptor associated protein     124   5e-30   
ref|XP_006130330.1|  PREDICTED: serine-threonine kinase receptor-...    124   5e-30   
ref|XP_011396442.1|  Serine-threonine kinase receptor-associated ...    124   5e-30   
ref|XP_005379079.1|  PREDICTED: serine-threonine kinase receptor-...    124   5e-30   
ref|XP_011809840.1|  PREDICTED: serine-threonine kinase receptor-...    124   5e-30   
dbj|BAG60258.1|  unnamed protein product                                124   5e-30   
ref|XP_011846214.1|  PREDICTED: serine-threonine kinase receptor-...    124   5e-30   
ref|XP_003265600.1|  PREDICTED: serine-threonine kinase receptor-...    124   5e-30   
gb|EHH20553.1|  hypothetical protein EGK_03430                          124   6e-30   
ref|XP_010196813.1|  PREDICTED: serine-threonine kinase receptor-...    123   6e-30   
ref|XP_011809832.1|  PREDICTED: serine-threonine kinase receptor-...    124   6e-30   
gb|KFV79686.1|  Serine-threonine kinase receptor-associated protein     123   6e-30   
gb|ENN71163.1|  hypothetical protein YQE_12093                          123   7e-30   
ref|XP_004407033.1|  PREDICTED: serine-threonine kinase receptor-...    124   8e-30   
gb|EGW07522.1|  Serine-threonine kinase receptor-associated protein     123   8e-30   
ref|XP_010001239.1|  PREDICTED: serine-threonine kinase receptor-...    123   8e-30   
emb|CEG64490.1|  hypothetical protein RMATCC62417_01451                 122   8e-30   
gb|KFP30380.1|  Serine-threonine kinase receptor-associated protein     123   9e-30   
ref|XP_003470485.1|  PREDICTED: serine-threonine kinase receptor-...    123   9e-30   
dbj|BAC36834.1|  unnamed protein product                                123   1e-29   
ref|XP_009986298.1|  PREDICTED: serine-threonine kinase receptor-...    122   1e-29   
ref|NP_611804.1|  wing morphogenesis defect, isoform A                  123   1e-29   
gb|KFW77589.1|  Serine-threonine kinase receptor-associated protein     122   1e-29   
ref|XP_006167390.1|  PREDICTED: serine-threonine kinase receptor-...    123   1e-29   
ref|XP_005072956.1|  PREDICTED: serine-threonine kinase receptor-...    123   1e-29   
gb|KFU93601.1|  Serine-threonine kinase receptor-associated protein     122   1e-29   
gb|KFZ52756.1|  Serine-threonine kinase receptor-associated protein     122   1e-29   
gb|KFV02551.1|  Serine-threonine kinase receptor-associated protein     122   1e-29   
ref|XP_004636879.1|  PREDICTED: serine-threonine kinase receptor-...    122   1e-29   
gb|EOB03138.1|  Serine-threonine kinase receptor-associated protein     121   1e-29   
ref|XP_004626155.1|  PREDICTED: serine-threonine kinase receptor-...    123   1e-29   
ref|XP_007639831.1|  PREDICTED: serine-threonine kinase receptor-...    123   1e-29   
ref|XP_002155180.2|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
ref|XP_006976563.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
ref|XP_005017139.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
ref|XP_008918070.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
ref|XP_009941305.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
ref|XP_005234771.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
ref|XP_010283534.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
ref|XP_009647020.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
ref|XP_009469303.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
ref|XP_010160441.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
ref|XP_008642236.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
ref|XP_009498489.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
gb|KFP46563.1|  Serine-threonine kinase receptor-associated protein     122   2e-29   
ref|XP_010150775.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
gb|EFX76037.1|  hypothetical protein DAPPUDRAFT_306319                  122   2e-29   
ref|XP_009960882.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
ref|XP_009941306.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
gb|KFM07331.1|  Serine-threonine kinase receptor-associated protein     122   2e-29   
gb|KFW96058.1|  Serine-threonine kinase receptor-associated protein     122   2e-29   
ref|XP_006030930.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
gb|KFQ66986.1|  Serine-threonine kinase receptor-associated protein     122   2e-29   
ref|XP_007423037.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
gb|EIE82147.1|  hypothetical protein RO3G_06852                         122   2e-29   
ref|XP_008504145.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
ref|XP_010300389.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
gb|KFV93538.1|  Serine-threonine kinase receptor-associated protein     122   2e-29   
gb|KFR03659.1|  Serine-threonine kinase receptor-associated protein     122   2e-29   
gb|KFQ43384.1|  Serine-threonine kinase receptor-associated protein     122   2e-29   
gb|KFR17334.1|  Serine-threonine kinase receptor-associated protein     122   2e-29   
gb|KFO54453.1|  Serine-threonine kinase receptor-associated protein     122   2e-29   
ref|XP_002074661.1|  GK23046                                            122   2e-29   
gb|KFV39167.1|  Serine-threonine kinase receptor-associated protein     122   2e-29   
ref|XP_009670239.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
ref|XP_010078294.1|  PREDICTED: serine-threonine kinase receptor-...    121   2e-29   
gb|KFO10719.1|  Serine-threonine kinase receptor-associated protein     122   2e-29   
ref|XP_001600320.1|  PREDICTED: serine-threonine kinase receptor-...    122   2e-29   
ref|XP_003226007.1|  PREDICTED: serine-threonine kinase receptor-...    122   3e-29   
emb|CEG64489.1|  hypothetical protein RMATCC62417_01451                 121   3e-29   
ref|XP_009901096.1|  PREDICTED: serine-threonine kinase receptor-...    122   3e-29   
emb|CAG31560.1|  hypothetical protein RCJMB04_7p19                      122   3e-29   
ref|XP_005108804.1|  PREDICTED: serine-threonine kinase receptor-...    122   3e-29   
ref|NP_001006247.2|  serine-threonine kinase receptor-associated ...    122   3e-29   
ref|XP_009871765.1|  PREDICTED: serine-threonine kinase receptor-...    121   3e-29   
ref|XP_007454678.1|  PREDICTED: serine-threonine kinase receptor-...    122   3e-29   
ref|XP_009093404.1|  PREDICTED: serine-threonine kinase receptor-...    122   3e-29   
emb|CEP16447.1|  hypothetical protein                                   121   3e-29   
gb|KFV69096.1|  Serine-threonine kinase receptor-associated protein     122   3e-29   
gb|KFV00111.1|  Serine-threonine kinase receptor-associated protein     121   3e-29   
gb|KFZ45992.1|  Serine-threonine kinase receptor-associated protein     121   3e-29   
gb|KFP10993.1|  Serine-threonine kinase receptor-associated protein     121   3e-29   
ref|XP_005481923.1|  PREDICTED: serine-threonine kinase receptor-...    122   3e-29   
gb|KFP77957.1|  Serine-threonine kinase receptor-associated protein     121   3e-29   
ref|XP_007128060.1|  PREDICTED: serine-threonine kinase receptor-...    122   3e-29   
ref|XP_005425359.1|  PREDICTED: serine-threonine kinase receptor-...    121   3e-29   
ref|XP_009927393.1|  PREDICTED: serine-threonine kinase receptor-...    121   3e-29   
ref|XP_011434029.1|  PREDICTED: serine-threonine kinase receptor-...    119   3e-29   
ref|XP_010402481.1|  PREDICTED: serine-threonine kinase receptor-...    122   3e-29   
ref|XP_009093405.1|  PREDICTED: serine-threonine kinase receptor-...    122   3e-29   
ref|XP_002192073.1|  PREDICTED: serine-threonine kinase receptor-...    121   3e-29   
ref|XP_005040456.1|  PREDICTED: serine-threonine kinase receptor-...    121   4e-29   
ref|XP_005481924.1|  PREDICTED: serine-threonine kinase receptor-...    122   4e-29   
ref|XP_009072405.1|  PREDICTED: serine-threonine kinase receptor-...    121   4e-29   
ref|XP_010564424.1|  PREDICTED: serine-threonine kinase receptor-...    122   4e-29   
gb|EMC81744.1|  Serine-threonine kinase receptor-associated protein     122   4e-29   
gb|KFP70262.1|  Serine-threonine kinase receptor-associated protein     121   4e-29   
ref|XP_005364593.1|  PREDICTED: serine-threonine kinase receptor-...    122   4e-29   
ref|XP_005148197.1|  PREDICTED: serine-threonine kinase receptor-...    122   4e-29   
ref|XP_009568933.1|  PREDICTED: serine-threonine kinase receptor-...    122   4e-29   
gb|KFO70957.1|  Serine-threonine kinase receptor-associated protein     121   4e-29   
emb|CEG82446.1|  hypothetical protein RMATCC62417_16515                 120   5e-29   
gb|EKC40117.1|  Serine-threonine kinase receptor-associated protein     118   5e-29   
ref|XP_004525970.1|  PREDICTED: serine-threonine kinase receptor-...    120   6e-29   
ref|XP_002295040.1|  WD40-repeat protein                                120   7e-29   
ref|XP_011190917.1|  PREDICTED: serine-threonine kinase receptor-...    120   7e-29   
ref|XP_011207556.1|  PREDICTED: serine-threonine kinase receptor-...    120   7e-29   
emb|CEG82445.1|  hypothetical protein RMATCC62417_16515                 120   8e-29   
ref|XP_008473381.1|  PREDICTED: serine-threonine kinase receptor-...    121   8e-29   
ref|XP_002059888.1|  GJ14989                                            120   1e-28   
ref|XP_004932595.1|  PREDICTED: serine-threonine kinase receptor-...    119   1e-28   
gb|KFQ24876.1|  Serine-threonine kinase receptor-associated protein     120   1e-28   
ref|XP_010188075.1|  PREDICTED: serine-threonine kinase receptor-...    120   1e-28   
gb|ELU00352.1|  hypothetical protein CAPTEDRAFT_229092                  119   1e-28   
ref|XP_011207555.1|  PREDICTED: serine-threonine kinase receptor-...    120   1e-28   
gb|EPB83379.1|  hypothetical protein HMPREF1544_09854                   119   2e-28   
ref|XP_004588235.1|  PREDICTED: serine-threonine kinase receptor-...    120   2e-28   
ref|XP_004664503.1|  PREDICTED: serine-threonine kinase receptor-...    119   2e-28   
ref|XP_002607713.1|  hypothetical protein BRAFLDRAFT_82840              119   3e-28   
gb|EHJ68792.1|  putative serine-threonine kinase receptor-associa...    119   3e-28   
ref|XP_002004424.1|  GI19623                                            119   3e-28   
gb|AEW08684.1|  hypothetical protein CL1186Contig1_01                   112   4e-28   
ref|XP_002898038.1|  WD domain-containing protein, putative             119   4e-28   
ref|XP_001363811.1|  PREDICTED: serine-threonine kinase receptor-...    119   5e-28   
ref|XP_003771228.1|  PREDICTED: serine-threonine kinase receptor-...    118   6e-28   
ref|XP_009059987.1|  hypothetical protein LOTGIDRAFT_182822             118   6e-28   
ref|XP_009697962.1|  PREDICTED: LOW QUALITY PROTEIN: serine-threo...    118   7e-28   
emb|CAF96754.1|  unnamed protein product                                117   9e-28   
ref|XP_001950349.1|  PREDICTED: serine-threonine kinase receptor-...    117   1e-27   
ref|XP_002120914.1|  PREDICTED: serine-threonine kinase receptor-...    117   2e-27   
gb|ETM37382.1|  hypothetical protein L914_16063                         116   4e-27   
gb|ETI37286.1|  hypothetical protein F443_16714                         116   4e-27   
ref|XP_008911963.1|  hypothetical protein PPTG_15500                    116   4e-27   
emb|CCJ29855.1|  unnamed protein product                                115   8e-27   
ref|XP_005835567.1|  hypothetical protein GUITHDRAFT_86025              115   1e-26   
ref|XP_009009309.1|  hypothetical protein HELRODRAFT_184835             114   2e-26   
ref|XP_009527981.1|  hypothetical protein PHYSODRAFT_501150             112   9e-26   
ref|XP_004333795.1|  WD domain containing protein                       112   1e-25   
ref|XP_003386567.1|  PREDICTED: serine-threonine kinase receptor-...    111   1e-25   
ref|XP_001652721.1|  AAEL007382-PA                                      111   2e-25   
ref|XP_007875269.1|  hypothetical protein PNEG_03206                    111   2e-25   
emb|CCI45985.1|  unnamed protein product                                110   7e-25   
gb|ETL84191.1|  hypothetical protein L917_15952                         105   1e-24   
gb|KGB80355.1|  serine/threonine kinase receptor associated protein     109   1e-24   
gb|KIR37578.1|  serine-threonine kinase receptor-associated protein     109   1e-24   
emb|CCA21517.1|  WD domaincontaining protein putative                   108   2e-24   
ref|XP_003192460.1|  serine/threonine kinase receptor associated ...    109   2e-24   
gb|KIR57708.1|  serine-threonine kinase receptor-associated protein     108   2e-24   
gb|KIR83390.1|  serine-threonine kinase receptor-associated protein     108   2e-24   
gb|KIR44979.1|  serine-threonine kinase receptor-associated protein     108   2e-24   
ref|XP_012047728.1|  serine-threonine kinase receptor-associated ...    108   2e-24   
dbj|GAC99227.1|  hypothetical protein PHSY_006827                       108   2e-24   
ref|XP_568762.1|  serine/threonine kinase receptor associated pro...    108   3e-24   
ref|XP_001868161.1|  serine-threonine kinase receptor-associated ...    108   3e-24   
ref|XP_006958851.1|  WD40 repeat-like protein                           107   6e-24   
ref|XP_007881347.1|  hypothetical protein PFL1_05622                    107   6e-24   
gb|EJT48331.1|  serine/threonine kinase receptor associated protein     107   7e-24   
gb|ERL83460.1|  hypothetical protein D910_00452                         108   8e-24   
ref|XP_011114217.1|  hypothetical protein H072_8512                     106   8e-24   
emb|CBN75289.1|  conserved unknown protein                              106   9e-24   
gb|EST04926.1|  serine/threonine kinase receptor-associated protein     106   1e-23   
gb|KFO83365.1|  Serine-threonine kinase receptor-associated protein     103   1e-23   
gb|ACO12171.1|  Serine-threonine kinase receptor-associated protein     105   2e-23   
gb|ETN67896.1|  serine-threonine kinase receptor-associated protein     105   2e-23   
ref|XP_002182271.1|  predicted protein                                  105   3e-23   
gb|EWC48094.1|  hypothetical protein DRE_02673                          105   3e-23   
emb|CCX05695.1|  Similar to Serine-threonine kinase receptor-asso...    104   4e-23   
gb|KDO33140.1|  hypothetical protein SPRG_01952                         104   5e-23   
gb|KIM32040.1|  hypothetical protein M408DRAFT_327394                   104   7e-23   
ref|XP_009845437.1|  hypothetical protein H257_18127                    103   1e-22   
ref|XP_002425236.1|  serine-threonine kinase receptor-associated ...    103   1e-22   
ref|XP_008861257.1|  hypothetical protein H310_00302                    103   2e-22   
ref|XP_002111133.1|  hypothetical protein TRIADDRAFT_22326              102   2e-22   
ref|XP_004052881.1|  PREDICTED: serine-threonine kinase receptor-...    102   2e-22   
ref|XP_011389730.1|  hypothetical protein UMAG_03336                    102   2e-22   
gb|KFB48346.1|  AGAP005029-PA-like protein                              102   3e-22   
emb|CCF52049.1|  related to UNR-interacting protein STRAP (serine...    102   3e-22   
ref|XP_008612434.1|  hypothetical protein SDRG_08331                    102   4e-22   
gb|KDN52909.1|  WD40 repeat-like protein                                101   5e-22   
gb|KIO34763.1|  hypothetical protein M407DRAFT_240566                   101   5e-22   
ref|XP_001688468.1|  AGAP005029-PA                                      101   6e-22   
ref|XP_003740623.1|  PREDICTED: serine-threonine kinase receptor-...    101   7e-22   
emb|CCU99212.1|  unnamed protein product                                100   1e-21   
ref|XP_010131791.1|  PREDICTED: serine-threonine kinase receptor-...  98.2    1e-21   
emb|CCM02868.1|  predicted protein                                      100   1e-21   
gb|EJT96784.1|  WD40 repeat-like protein                                100   2e-21   
ref|XP_011125340.1|  hypothetical protein AOL_s00112g8                99.8    3e-21   
emb|CCO30117.1|  Serine-threonine kinase receptor-associated protein    100   3e-21   
emb|CBQ73736.1|  related to UNR-interacting protein STRAP (serine...  99.8    3e-21   
ref|XP_004326106.1|  PREDICTED: serine-threonine kinase receptor-...  97.4    3e-21   
gb|EHB01677.1|  Serine-threonine kinase receptor-associated protein   99.8    3e-21   
ref|XP_008945315.1|  PREDICTED: LOW QUALITY PROTEIN: serine-threo...  99.0    4e-21   
emb|CEL54246.1|  Serine-threonine kinase receptor-associated prot...  99.4    4e-21   
ref|XP_010537967.1|  PREDICTED: serine-threonine kinase receptor-...  97.1    7e-21   



>gb|KCW68995.1| hypothetical protein EUGRSUZ_F02555 [Eucalyptus grandis]
Length=308

 Score =   287 bits (734),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  90   RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  149

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G +FIAGGEDMWV
Sbjct  150  SEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCNIESASLEPKLGNKFIAGGEDMWV  209

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
             +FDFH GE+IGCNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP    +  A P 
Sbjct  210  HIFDFHTGEEIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPANNVEGDANPS  269

Query  104  KPKVXKXVXVEIDK  63
               V     V  D+
Sbjct  270  NGPVTGKAKVGADE  283



>ref|XP_010061947.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Eucalyptus grandis]
 gb|KCW68992.1| hypothetical protein EUGRSUZ_F02555 [Eucalyptus grandis]
Length=351

 Score =   286 bits (732),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G +FIAGGEDMWV
Sbjct  193  SEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCNIESASLEPKLGNKFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
             +FDFH GE+IGCNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP    +  A P 
Sbjct  253  HIFDFHTGEEIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPANNVEGDANPS  312

Query  104  KPKVXKXVXVEIDK  63
               V     V  D+
Sbjct  313  NGPVTGKAKVGADE  326



>ref|XP_008785422.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Phoenix dactylifera]
Length=343

 Score =   286 bits (731),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 159/189 (84%), Gaps = 5/189 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS  +V+TL+TKS VTS
Sbjct  133  RPDAPPREVDKSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGNIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F LVKSY+MPC VESASLEP+FG RFIAGGED+WV
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYNMPCTVESASLEPKFGNRFIAGGEDLWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP-----NEATDA  120
             +FDFH GEQI CNKGHHGPVHCVRFSP G+S  SGSEDGTIRIWQT P     NEAT A
Sbjct  253  HVFDFHSGEQITCNKGHHGPVHCVRFSPMGKSYASGSEDGTIRIWQTSPATADENEATGA  312

Query  119  SAGPXKPKV  93
            +    K KV
Sbjct  313  NGAAGKVKV  321



>ref|XP_011040004.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Populus euphratica]
Length=350

 Score =   285 bits (729),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVSRDG YITTADGS+VKFWDAN F LVKSYDMPCNVESASLEP+FG +F+AGGEDMW+
Sbjct  193  AEVSRDGRYITTADGSTVKFWDANHFGLVKSYDMPCNVESASLEPKFGNKFVAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             +FDFH GEQIGCNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQ GP
Sbjct  253  HVFDFHTGEQIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLGP  301



>gb|EYU21599.1| hypothetical protein MIMGU_mgv1a009096mg [Erythranthe guttata]
Length=353

 Score =   285 bits (729),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 162/196 (83%), Gaps = 0/196 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPPR+++  PGSVRT+AWLH+DQTIL SC+D  GVRLWD+R+  +VRTL+TKSSVTS
Sbjct  133  RSDAPPRELEKSPGSVRTIAWLHSDQTILGSCTDMGGVRLWDVRTGTIVRTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPC VESASLEP++G +FIAGGEDMW+
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCVVESASLEPKYGNKFIAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
            R+FDFH GE++GCNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP+   +      
Sbjct  253  RVFDFHTGEEVGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPSNNAEQEGSST  312

Query  104  KPKVXKXVXVEIDKXH  57
               V + +  EI+  H
Sbjct  313  VKDVSEEITREIENVH  328



>ref|XP_010688097.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Beta vulgaris subsp. vulgaris]
Length=352

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+R+ ++VRTL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQTILSSCTDIGGVRLWDVRNGQIVRTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITT DG+SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTCDGTSVKFWDANYFGLVKSYEMPCTVESASLEPKYGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            R+FDFH GE+I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP
Sbjct  253  RMFDFHTGEEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP  301



>ref|XP_006854996.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Amborella trichopoda]
 gb|ERN16463.1| hypothetical protein AMTR_s00052p00205770 [Amborella trichopoda]
Length=351

 Score =   283 bits (725),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 164/212 (77%), Gaps = 1/212 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
             P+APPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++VRTLDTKS VTS
Sbjct  133  HPEAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSAKIVRTLDTKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADG +VKFWDAN F LVKSY MPC VESASLEP+ G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGCTVKFWDANHFGLVKSYTMPCTVESASLEPKLGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDAS-AGP  108
            RLFDFH GE+I CNKGHHGPVHCVRFSP G+S  SGSEDGTIRIWQT P   +D S A P
Sbjct  253  RLFDFHTGEEIACNKGHHGPVHCVRFSPLGDSYASGSEDGTIRIWQTQPTTGSDESEALP  312

Query  107  XKPKVXKXVXVEIDKXHXAKGAXIDXDXXNEE  12
                  K   V  D  H  +G  I  +  +E+
Sbjct  313  ANGPSAKIKVVAEDVVHKIEGFHIASNVVDED  344



>ref|XP_010098976.1| Serine-threonine kinase receptor-associated protein [Morus notabilis]
 gb|EXB76278.1| Serine-threonine kinase receptor-associated protein [Morus notabilis]
Length=350

 Score =   283 bits (725),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 163/196 (83%), Gaps = 2/196 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSIRTVAWLHSDQTILSSCTDLGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPC VESASLEP++G +FIAGGEDMW+
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCTVESASLEPKYGNKFIAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP--NEATDASAG  111
            R+FDFH G +I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP  NE T+    
Sbjct  253  RVFDFHTGNEITCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTNEDTEVHGA  312

Query  110  PXKPKVXKXVXVEIDK  63
                   K +  E+ +
Sbjct  313  NGSTGKVKVIADEVSR  328



>ref|XP_002303265.1| transducin family protein [Populus trichocarpa]
 gb|EEE78244.1| transducin family protein [Populus trichocarpa]
Length=350

 Score =   283 bits (723),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVSRDG YITTADGS+VKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGGEDMW+
Sbjct  193  AEVSRDGRYITTADGSTVKFWDANHFGLVKSYDMPCNVESASLEPKLGNKFVAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             +FDFH GEQIGCNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQ GP
Sbjct  253  HVFDFHTGEQIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLGP  301



>ref|XP_011035638.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Populus euphratica]
Length=350

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCADIGGVRLWDIRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCNVESASLEP+FG +F+AGGEDMW+
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNVESASLEPKFGNKFVAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             +FDFH GEQIGCNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQ  P
Sbjct  253  HVFDFHTGEQIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLSP  301



>ref|XP_002529368.1| serine-threonine kinase receptor-associated protein, putative 
[Ricinus communis]
 gb|EEF33035.1| serine-threonine kinase receptor-associated protein, putative 
[Ricinus communis]
Length=350

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 167/206 (81%), Gaps = 6/206 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITT DGS+VKFWDAN F LVKSYDMPC VESASLEP++G +FIAGGEDMW+
Sbjct  193  AEVSQDGRYITTCDGSTVKFWDANHFGLVKSYDMPCTVESASLEPKYGNKFIAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP-----NEATDA  120
             +FDFH G++I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP      E   A
Sbjct  253  HVFDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLIQDDTEGLAA  312

Query  119  SAGPXKPKV-XKXVXVEIDKXHXAKG  45
            +    K KV  + V  +I+  H A G
Sbjct  313  NGSVGKVKVTAEEVTHKIEGFHIADG  338



>gb|KHN27398.1| Serine-threonine kinase receptor-associated protein [Glycine 
soja]
Length=352

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN + LVKSYDMPC VES SLEP++G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANYYGLVKSYDMPCTVESVSLEPKYGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            R+FDFH G +I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP
Sbjct  253  RVFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP  301



>ref|XP_003524526.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Glycine max]
Length=352

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN + LVKSYDMPC VES SLEP++G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANYYGLVKSYDMPCTVESVSLEPKYGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            R+FDFH G +I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP
Sbjct  253  RVFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP  301



>ref|XP_002298116.1| transducin family protein [Populus trichocarpa]
 gb|EEE82921.1| transducin family protein [Populus trichocarpa]
Length=350

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCADIGGVRLWDIRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCNVESASLEP+FG +F+AGGEDMW+
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNVESASLEPKFGNKFVAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             +FDFH GEQIGCNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQ  P
Sbjct  253  HVFDFHTGEQIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLSP  301



>ref|XP_002517562.1| serine-threonine kinase receptor-associated protein, putative 
[Ricinus communis]
 gb|EEF44726.1| serine-threonine kinase receptor-associated protein, putative 
[Ricinus communis]
Length=336

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR+++  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVNSSPGSIRTVAWLHSDQTILSSCTDMGGVRLWDIRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPCNVESASLEP+ G +F+AGGEDMW+
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCNVESASLEPKLGNKFVAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPN  135
             +FDFH GEQIGCNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQTGP 
Sbjct  253  HVFDFHTGEQIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQTGPQ  302



>ref|XP_004287375.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Fragaria vesca subsp. vesca]
Length=357

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 163/193 (84%), Gaps = 7/193 (4%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TLDTKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLDTKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VES SLEP+FG +FIAGGEDMWV
Sbjct  193  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESVSLEPKFGNKFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP--NEATDASA-  114
             +FDFH G++I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP  NE ++A A 
Sbjct  253  HVFDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTNEESEAQAA  312

Query  113  ----GPXKPKVXK  87
                G  KP V +
Sbjct  313  NGAIGKVKPPVEE  325



>ref|XP_002284993.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Vitis vinifera]
 emb|CBI28146.3| unnamed protein product [Vitis vinifera]
Length=348

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 165/204 (81%), Gaps = 6/204 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+T SSVTS
Sbjct  133  RPDAPPREVDNSPGSVRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETNSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YI TADGSSVKFWDAN F LVKSY MPC VESASLEP+ G +FIAGGEDMW+
Sbjct  193  AEVSQDGRYIITADGSSVKFWDANHFGLVKSYKMPCTVESASLEPKNGDKFIAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP-----NEATDA  120
            RLFDFH GE+I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP     NE   A
Sbjct  253  RLFDFHTGEEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTHDNNEMFRA  312

Query  119  SAGPXKPKV-XKXVXVEIDKXHXA  51
            +    K KV  + V  +I+  H A
Sbjct  313  NGLTGKVKVAAEEVSCKIEGFHIA  336



>ref|XP_007154947.1| hypothetical protein PHAVU_003G160500g [Phaseolus vulgaris]
 gb|ESW26941.1| hypothetical protein PHAVU_003G160500g [Phaseolus vulgaris]
Length=353

 Score =   281 bits (719),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 160/189 (85%), Gaps = 5/189 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN + LVKSYDMPC VES SLEP+FG +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANYYGLVKSYDMPCTVESVSLEPKFGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP-----NEATDA  120
             +FDFH G +I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP     +EA  A
Sbjct  253  HVFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTLDDSEALSA  312

Query  119  SAGPXKPKV  93
            +    K KV
Sbjct  313  NGSIDKVKV  321



>ref|XP_011081111.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Sesamum indicum]
Length=340

 Score =   280 bits (717),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR+I+  PGSVRT+AWLH+DQTIL SC+D  GVRLWD+R+  +VRTL+TKSSVTS
Sbjct  133  RPDAPPREIEKSPGSVRTLAWLHSDQTILGSCTDMGGVRLWDVRTGTIVRTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVK YDMPC +ESASLEP+FG +FIAGGEDMW+
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKRYDMPCIMESASLEPKFGNKFIAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
             +FDFH G +IGCNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP + + A+ GP 
Sbjct  253  HVFDFHTGAEIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPEQDSCAANGPS  312

Query  104  K  102
            +
Sbjct  313  Q  313



>ref|XP_007202311.1| hypothetical protein PRUPE_ppa008052mg [Prunus persica]
 gb|EMJ03510.1| hypothetical protein PRUPE_ppa008052mg [Prunus persica]
Length=347

 Score =   281 bits (718),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 168/201 (84%), Gaps = 3/201 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGGEDMWV
Sbjct  193  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP--NEATDASAG  111
             +FDFH G++I CNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQTGP   + T+A A 
Sbjct  253  HVFDFHTGDEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQTGPLTQDETEALAA  312

Query  110  PXKPKV-XKXVXVEIDKXHXA  51
              K KV  + V  +I+  H A
Sbjct  313  NGKVKVPAEEVSRKIEGFHIA  333



>ref|XP_011072259.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Sesamum indicum]
Length=349

 Score =   280 bits (716),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 164/205 (80%), Gaps = 6/205 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR+I+  PGSVRTVAWLH+DQTIL SC+D  GVRLWD+R+  +VRTL+TKSSVTS
Sbjct  133  RPDAPPREIEKSPGSVRTVAWLHSDQTILGSCTDMGGVRLWDVRTGTIVRTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+V FWDAN F LVKSYDMPC VESASLEP++G +FIA GEDMW+
Sbjct  193  AEVSQDGRYITTADGSTVTFWDANHFGLVKSYDMPCIVESASLEPKYGNKFIASGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP----NEATDAS  117
             +FDFH G +IGCNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP    N+ T  S
Sbjct  253  HVFDFHTGAEIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPQNNTNQETSGS  312

Query  116  AGPXK--PKVXKXVXVEIDKXHXAK  48
             GP +        V  +I+  H A+
Sbjct  313  NGPIQNVKDAADEVARQIENAHIAE  337



>gb|KJB70541.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
Length=228

 Score =   276 bits (705),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 164/197 (83%), Gaps = 4/197 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DA PR++D  PGS+RTVAWLH+DQTILSSCSDTSGVR WDLRS ++V+TL+TKS VTS
Sbjct  22   RLDAAPREVDNSPGSIRTVAWLHSDQTILSSCSDTSGVRFWDLRSGKIVQTLETKSPVTS  81

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWD+N F LVKSYDMPCNVESASLEP+ G +FIAGGEDMWV
Sbjct  82   AEVSQDGRYITTADGSTVKFWDSNHFELVKSYDMPCNVESASLEPKHGDKFIAGGEDMWV  141

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP--NEATDASAG  111
             +FDFH G+++GCNKGHHGP+HCVRF+PGGES  SGSEDGTIRIW T P   E +DA  G
Sbjct  142  HVFDFHTGKELGCNKGHHGPIHCVRFAPGGESYASGSEDGTIRIWLTSPVSREESDAVPG  201

Query  110  -PXKPKVXKXVXVEIDK  63
                PKV K V  E+ +
Sbjct  202  NALNPKV-KAVADEVTR  217



>ref|XP_010545787.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Tarenaya hassleriana]
Length=341

 Score =   280 bits (715),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 165/201 (82%), Gaps = 3/201 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPPR++D  PGS+RTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+T+SSVTS
Sbjct  133  RLDAPPREVDKSPGSIRTVTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETESSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTVESASLEPKFGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATD--ASAG  111
            R+FDFH GE+IGCNKGHHGPVHCVRFSP GES  SGSEDGTIRIWQT P+   D   S G
Sbjct  253  RVFDFHSGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTAPSNPEDNKTSTG  312

Query  110  PXKPKVXKXVXVEIDKXHXAK  48
              K  V + V  +I+  H  K
Sbjct  313  RAKQTV-EEVARKIEGFHMNK  332



>ref|XP_008385948.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Malus domestica]
Length=352

 Score =   280 bits (716),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 163/203 (80%), Gaps = 0/203 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  134  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  193

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGGEDMWV
Sbjct  194  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDMWV  253

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
             +FDFH GE+I CNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQTGP    +A A   
Sbjct  254  HVFDFHTGEEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQTGPLTPDEAEALAA  313

Query  104  KPKVXKXVXVEIDKXHXAKGAXI  36
               V K      +  H  +G  I
Sbjct  314  NGSVGKVKVPAEEVSHKIEGFHI  336



>ref|XP_010925262.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Elaeis guineensis]
Length=343

 Score =   280 bits (715),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 162/205 (79%), Gaps = 6/205 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
             PDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS  +V+TL+TKS VTS
Sbjct  133  HPDAPPREVDKSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGNIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F LVKSY+MPC VESASLEP+ G RFIAGGEDMW+
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYNMPCTVESASLEPKLGNRFIAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP-----NEATDA  120
             +FDFH GEQI CNKGHHGPVHCVRFSP GES  SGSEDGTIRIWQ  P     NE T A
Sbjct  253  HVFDFHTGEQITCNKGHHGPVHCVRFSPVGESYASGSEDGTIRIWQMSPATADENEVTGA  312

Query  119  SAGPXKPKV-XKXVXVEIDKXHXAK  48
            +    K KV    V  +I+  H +K
Sbjct  313  NGSAGKVKVGANEVARKIEGFHISK  337



>ref|XP_008343948.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Malus domestica]
Length=352

 Score =   280 bits (715),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 163/203 (80%), Gaps = 0/203 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  134  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  193

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGGEDMWV
Sbjct  194  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDMWV  253

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
             +FDFH GE+I CNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQTGP    +A A   
Sbjct  254  HVFDFHTGEEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQTGPLTPDEAEALAA  313

Query  104  KPKVXKXVXVEIDKXHXAKGAXI  36
               V K      +  H  +G  I
Sbjct  314  NGSVGKVKVPAEEVSHKIEGFHI  336



>gb|ACU23446.1| unknown [Glycine max]
Length=352

 Score =   280 bits (715),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTVAWLH+DQ ILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQAILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN + LVKSYDMPC VES SLEP++G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANYYGLVKSYDMPCTVESVSLEPKYGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            R+FDFH G +I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP
Sbjct  253  RVFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP  301



>ref|XP_009347464.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Pyrus x bretschneideri]
 ref|XP_009348196.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Pyrus x bretschneideri]
Length=349

 Score =   279 bits (714),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  134  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  193

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGGEDMWV
Sbjct  194  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDMWV  253

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
             +FDFH GE+I CNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQTGP    +A A   
Sbjct  254  HVFDFHTGEEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQTGPLTPDEAEANGS  313

Query  104  KPKV  93
              KV
Sbjct  314  VGKV  317



>ref|XP_008337419.1| PREDICTED: serine-threonine kinase receptor-associated protein-like, 
partial [Malus domestica]
Length=230

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  13   RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  72

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGGEDMWV
Sbjct  73   SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDMWV  132

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
             +FDFH GE+I CNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQT
Sbjct  133  HVFDFHTGEEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQT  179



>ref|XP_008242709.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Prunus mume]
Length=347

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 168/201 (84%), Gaps = 3/201 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+DG YITTADGS+VKFWDAN F LVKSY++PC VESASLEP+FG +FIAGGEDMWV
Sbjct  193  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNIPCTVESASLEPKFGNKFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP--NEATDASAG  111
             +FDFH G++I CNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQTGP   + T+A A 
Sbjct  253  HVFDFHTGDEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQTGPLTQDETEALAA  312

Query  110  PXKPKV-XKXVXVEIDKXHXA  51
              K KV  + V  +I+  H A
Sbjct  313  NGKVKVPAEEVSRKIEGFHIA  333



>ref|XP_003549786.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Glycine max]
 gb|KHN15128.1| Serine-threonine kinase receptor-associated protein [Glycine 
soja]
Length=352

 Score =   278 bits (712),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 159/189 (84%), Gaps = 5/189 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN + LVKSYDMPC +ES SLEP++G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANYYGLVKSYDMPCTIESVSLEPKYGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP-----NEATDA  120
             +FDFH G +I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP     +E   A
Sbjct  253  HVFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTLDGSETVSA  312

Query  119  SAGPXKPKV  93
            +    K KV
Sbjct  313  NGSVDKVKV  321



>ref|XP_002885098.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61357.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=341

 Score =   278 bits (711),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 162/199 (81%), Gaps = 1/199 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP +ID  PGS+RT+AWLH DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEIDKSPGSIRTLAWLHGDQTILSSCTDIGGVRLWDMRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
            RLFDFH GE+IGCNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQTGP    + +    
Sbjct  253  RLFDFHTGEEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGPVNPEENNESKP  312

Query  104  KPKVXKXVXVEIDKXHXAK  48
            K  V + V  +I+  H  K
Sbjct  313  KQSVDE-VTRKIEGFHINK  330



>ref|XP_006451011.1| hypothetical protein CICLE_v10008796mg [Citrus clementina]
 ref|XP_006475776.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Citrus sinensis]
 gb|ESR64251.1| hypothetical protein CICLE_v10008796mg [Citrus clementina]
 gb|KDO80363.1| hypothetical protein CISIN_1g018860mg [Citrus sinensis]
Length=349

 Score =   278 bits (712),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTVAWLH+DQTILS+C+D  GVRLWD+RS E+V+TL+TKS VTS
Sbjct  133  RPDAPPREVDRSPGSVRTVAWLHSDQTILSTCTDMGGVRLWDVRSGEIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC +ESASLEP++G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTIESASLEPKYGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            R FDFH G +I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP
Sbjct  253  RFFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP  301



>gb|AFK46987.1| unknown [Lotus japonicus]
Length=350

 Score =   278 bits (711),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 160/187 (86%), Gaps = 3/187 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS  +V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGIIVQTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YI TADGS+VKFWDAN + +VKSYDMPC VESASLEP++G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYIITADGSTVKFWDANYYGMVKSYDMPCTVESASLEPKYGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP---NEATDASA  114
            R+FDFH G +I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIW+TGP   +E+ D SA
Sbjct  253  RVFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWRTGPLTHDESEDLSA  312

Query  113  GPXKPKV  93
                 KV
Sbjct  313  NGSIDKV  319



>ref|XP_010254304.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Nelumbo nucifera]
Length=353

 Score =   278 bits (710),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 165/211 (78%), Gaps = 1/211 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TLDTKS VTS
Sbjct  133  RPDAPPREVDRSPGSVRTVAWLHSDQTILSSCTDMGGVRLWDVRSGKIVQTLDTKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS VKFWDAN F LVKSY+MPC VESASLEP+ G +FIAGGEDMW+
Sbjct  193  AEVSQDGRYITTADGSMVKFWDANHFTLVKSYNMPCTVESASLEPKHGNKFIAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
             +FDFH G +IGCNKGHHGPVHCVRF+PGGES  SGSEDGTIRIWQTGP+     + G  
Sbjct  253  HVFDFHSGAEIGCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQTGPSHDEIETFGAN  312

Query  104  KPKVXKXVXVEIDKXHXAKGAXIDXDXXNEE  12
             P     V  + +  +  +G  I  D   EE
Sbjct  313  GPAGKVKVTAD-EVANKIEGFHIAKDGKTEE  342



>ref|XP_010654727.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Vitis vinifera]
Length=356

 Score =   278 bits (710),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR+++  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+R+ ++V TL+TKS VTS
Sbjct  143  RPDAPPREVENSPGSIRTVAWLHSDQTILSSCTDNGGVRLWDVRTGKIVHTLETKSPVTS  202

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADG++VKFWDAN + LVKSY+MPCN+ESASLEP+FG +FIAGGEDMW+
Sbjct  203  AEVSQDGRYITTADGTTVKFWDANHYGLVKSYNMPCNMESASLEPKFGNKFIAGGEDMWI  262

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPN--EATDASAG  111
             +FDF+ GE+IGCNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP   E  D+   
Sbjct  263  HMFDFNTGEEIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPQNLEEPDSFVS  322

Query  110  PXKPKVXKXVXVEIDKXHXAK  48
                 V   V  +++  H  K
Sbjct  323  GKVKVVVDEVTRKVEGFHVGK  343



>ref|XP_010249966.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Nelumbo nucifera]
Length=350

 Score =   277 bits (709),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWDLRS ++++TL+TKS VTS
Sbjct  133  RPDAPPREVDKSPGSIRTVAWLHSDQTILSSCTDMGGVRLWDLRSGQIIQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+V+FWDAN F LVKSY+MPC VESASLEP+ G +FIAGGEDMW+
Sbjct  193  AEVSQDGRYITTADGSTVRFWDANHFALVKSYNMPCTVESASLEPKLGNKFIAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             +FDFH G++IGCNKGHHGPVHCVRF+PGGES  SGSEDGTIRIWQTGP
Sbjct  253  HVFDFHTGKEIGCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQTGP  301



>ref|XP_008792113.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Phoenix dactylifera]
Length=343

 Score =   277 bits (709),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDKSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG RFIAGGEDMW+
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTVESASLEPKFGNRFIAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATD  123
             +FDFH GEQI CNKGHHGPVHCVRFSP GES  SGSEDGTIRIWQ  P  A +
Sbjct  253  HVFDFHTGEQITCNKGHHGPVHCVRFSPIGESYASGSEDGTIRIWQMSPATADE  306



>ref|XP_007013329.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY30948.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=349

 Score =   277 bits (709),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = -3

Query  641  PDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSA  462
            PDAPPR++D  PGSVRTVAW+H+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSA
Sbjct  134  PDAPPREVDKSPGSVRTVAWMHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTSA  193

Query  461  EVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVR  282
            EVS DG YITTADGS+VKFWDAN F LVKS++MPC VESASLEP++G +F+AGGEDMWVR
Sbjct  194  EVSLDGRYITTADGSTVKFWDANHFGLVKSHNMPCTVESASLEPKYGNKFVAGGEDMWVR  253

Query  281  LFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASA  114
            +FDFH G++I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP    DA +
Sbjct  254  VFDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTHDDAES  309



>ref|XP_008464982.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Cucumis melo]
 ref|XP_008464983.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Cucumis melo]
Length=353

 Score =   277 bits (709),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 161/190 (85%), Gaps = 6/190 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVTWLHSDQTILSSCTDMGGVRLWDVRSGQIVQTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP++G +FIAGGEDMW+
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTVESASLEPKYGMKFIAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP------NEATD  123
             +FDFH G++I CNKGHHGPVHC+RF+PGGES  SGSEDGTIRIWQTGP      +EAT 
Sbjct  253  HVFDFHTGDEIACNKGHHGPVHCLRFAPGGESYASGSEDGTIRIWQTGPLTHDDSDEATL  312

Query  122  ASAGPXKPKV  93
             +    K KV
Sbjct  313  VNGSIGKVKV  322



>ref|XP_004515599.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Cicer arietinum]
Length=353

 Score =   277 bits (709),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPP+++D  PGSVR+VAWLH+DQTILSSC+D  GVRLWD+R+ ++V+TLDTKS +TS
Sbjct  133  RPDAPPKEVDKSPGSVRSVAWLHSDQTILSSCTDKGGVRLWDVRTGKIVQTLDTKSPMTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN + LVKSYDMPCNVESASLEP+FG +FIAGGED+WV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHYGLVKSYDMPCNVESASLEPKFGNKFIAGGEDLWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             +FDFH G +I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP
Sbjct  253  HVFDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP  301



>gb|KJB70542.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
 gb|KJB70543.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
 gb|KJB70544.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
 gb|KJB70545.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
Length=296

 Score =   275 bits (704),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 164/197 (83%), Gaps = 4/197 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DA PR++D  PGS+RTVAWLH+DQTILSSCSDTSGVR WDLRS ++V+TL+TKS VTS
Sbjct  90   RLDAAPREVDNSPGSIRTVAWLHSDQTILSSCSDTSGVRFWDLRSGKIVQTLETKSPVTS  149

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWD+N F LVKSYDMPCNVESASLEP+ G +FIAGGEDMWV
Sbjct  150  AEVSQDGRYITTADGSTVKFWDSNHFELVKSYDMPCNVESASLEPKHGDKFIAGGEDMWV  209

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP--NEATDASAG  111
             +FDFH G+++GCNKGHHGP+HCVRF+PGGES  SGSEDGTIRIW T P   E +DA  G
Sbjct  210  HVFDFHTGKELGCNKGHHGPIHCVRFAPGGESYASGSEDGTIRIWLTSPVSREESDAVPG  269

Query  110  -PXKPKVXKXVXVEIDK  63
                PKV K V  E+ +
Sbjct  270  NALNPKV-KAVADEVTR  285



>ref|XP_010487393.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=342

 Score =   277 bits (708),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP +ID  PGS+RTV WLH DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEIDKSPGSIRTVTWLHGDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            RLFDFH GE+IGCNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQTGP
Sbjct  253  RLFDFHTGEEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGP  301



>ref|XP_002285272.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Vitis vinifera]
 emb|CBI36243.3| unnamed protein product [Vitis vinifera]
Length=346

 Score =   277 bits (708),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR+++  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+R+ ++V TL+TKS VTS
Sbjct  133  RPDAPPREVENSPGSIRTVAWLHSDQTILSSCTDNGGVRLWDVRTGKIVHTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADG++VKFWDAN + LVKSY+MPCN+ESASLEP+FG +FIAGGEDMW+
Sbjct  193  AEVSQDGRYITTADGTTVKFWDANHYGLVKSYNMPCNMESASLEPKFGNKFIAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPN--EATDASAG  111
             +FDF+ GE+IGCNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP   E  D+   
Sbjct  253  HMFDFNTGEEIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPQNLEEPDSFVS  312

Query  110  PXKPKVXKXVXVEIDKXHXAK  48
                 V   V  +++  H  K
Sbjct  313  GKVKVVVDEVTRKVEGFHVGK  333



>emb|CDY61819.1| BnaC06g41840D [Brassica napus]
Length=330

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP ++D  PGS+RT+ WLH+DQTIL+SC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSIRTLTWLHSDQTILTSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F LVKSYDMPCN+ESASLEP+ G++F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYDMPCNIESASLEPKSGEKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASA  114
            R+FDF+ GE+IGCNKGHHGPVHCVRFSP GES  SGSEDGTIRIWQT PN + D  A
Sbjct  253  RMFDFYTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTTPNHSVDEVA  309



>ref|XP_010465533.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=341

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP +ID  PGS+RTV WLH DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEIDKSPGSIRTVTWLHGDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            RLFDFH GE+IGCNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQTGP
Sbjct  253  RLFDFHTGEEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGP  301



>gb|KEH37967.1| Serine/Threonine kinase receptor-associated-like protein [Medicago 
truncatula]
Length=351

 Score =   277 bits (708),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 158/178 (89%), Gaps = 1/178 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPP+++D  PGSVR+VAWLH+DQTILSSC+D  GVRLWD+R+ ++V+TLDTKS +TS
Sbjct  133  RPDAPPKEVDKSPGSVRSVAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLDTKSPMTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN + LVKSYDMPCNVESASLEP+FG +F+AGGED+WV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHYGLVKSYDMPCNVESASLEPKFGNKFVAGGEDLWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAG  111
             +FDFH G++I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP  A D S G
Sbjct  253  HVFDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP-LAHDESEG  309



>gb|KHG15168.1| Serine-threonine kinase receptor-associated [Gossypium arboreum]
Length=339

 Score =   276 bits (706),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 162/196 (83%), Gaps = 2/196 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DA PR++D  PGSVRTVAWLH+DQTILSSCSDTSGVRLWDLRS ++V+TL++KS VTS
Sbjct  133  RLDAAPREVDNSPGSVRTVAWLHSDQTILSSCSDTSGVRLWDLRSGKIVQTLESKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWD+N F LVKSYDMPCNVESASLEP+ G +FIAGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDSNHFELVKSYDMPCNVESASLEPKHGNKFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP--NEATDASAG  111
             +FDFH G+++GCNKGHHGP+HCVRF+PGGES  SGSEDGTIRIW T P   E +DA  G
Sbjct  253  HVFDFHTGKELGCNKGHHGPIHCVRFAPGGESYASGSEDGTIRIWLTSPVSREESDAVPG  312

Query  110  PXKPKVXKXVXVEIDK  63
                   K V  E+ +
Sbjct  313  NAPNPKVKAVADEVTR  328



>ref|XP_012078706.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Jatropha curcas]
 gb|KDP32349.1| hypothetical protein JCGZ_13274 [Jatropha curcas]
Length=350

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSCSD  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSIRTVAWLHSDQTILSSCSDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITT DGS+VKFWDAN F LVKSY+MPC VESASLEP++G +FIAGGEDMW+
Sbjct  193  AEVSQDGRYITTCDGSTVKFWDANHFGLVKSYNMPCTVESASLEPKYGNKFIAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             ++DFH G +I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP
Sbjct  253  HVYDFHTGNEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP  301



>ref|XP_007013330.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY30949.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
Length=303

 Score =   275 bits (702),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = -3

Query  638  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  459
            DAPPR++D  PGSVRTVAW+H+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTSAE
Sbjct  89   DAPPREVDKSPGSVRTVAWMHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTSAE  148

Query  458  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVRL  279
            VS DG YITTADGS+VKFWDAN F LVKS++MPC VESASLEP++G +F+AGGEDMWVR+
Sbjct  149  VSLDGRYITTADGSTVKFWDANHFGLVKSHNMPCTVESASLEPKYGNKFVAGGEDMWVRV  208

Query  278  FDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASA  114
            FDFH G++I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP    DA +
Sbjct  209  FDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTHDDAES  263



>ref|XP_004146293.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Cucumis sativus]
Length=353

 Score =   276 bits (706),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVTWLHSDQTILSSCTDMGGVRLWDVRSGQIVQTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP++G +FIAGGEDMW+
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTVESASLEPKYGMKFIAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP--NEATDASA  114
             +FDFH G++I CNKGHHGPVHC+RF+PGGES  SGSEDGTIRIWQTGP  ++ +D SA
Sbjct  253  HVFDFHTGDEIACNKGHHGPVHCLRFAPGGESYASGSEDGTIRIWQTGPLTHDDSDESA  311



>gb|KJB13091.1| hypothetical protein B456_002G056400 [Gossypium raimondii]
 gb|KJB13092.1| hypothetical protein B456_002G056400 [Gossypium raimondii]
Length=307

 Score =   275 bits (702),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R D  PRQ+D  PGS+RTVAWLH+DQ ILSSC+DT+GVRLWDLRS ++V+TL+TKS VTS
Sbjct  90   RLDEQPRQVDNSPGSIRTVAWLHSDQMILSSCTDTNGVRLWDLRSGKIVQTLETKSPVTS  149

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCNVESASLEP+ G +FIAGGEDMWV
Sbjct  150  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNVESASLEPKHGNKFIAGGEDMWV  209

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             +FDFH GE++GCNKGHHGPVHCVRFSPGG S  SGSEDGTIRIWQT P
Sbjct  210  HVFDFHTGEELGCNKGHHGPVHCVRFSPGGGSFASGSEDGTIRIWQTSP  258



>ref|NP_566519.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 dbj|BAB02292.1| WD-40 repeat protein-like [Arabidopsis thaliana]
 gb|AAN72058.1| expressed protein [Arabidopsis thaliana]
 gb|AAO30083.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE75702.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=341

 Score =   276 bits (705),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 161/199 (81%), Gaps = 1/199 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP +ID  PGS+RT+ WLH DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEIDKSPGSIRTLTWLHGDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
            RLFDFH G++IGCNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQTGP    + S    
Sbjct  253  RLFDFHTGKEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGPVNPEEISESKP  312

Query  104  KPKVXKXVXVEIDKXHXAK  48
            K  V + V  +I+  H  K
Sbjct  313  KQSVDE-VARKIEGFHINK  330



>gb|KGN65408.1| hypothetical protein Csa_1G418250 [Cucumis sativus]
Length=366

 Score =   276 bits (707),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  146  RPDAPPREVDKSPGSVRTVTWLHSDQTILSSCTDMGGVRLWDVRSGQIVQTLETKSSVTS  205

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP++G +FIAGGEDMW+
Sbjct  206  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTVESASLEPKYGMKFIAGGEDMWI  265

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP--NEATDASA  114
             +FDFH G++I CNKGHHGPVHC+RF+PGGES  SGSEDGTIRIWQTGP  ++ +D SA
Sbjct  266  HVFDFHTGDEIACNKGHHGPVHCLRFAPGGESYASGSEDGTIRIWQTGPLTHDDSDESA  324



>gb|KDO52915.1| hypothetical protein CISIN_1g018784mg [Citrus sinensis]
Length=350

 Score =   276 bits (705),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 161/211 (76%), Gaps = 0/211 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++    GS+RTVAWLH+DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVGNSSGSIRTVAWLHSDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVSRDG YITTADGSSVKFWDAN F LVK Y+MPCN ESASLEP+ G  FIAGGEDMWV
Sbjct  193  AEVSRDGRYITTADGSSVKFWDANHFGLVKGYNMPCNTESASLEPKLGNIFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
             +FDFH GEQIGCNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQT P    +  +G  
Sbjct  253  HVFDFHTGEQIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTNPPNHEENHSGTG  312

Query  104  KPKVXKXVXVEIDKXHXAKGAXIDXDXXNEE  12
              +  K      +     +G  I+ +   EE
Sbjct  313  NAQTGKLKASTDEVTRKIEGFHINKEGKAEE  343



>gb|KHG01497.1| Serine-threonine kinase receptor-associated [Gossypium arboreum]
Length=349

 Score =   276 bits (705),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTV W+H+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVTWMHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN + LVKSY+MPC VESASLEP++G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHYGLVKSYNMPCTVESASLEPKYGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            R+FDFH G++I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIW TGP
Sbjct  253  RVFDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWLTGP  301



>ref|XP_006465394.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X1 [Citrus sinensis]
Length=350

 Score =   276 bits (705),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 160/211 (76%), Gaps = 0/211 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++    GS+RTVAWLH DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVGNSSGSIRTVAWLHGDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVSRDG YITTADGSSVKFWDAN F LVK Y+MPCN ESASLEP+ G  FIAGGEDMWV
Sbjct  193  AEVSRDGRYITTADGSSVKFWDANHFGLVKGYNMPCNTESASLEPKLGNIFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
             +FDFH GEQIGCNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQT P    +  +G  
Sbjct  253  HVFDFHTGEQIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTNPPNHEENHSGTG  312

Query  104  KPKVXKXVXVEIDKXHXAKGAXIDXDXXNEE  12
              +  K      +     +G  I+ +   EE
Sbjct  313  NAQTGKLKASTDEVTRKIEGFHINKERKAEE  343



>gb|KJB70540.1| hypothetical protein B456_011G079800 [Gossypium raimondii]
Length=339

 Score =   275 bits (703),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 164/197 (83%), Gaps = 4/197 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DA PR++D  PGS+RTVAWLH+DQTILSSCSDTSGVR WDLRS ++V+TL+TKS VTS
Sbjct  133  RLDAAPREVDNSPGSIRTVAWLHSDQTILSSCSDTSGVRFWDLRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWD+N F LVKSYDMPCNVESASLEP+ G +FIAGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDSNHFELVKSYDMPCNVESASLEPKHGDKFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP--NEATDASAG  111
             +FDFH G+++GCNKGHHGP+HCVRF+PGGES  SGSEDGTIRIW T P   E +DA  G
Sbjct  253  HVFDFHTGKELGCNKGHHGPIHCVRFAPGGESYASGSEDGTIRIWLTSPVSREESDAVPG  312

Query  110  -PXKPKVXKXVXVEIDK  63
                PKV K V  E+ +
Sbjct  313  NALNPKV-KAVADEVTR  328



>gb|KJB54108.1| hypothetical protein B456_009G020900 [Gossypium raimondii]
Length=349

 Score =   275 bits (704),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTV W+H+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  RPDAPPREVDKSPGSVRTVTWMHSDQTILSSCTDMGGVRLWDVRSGKIVQTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN + LVKSY+MPC VESASLEP++G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHYGLVKSYNMPCTVESASLEPKYGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            R+FDFH G++I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIW TGP
Sbjct  253  RVFDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWLTGP  301



>ref|XP_012073264.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Jatropha curcas]
 gb|KDP37150.1| hypothetical protein JCGZ_06206 [Jatropha curcas]
Length=350

 Score =   275 bits (703),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  638  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  459
            DAPPR++   PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTSAE
Sbjct  135  DAPPREVGSSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDIRSGKIVQTLETKSPVTSAE  194

Query  458  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVRL  279
            VS+DG YITTADGS+VKFWDAN F LVKSY+MPCN ESASLEP+FG +F+AGGEDMW+ +
Sbjct  195  VSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCNTESASLEPKFGNKFVAGGEDMWIHI  254

Query  278  FDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            FDF+ GEQIGCNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP
Sbjct  255  FDFNTGEQIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP  301



>ref|XP_006427175.1| hypothetical protein CICLE_v10025975mg [Citrus clementina]
 gb|ESR40415.1| hypothetical protein CICLE_v10025975mg [Citrus clementina]
Length=350

 Score =   275 bits (703),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 161/211 (76%), Gaps = 0/211 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++    GS+RTVAWLH+DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTS
Sbjct  133  RPDASPREVGNSSGSIRTVAWLHSDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVSRDG YITTADGSSVKFWDAN F LVKSY+MPCN ESASLEP+ G  FIAGGEDMWV
Sbjct  193  AEVSRDGRYITTADGSSVKFWDANHFGLVKSYNMPCNTESASLEPKLGNIFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
             +FDFH GEQIGCNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQT P    +  +G  
Sbjct  253  HVFDFHTGEQIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTNPPNHEENHSGTG  312

Query  104  KPKVXKXVXVEIDKXHXAKGAXIDXDXXNEE  12
              +  K      +     +G  I+ +   EE
Sbjct  313  NAQTGKLKASTDEVTRKIEGFHINKEGKAEE  343



>ref|XP_009144818.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Brassica rapa]
Length=330

 Score =   274 bits (701),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DA P ++D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAAPTEVDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G++F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGEKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASA  114
            R+FDF+ GE+IGCNKGHHGPVHCVRFSP GES  SGSEDGTIRIWQT PN + D  A
Sbjct  253  RVFDFYTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTTPNHSVDEVA  309



>ref|XP_009402893.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Musa acuminata subsp. malaccensis]
Length=347

 Score =   274 bits (701),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 164/212 (77%), Gaps = 2/212 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR+ID  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREIDKSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F LVKSY+MPC VESASLEP+ G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYNMPCTVESASLEPKDGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDAS-AGP  108
             +FDFH G +I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQ GP    D    G 
Sbjct  253  HVFDFHTGVEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQMGPTATDDNEPYGT  312

Query  107  XKPKVXKXVXVEIDKXHXAKGAXIDXDXXNEE  12
              P     V V  +  H  +G  I  D  +E+
Sbjct  313  NGPTGKAKVGVN-EVSHKIEGFHITKDGPSEK  343



>ref|XP_006298067.1| hypothetical protein CARUB_v10014111mg [Capsella rubella]
 gb|EOA30965.1| hypothetical protein CARUB_v10014111mg [Capsella rubella]
Length=341

 Score =   274 bits (700),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DA P +ID  PGS+RTV WLH DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDASPTEIDKSPGSIRTVTWLHGDQTILSSCADIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
            RLFDFH GE+IGCNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQTGP    +      
Sbjct  253  RLFDFHTGEEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGPVNPEEIIESKS  312

Query  104  KPKVXKXV  81
            K  V + V
Sbjct  313  KKNVDEVV  320



>gb|KJB13093.1| hypothetical protein B456_002G056400 [Gossypium raimondii]
 gb|KJB13094.1| hypothetical protein B456_002G056400 [Gossypium raimondii]
Length=350

 Score =   274 bits (701),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R D  PRQ+D  PGS+RTVAWLH+DQ ILSSC+DT+GVRLWDLRS ++V+TL+TKS VTS
Sbjct  133  RLDEQPRQVDNSPGSIRTVAWLHSDQMILSSCTDTNGVRLWDLRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCNVESASLEP+ G +FIAGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNVESASLEPKHGNKFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             +FDFH GE++GCNKGHHGPVHCVRFSPGG S  SGSEDGTIRIWQT P
Sbjct  253  HVFDFHTGEELGCNKGHHGPVHCVRFSPGGGSFASGSEDGTIRIWQTSP  301



>gb|KFK38907.1| hypothetical protein AALP_AA3G176400 [Arabis alpina]
Length=349

 Score =   274 bits (700),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 160/196 (82%), Gaps = 3/196 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP + D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++ +TL+TKS VTS
Sbjct  134  RLDAPPTEFDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIEQTLETKSPVTS  193

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G +F+AGGEDMWV
Sbjct  194  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGGEDMWV  253

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG---PNEATDASA  114
            RLFDFH G++IGCNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQTG   P E  + +A
Sbjct  254  RLFDFHTGDEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGPVNPEEIIEPNA  313

Query  113  GPXKPKVXKXVXVEID  66
            G  K    + V  E++
Sbjct  314  GKSKQNNVEEVAREVE  329



>ref|XP_010542265.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Tarenaya hassleriana]
 ref|XP_010542266.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Tarenaya hassleriana]
Length=343

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP ++D  PGS+RTV WLH+DQTILSSC+D  GVRLWD+RS  +V+TL+TKS VTS
Sbjct  133  RLDAPPGEVDKSPGSIRTVTWLHSDQTILSSCTDIGGVRLWDVRSGRIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVSRDG YITTADGS+VKFWDAN F LVKSY+MPC VESASLE + G +F+AGGEDMWV
Sbjct  193  AEVSRDGRYITTADGSTVKFWDANHFGLVKSYNMPCTVESASLETKSGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
            R+FDFH GE+IGCNKGHHGPVHCVRFSP GES  SGSEDGTIRIWQTGP+   D  A   
Sbjct  253  RVFDFHTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTGPSNPEDIEASTG  312

Query  104  KPK  96
            + K
Sbjct  313  RAK  315



>emb|CDX89958.1| BnaA10g01240D [Brassica napus]
Length=341

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP ++D  PGSVRT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSVRTLTWLHSDQTILSSCADIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G++F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYEMPCNIESASLEPKSGEKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNE  132
            R+FDF+ GE+IGCNKGHHGPVHCVRFSP GES  SGSEDGTIRIWQT PN+
Sbjct  253  RVFDFYTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTAPNQ  303



>ref|XP_008337340.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Malus domestica]
 ref|XP_008352271.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Malus domestica]
Length=351

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  134  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  193

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGGEDMWV
Sbjct  194  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDMWV  253

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
             +FDFH GE+I CNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQT
Sbjct  254  HVFDFHTGEEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQT  300



>ref|XP_009374067.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Pyrus x bretschneideri]
Length=351

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  134  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  193

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGGEDMWV
Sbjct  194  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDMWV  253

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
             +FDFH GE+I CNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQT
Sbjct  254  HVFDFHTGEEIACNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQT  300



>gb|AFK34417.1| unknown [Medicago truncatula]
Length=351

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 156/178 (88%), Gaps = 1/178 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPP+++D  PGSV +VAWLH+DQTILSSC+D  GVRLWD+R+ ++V+TLDTKS +TS
Sbjct  133  RPDAPPKEVDKSPGSVTSVAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLDTKSPMTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS+DG YITTADGS+VKFWDAN + LVKSYDMPCNVESASLEP+FG +F+AGGED+WV
Sbjct  193  VEVSQDGRYITTADGSTVKFWDANHYGLVKSYDMPCNVESASLEPKFGNKFVAGGEDLWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAG  111
             +FDFH G++I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP  A D S G
Sbjct  253  HVFDFHTGDEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGP-LAHDESEG  309



>gb|KHG21144.1| Serine-threonine kinase receptor-associated [Gossypium arboreum]
Length=350

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DA PRQ+D  PGS+RTVAWLH+DQ ILSSC++T+GVRLWDLRS ++V+TL+TKS VTS
Sbjct  133  RLDAQPRQVDNSPGSIRTVAWLHSDQMILSSCTETNGVRLWDLRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+DG YITTADGS+VKFWDAN F LVKSYDMPCNVESASLEP+ G +FIAGGEDMWV
Sbjct  193  SEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNVESASLEPKHGNKFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             +FDFH GE++GCNKGHHGPVHCVRFSPGG S  SGSEDGTIRIWQT P
Sbjct  253  HVFDFHTGEELGCNKGHHGPVHCVRFSPGGGSFASGSEDGTIRIWQTSP  301



>ref|XP_010503217.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=341

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP +ID  PGS+RTV WLH DQTILS C+D  GVRLWD+RS ++V+TL+TKS  TS
Sbjct  133  RLDAPPTEIDKSPGSIRTVTWLHGDQTILSFCTDIGGVRLWDVRSGKIVQTLETKSPATS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            RLFDFH GE+IGCNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQTGP
Sbjct  253  RLFDFHTGEEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGP  301



>emb|CDY40132.1| BnaC06g05570D [Brassica napus]
Length=341

 Score =   272 bits (696),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP ++D  PGSVRT+ WLH+DQTILSSC+D  GVRLWD+RS ++++TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSVRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIMQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G++F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYEMPCNIESASLEPKSGEKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNE  132
            R+FDF+ GE+IGCNKGHHGPVHCVRFSP GES  SGSEDGTIRIWQT PN+
Sbjct  253  RVFDFYTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTAPNQ  303



>emb|CDY62165.1| BnaA05g35670D [Brassica napus]
Length=330

 Score =   272 bits (695),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DA   ++D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAAATEVDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G++F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGEKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASA  114
            R+FDF+ GE+IGCNKGHHGPVHCVRFSP GES  SGSEDGTIRIWQT PN + D  A
Sbjct  253  RVFDFYTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTTPNHSVDEVA  309



>ref|XP_006406945.1| hypothetical protein EUTSA_v10021071mg [Eutrema salsugineum]
 gb|ESQ48398.1| hypothetical protein EUTSA_v10021071mg [Eutrema salsugineum]
Length=342

 Score =   272 bits (695),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP +ID  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEIDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASL+P+ G +F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCNIESASLDPKSGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEA  129
            RLFDFH GE+IGCNKGHHGPVHCVRF+P GES  SGSEDGTIRIW+TGP  A
Sbjct  253  RLFDFHTGEEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWETGPVNA  304



>ref|XP_009602512.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Nicotiana tomentosiformis]
Length=355

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPPR+ID  PGSVRTVAWLH+DQT+LSS  D  G+RLWD+RS +VV+TL+TK  VTS
Sbjct  133  RLDAPPREIDSSPGSVRTVAWLHSDQTLLSSSGDAGGLRLWDVRSGKVVQTLETKFPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F LVKSYD+PC VESASLEP+FG RFIAGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYDLPCKVESASLEPKFGNRFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             +FDFH GE+IGCNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQ GP
Sbjct  253  HVFDFHTGEEIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLGP  301



>ref|XP_007023961.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY26583.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=351

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++   PGS+RTVAWLH+DQTILSSC+DTSGVRLWDLRS ++V+TL+TKS VTS
Sbjct  133  RPDALPREVGNSPGSIRTVAWLHSDQTILSSCTDTSGVRLWDLRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSY MPCNVESASLEP+ G + IAGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYYMPCNVESASLEPKHGNKLIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
             +FDFH GE+IGCNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQ G
Sbjct  253  HVFDFHTGEEIGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQIG  300



>ref|XP_009147669.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Brassica rapa]
 emb|CDY62196.1| BnaA06g01530D [Brassica napus]
Length=337

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP ++D  PGSVRT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSVRTLTWLHSDQTILSSCADIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G++F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYEMPCNIESASLEPKSGEKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNE  132
            R+FDF  GE+IGCNKGHHGPVHCVRFSP GES  SGSEDGTIRIWQT PN+
Sbjct  253  RVFDFFTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTTPNQ  303



>ref|XP_006341669.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Solanum tuberosum]
Length=356

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR+ID  PGSVRTVAWLH+DQTILSS  D  G+RLWD+RS +VV+ L+TK  VTS
Sbjct  133  RPDAPPREIDSSPGSVRTVAWLHSDQTILSSSGDAGGLRLWDVRSGKVVQILETKFPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F LVKS+D+PC VESASLEP+FG RFIAGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSHDLPCKVESASLEPKFGNRFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             +FDFH GE+IGCNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQ GP
Sbjct  253  HVFDFHTGEEIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLGP  301



>emb|CDP03398.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   271 bits (694),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 158/189 (84%), Gaps = 5/189 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTV WLH+DQTILSSC+D  GVRLWD+R+ +VV TL+TKS VTS
Sbjct  133  RPDAPPREVDKSPGSVRTVTWLHSDQTILSSCTDMGGVRLWDVRTGKVVETLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADG SVKFWDAN F LVKSY+MPC VESASLEP++G +F+A GEDMW+
Sbjct  193  AEVSQDGRYITTADGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGFKFVAAGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP-----NEATDA  120
            R+FDFH G++I CNKGHHGPVHCVRF+PGGE+  SGSEDGTIRIWQTGP     +E   A
Sbjct  253  RVFDFHTGDEIACNKGHHGPVHCVRFAPGGETYASGSEDGTIRIWQTGPLINDESEPIAA  312

Query  119  SAGPXKPKV  93
            + G  + KV
Sbjct  313  NGGTGRVKV  321



>gb|AGT15994.1| hypothetical protein SHCRBa_159_J23_F_580 [Saccharum hybrid cultivar 
R570]
Length=340

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 160/202 (79%), Gaps = 3/202 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+SVTS
Sbjct  133  RPDAAPRELDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGGED+WV
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGGEDLWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
             +FDF  GE+I CNKGHHGPVHCVRF+PGGES  SGSEDGTIRIWQ  P  A D  A   
Sbjct  253  HVFDFFTGEEIACNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPANADDNEAANA  312

Query  104  KPK---VXKXVXVEIDKXHXAK  48
              K   V   V  +I+  H  K
Sbjct  313  NGKTNAVVNEVTTKIEGFHIPK  334



>ref|XP_004965966.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Setaria italica]
Length=339

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+SVTS
Sbjct  134  RPDAAPRELDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASVTS  193

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGGED+WV
Sbjct  194  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGGEDLWV  253

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
             LFDF  GE+I CNKGHHGPVHCVRF+PGGES  SGSEDGTIRIWQ  P  A D  A   
Sbjct  254  HLFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPPNADDNEAANG  313

Query  104  KP  99
            KP
Sbjct  314  KP  315



>ref|XP_006392876.1| hypothetical protein EUTSA_v10011626mg [Eutrema salsugineum]
 gb|ESQ30162.1| hypothetical protein EUTSA_v10011626mg [Eutrema salsugineum]
Length=343

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 161/200 (81%), Gaps = 1/200 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP ++D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G++F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGEKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP-NEATDASAGP  108
            R+FDF+ GE+IGCNKGHHGPVHCVRFSP GES  SGSEDGTIRIWQT P N   + SA  
Sbjct  253  RVFDFYTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTTPANTEENESASR  312

Query  107  XKPKVXKXVXVEIDKXHXAK  48
                    V  +I+  H  K
Sbjct  313  RVKHNVDEVSKKIEGFHINK  332



>ref|XP_010914940.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Elaeis guineensis]
Length=344

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
             PDA PR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  HPDASPREVDKSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+ G RFIAGGEDMW+
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCTVESASLEPKIGNRFIAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATD  123
             +FDFH GEQI CNKGHHGPVHCVRFSP GES  SGSEDGTIRIWQ  P  A +
Sbjct  253  HVFDFHTGEQIACNKGHHGPVHCVRFSPIGESYASGSEDGTIRIWQMSPATADE  306



>ref|XP_002891712.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67971.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=343

 Score =   270 bits (690),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP ++D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G++F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGEKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            R+FDF+ GE+IGCNKGHHGPVHCVRF+P G S  SGSEDGTIRIWQT P
Sbjct  253  RVFDFYTGEEIGCNKGHHGPVHCVRFTPTGLSYASGSEDGTIRIWQTTP  301



>ref|XP_009770768.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X2 [Nicotiana sylvestris]
Length=299

 Score =   268 bits (686),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  88   RPDAAPREVAKTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  147

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGGEDMW+
Sbjct  148  AEVSQDGRYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDMWI  207

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            R+FDFH GE++ CNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQTGP
Sbjct  208  RVFDFHTGEELACNKGHHGPVHCVRFAPSGESYASGSEDGTIRIWQTGP  256



>ref|NP_849800.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
 ref|NP_175682.2| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
 gb|AAD55591.1|AC008016_1 Similar to gb|AJ010025 unr-interacting protein from Homo sapiens 
and contains 3 PF|00400 WD40 domains. EST gb|T45021 comes 
from this gene [Arabidopsis thaliana]
 gb|AAP37674.1| At1g52730 [Arabidopsis thaliana]
 dbj|BAE99937.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH20036.1| AT1G52730 [Arabidopsis thaliana]
 gb|AEE32845.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
 gb|AEE32846.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana]
Length=343

 Score =   270 bits (690),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP ++D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G++F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGEKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            R+FDF+ GE+IGCNKGHHGPVHCVRF+P G S  SGSEDGTIRIWQT P
Sbjct  253  RVFDFYTGEEIGCNKGHHGPVHCVRFTPTGLSYASGSEDGTIRIWQTTP  301



>ref|XP_010500889.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
 ref|XP_010462123.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
 ref|XP_010479792.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=343

 Score =   270 bits (690),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP ++D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPCN+ESASLEP+ G++F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSGEKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            R+FDF+ GE+IGCNKGHHGPVHCVRF+P G S  SGSEDGTIRIWQT P
Sbjct  253  RVFDFYTGEEIGCNKGHHGPVHCVRFTPTGVSYASGSEDGTIRIWQTTP  301



>ref|XP_004235719.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Solanum lycopersicum]
Length=356

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR+ID  PGSVRTVAWLH+DQTILSS  D  G+RLWD+R+ +VV+ L+TK  VTS
Sbjct  133  RPDAPPREIDSSPGSVRTVAWLHSDQTILSSSGDAGGLRLWDVRTGKVVQILETKFPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F LVKS+++PC VESASLEP+FG RFIAGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSHELPCKVESASLEPKFGNRFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             +FDFH GE+IGCNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQ GP
Sbjct  253  HVFDFHTGEEIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLGP  301



>ref|XP_006305259.1| hypothetical protein CARUB_v10009632mg [Capsella rubella]
 gb|EOA38157.1| hypothetical protein CARUB_v10009632mg [Capsella rubella]
Length=343

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 164/201 (82%), Gaps = 3/201 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP ++D  PGS+RT+ WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSIRTLTWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F L+KSYDMPCN+ESASLEP+ G++F+AGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLLKSYDMPCNIESASLEPKSGEKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP--NEATDASAG  111
            R+FDF+ GE+IGCNKGHHGPVHCVRF+P G S  SGSEDGTIRIWQT P  +E  + S+ 
Sbjct  253  RVFDFYTGEEIGCNKGHHGPVHCVRFTPTGVSYASGSEDGTIRIWQTTPANSEENETSSR  312

Query  110  PXKPKVXKXVXVEIDKXHXAK  48
              K  V + V  +I+  H  K
Sbjct  313  RVKHSVDE-VSKKIEGFHINK  332



>ref|XP_009770767.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X1 [Nicotiana sylvestris]
Length=301

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  90   RPDAAPREVAKTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  149

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGGEDMW+
Sbjct  150  AEVSQDGRYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDMWI  209

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            R+FDFH GE++ CNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQTGP
Sbjct  210  RVFDFHTGEELACNKGHHGPVHCVRFAPSGESYASGSEDGTIRIWQTGP  258



>ref|XP_002438635.1| hypothetical protein SORBIDRAFT_10g023300 [Sorghum bicolor]
 gb|EER90002.1| hypothetical protein SORBIDRAFT_10g023300 [Sorghum bicolor]
Length=340

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 159/202 (79%), Gaps = 3/202 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+SVTS
Sbjct  133  RPDAAPRELDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGGED+WV
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGGEDLWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
             +FDF  GE+I CNKGHHGPVHCVRF+PGGES  SGSEDGTIRIWQ  P  + D  A   
Sbjct  253  HVFDFFTGEEIACNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPANSDDNEAANA  312

Query  104  KPKVX---KXVXVEIDKXHXAK  48
              K       V  +I+  H  K
Sbjct  313  NGKTTAGVNEVTTKIEGFHIPK  334



>gb|EPS74468.1| hypothetical protein M569_00279, partial [Genlisea aurea]
Length=306

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DA PR+I+  PGSVR + WLH+DQTIL SC+DT GVRLWD+R+  +VRTL+TKSSVTS
Sbjct  133  RLDATPREIEKSPGSVRALTWLHSDQTILGSCTDTGGVRLWDVRTGSIVRTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSYDMPC VESASLEP++G +F+AGGEDMW+
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCIVESASLEPKYGNKFVAGGEDMWI  252

Query  284  RLFDFHXGEQI-GCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNE  132
             +FDFH GEQI GCNKGHHGPVHCVRFSP GES  SGSEDGTIRIW+TGP E
Sbjct  253  HVFDFHTGEQIVGCNKGHHGPVHCVRFSPEGESYASGSEDGTIRIWETGPGE  304



>ref|XP_009760123.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Nicotiana sylvestris]
Length=355

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPPR+ID  PGSVRTVAWLH+DQT+LSS  D  G+RLWD+RS +VV+TL+TK  VTS
Sbjct  133  RIDAPPREIDSSPGSVRTVAWLHSDQTLLSSSGDAGGLRLWDVRSGKVVQTLETKFPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F LVKSYD+ C VESASLEP+FG RFIAGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYDLSCKVESASLEPKFGNRFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             +FDFH GE+IGCNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQ GP
Sbjct  253  HVFDFHTGEEIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLGP  301



>ref|NP_001142332.1| LOC100274502 [Zea mays]
 gb|ACF88209.1| unknown [Zea mays]
 gb|AFW87111.1| serine-threonine kinase receptor-associated protein [Zea mays]
Length=340

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 159/202 (79%), Gaps = 3/202 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+SVTS
Sbjct  133  RPDAAPRELDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGGED+WV
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGGEDLWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATD---ASA  114
             +FDF  GE+I CNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQ  P  A D   A+A
Sbjct  253  HVFDFFTGEEIACNKGHHGPVHCVRFAPCGESYASGSEDGTIRIWQLSPANADDNEVANA  312

Query  113  GPXKPKVXKXVXVEIDKXHXAK  48
                      V  +I+  H  K
Sbjct  313  NGKTTAGVNEVTTKIEGFHIPK  334



>gb|KJB64820.1| hypothetical protein B456_010G066700 [Gossypium raimondii]
Length=346

 Score =   267 bits (682),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 165/206 (80%), Gaps = 9/206 (4%)
 Frame = -3

Query  641  PDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSA  462
            P+AP R++D  PGSVRTV+W+H+DQT+LSSC+D  GVRLWD+RS ++V+TL+TKS VTSA
Sbjct  134  PEAPLREVDKSPGSVRTVSWMHSDQTLLSSCTDMGGVRLWDVRSGKIVQTLETKSPVTSA  193

Query  461  EVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVR  282
            EVS+DG YITTADG++VKFWDA+ F LVKSY+MPC VESASLEP++G +FIAGGEDMWVR
Sbjct  194  EVSQDGRYITTADGATVKFWDADHFGLVKSYNMPCTVESASLEPKYGNKFIAGGEDMWVR  253

Query  281  LFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP--------NEAT  126
            +FDFH G++  CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQTGP        + A 
Sbjct  254  VFDFHTGDETACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQTGPLTDHEETKSHAA  313

Query  125  DASAGPXKPKVXKXVXVEIDKXHXAK  48
            + S G  K  V + V  +I   H A+
Sbjct  314  NGSVGKVKVSV-EEVSRKIGGFHIAE  338



>ref|NP_001046249.1| Os02g0205400 [Oryza sativa Japonica Group]
 dbj|BAD16018.1| putative serine-threonine kinase receptor-associated protein 
[Oryza sativa Japonica Group]
 dbj|BAD38438.1| putative serine-threonine kinase receptor-associated protein 
[Oryza sativa Japonica Group]
 dbj|BAF08163.1| Os02g0205400 [Oryza sativa Japonica Group]
 gb|EEC72710.1| hypothetical protein OsI_06306 [Oryza sativa Indica Group]
 gb|EEE56531.1| hypothetical protein OsJ_05825 [Oryza sativa Japonica Group]
Length=342

 Score =   266 bits (681),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR+ID  PGSVRTVAWLH+DQ+ILS C+D  GVRLWD+RS ++ +TL+TK++VTS
Sbjct  133  RPDAAPREIDKSPGSVRTVAWLHSDQSILSCCTDMGGVRLWDVRSGKIAQTLETKATVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YI TADGSSVKFWDAN F LVKSY+MPCNVESASLEP++G +FIAGGEDMWV
Sbjct  193  AEVSQDGRYIITADGSSVKFWDANYFGLVKSYNMPCNVESASLEPKYGNKFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGP  108
             +FDF  GE+I CNKGHHGPVHCVRF+PGGES  SGSEDGTIRIWQ GP  + +  + P
Sbjct  253  HVFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLGPATSDEQESPP  311



>ref|XP_009596073.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X4 [Nicotiana tomentosiformis]
Length=341

 Score =   266 bits (680),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 152/178 (85%), Gaps = 2/178 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  134  RPDAAPREVAKTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  193

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGGEDMW+
Sbjct  194  AEVSQDGRYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDMWI  253

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP--NEATDAS  117
            R+F+FH GE++ CNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQTGP  N+  D +
Sbjct  254  RVFNFHTGEELACNKGHHGPVHCVRFAPSGESYASGSEDGTIRIWQTGPLTNDGVDMT  311



>ref|XP_002451748.1| hypothetical protein SORBIDRAFT_04g007180 [Sorghum bicolor]
 gb|EES04724.1| hypothetical protein SORBIDRAFT_04g007180 [Sorghum bicolor]
Length=341

 Score =   266 bits (680),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 163/207 (79%), Gaps = 3/207 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR+ID  PGSVRTV WLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDATPREIDKSPGSVRTVTWLHSDQTILSSCADLGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG +ITT DGSSVKFWDAN F LVKSY+MPC VESASLEP  G +F+ GGEDMWV
Sbjct  193  AEVSQDGRFITTTDGSSVKFWDANHFGLVKSYNMPCAVESASLEPNCGNKFVTGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP--NEATDASAG  111
            R+FDF  GE++ CNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQ GP  ++  +A++ 
Sbjct  253  RVFDFFTGEELACNKGHHGPVHCVRFTPVGESYASGSEDGTIRIWQLGPANSDEQEAASA  312

Query  110  PXKPKV-XKXVXVEIDKXHXAKGAXID  33
              K KV    V  +I+  H +K   ++
Sbjct  313  NGKAKVGVNDVARKIEGFHISKDGQVE  339



>ref|NP_001288531.1| uncharacterized protein LOC103629787 [Zea mays]
 gb|ACN35648.1| unknown [Zea mays]
 gb|AFW76434.1| hypothetical protein ZEAMMB73_231124 [Zea mays]
Length=341

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+S+TS
Sbjct  133  RPDAAPRELDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASITS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGGED+WV
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGGEDLWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATD  123
             +FDF  GE+I CNKGHHGPVHCVRF+PGGES  SGSEDGTIRIWQ  P  A D
Sbjct  253  HVFDFFTGEEIACNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPVNADD  306



>ref|XP_009596074.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X5 [Nicotiana tomentosiformis]
Length=340

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 152/178 (85%), Gaps = 2/178 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  133  RPDAAPREVAKTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGGEDMW+
Sbjct  193  AEVSQDGRYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP--NEATDAS  117
            R+F+FH GE++ CNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQTGP  N+  D +
Sbjct  253  RVFNFHTGEELACNKGHHGPVHCVRFAPSGESYASGSEDGTIRIWQTGPLTNDGVDMT  310



>gb|ACG31749.1| serine-threonine kinase receptor-associated protein [Zea mays]
Length=340

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 158/202 (78%), Gaps = 3/202 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ + V+TL+TK+SVTS
Sbjct  133  RPDAAPRELDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKNVQTLETKASVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGGED+WV
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGGEDLWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATD---ASA  114
             +FDF  GE+I CNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQ  P  A D   A+A
Sbjct  253  HVFDFFTGEEIACNKGHHGPVHCVRFAPCGESYASGSEDGTIRIWQLSPANADDNEVANA  312

Query  113  GPXKPKVXKXVXVEIDKXHXAK  48
                      V  +I+  H  K
Sbjct  313  NGKTTAGVNEVTTKIEGFHIPK  334



>ref|XP_009388533.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Musa acuminata subsp. malaccensis]
Length=342

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 162/201 (81%), Gaps = 6/201 (3%)
 Frame = -3

Query  641  PDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSA  462
            PDAPPR+ID  PGS+RTVAWLH+DQTILSSC+D  GVRLWD++S ++V+TL+TKS VTSA
Sbjct  134  PDAPPREIDKSPGSIRTVAWLHSDQTILSSCTDMGGVRLWDVKSGKIVQTLETKSPVTSA  193

Query  461  EVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVR  282
            EVS+DG YITTADGS+VKFWDAN F L+KSY+M C VESASLEP+ G +F+AGGEDMW+ 
Sbjct  194  EVSQDGRYITTADGSTVKFWDANHFGLIKSYNMSCTVESASLEPKDGNKFVAGGEDMWIH  253

Query  281  LFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATD----ASA  114
            +FDFH GE+I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQ  P  + D     S+
Sbjct  254  VFDFHTGEEIACNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQMNPAVSDDHESHGSS  313

Query  113  GPX-KPKV-XKXVXVEIDKXH  57
            GP  K KV    V  +ID  H
Sbjct  314  GPSGKVKVGVNEVVHKIDGFH  334



>gb|EMS49047.1| Serine-threonine kinase receptor-associated protein [Triticum 
urartu]
Length=320

 Score =   265 bits (676),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 157/204 (77%), Gaps = 5/204 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PGSVRTVAWLH+DQ+ILSSCSD  GVRLWD+RS ++V+TL+TK+ VTS
Sbjct  111  RPDAAPRELDKTPGSVRTVAWLHSDQSILSSCSDMGGVRLWDVRSGKIVQTLETKAPVTS  170

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDM C VESASLEP+ G +FI GGEDMWV
Sbjct  171  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMSCTVESASLEPKSGSKFITGGEDMWV  230

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPN-----EATDA  120
             ++DF  GE+I CNKGHHGPVHCVRF+P GES  SGSEDGTIRIW   P      EA +A
Sbjct  231  HVYDFFTGEEIACNKGHHGPVHCVRFAPVGESYASGSEDGTIRIWPLNPANTEDPEAPNA  290

Query  119  SAGPXKPKVXKXVXVEIDKXHXAK  48
            +  P    V   V  +I+  H  K
Sbjct  291  NGKPKAAAVANEVARKIEGFHITK  314



>ref|XP_003563679.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Brachypodium distachyon]
Length=340

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 152/185 (82%), Gaps = 2/185 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PGSVRTVAWLH+DQ+ILSSC+D  GVRLWD+RS ++V+TL+TK+ VTS
Sbjct  133  RPDAAPRELDKAPGSVRTVAWLHSDQSILSSCTDMGGVRLWDVRSGKIVQTLETKAPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPC VESASLEP+ G +FI GGEDMWV
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFITGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASA--G  111
             +FDF  GE+I CNKGHHGPVHCVRF+P GES  SGSEDGTIRIW   P  A D+ A   
Sbjct  253  HVFDFFTGEEIACNKGHHGPVHCVRFAPVGESYASGSEDGTIRIWPLNPANADDSEAPNA  312

Query  110  PXKPK  96
              KPK
Sbjct  313  NGKPK  317



>dbj|BAE46565.1| putative WD-40 repeat protein [Nicotiana glutinosa]
Length=336

 Score =   264 bits (675),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  133  RPDAAPREVAMTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGGEDMW+
Sbjct  193  AEVSQDGCYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            R+F+FH GE++ CNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQTGP
Sbjct  253  RVFNFHTGEELACNKGHHGPVHCVRFAPSGESYASGSEDGTIRIWQTGP  301



>emb|CDO98105.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 152/181 (84%), Gaps = 2/181 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PDAPPR++   PGSVRT+AWLH+DQ+ILSSC+D  GVRLWD+RS ++VRTL+TKS+VTS
Sbjct  133  QPDAPPREVHDSPGSVRTLAWLHSDQSILSSCTDIGGVRLWDVRSGKIVRTLETKSAVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS DG YITT DGS+VKFWDAN F LV+SYDMPCN+ESASLEPRFG +F+AGGEDMWV
Sbjct  193  TEVSHDGRYITTVDGSTVKFWDANHFGLVRSYDMPCNMESASLEPRFGNKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQ--TGPNEATDASAG  111
             +FDFH G +I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIWQ      E T  + G
Sbjct  253  HVFDFHTGAEIVCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWQILNHNEEETIMANG  312

Query  110  P  108
            P
Sbjct  313  P  313



>gb|EYU24671.1| hypothetical protein MIMGU_mgv1a010043mg [Erythranthe guttata]
Length=324

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPD  P +I+  PGSVRT+ WLH DQTIL SC+D SGVRLWD+R+ ++VRTL+TKSSVTS
Sbjct  133  RPDVGPTEIEKSPGSVRTLTWLHTDQTILGSCTDMSGVRLWDVRTGKIVRTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGGEDMW+
Sbjct  193  AEVSQDGRYITTADGSTVKFWDANHFGLVKSYEMPCIVESASLEPKFGNKFIAGGEDMWI  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
            R+FDF  G ++GCNKGHHGPVHCVRFSPGGES  SGSEDGTIRIW+TG
Sbjct  253  RVFDFDTGAEVGCNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWRTG  300



>ref|XP_004951509.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Setaria italica]
Length=341

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR+I+  P SVRTV WLH+DQTILS+CSD  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAAPREIEKSPSSVRTVTWLHSDQTILSTCSDMGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG +ITT DGSSVKFWDAN + LVKSY+MPC VESASLEP++G +F+ GGEDMWV
Sbjct  193  AEVSQDGRFITTTDGSSVKFWDANHYGLVKSYNMPCAVESASLEPKYGNKFVTGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATD  123
            R+FDF  GE++ CNKGHHGPVHCVRFSP GES  SGSEDGTIRIWQ GP  + D
Sbjct  253  RVFDFFTGEELACNKGHHGPVHCVRFSPVGESYASGSEDGTIRIWQLGPANSED  306



>dbj|BAJ97958.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92033.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=342

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 156/204 (76%), Gaps = 5/204 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PGSVRTVAWLH+DQ+ILSSCSD  GVRLWD+RS ++V+TL+TK+ VTS
Sbjct  133  RPDAAPRELDKTPGSVRTVAWLHSDQSILSSCSDMGGVRLWDVRSGKIVQTLETKAPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDM C VESASLEP+ G +FI GGEDMWV
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMSCTVESASLEPKSGSKFITGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASA---  114
             ++DF  GE+I CNKGHHGPVHCVRF+P GES  SGSEDGTIRIW   P    DA A   
Sbjct  253  HVYDFFTGEEIACNKGHHGPVHCVRFAPVGESYASGSEDGTIRIWPLNPASTDDAEAPTA  312

Query  113  --GPXKPKVXKXVXVEIDKXHXAK  48
               P    V   V  +I+  H +K
Sbjct  313  NGKPKAAAVANEVARKIEGFHISK  336



>gb|AFW87112.1| serine-threonine kinase receptor-associated protein [Zea mays]
Length=484

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 159/202 (79%), Gaps = 3/202 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TK+SVTS
Sbjct  133  RPDAAPRELDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKASVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDMPCNVESASLEP+ G +F+AGGED+WV
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMPCNVESASLEPKSGSKFVAGGEDLWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATD---ASA  114
             +FDF  GE+I CNKGHHGPVHCVRF+P GES  SGSEDGTIRIWQ  P  A D   A+A
Sbjct  253  HVFDFFTGEEIACNKGHHGPVHCVRFAPCGESYASGSEDGTIRIWQLSPANADDNEVANA  312

Query  113  GPXKPKVXKXVXVEIDKXHXAK  48
                      V  +I+  H  K
Sbjct  313  NGKTTAGVNEVTTKIEGFHIPK  334



>ref|XP_006647058.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Oryza brachyantha]
Length=344

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 158/211 (75%), Gaps = 0/211 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR+ID  PGSVRTVAWLH+DQ+ILS C+D  GVRLWD+RS ++V+TL+T + VTS
Sbjct  133  RPDAAPREIDKSPGSVRTVAWLHSDQSILSCCTDMGGVRLWDVRSGKIVQTLETNAPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YI TADGSSVKFWDAN F LVKSY+M CNVESASLEP++G +FIAGGEDMWV
Sbjct  193  AEVSQDGRYIITADGSSVKFWDANYFGLVKSYNMSCNVESASLEPKYGNKFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
             +FDF  GE+I CNKGHHGPVHCVRF+PGGES  SGSEDGTIRIWQ GP  + +  + P 
Sbjct  253  HVFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLGPANSDEQESPPP  312

Query  104  KPKVXKXVXVEIDKXHXAKGAXIDXDXXNEE  12
                 K      D     +G  +  D    E
Sbjct  313  PDGSGKLKATASDAARKIEGFHLPKDGQQPE  343



>emb|CCW03293.1| similar to serine-threonine kinase receptor-associated protein-like 
[Lupinus angustifolius]
Length=345

 Score =   263 bits (672),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 171/218 (78%), Gaps = 10/218 (5%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRTVAWLH+DQTILSSC+D  GV LWD+RS ++ +TL+TKSSVTS
Sbjct  131  RPDAPPREVDKSPGSVRTVAWLHSDQTILSSCTDMGGV-LWDVRSGKIEQTLETKSSVTS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS++KFWDAN + LVKSYDMPC +ESASLEP++G +F+AGGEDMWV
Sbjct  190  AEVSQDGRYITTADGSTIKFWDAN-YGLVKSYDMPCTMESASLEPKYGNKFVAGGEDMWV  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP-----NEATDA  120
            R+FDFH G +I CNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQTGP     +EA   
Sbjct  249  RVFDFHTGNEI-CNKGHHGPVHCIRFSPGGESYASGSEDGTIRIWQTGPLTNDESEALSR  307

Query  119  SAGPXKPKV-XKXVXVEIDKXHXA-KGAXIDXDXXNEE  12
                 K +V  + V  +ID  H A +G   + +   EE
Sbjct  308  DGSTEKVEVTAEEVSRKIDGFHIADEGKSKEKEEAREE  345



>ref|XP_006656206.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Oryza brachyantha]
Length=343

 Score =   263 bits (671),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PG+VRTVAWLH+DQTILSSCSD  GVRLWD+R+ ++V+TL+TK+ VTS
Sbjct  133  RPDAAPRELDKAPGNVRTVAWLHSDQTILSSCSDMGGVRLWDVRTGKIVQTLETKAPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+D  +ITTADGSSVKFWDAN F LVKSYDMPC VESASLEP+ G +FI GGEDMWV
Sbjct  193  AEVSQDSRFITTADGSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFIVGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATD  123
             LFDF  GE+I CNKGHHGPVHCVRF+PGGES  SGSEDGTIRIWQ  P  A D
Sbjct  253  HLFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPPNADD  306



>ref|NP_001057997.1| Os06g0598900 [Oryza sativa Japonica Group]
 dbj|BAF19911.1| Os06g0598900 [Oryza sativa Japonica Group]
Length=342

 Score =   263 bits (671),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PG+VRTVAWLH+DQTILSSCSD  GVRLWD+R+ ++V+TL+TK+ VTS
Sbjct  133  RPDAAPRELDKAPGNVRTVAWLHSDQTILSSCSDMGGVRLWDVRTGKIVQTLETKAPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+D  +ITTADGSSVKFWDAN F LVKSYDMPC VESASLEP+ G +FI GGEDMWV
Sbjct  193  AEVSQDSRFITTADGSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFIVGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASA  114
             +FDF  GE+I CNKGHHGPVHCVRF+PGGES  SGSEDGTIRIWQ  P  A D  A
Sbjct  253  HVFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPPNADDNEA  309



>gb|EEC80916.1| hypothetical protein OsI_23591 [Oryza sativa Indica Group]
Length=302

 Score =   261 bits (666),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PG+VRTVAWLH+DQTILSSCSD  GVRLWD+R+ ++V+TL+TK+ VTS
Sbjct  90   RPDAAPRELDKAPGNVRTVAWLHSDQTILSSCSDMGGVRLWDVRTGKIVQTLETKAPVTS  149

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+D  +ITTADGSSVKFWDAN F LVKSYDMPC VESASLEP+ G +FI GGEDMWV
Sbjct  150  SEVSQDSRFITTADGSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFIVGGEDMWV  209

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASA  114
             +FDF  GE+I CNKGHHGPVHCVRF+PGGES  SGSEDGTIRIWQ  P  A D  A
Sbjct  210  HVFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPPNADDNEA  266



>gb|KFK35774.1| hypothetical protein AALP_AA4G034300 [Arabis alpina]
Length=345

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP ++D  PGS+RT+ +LH+DQTILSSC+D  GVRLWD+RS  +V+TL+TKS VTS
Sbjct  133  RLDAPPTEVDKSPGSIRTLTYLHSDQTILSSCTDIGGVRLWDVRSGNIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YI TADGS+VKFWDAN F LVKS+DMPC +ESASLEP+ G++F+AGGEDMWV
Sbjct  193  AEVSQDGRYIITADGSTVKFWDANHFGLVKSFDMPCTIESASLEPKSGEKFVAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATD  123
            R+FDF+ GE+IGCNKGHHGPVHCVRFSP GES  SGSEDGTIRIWQT P    D
Sbjct  253  RVFDFYTGEEIGCNKGHHGPVHCVRFSPTGESYASGSEDGTIRIWQTNPPNPED  306



>dbj|BAJ92707.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=342

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 155/204 (76%), Gaps = 5/204 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PGSVRTVAWLH+DQ+ILSSCSD  GVRLWD+RS ++V+TL+TK+ VTS
Sbjct  133  RPDAAPRELDKTPGSVRTVAWLHSDQSILSSCSDMGGVRLWDVRSGKIVQTLETKAPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDM C VESASLEP+ G +F  GGEDMWV
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMSCTVESASLEPKSGSKFFTGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASA---  114
             ++DF  GE+I CNKGHHGPVHCVRF+P GES  SGSEDGTIRIW   P    DA A   
Sbjct  253  HVYDFFTGEEIACNKGHHGPVHCVRFAPVGESYASGSEDGTIRIWPLNPASTDDAEAPTA  312

Query  113  --GPXKPKVXKXVXVEIDKXHXAK  48
               P    V   V  +I+  H +K
Sbjct  313  NGKPKAAAVANEVARKIEGFHISK  336



>dbj|BAD32940.1| putative WD-40 repeat protein [Oryza sativa Japonica Group]
 gb|EAZ37546.1| hypothetical protein OsJ_21874 [Oryza sativa Japonica Group]
Length=345

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PG+VRTVAWLH+DQTILSSCSD  GVRLWD+R+ ++V+TL+TK+ VTS
Sbjct  133  RPDAAPRELDKAPGNVRTVAWLHSDQTILSSCSDMGGVRLWDVRTGKIVQTLETKAPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+D  +ITTADGSSVKFWDAN F LVKSYDMPC VESASLEP+ G +FI GGEDMWV
Sbjct  193  AEVSQDSRFITTADGSSVKFWDANHFGLVKSYDMPCTVESASLEPKSGSKFIVGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASA  114
             +FDF  GE+I CNKGHHGPVHCVRF+PGGES  SGSEDGTIRIWQ  P  A D  A
Sbjct  253  HVFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPPNADDNEA  309



>gb|EMT15935.1| hypothetical protein F775_06783 [Aegilops tauschii]
Length=367

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 151/185 (82%), Gaps = 2/185 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PGSVRTVAWLH+DQ+ILSSCSD  GVRLWD+RS ++V+TL+TK+ VTS
Sbjct  156  RPDAAPRELDKTPGSVRTVAWLHSDQSILSSCSDMGGVRLWDVRSGKIVQTLETKAPVTS  215

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDM C VESASLEP+ G +FI GGEDMWV
Sbjct  216  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMSCTVESASLEPKSGSKFITGGEDMWV  275

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASA--G  111
             ++DF  GE+I CNKGHHGPVHCVRF+P GES  SGSEDGTIRIW   P  A DA A   
Sbjct  276  HVYDFFTGEEIACNKGHHGPVHCVRFAPVGESYASGSEDGTIRIWPLNPANADDAEAPTA  335

Query  110  PXKPK  96
              KPK
Sbjct  336  NGKPK  340



>ref|XP_010537966.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Tarenaya hassleriana]
Length=259

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR+ID  PGS+RT+AWLH+D+TILSSC+D  GVRLWD R+ ++++TL+TKS VTS
Sbjct  90   RPDAPPREIDKSPGSIRTLAWLHSDKTILSSCTDVGGVRLWDTRTGDIIQTLETKSPVTS  149

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVSRDG YITTADGS+VKFWDAN F LVKSY+MPC+VESASLEP+ G+ FIAGGEDMWV
Sbjct  150  AEVSRDGRYITTADGSTVKFWDANHFGLVKSYEMPCSVESASLEPKKGETFIAGGEDMWV  209

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQ  147
             +FDF  GE+ GCNKGHHG VHCVRF PGGES  SGSEDGTIRIWQ
Sbjct  210  HVFDFQTGEETGCNKGHHGAVHCVRFEPGGESYGSGSEDGTIRIWQ  255



>gb|EMT09457.1| hypothetical protein F775_27621 [Aegilops tauschii]
Length=340

 Score =   259 bits (663),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 160/202 (79%), Gaps = 3/202 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PD  P+++D  PGSVRTVAWLHNDQTILSSC+DT GVRLWD+RS ++V+TL+TK  VTS
Sbjct  133  KPDVAPKELDKSPGSVRTVAWLHNDQTILSSCTDTGGVRLWDVRSEKIVQTLETKGPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG +ITTADGSSVKFWDAN F LVKSYDM   VESASLEP+ G +FIAGGEDMWV
Sbjct  193  AEVSQDGRFITTADGSSVKFWDANHFGLVKSYDMSFIVESASLEPKSGSKFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPN--EATDASAG  111
             +FDF  GE+I CNKGHHGPVHCVRF+PGGES  SGSEDGTIRIWQ  P   +A +A   
Sbjct  253  HVFDFLTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIRIWQLSPPNVDAEEAVDT  312

Query  110  PXKPKV-XKXVXVEIDKXHXAK  48
              KPK   + +  +I+  H AK
Sbjct  313  NGKPKAGAEEIACKIEGFHIAK  334



>ref|XP_010537963.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Tarenaya hassleriana]
Length=302

 Score =   258 bits (659),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR+ID  PGS+RT+AWLH+D+TILSSC+D  GVRLWD R+ ++++TL+TKS VTS
Sbjct  133  RPDAPPREIDKSPGSIRTLAWLHSDKTILSSCTDVGGVRLWDTRTGDIIQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVSRDG YITTADGS+VKFWDAN F LVKSY+MPC+VESASLEP+ G+ FIAGGEDMWV
Sbjct  193  AEVSRDGRYITTADGSTVKFWDANHFGLVKSYEMPCSVESASLEPKKGETFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQ  147
             +FDF  GE+ GCNKGHHG VHCVRF PGGES  SGSEDGTIRIWQ
Sbjct  253  HVFDFQTGEETGCNKGHHGAVHCVRFEPGGESYGSGSEDGTIRIWQ  298



>ref|XP_006305313.1| hypothetical protein CARUB_v10009691mg [Capsella rubella]
 gb|EOA38211.1| hypothetical protein CARUB_v10009691mg [Capsella rubella]
Length=332

 Score =   259 bits (661),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPP++I   PGS+RTV WLH+D+TILSSC+DT  +RLWD+RS ++V+TL+TK  VTS
Sbjct  128  RPDAPPKEIGNSPGSIRTVEWLHSDKTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTS  187

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F L+KSYDMPCNVESASLEP+ G  FIAGGEDMWV
Sbjct  188  AEVSQDGRYITTADGSSVKFWDANSFGLLKSYDMPCNVESASLEPKLGNSFIAGGEDMWV  247

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              FDF  GE+IGCNKGHHGPVHCVR++PGGES  SGSEDGT+RIW  G
Sbjct  248  HRFDFQTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWVVG  295



>ref|NP_563978.1| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
 gb|AAD39675.1|AC007591_40 Strong similarity to gb|AF096285 serine-threonine kinase receptor-associated 
protein from Mus musculus and contains 5 PF|00400 
WD40, G-beta repeat domains. EST gb|F14050 comes from 
this gene [Arabidopsis thaliana]
 gb|AAM61168.1| Similar to unr-interacting protein and contains WD40 domains 
[Arabidopsis thaliana]
 gb|AAN41335.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29327.1| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
Length=333

 Score =   256 bits (655),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPP+++   PGS+RTV WLH+D TILSSC+DT  +RLWD+RS ++V TL+TKS VTS
Sbjct  128  RPDAPPKEVGNSPGSIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVHTLETKSPVTS  187

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDA  F L+KSYDMPCNVESASLEP+ G  FIAGGEDMWV
Sbjct  188  AEVSQDGRYITTADGSSVKFWDAKNFGLLKSYDMPCNVESASLEPKHGNTFIAGGEDMWV  247

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              FDF  GE+IGCNKGHHGPVHCVR++PGGES  SGSEDGT+RIW  G
Sbjct  248  HRFDFQTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWVVG  295



>ref|XP_009148941.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Brassica rapa]
 emb|CDY36565.1| BnaA06g10180D [Brassica napus]
Length=335

 Score =   256 bits (655),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPP+++   PGS+RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+TK  VTS
Sbjct  128  RPDAPPKEVGNSPGSIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTS  187

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F L+KSY+MPCNVESASLEP+ G  FIAGGEDMWV
Sbjct  188  AEVSQDGRYITTADGSSVKFWDANNFGLLKSYEMPCNVESASLEPKHGNTFIAGGEDMWV  247

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQ  147
              FDF  GE+IGCNKGHHGPVHCVR+SPGGES  SGSEDGT+RIW+
Sbjct  248  HRFDFQTGEEIGCNKGHHGPVHCVRYSPGGESYTSGSEDGTVRIWE  293



>emb|CDY39650.1| BnaC05g11790D [Brassica napus]
Length=335

 Score =   256 bits (654),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPD PP+++ G PGS+RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+TK  VTS
Sbjct  128  RPDVPPKEVGGSPGSIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTS  187

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F L+KSY+MPCN+ESASLEP+ G  FIAGGEDMWV
Sbjct  188  AEVSQDGRYITTADGSSVKFWDANNFGLLKSYEMPCNIESASLEPKHGNTFIAGGEDMWV  247

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQ  147
              FDF  GE+IGCNKGHHGPVHCVR+SPGGES  SGSEDGT+RIW+
Sbjct  248  HRFDFQTGEEIGCNKGHHGPVHCVRYSPGGESYTSGSEDGTVRIWE  293



>ref|XP_010497185.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=332

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPP++I   PG +RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+TK  VTS
Sbjct  128  RPDAPPKEIGNSPGLIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTS  187

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F L+KSYDMPCNVESASLEP+ G  FIAGGEDMWV
Sbjct  188  AEVSQDGRYITTADGSSVKFWDANNFGLLKSYDMPCNVESASLEPKHGNTFIAGGEDMWV  247

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP-NEATDASAGP  108
              FDF  GE+IGCNKGHHGPVHCVR++PGGES  SGSEDGT+RIW  G  N     S+G 
Sbjct  248  HRFDFQTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWVVGSVNHEESNSSGH  307

Query  107  XK  102
             K
Sbjct  308  VK  309



>ref|XP_002890105.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66364.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=333

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPP+++   PGS+RTV WLH+D TILSSC+DT  +RLWD+RS ++V TL+TKS VTS
Sbjct  128  RPDAPPKEVGNSPGSIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVHTLETKSPVTS  187

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDA  F L+KSYDMPCNVESASLEP+ G  FIAGGEDMWV
Sbjct  188  AEVSQDGRYITTADGSSVKFWDAKNFGLLKSYDMPCNVESASLEPKHGNTFIAGGEDMWV  247

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              FDF  GE+IGCNKGHHGPVHCVR++PGGES  SGSEDGT+RIW  G
Sbjct  248  HRFDFQTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWVVG  295



>ref|XP_010476637.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=332

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPP++I   PG +RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+TK  VTS
Sbjct  128  RPDAPPKEIGNSPGLIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTS  187

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F L+KSYDMPCNVESASLEP+ G  FIAGGEDMWV
Sbjct  188  AEVSQDGRYITTADGSSVKFWDANNFGLLKSYDMPCNVESASLEPKHGNTFIAGGEDMWV  247

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              FDF  GE+IGCNKGHHGPVHCVR++PGGES  SGSEDGT+RIW  G
Sbjct  248  HRFDFQTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWVVG  295



>gb|KJB27111.1| hypothetical protein B456_004G278600 [Gossypium raimondii]
Length=303

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++D  PGSVRTV+W+H+DQTILSSC+D  GVRLWD+RS ++V+TL+T+SSVTS
Sbjct  133  RPDAVPREVDKSPGSVRTVSWMHSDQTILSSCTDMGGVRLWDVRSGKIVKTLETESSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YI TADGS+VK WDAN F LV+ Y+MPC VESASLEP +G +FIAGGEDMWV
Sbjct  193  AEVSQDGRYIMTADGSTVKIWDANHFGLVRRYNMPCTVESASLEPIYGNKFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQ  147
            R+FDF  G++I CNKGHHGPVHCVRFSP GES  SGSEDGTIRIW 
Sbjct  253  RVFDFQSGDEIACNKGHHGPVHCVRFSPKGESYASGSEDGTIRIWH  298



>emb|CDY55992.1| BnaA09g56870D [Brassica napus]
Length=336

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPP+++   PGS+RTV WLH+D TILSSC+DT  +RLWD+R+ ++V+TL+TK  VTS
Sbjct  128  RPDAPPKEVGTPPGSIRTVEWLHSDNTILSSCTDTGDIRLWDIRNDKIVQTLETKFPVTS  187

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F LVKSY+MPCNVESASLEP+ G  FIAGGEDMWV
Sbjct  188  AEVSQDGRYITTADGSSVKFWDANNFGLVKSYEMPCNVESASLEPKNGNTFIAGGEDMWV  247

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQ  147
              FDFH GE+IGCNKGHHGPVHCVR++PGG+S  SGSEDGT+RIW+
Sbjct  248  HRFDFHTGEEIGCNKGHHGPVHCVRYAPGGDSYTSGSEDGTVRIWE  293



>gb|KHG29669.1| Serine-threonine kinase receptor-associated [Gossypium arboreum]
Length=303

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
             PDA PR++D  PGSVRTV+W+H+DQTILSSC+D  GVRLWD+RS ++V+TL+TKSSVTS
Sbjct  133  HPDALPREVDKSPGSVRTVSWMHSDQTILSSCTDMGGVRLWDVRSGDIVKTLETKSSVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+V  WDAN F LV+ Y+MPC VESASLEP +G +FIAGGEDMWV
Sbjct  193  AEVSQDGRYITTADGSTVNIWDANHFGLVRRYNMPCTVESASLEPIYGNKFIAGGEDMWV  252

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQ  147
            R+FDF  G++I CNKGHHGPVHCVRFSP GES  SGSEDGTIRIW 
Sbjct  253  RVFDFQSGDEIACNKGHHGPVHCVRFSPKGESYASGSEDGTIRIWH  298



>ref|XP_009117826.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Brassica rapa]
Length=336

 Score =   254 bits (649),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPP+++   PGS+RTV WLH+D TILSSC+DT  +RLWD+R+ ++V+TL+TK  VTS
Sbjct  128  RPDAPPKEVGTPPGSIRTVEWLHSDNTILSSCTDTGDIRLWDIRNDKIVQTLETKFPVTS  187

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YI+TADGSSVKFWDAN F LVKSY+MPCNVESASLEP+ G  FIAGGEDMWV
Sbjct  188  AEVSQDGRYISTADGSSVKFWDANNFGLVKSYEMPCNVESASLEPKNGNTFIAGGEDMWV  247

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQ  147
              FDFH GE+IGCNKGHHGPVHCVR++PGG+S  SGSEDGT+RIW+
Sbjct  248  HRFDFHTGEEIGCNKGHHGPVHCVRYAPGGDSYTSGSEDGTVRIWE  293



>ref|XP_006416902.1| hypothetical protein EUTSA_v10008159mg [Eutrema salsugineum]
 gb|ESQ35255.1| hypothetical protein EUTSA_v10008159mg [Eutrema salsugineum]
Length=332

 Score =   254 bits (648),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA P+++   PGS+RTV WLH+D TILSSC+DT  VRLWD+RS ++V+TL+TK  VTS
Sbjct  128  RPDAAPKEVGNSPGSIRTVEWLHSDNTILSSCTDTGDVRLWDIRSDKIVQTLETKFPVTS  187

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS DG YITTADGSSVKFWDAN F L+KSY+MPCNVESASLEP+ G  FIAGGEDMWV
Sbjct  188  AEVSHDGRYITTADGSSVKFWDANNFGLLKSYEMPCNVESASLEPKHGNTFIAGGEDMWV  247

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              FDF  GE+IGCNKGHHGPVHCVR++PGGES  SGSEDGT+RIW+ G
Sbjct  248  HRFDFRTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWEVG  295



>emb|CDX81717.1| BnaC08g38840D [Brassica napus]
Length=336

 Score =   252 bits (643),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPP+++   PGS+RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+T   VTS
Sbjct  128  RPDAPPKEVGTPPGSIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETTFPVTS  187

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F LVKSY+MPCNVESASLEP+ G  FIAGGEDMWV
Sbjct  188  AEVSQDGRYITTADGSSVKFWDANNFGLVKSYEMPCNVESASLEPKNGNTFIAGGEDMWV  247

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQ  147
              FDF  GE+IGCNKGHHGPVHCVR++PGGES  SGSEDGT+RIW+
Sbjct  248  HRFDFQTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWE  293



>ref|XP_009596072.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X3 [Nicotiana tomentosiformis]
Length=363

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 153/212 (72%), Gaps = 36/212 (17%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  122  RPDAAPREVAKTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  181

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGGEDMW+
Sbjct  182  AEVSQDGRYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDMWI  241

Query  284  RLFDFHXGEQIG----------------------------------CNKGHHGPVHCVRF  207
            R+F+FH GE++G                                  CNKGHHGPVHCVRF
Sbjct  242  RVFNFHTGEELGLDKVTYPDKGFFPLVLVIHQNSGRLYHLHDQRQACNKGHHGPVHCVRF  301

Query  206  SPggesxxsgsEDGTIRIWQTGP--NEATDAS  117
            +P GES  SGSEDGTIRIWQTGP  N+  D +
Sbjct  302  APSGESYASGSEDGTIRIWQTGPLTNDGVDMT  333



>ref|XP_010459083.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Camelina sativa]
Length=332

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            R DAPP++I   PG +RTV WLH+D TILSSC+DT  +RLWD+RS ++V+TL+TK  VTS
Sbjct  128  RLDAPPKEIGNSPGLIRTVEWLHSDNTILSSCTDTGDIRLWDIRSDKIVQTLETKFPVTS  187

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVSRDG YITTADGSSVKFWDAN F L+KSYDMPCNVESASLEP+    FIAGGEDMWV
Sbjct  188  AEVSRDGRYITTADGSSVKFWDANNFGLLKSYDMPCNVESASLEPKHENTFIAGGEDMWV  247

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              FDF  GE+IGCNKGHHGPVHCVR++PGGES  SGSEDGT+RIW  G
Sbjct  248  HRFDFQTGEEIGCNKGHHGPVHCVRYAPGGESYTSGSEDGTVRIWVVG  295



>ref|XP_009596070.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X1 [Nicotiana tomentosiformis]
Length=375

 Score =   251 bits (640),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 153/212 (72%), Gaps = 36/212 (17%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  134  RPDAAPREVAKTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  193

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGGEDMW+
Sbjct  194  AEVSQDGRYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDMWI  253

Query  284  RLFDFHXGEQIG----------------------------------CNKGHHGPVHCVRF  207
            R+F+FH GE++G                                  CNKGHHGPVHCVRF
Sbjct  254  RVFNFHTGEELGLDKVTYPDKGFFPLVLVIHQNSGRLYHLHDQRQACNKGHHGPVHCVRF  313

Query  206  SPggesxxsgsEDGTIRIWQTGP--NEATDAS  117
            +P GES  SGSEDGTIRIWQTGP  N+  D +
Sbjct  314  APSGESYASGSEDGTIRIWQTGPLTNDGVDMT  345



>ref|XP_009596071.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X2 [Nicotiana tomentosiformis]
Length=374

 Score =   250 bits (639),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 153/212 (72%), Gaps = 36/212 (17%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++   PGSVR V WLH+DQTILSSC+D+ GVRLWD+R+ ++VRTL+TKS VTS
Sbjct  133  RPDAAPREVAKTPGSVRAVTWLHSDQTILSSCTDSGGVRLWDVRTGDIVRTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITT DG SVKFWDAN F LVKSY+MPC VESASLEP++G +F+AGGEDMW+
Sbjct  193  AEVSQDGRYITTCDGFSVKFWDANHFGLVKSYNMPCTVESASLEPKYGLKFVAGGEDMWI  252

Query  284  RLFDFHXGEQIG----------------------------------CNKGHHGPVHCVRF  207
            R+F+FH GE++G                                  CNKGHHGPVHCVRF
Sbjct  253  RVFNFHTGEELGLDKVTYPDKGFFPLVLVIHQNSGRLYHLHDQRQACNKGHHGPVHCVRF  312

Query  206  SPggesxxsgsEDGTIRIWQTGP--NEATDAS  117
            +P GES  SGSEDGTIRIWQTGP  N+  D +
Sbjct  313  APSGESYASGSEDGTIRIWQTGPLTNDGVDMT  344



>ref|XP_008785435.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Phoenix dactylifera]
Length=322

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 141/189 (75%), Gaps = 26/189 (14%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GV                     S
Sbjct  133  RPDAPPREVDKSPGSIRTVAWLHSDQTILSSCTDIGGV---------------------S  171

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGSSVKFWDAN F LVKSY+MPC VESASLEP+FG RFIAGGED+WV
Sbjct  172  AEVSQDGRYITTADGSSVKFWDANHFGLVKSYNMPCTVESASLEPKFGNRFIAGGEDLWV  231

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP-----NEATDA  120
             +FDFH GEQI CNKGHHGPVHCVRFSP G+S  SGSEDGTIRIWQT P     NEAT A
Sbjct  232  HVFDFHSGEQITCNKGHHGPVHCVRFSPMGKSYASGSEDGTIRIWQTSPATADENEATGA  291

Query  119  SAGPXKPKV  93
            +    K KV
Sbjct  292  NGAAGKVKV  300



>gb|KEH23437.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
Length=762

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 153/193 (79%), Gaps = 16/193 (8%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA P+++D  PGSVR+VAWLH+DQTILSSC+D  GVRLWD+R+ ++V+TLDTKS +TS
Sbjct  546  RPDATPKEVDKSPGSVRSVAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLDTKSPMTS  605

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVS+DG YITTADGS+VKFW AN + LVKSYDMPCNVESASLEP+FG +F+AGGED+WV
Sbjct  606  AEVSQDGCYITTADGSTVKFWYANHYGLVKSYDMPCNVESASLEPKFGNKFVAGGEDLWV  665

Query  284  RLFDFHXG---------------EQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIW  150
             +F FH                 + + CNKG+HGPVHCVRFSPGGES  SGSEDGTIRIW
Sbjct  666  HVFYFHRAMRLHTQVHQFQLSPLQSMTCNKGYHGPVHCVRFSPGGESYASGSEDGTIRIW  725

Query  149  QTGPNEATDASAG  111
            QTGP  A D S G
Sbjct  726  QTGP-LAHDESEG  737



>ref|XP_001756882.1| predicted protein [Physcomitrella patens]
 gb|EDQ78113.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   226 bits (575),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 140/175 (80%), Gaps = 4/175 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGS-VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVT  468
            RPDAPP  ++  P + +R   W H+DQTILSS +D  GVR+WD+R+  VVRTLDTKSS T
Sbjct  133  RPDAPPTLLESKPETPIRAAVWHHSDQTILSSSNDIGGVRVWDVRTKSVVRTLDTKSSCT  192

Query  467  SAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMW  288
            S EVSRDG YITTADG++VKFWDAN F LVKSY MP  VESASL P  GK FIAGG+DMW
Sbjct  193  SVEVSRDGRYITTADGNTVKFWDANHFGLVKSYSMPRPVESASLFPSRGK-FIAGGDDMW  251

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT--GPNEA  129
            VRLFDF  G++I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIW+T  G +EA
Sbjct  252  VRLFDFDTGDEIECNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWKTVNGNDEA  306



>ref|XP_008385958.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Malus domestica]
Length=274

 Score =   222 bits (565),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 122/136 (90%), Gaps = 1/136 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGSVRT AWLH+DQTILSSC+D  GVRLWD+R+ ++V+TL+TKSSVTS
Sbjct  134  RPDAPPREVDKSPGSVRTAAWLHSDQTILSSCTDMGGVRLWDVRTGKIVQTLETKSSVTS  193

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPC VESASLEP+FG +FIAGGEDMWV
Sbjct  194  SEVSQDGRYITTADGSTVKFWDANYFGLVKSYNMPCTVESASLEPKFGNKFIAGGEDMWV  253

Query  284  RLFDFHXGEQIG-CNK  240
             +FDFH GE+IG C+K
Sbjct  254  HVFDFHTGEEIGMCSK  269



>gb|AFK43194.1| unknown [Medicago truncatula]
Length=185

 Score =   218 bits (556),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = -3

Query  536  GVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPC  357
            GVRLWD+R+ ++V+TLDTKS +TSAEVS+DG YITTADGS+VKFWDAN + LVKSYDMPC
Sbjct  3    GVRLWDVRTGKIVQTLDTKSPMTSAEVSQDGRYITTADGSTVKFWDANHYGLVKSYDMPC  62

Query  356  NVESASLEPRFGKRFIAGGEDMWVRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsg  177
            NVESASLEP+FG +F+AGGED+WV +FDFH G++I CNKGHHGPVHCV+FSPGGES  SG
Sbjct  63   NVESASLEPKFGNKFVAGGEDLWVHVFDFHTGDEIACNKGHHGPVHCVQFSPGGESYASG  122

Query  176  sEDGTIRIWQTGPNEATDASAG  111
            SEDGTIRIWQTGP  A D S G
Sbjct  123  SEDGTIRIWQTGP-LAHDESEG  143



>gb|KCW68994.1| hypothetical protein EUGRSUZ_F02555 [Eucalyptus grandis]
Length=265

 Score =   221 bits (563),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G +FIAGGEDMWV
Sbjct  193  SEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCNIESASLEPKLGNKFIAGGEDMWV  252

Query  284  RLFDFHXGEQIG  249
             +FDFH GE+IG
Sbjct  253  HIFDFHTGEEIG  264



>gb|KCW68993.1| hypothetical protein EUGRSUZ_F02555 [Eucalyptus grandis]
Length=304

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GVRLWD+RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGVRLWDVRSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            +EVS+DG YITTADGS+VKFWDAN F LVKSY+MPCN+ESASLEP+ G +FIAGGEDMWV
Sbjct  193  SEVSQDGRYITTADGSTVKFWDANHFGLVKSYNMPCNIESASLEPKLGNKFIAGGEDMWV  252

Query  284  RLFDFHXGEQIG  249
             +FDFH GE+IG
Sbjct  253  HIFDFHTGEEIG  264



>ref|XP_001777192.1| predicted protein [Physcomitrella patens]
 gb|EDQ57972.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   221 bits (562),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 141/195 (72%), Gaps = 2/195 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGS-VRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVT  468
            RPDAPP  ++  P + +R   W H+DQTILSS +D  G+R+WD+R+  VVRTLDTKSS T
Sbjct  133  RPDAPPTLLECSPETPIRAAVWHHSDQTILSSSNDIGGLRVWDVRTKSVVRTLDTKSSCT  192

Query  467  SAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMW  288
            S EVSRDG YITTA G++V FWDAN F LVKSY MP  VESASL P  GK FIAGG+DMW
Sbjct  193  SVEVSRDGRYITTAHGNTVNFWDANHFGLVKSYTMPRPVESASLFPSKGK-FIAGGDDMW  251

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGP  108
            VRLFDF  G++I CNKGHHGPVHCVRFSPGGES  SGSEDGTIRIW+T          G 
Sbjct  252  VRLFDFDTGDEIECNKGHHGPVHCVRFSPGGESYASGSEDGTIRIWKTVNGSQEAEVGGL  311

Query  107  XKPKVXKXVXVEIDK  63
             +      + V +D+
Sbjct  312  AEAAAGNQIKVRVDE  326



>ref|XP_002977277.1| hypothetical protein SELMODRAFT_151778 [Selaginella moellendorffii]
 gb|EFJ21886.1| hypothetical protein SELMODRAFT_151778 [Selaginella moellendorffii]
Length=342

 Score =   220 bits (561),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA P +++G   ++R+  W H+DQTILSSC+DT  VRLWD+R+   VR L+TKS  TS
Sbjct  133  RPDAAPTEMEGLTSTIRSAVWHHSDQTILSSCNDTGSVRLWDVRTKTTVRQLETKSPCTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVSRDG YITTADG+SVKFWDAN F +VKS+ M   +ESASL P  GK F+AGG+DMWV
Sbjct  193  VEVSRDGRYITTADGNSVKFWDANHFGMVKSFTMARPMESASLYPALGK-FVAGGDDMWV  251

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            R+FDF+ GE+I C KGHHGPVHCVRFSPGGES  SGSEDGTIRIWQT
Sbjct  252  RVFDFYTGEEIECCKGHHGPVHCVRFSPGGESFASGSEDGTIRIWQT  298



>ref|XP_002992164.1| hypothetical protein SELMODRAFT_186588 [Selaginella moellendorffii]
 gb|EFJ06819.1| hypothetical protein SELMODRAFT_186588 [Selaginella moellendorffii]
Length=342

 Score =   220 bits (561),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA P +++G   ++R+  W H+DQTILSSC+DT  VRLWD+R+   VR L+TKS  TS
Sbjct  133  RPDAAPTEMEGLTSTIRSAVWHHSDQTILSSCNDTGSVRLWDVRTKTTVRQLETKSPCTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVSRDG YITTADG+SVKFWDAN F +VKS+ M   +ESASL P  GK F+AGG+DMWV
Sbjct  193  VEVSRDGRYITTADGNSVKFWDANHFGMVKSFTMARPMESASLYPALGK-FVAGGDDMWV  251

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            R+FDF+ GE+I C KGHHGPVHCVRFSPGGES  SGSEDGTIRIWQT
Sbjct  252  RVFDFYTGEEIECCKGHHGPVHCVRFSPGGESFASGSEDGTIRIWQT  298



>gb|KDO52917.1| hypothetical protein CISIN_1g018784mg [Citrus sinensis]
Length=264

 Score =   215 bits (548),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++    GS+RTVAWLH+DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVGNSSGSIRTVAWLHSDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVSRDG YITTADGSSVKFWDAN F LVK Y+MPCN ESASLEP+ G  FIAGGEDMWV
Sbjct  193  AEVSRDGRYITTADGSSVKFWDANHFGLVKGYNMPCNTESASLEPKLGNIFIAGGEDMWV  252

Query  284  RLFDFHXGEQIG  249
             +FDFH GEQIG
Sbjct  253  HVFDFHTGEQIG  264



>gb|KDO52916.1| hypothetical protein CISIN_1g018784mg [Citrus sinensis]
Length=268

 Score =   214 bits (544),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++    GS+RTVAWLH+DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVGNSSGSIRTVAWLHSDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVSRDG YITTADGSSVKFWDAN F LVK Y+MPCN ESASLEP+ G  FIAGGEDMWV
Sbjct  193  AEVSRDGRYITTADGSSVKFWDANHFGLVKGYNMPCNTESASLEPKLGNIFIAGGEDMWV  252

Query  284  RLFDFHXGEQIG  249
             +FDFH GEQI 
Sbjct  253  HVFDFHTGEQIA  264



>ref|XP_006465395.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X2 [Citrus sinensis]
Length=268

 Score =   213 bits (543),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++    GS+RTVAWLH DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTS
Sbjct  133  RPDAPPREVGNSSGSIRTVAWLHGDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVSRDG YITTADGSSVKFWDAN F LVK Y+MPCN ESASLEP+ G  FIAGGEDMWV
Sbjct  193  AEVSRDGRYITTADGSSVKFWDANHFGLVKGYNMPCNTESASLEPKLGNIFIAGGEDMWV  252

Query  284  RLFDFHXGEQIG  249
             +FDFH GEQI 
Sbjct  253  HVFDFHTGEQIA  264



>emb|CAN67314.1| hypothetical protein VITISV_014120 [Vitis vinifera]
Length=426

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 132/168 (79%), Gaps = 6/168 (4%)
 Frame = -3

Query  536  GVRLWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPC  357
            GV LWD+RS ++V+TL+T SSVTSAEVS+DG YI TADGSSVKFWDAN F LVKSY MPC
Sbjct  247  GVGLWDVRSGKIVQTLETNSSVTSAEVSQDGRYIITADGSSVKFWDANHFGLVKSYKMPC  306

Query  356  NVESASLEPRFGKRFIAGGEDMWVRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsg  177
             VESASLEP+ G +FIAGGEDMW+RLFDFH GE+I CNKGHHGPVHCVRFSPGGES  SG
Sbjct  307  TVESASLEPKNGDKFIAGGEDMWIRLFDFHTGEEIACNKGHHGPVHCVRFSPGGESYASG  366

Query  176  sEDGTIRIWQTGP-----NEATDASAGPXKPKV-XKXVXVEIDKXHXA  51
            SEDGTIRIWQTGP     NE   A+    K KV  + V  +I+  H A
Sbjct  367  SEDGTIRIWQTGPLTHDNNEMFRANGLTGKVKVAAEEVSCKIEGFHIA  414



>ref|XP_006427174.1| hypothetical protein CICLE_v10025975mg [Citrus clementina]
 gb|ESR40414.1| hypothetical protein CICLE_v10025975mg [Citrus clementina]
Length=268

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR++    GS+RTVAWLH+DQTILSSC+D+ GVRLWD RS ++V+TL+TKS VTS
Sbjct  133  RPDASPREVGNSSGSIRTVAWLHSDQTILSSCTDSGGVRLWDARSGKIVQTLETKSPVTS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
            AEVSRDG YITTADGSSVKFWDAN F LVKSY+MPCN ESASLEP+ G  FIAGGEDMWV
Sbjct  193  AEVSRDGRYITTADGSSVKFWDANHFGLVKSYNMPCNTESASLEPKLGNIFIAGGEDMWV  252

Query  284  RLFDFHXGEQIG  249
             +FDFH GEQI 
Sbjct  253  HVFDFHTGEQIA  264



>gb|ABR25578.1| serine-threonine kinase receptor-associated protein [Oryza sativa 
Indica Group]
Length=167

 Score =   200 bits (508),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -3

Query  515  RSCEVVRTLDTKSSVTSAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASL  336
            RS ++ +TL+TK++VTSAEVS+DG YI TADGSSVKFWDAN F LVKSY+MPCNVESASL
Sbjct  1    RSGKIAQTLETKATVTSAEVSQDGRYIITADGSSVKFWDANYFGLVKSYNMPCNVESASL  60

Query  335  EPRFGKRFIAGGEDMWVRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIR  156
            EP++G +FIAGGEDMWV +FDF  GE+I CNKGHHGPVHCVRF+PGGES  SGSEDGTIR
Sbjct  61   EPKYGNKFIAGGEDMWVHVFDFFTGEEITCNKGHHGPVHCVRFAPGGESYASGSEDGTIR  120

Query  155  IWQTGPNEATDASAGP  108
            IWQ GP  + +  + P
Sbjct  121  IWQLGPATSDEQESPP  136



>ref|XP_006385489.1| hypothetical protein POPTR_0003s05820g [Populus trichocarpa]
 gb|ERP63286.1| hypothetical protein POPTR_0003s05820g [Populus trichocarpa]
Length=298

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 106/169 (63%), Gaps = 52/169 (31%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDAPPR++D  PGS+RTVAWLH+DQTILSSC+D  GV                      
Sbjct  133  RPDAPPREVDNSPGSIRTVAWLHSDQTILSSCTDIGGV----------------------  170

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
                                          SYDMPCNVESASLEP+ G +F+AGGEDMW+
Sbjct  171  ------------------------------SYDMPCNVESASLEPKLGNKFVAGGEDMWI  200

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             +FDFH GEQIGCNKGHHGPVHC+RFSPGGES  SGSEDGTIRIWQ GP
Sbjct  201  HVFDFHTGEQIGCNKGHHGPVHCLRFSPGGESYASGSEDGTIRIWQLGP  249



>ref|XP_005650326.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25782.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=317

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 119/184 (65%), Gaps = 1/184 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            + D+ P  +   P  +R  AW  ND  +L+S +D  G+ +WD+R+  +V+TL T   VTS
Sbjct  132  KMDSEPATVRDVPDKIRCAAWHQNDALLLTSYTDQPGIGVWDIRTAGLVKTLATGKEVTS  191

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E+S+DG YIT+ADG+ V+FWD  +   +K +  P +VESAS  P  G RF+AGG DMW 
Sbjct  192  IEISQDGRYITSADGTEVRFWDGERLEPIKVFSQPYSVESASFCPEKG-RFVAGGGDMWA  250

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEATDASAGPX  105
             L D+  G ++ CN+GHHGPVH +RF+PGG+S  SGSEDGTIRIW+T     T+    P 
Sbjct  251  HLHDYETGAELECNRGHHGPVHTIRFAPGGDSYASGSEDGTIRIWETDYALKTENGEAPA  310

Query  104  KPKV  93
             P V
Sbjct  311  APAV  314



>ref|XP_001419915.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98208.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=299

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P  + G    ++T +++ ND+ ILSSC++  G+R+WD+R+  VV TL T+S V S
Sbjct  129  KPEAEPYAMAGSASQIKTASFIANDELILSSCAEDKGIRVWDVRTNTVVTTLSTESPVMS  188

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS DG  +TTADG  V FWD   F  V+ + M   VESAS+  +  K+F+AGG DMWV
Sbjct  189  IEVSADGKNMTTADGKDVTFWDLQNFSKVQKWTMEYEVESASVSLKH-KKFVAGGPDMWV  247

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
             L D   G +   NKGHHGPVHCVRF+P   S  SGSEDGTIRIWQT
Sbjct  248  HLHDMETGAEEQTNKGHHGPVHCVRFAPDQNSYCSGSEDGTIRIWQT  294



>emb|CEF99303.1| G-protein beta WD-40 repeat [Ostreococcus tauri]
Length=299

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 114/167 (68%), Gaps = 1/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P  + G   S++T +++HND+ ILSSC++  G+R+WD+R+  VV TL T+S V S
Sbjct  129  KPEADPYAMAGHASSIKTASFIHNDELILSSCAEDKGIRVWDVRTNTVVTTLSTESPVMS  188

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS DG ++TTADG  V FWD   F  ++ + M   VESAS+  +  ++F+AGG DMWV
Sbjct  189  IEVSADGKHMTTADGKDVTFWDLQNFSKIQKWTMEYEVESASVSLKH-RKFVAGGPDMWV  247

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
             L D   G +   NKGHHGPVH VRF+P   S  SGSEDGTIRIWQT
Sbjct  248  HLHDMETGAEEQTNKGHHGPVHNVRFAPDQNSYCSGSEDGTIRIWQT  294



>ref|XP_007023909.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY26531.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=157

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 111/148 (75%), Gaps = 7/148 (5%)
 Frame = -3

Query  527  LWDLRSCEVVRTLDTKSSVTSAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVE  348
            LWDLRS ++V+TL+TKS VTSAEVS+DG +ITTADGS+VKFWDAN F LVKSY MPC+VE
Sbjct  2    LWDLRSGKIVQTLETKSPVTSAEVSQDGRHITTADGSNVKFWDANHFALVKSYYMPCSVE  61

Query  347  SASLEPRFGKRFIAGGEDMWVRLFDFHXGEQIGCNKGHHGP----VHCVRFSPggesxxs  180
            SASLEP+ G +FIAGGEDMWV +FDFH GE+I   +   G     +  V  SPGGES  S
Sbjct  62   SASLEPKHGNKFIAGGEDMWVHVFDFHTGEEI--VRLQQGSPCMVLSTVCSSPGGESYAS  119

Query  179  gsEDGTIRIWQTGP-NEATDASAGPXKP  99
            GSEDGTIRIWQTG  N   + S  P  P
Sbjct  120  GSEDGTIRIWQTGSGNHEKNDSVPPNGP  147



>ref|XP_007510202.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18547.1| predicted protein [Bathycoccus prasinos]
Length=323

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 116/164 (71%), Gaps = 2/164 (1%)
 Frame = -3

Query  632  PPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVS  453
            P  ++ G P  ++T  ++ ND+ ILSSCSD   +R+WD R+  +  TL T+++VTS E+S
Sbjct  156  PMSELTGAPSQIKTARYICNDELILSSCSDNPDLRVWDARTGIIATTLKTENAVTSIEIS  215

Query  452  RDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVRLFD  273
             DG YITTADG +V  WD   FR ++++ M  N+ESAS+  + GK F+ GGEDMWV + D
Sbjct  216  EDGKYITTADGKNVTLWDVGSFRPMETWKMKYNMESASVCMKEGK-FVCGGEDMWVHVHD  274

Query  272  FHXGEQIG-CNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
               GE+IG   KGHHGPVHCVRF+P G+S  SGSEDGTIRIWQT
Sbjct  275  CASGEEIGEPGKGHHGPVHCVRFAPDGKSYSSGSEDGTIRIWQT  318



>ref|XP_003081517.1| WD40 repeat protein (ISS) [Ostreococcus tauri]
Length=627

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 114/167 (68%), Gaps = 1/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P  + G   S++T +++HND+ ILSSC++  G+R+WD+R+  VV TL T+S V S
Sbjct  457  KPEADPYAMAGHASSIKTASFIHNDELILSSCAEDKGIRVWDVRTNTVVTTLSTESPVMS  516

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS DG ++TTADG  V FWD   F  ++ + M   VESAS+  +  ++F+AGG DMWV
Sbjct  517  IEVSADGKHMTTADGKDVTFWDLQNFSKIQKWTMEYEVESASVSLKH-RKFVAGGPDMWV  575

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
             L D   G +   NKGHHGPVH VRF+P   S  SGSEDGTIRIWQT
Sbjct  576  HLHDMETGAEEQTNKGHHGPVHNVRFAPDQNSYCSGSEDGTIRIWQT  622



>ref|XP_003055628.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60880.1| predicted protein [Micromonas pusilla CCMP1545]
Length=302

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 115/169 (68%), Gaps = 3/169 (2%)
 Frame = -3

Query  638  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  459
            DAPP ++ G P  +RT  +   D  I+SSC+D  G+R+WD+R+  VV TL T + VTS E
Sbjct  130  DAPPYEMQGSPSQIRTAQFTAEDTLIVSSCADDPGIRVWDVRTNTVVTTLGTDTPVTSIE  189

Query  458  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVRL  279
            ++ +G YITTADG +V F+DA  F  VK + MP  VESAS+  +  +RF+AGG DMWV +
Sbjct  190  ITENGRYITTADGKNVTFFDAMTFTPVKKWTMPYEVESASVCVKH-ERFVAGGTDMWVHV  248

Query  278  FDFH--XGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
             D      +++   KGHHGPVH VRF+P GES  SGSEDGTIRIW+T P
Sbjct  249  HDMSGTDAKELDVGKGHHGPVHSVRFAPDGESYSSGSEDGTIRIWRTFP  297



>ref|XP_002503507.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64765.1| predicted protein [Micromonas sp. RCC299]
Length=300

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 109/169 (64%), Gaps = 1/169 (1%)
 Frame = -3

Query  638  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  459
            DA P  + G P  +RT  +   D  I+SSC+D  G+R+WD+R+  +V TL T S VTS E
Sbjct  133  DAEPYVMQGSPSQIRTAQFTAEDTLIMSSCADDKGIRVWDVRTNTIVTTLGTDSPVTSIE  192

Query  458  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVRL  279
            ++ DG YITTADG +V F+DA  F  V    M   VESAS+  +    F+AGG DMWV  
Sbjct  193  ITDDGRYITTADGKTVTFFDAMTFTPVWKRTMGYEVESASVCIK-NDVFVAGGTDMWVHA  251

Query  278  FDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNE  132
                 GE++ C KGHHGPVH VRF+P G+S  SGSEDGTIRIW+T P +
Sbjct  252  HSMSTGEEVDCGKGHHGPVHSVRFAPDGKSYASGSEDGTIRIWRTLPGK  300



>ref|XP_637742.1| WD40 repeat-containing protein [Dictyostelium discoideum AX4]
 sp|Q54LT8.1|STRAP_DICDI RecName: Full=Serine-threonine kinase receptor-associated protein; 
AltName: Full=WD40 repeat-containing protein strap [Dictyostelium 
discoideum]
 gb|EAL64253.1| WD40 repeat-containing protein [Dictyostelium discoideum AX4]
Length=293

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 106/167 (63%), Gaps = 4/167 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAW-LHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVT  468
            RP+ P  QI G   +++T  W +HND  +LS   D   +R+WDLRS   V +L  KSS+T
Sbjct  128  RPNDPLLQISGHTNTIKTATWSVHNDDIVLSGGLDEV-IRIWDLRSGTQV-SLCAKSSIT  185

Query  467  SAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMW  288
            S E S+D  ++ T  G+ V FWDA  F  +K Y +P +V  ASL P    +FIAGG D W
Sbjct  186  SMEFSKDRRFLVTTAGNEVTFWDAQSFYPLKVYSLPFDVNCASLHPD-NSKFIAGGSDFW  244

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQ  147
            V ++DF  G +I  NKGHHGPV+C RFSP G S  SGS DGTIR+W+
Sbjct  245  VHVYDFSTGNEIEVNKGHHGPVNCCRFSPDGASFASGSLDGTIRLWK  291



>ref|XP_005849411.1| hypothetical protein CHLNCDRAFT_143924 [Chlorella variabilis]
 gb|EFN57309.1| hypothetical protein CHLNCDRAFT_143924 [Chlorella variabilis]
Length=337

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 109/175 (62%), Gaps = 9/175 (5%)
 Frame = -3

Query  644  RPDAPPR-------QIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLD  486
            RPDA P        Q+     ++R   W+ ++Q +L S  D   V +WD+R  EV R+L 
Sbjct  137  RPDAAPTGEWGAEGQLSKAQDNIRVTHWIGDNQLLLVSYLDKPNVDVWDVRMGEVARSLG  196

Query  485  TKSSVTSAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMP-CNVESASLEPRFGKRFI  309
            ++ +VTS EV+  G YI TADG  V F DA  F LVKS+      VESAS  P  G RF+
Sbjct  197  SQGTVTSIEVTPCGRYIVTADGKQVDFRDAASFDLVKSHACEGYEVESASFAPERG-RFV  255

Query  308  AGGEDMWVRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
             GG DMWVRL DF  G+++   KGHHGPVH VRF+PGG +  SGSEDGTIRIW+T
Sbjct  256  TGGSDMWVRLHDFETGQELEVCKGHHGPVHNVRFAPGGATYASGSEDGTIRIWRT  310



>gb|KIZ04267.1| serine-threonine kinase receptor-associated protein [Monoraphidium 
neglectum]
Length=294

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 94/148 (64%), Gaps = 1/148 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA P+Q+ G    +R V W+H D  +L++  DT G+ +WD+RS  +V+TL T++ VTS
Sbjct  135  RPDAAPQQLSGAAKGIRNVVWVHGDSLVLTTQQDTPGLDVWDVRSGSIVQTLATEAPVTS  194

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E++ DG ++TT DG++++FWD    R  K +     VE+AS  P  G RF  GG DMWV
Sbjct  195  VELTFDGRFLTTTDGATIRFWDVGALREAKQHKAAYPVEAASYCPAKG-RFACGGGDMWV  253

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSP  201
             L  +  G ++   KGHHGPVH +RF P
Sbjct  254  HLHSYDDGSELEVCKGHHGPVHTIRFGP  281



>gb|AFK49343.1| unknown [Lotus japonicus]
Length=131

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 82/100 (82%), Gaps = 3/100 (3%)
 Frame = -3

Query  383  LVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVRLFDFHXGEQIGCNKGHHGPVHCVRFS  204
            +V+SYDMPC VESASLEP++G +F+AGGEDMWVR+FDFH G +I CNKGHHGPVHCVRF 
Sbjct  1    MVRSYDMPCTVESASLEPKYGNKFVAGGEDMWVRVFDFHTGNEIACNKGHHGPVHCVRFF  60

Query  203  PggesxxsgsEDGTIRIWQTGP---NEATDASAGPXKPKV  93
            PGGES  SGSEDGTIRIW+TGP   +E+ D SA     KV
Sbjct  61   PGGESYASGSEDGTIRIWRTGPLTHDESEDLSANGSIDKV  100



>ref|XP_001691265.1| hypothetical protein CHLREDRAFT_128295 [Chlamydomonas reinhardtii]
 gb|EDP04998.1| predicted protein [Chlamydomonas reinhardtii]
Length=307

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 111/166 (67%), Gaps = 3/166 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P A P ++      +R+V ++ ND TI+ S  D  G+ ++D+RS + V+T+DT + VTS
Sbjct  131  KPAAEPLKLPPAHSGIRSVNFIQNDNTIICSYVDKPGLGVYDVRSLQHVQTIDTSAPVTS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKR-FIAGGEDMW  288
             E+S D  +ITTA+GS V+ ++      VKS+ MP   ESASL   + KR F+AGGEDMW
Sbjct  191  IEISFDQQHITTAEGSHVRVFEVGSLNQVKSHRMPAPAESASL--CWAKRKFVAGGEDMW  248

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIW  150
            V L+D    +++  NKGHHGPVH +R++P  ++  SGSEDGTIRIW
Sbjct  249  VHLYDLDTCQELEVNKGHHGPVHAIRWAPTYDAYASGSEDGTIRIW  294



>gb|EFA79493.1| WD40 repeat-containing protein [Polysphondylium pallidum PN500]
Length=315

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 103/166 (62%), Gaps = 4/166 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAW-LHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVT  468
            +P+ P  QI G    ++T  W ++ND  ILS  +D   +R+ DLRS   +  L  K+ ++
Sbjct  128  KPNVPLAQIPGHQSMIKTAMWSVYNDDVILSGGNDEV-IRIMDLRSGTQM-ALCAKAPIS  185

Query  467  SAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMW  288
            S E S+D  Y+ T  G+ V FW+A  F  VK Y +P  V  ASL P    RFIAGG D W
Sbjct  186  SMEFSKDKQYLVTTAGNEVTFWNAQNFHPVKVYSLPFEVICASLHPD-NSRFIAGGSDFW  244

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIW  150
            V ++DF+ G +I  NKGHHGPV+C R+SP GES  SGS DGTIRIW
Sbjct  245  VHVYDFNTGNEIEVNKGHHGPVNCCRYSPDGESFASGSVDGTIRIW  290



>gb|ACO09706.1| Serine-threonine kinase receptor-associated protein [Osmerus 
mordax]
Length=344

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 105/168 (63%), Gaps = 2/168 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P++I G   +++   W +ND+ ILS+  D + VRLWD  S E VRTL    SV+S
Sbjct  145  KPEAEPQEIPGHTSAIKKALWCNNDKQILSAADDKT-VRLWDRNSTEAVRTLSFDMSVSS  203

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   DG  +    G ++ F++A    L+K+ D P ++ SASL P   + F+AGG+D  +
Sbjct  204  MEYIPDGEVLVITYGKTIAFYNALSLDLIKTVDAPASIHSASLHPD-KEFFVAGGDDFKL  262

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              FD+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  263  YKFDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  310



>gb|ESA22835.1| hypothetical protein GLOINDRAFT_342473 [Rhizophagus irregularis 
DAOM 181602]
Length=334

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 111/173 (64%), Gaps = 3/173 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PD P  + +G   ++++V W   ++ ++ S  D   +R+WD+R+ + + T  T+  +TS
Sbjct  140  KPDDPASEAEGHESTIKSVIW-DGERNVILSAGDDKEIRVWDVRNFDQINTFKTEHPITS  198

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGG-EDMW  288
             E+S +G YIT+  G  V F DA+ +++ KS     +V S SL P   KRF+AGG  D+W
Sbjct  199  MELSANGKYITSTAGKVVHFLDASTYQVFKSVPTAYDVSSVSLHPDH-KRFVAGGSNDLW  257

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNEA  129
            VR++DF  G+++   KGHHGP+H V +SP GE   +GSEDGTIR+WQT P ++
Sbjct  258  VRIYDFESGKELEVYKGHHGPIHTVSYSPDGEIYATGSEDGTIRLWQTTPGKS  310



>ref|XP_007577214.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Poecilia formosa]
Length=329

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PDA P++I G   +++   W +ND  ILS+  D + VRLWD RS E V+TL   +SV+S
Sbjct  131  KPDAAPQEIAGHSSAIKKSLWCNNDSQILSAAEDKT-VRLWDSRSMEEVKTLTFDTSVSS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGG+D  +
Sbjct  190  MEYLADGEILVITYGKTIAFYNALSLDLIKTVEAPAPINSASLHPE-KDFFVAGGDDFKL  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              FD+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  249  YKFDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_008399465.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Poecilia reticulata]
Length=329

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PDA P++I G   +++   W +ND  ILS+  D + VRLWD RS E V+TL   +SV+S
Sbjct  131  KPDAAPQEIAGHSSAIKKSLWCNNDSQILSAAEDKT-VRLWDSRSMEEVKTLTFDTSVSS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   DG  +    G ++ F++A    L++  + P ++ SASL P     F+AGG+D  +
Sbjct  190  MEYLADGEILVITYGKTIAFYNALSLDLIQMVEAPASINSASLHPE-KDFFVAGGDDFKL  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              FD+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  249  YKFDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_002949849.1| hypothetical protein VOLCADRAFT_80852 [Volvox carteri f. nagariensis]
 gb|EFJ48952.1| hypothetical protein VOLCADRAFT_80852 [Volvox carteri f. nagariensis]
Length=305

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 114/165 (69%), Gaps = 1/165 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PDA P ++      +R+V ++ ND  ++ S  D  G+ ++DLRS ++ +T++T +SVTS
Sbjct  131  KPDADPIKLPAAQAGIRSVNFIQNDNLVICSYVDKPGIGVYDLRSQQLSQTVETTTSVTS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS D  ++TTA+GS V+F++A   + VK + +    ESAS      ++F+AGGEDMWV
Sbjct  191  IEVSFDQQHVTTAEGSHVRFFEAATLQQVKQHKLSAPAESASY-CAVKRKFVAGGEDMWV  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIW  150
             L+D+  G+++ CNKGHHGPVH +R++P  ++  SGSEDGTIRIW
Sbjct  250  HLYDYDTGQELECNKGHHGPVHTIRWAPTYDAYASGSEDGTIRIW  294



>ref|XP_004564827.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X4 [Maylandia zebra]
 ref|XP_005730245.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Pundamilia nyererei]
 ref|XP_005940646.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Haplochromis burtoni]
 ref|XP_006808414.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X1 [Neolamprologus brichardi]
 ref|XP_006808415.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X2 [Neolamprologus brichardi]
Length=329

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 103/167 (62%), Gaps = 2/167 (1%)
 Frame = -3

Query  641  PDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSA  462
            P+A P++I G   +++   W +NDQ ILS+  D + +RLWD  S E V+TL   +SV+S 
Sbjct  132  PEAAPQEISGHTSAIKKALWCNNDQQILSAADDKT-IRLWDRSSMEEVKTLTFDTSVSSM  190

Query  461  EVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVR  282
            E   DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGG+D  + 
Sbjct  191  EYVADGQILVITYGKTIAFYNALSLELIKTVEAPAPINSASLHPE-KDFFVAGGDDFKLY  249

Query  281  LFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
             FD+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  250  KFDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_010882092.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Esox lucius]
Length=329

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 107/167 (64%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PDA P++I G  G+++   W +ND+ ILS+  D + VRLWD  S EVV++L  ++SV+S
Sbjct  131  KPDAEPQEIAGHSGAIKKALWCNNDKHILSAADDRT-VRLWDRSSAEVVKSLSFEASVSS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   +   +    G ++ F++A    L+K+ D P ++ SASL P     F+AGG+D  +
Sbjct  190  MEYMPEEEILVVTYGKTISFFNALSLDLIKTVDAPASIHSASLHPD-KDFFVAGGDDFKI  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              +D+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  249  YKYDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  295



>ref|XP_008314236.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Cynoglossus semilaevis]
Length=329

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 103/167 (62%), Gaps = 2/167 (1%)
 Frame = -3

Query  641  PDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSA  462
            PD  P++I G   +++   W ++D+ ILS+  D + +RLWD  S EVV+TL   +SV+S 
Sbjct  132  PDTAPQEIAGHTSAIKKALWCNDDKQILSAAEDKT-IRLWDRNSTEVVKTLTFDASVSSM  190

Query  461  EVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVR  282
            E   DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGGED  + 
Sbjct  191  EYMADGEILVITYGKTIAFYNALSLDLIKAVEAPAPISSASLHPE-KDFFVAGGEDFKLY  249

Query  281  LFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
             FD+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  250  KFDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|NP_956598.1| serine-threonine kinase receptor-associated protein [Danio rerio]
 gb|AAH49525.1| Serine/threonine kinase receptor associated protein [Danio rerio]
 gb|AAH65428.1| Serine/threonine kinase receptor associated protein [Danio rerio]
Length=329

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 106/168 (63%), Gaps = 2/168 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P++I G   +++   W +NDQ ILS+  D + +RLWD  + E V+TL   +SV+S
Sbjct  131  KPEAEPQEIAGHTSAIKKALWCNNDQQILSAADDKT-IRLWDKNTNEAVKTLSFDASVSS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   DG  +    G ++ F++A+   L+K+ D P ++ SASL P     F+AGG+D  +
Sbjct  190  MEYIPDGETLVITYGRTIAFYNAHSLDLIKTVDAPASIHSASLHPD-KDFFVAGGDDFKL  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              +D+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  249  YKYDYTTKEEMESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_006633224.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Lepisosteus oculatus]
Length=329

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 105/168 (63%), Gaps = 2/168 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PDA P++I G   +++   W ++D  ILS+  D + VRLWD  S EVV+TL    SV+S
Sbjct  131  KPDAEPQEITGHTSAIKKALWCNDDTQILSAADDKT-VRLWDRNSMEVVKTLSFDISVSS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   +G  +    G ++ F++A    L+K+ D P ++ SASL P     F+AGG+D  +
Sbjct  190  MEYIPEGEILVITYGKTIAFYNALSLDLIKTVDTPASINSASLHPE-KDFFVAGGDDFKL  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              +D++  E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  249  YKYDYNTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_010740062.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Larimichthys crocea]
Length=329

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 103/168 (61%), Gaps = 2/168 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
             PDA P++I G   +++   W +ND+ ILS+  D + +RLWD  S + V+TL   +SV+S
Sbjct  131  NPDAAPQEIAGHTSAIKKALWYNNDKQILSAAEDKT-IRLWDRSSMQEVKTLTFDTSVSS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   DG  +    G ++ F++A    L+KS + P  + SASL P     F+AGG+D  +
Sbjct  190  MEYMTDGDILVITYGKTIAFYNALSLDLIKSVEAPAPINSASLHPE-KDFFVAGGDDFKL  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              FD+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  249  YKFDYSNKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_005454109.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Oreochromis niloticus]
Length=350

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 103/167 (62%), Gaps = 2/167 (1%)
 Frame = -3

Query  641  PDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSA  462
            P+A P++I G   +++   W +NDQ ILS+  D + +RLWD  S + V+TL   +SV+S 
Sbjct  132  PEAAPQEISGHTSAIKKALWCNNDQQILSAADDKT-IRLWDRSSMQEVKTLTFDTSVSSM  190

Query  461  EVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVR  282
            E   DG  +    G ++ F++A    ++K+ + P  + SASL P     F+AGG+D  + 
Sbjct  191  EYVADGQILVITYGKTIAFYNALSLEMIKTVEAPAPINSASLHPE-KDFFVAGGDDFKLY  249

Query  281  LFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
             FD+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  250  KFDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>gb|EXX68237.1| Tif34p [Rhizophagus irregularis DAOM 197198w]
Length=308

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 107/167 (64%), Gaps = 3/167 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PD P  + +G   ++++V W   ++ ++ S  D   +R+WD+R+ + + T  T+  +TS
Sbjct  140  KPDDPASEAEGHESTIKSVIW-DGERNVILSAGDDKEIRVWDVRNFDQINTFKTEHPITS  198

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGG-EDMW  288
             E+S +G YIT+  G  V F DA+ +++ KS     +V S SL P   KRF+AGG  D+W
Sbjct  199  MELSANGKYITSTAGKVVHFLDASTYQVFKSVPTAYDVSSVSLHPDH-KRFVAGGSNDLW  257

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQ  147
            VR++DF  G+++   KGHHGP+H V +SP GE   +GSEDGTIR+WQ
Sbjct  258  VRIYDFESGKELEVYKGHHGPIHTVSYSPDGEIYATGSEDGTIRLWQ  304



>emb|CDQ67406.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ64442.1| unnamed protein product [Oncorhynchus mykiss]
Length=331

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 103/168 (61%), Gaps = 2/168 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P++I G   +++   W +ND  ILS+  D + VRLWD  S EVV+ L    SV+S
Sbjct  131  KPEAEPQEITGHTSAIKKALWCNNDTQILSAADDKT-VRLWDRNSTEVVKQLSFDMSVSS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   DG  +    G ++ F++A    ++K+ D P ++ SASL P     F+AGG+D  +
Sbjct  190  MEYIPDGEVLVITYGKTIAFYNALSLDMIKTVDAPASIHSASLHPD-KDFFVAGGDDFKL  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              FD+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  249  YKFDYGTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_003487985.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Bombus impatiens]
Length=330

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 102/167 (61%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PDA P+   G    +R V + +ND T L +C D   +R+WD +S + VR LD  +   S
Sbjct  132  KPDAAPQVFSGHKSGIRHVTFFNND-TALITCGDDKTLRVWDRKSGQEVRRLDFPAIPNS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVSRDG+ ITT   + V FW++ +   ++ Y  P  + SASL P     F+ GGED+ +
Sbjct  191  MEVSRDGNIITTTHSNIVTFWNSRELTKLREYTAPTQMNSASLHPDCSI-FVCGGEDLKM  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD+  G +I   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  250  YKFDYATGTEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_003402993.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Bombus terrestris]
Length=330

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 102/167 (61%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PDA P+   G    +R V + +ND T L +C D   +R+WD +S + VR LD  +   S
Sbjct  132  KPDATPQVFSGHKNGIRHVTFFNND-TALITCGDDKTLRVWDRKSGQEVRRLDFPAIPNS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVSRDG+ ITT   + V FW++ +   ++ Y  P  + SASL P     F+ GGED+ +
Sbjct  191  MEVSRDGNIITTTHSNIVTFWNSRELTKLREYTAPTQMNSASLHPDCSI-FVCGGEDLKM  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD+  G +I   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  250  YKFDYATGTEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_011270254.1| hypothetical protein CAOG_08643 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91798.1| hypothetical protein CAOG_008643 [Capsaspora owczarzaki ATCC 
30864]
Length=321

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 103/167 (62%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RP+A P   DG   + R   +++ND  +L++  D S +RLWDLR+ +  R +   +S TS
Sbjct  131  RPEAEPVIFDGLTATARVAMFVNNDSMLLTAAED-SCIRLWDLRTRQEERVIPLDASATS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS DG  +T A G S+ F++   F  +KS      + SASL      +F+AGG D ++
Sbjct  190  VEVSADGQIMTVAHGHSISFFNMQTFEKIKSITHTSPLYSASLHGS-KTKFVAGGNDFYL  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
             ++D+    +I  +KGHHGPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  249  HVYDYETLREIETHKGHHGPVHCVRFSPDGELYASGSEDGTVRLWQT  295



>ref|XP_008288513.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Stegastes partitus]
Length=329

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 103/168 (61%), Gaps = 2/168 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
             P+A P++I G   +++   W +ND+ ILS+  D + +RLW+  S E V+TL   +SV+S
Sbjct  131  NPEAAPQEIAGHTSAIKKALWCNNDKQILSAADDKT-IRLWNRSSMEEVKTLTFDTSVSS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGGED  +
Sbjct  190  MEYVADGEIVVITYGKTIAFYNALSLELIKTVEAPAPINSASLHPD-KDFFVAGGEDFKL  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              FD+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  249  YKFDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_008288505.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Stegastes partitus]
Length=357

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 103/168 (61%), Gaps = 2/168 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
             P+A P++I G   +++   W +ND+ ILS+  D + +RLW+  S E V+TL   +SV+S
Sbjct  131  NPEAAPQEIAGHTSAIKKALWCNNDKQILSAADDKT-IRLWNRSSMEEVKTLTFDTSVSS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGGED  +
Sbjct  190  MEYVADGEIVVITYGKTIAFYNALSLELIKTVEAPAPINSASLHPD-KDFFVAGGEDFKL  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              FD+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  249  YKFDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>gb|AAK01368.1| serine-threonine kinase receptor-associated protein [Carassius 
gibelio]
Length=329

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P++I G   +++   W +NDQ ILS+  D + VRLWD  + E V+T    +SV+S
Sbjct  131  KPEAEPQEIAGHTSAIKKALWCNNDQQILSAADDKT-VRLWDKNTKEAVKTPSFDASVSS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   DG  +    G ++ F+ A+   L+K+ D P ++ SASL P     F+AGG+D  +
Sbjct  190  MEYIPDGEILVITYGRTIAFYKAHSLDLIKTVDAPASIHSASLHPE-KDFFVAGGDDFKL  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              +D+   E++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  249  YKYDYTTKEEMESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_004082930.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Oryzias latipes]
Length=329

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = -3

Query  638  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  459
            DA P++I G   +++   W ++D+ ILS+  D + +RLWD  S E V+TL   +SV+S E
Sbjct  133  DAAPQEIAGHGAAIKKALWCNDDKQILSAADDKT-IRLWDRTSMEEVKTLTFNTSVSSME  191

Query  458  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVRL  279
               DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGGED  +  
Sbjct  192  YMADGEILVITYGKTIAFYNALSLELIKTAEAPAPINSASLHPE-KDFFVAGGEDFKLYK  250

Query  278  FDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
            FD+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  251  FDYGTQEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_010773038.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Notothenia coriiceps]
Length=329

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 102/168 (61%), Gaps = 2/168 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
             P+A P++I G   +++   W +ND+ ILS+  D + +RLWD  S E V+ L   ++V+S
Sbjct  131  NPEAAPQEIAGHTSAIKKALWCNNDKQILSAADDKT-IRLWDRSSMEEVKQLKFDTAVSS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   DG  +    G ++ F++A    L+K+ D P  + SASL P     F+AGGED  +
Sbjct  190  MEYLADGEILVITYGKTIGFYNALSLDLIKTVDAPAPINSASLHPD-KDFFVAGGEDFKL  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              FD+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  249  YKFDYGTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_004360523.1| WD40 repeat-containing protein [Dictyostelium fasciculatum]
 gb|EGG22672.1| WD40 repeat-containing protein [Dictyostelium fasciculatum]
Length=334

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 101/167 (60%), Gaps = 4/167 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAW-LHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVT  468
             P  P  ++ G  G ++   W ++ND  +LS  +D   +R+WDLRS +   T+  K+ ++
Sbjct  128  NPTEPIFKVSGHNGMIKCALWSVYNDDCVLSGGADEV-IRIWDLRS-QNKMTICAKAPIS  185

Query  467  SAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMW  288
            S E S+D   + T  G+ V FWDA  F  VK Y +P +V  ASL P  G RFIAGG D W
Sbjct  186  SMEFSKDKKLLLTTAGNEVTFWDAQSFHPVKVYSLPYDVHCASLHPD-GSRFIAGGSDFW  244

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQ  147
            V ++D   G +I  NKGHHGPV+C R+S  GES  SGS DGTIRIW 
Sbjct  245  VHVYDSATGNEIEVNKGHHGPVNCCRYSSDGESFASGSVDGTIRIWN  291



>dbj|GAM26537.1| hypothetical protein SAMD00019534_097120 [Acytostelium subglobosum 
LB1]
Length=291

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAW-LHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVT  468
            +P+ P  QI G    ++   W  +ND  +LS   D   +R+ DLR+   +  L  K+ ++
Sbjct  128  KPNEPLLQIPGHQSMIKAAMWSAYNDDVVLSGGGDEI-IRIMDLRAGTHM-ALCAKAPIS  185

Query  467  SAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMW  288
            S E S+D  Y+ T  G+ + FWDA  F  +K Y +P  V  ASL P    +FIAGG D W
Sbjct  186  SMEFSKDKKYLITTAGAEITFWDAATFHPLKVYSLPFEVNCASLHPD-NSKFIAGGSDFW  244

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIW  150
            V ++DF+ G +I  NKGHHGPV+C R+SP G+S  SGS DGTIRIW
Sbjct  245  VHVYDFNTGHEIEVNKGHHGPVNCCRYSPDGQSFASGSVDGTIRIW  290



>ref|XP_010885258.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Esox lucius]
Length=331

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 102/167 (61%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P++I G   +++   W +ND  ILS+  D + VRLWD  S  VV+ L    SV+S
Sbjct  131  KPEAEPQEITGHTSAIKKALWCNNDTQILSAADDKT-VRLWDRTSTAVVKQLSFDMSVSS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   DG  +    G ++ F++A    L+K+ D P ++ SASL P     F+AGG+D  +
Sbjct  190  MEYIPDGEVLVITYGKTIAFYNALSLDLIKTVDAPASIHSASLHPD-KDFFVAGGDDFKL  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              +D+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  249  YKYDYSTKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  295



>ref|NP_001279558.1| serine/threonine kinase receptor associated protein [Callorhinchus 
milii]
 gb|AFK10801.1| serine/threonine kinase receptor associated protein [Callorhinchus 
milii]
 gb|AFM85457.1| serine-threonine kinase receptor associated protein [Callorhinchus 
milii]
Length=329

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 103/167 (62%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            + DA P +I G   +++   W + D+ ILS+  D + +RLWD  S   V++++  +SV+S
Sbjct  131  KTDAEPLEIGGHTSAIKKACWCNGDKQILSAADDKT-IRLWDRESMTEVKSINFGTSVSS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E    G  +    G ++ F++A    L+KS+D P ++ SASL P     F+AGG+D  +
Sbjct  190  MEYIPKGEMLILTHGKTIAFYNALSLELIKSFDAPASINSASLHPE-KDCFVAGGDDFKL  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD++ GE +   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  249  YKFDYNTGEDLESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  295



>ref|XP_396504.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Apis mellifera]
 ref|XP_003691084.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Apis florea]
 ref|XP_006613623.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Apis dorsata]
Length=330

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 101/167 (60%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PDA P+   G    +R V + +N+ T L +C D   +R+WD  S + V+ LD  +   S
Sbjct  132  KPDAAPQVFSGHKNGIRHVTFFNNN-TALITCGDDKTLRVWDRNSGQEVKRLDFPAIPNS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVSRDG+ ITT   + V FW++ +   ++ Y  P  + SASL P     F+ GGED+ +
Sbjct  191  MEVSRDGNIITTTHSNIVTFWNSRELTKLREYTAPTQMNSASLHPDCSI-FVCGGEDLKM  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD+  G +I   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  250  YKFDYTTGAEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_011873479.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Vollenhovia emeryi]
Length=288

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 102/167 (61%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P+   G    +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S
Sbjct  90   KPEAAPQIFSGHTSGIRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEVKRLDFPAIPSS  148

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS+DG+ ITT   + V FWD+ +   +K + +P  V SA L P     F+ GGED  +
Sbjct  149  MEVSKDGNVITTTHSNIVTFWDSKELTKIKEFMVPTQVNSACLHPD-STIFVCGGEDFKM  207

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD++ G +I   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  208  YKFDYNTGAEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  254



>ref|XP_003294375.1| WD40 repeat-containing protein [Dictyostelium purpureum]
 gb|EGC29100.1| WD40 repeat-containing protein [Dictyostelium purpureum]
Length=283

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 97/165 (59%), Gaps = 2/165 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            + + P  QI G   +++   W   +  I+ S      +R+WDLRS   + +L  KSS++S
Sbjct  120  KANEPLFQISGHQNTIKKATWSAFNSDIVLSGGLDEVIRIWDLRSGTQI-SLCAKSSISS  178

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E S+D  Y+ T  G+ V FWDA+ F  +K Y +P  V  ASL P    +FIAGG D WV
Sbjct  179  MEFSKDKKYLVTTAGNEVTFWDAHSFYPLKVYSLPFEVNCASLSPD-NSKFIAGGSDFWV  237

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIW  150
              +DF  G ++  +KGHHGPV+C  F+P G S  SGS DGTIR+W
Sbjct  238  HSYDFETGNELEVSKGHHGPVNCCSFAPNGSSFASGSVDGTIRVW  282



>ref|XP_001624518.1| predicted protein [Nematostella vectensis]
 gb|EDO32418.1| predicted protein, partial [Nematostella vectensis]
Length=213

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 103/164 (63%), Gaps = 2/164 (1%)
 Frame = -3

Query  638  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  459
            D+ P+ + G  GS++T  W + +  ++ S  D   +RLWD R+ E  R +    ++T+ +
Sbjct  39   DSEPQVLTGHTGSIKTALW-NKENNMVYSGGDDKMIRLWDTRTLENTRNIQLPHNLTNMD  97

Query  458  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVRL  279
            +SRDG+ +    G++V F++     ++KS++MP  V  ASL P     F+AGGED+ +  
Sbjct  98   MSRDGNVLVITHGTTVVFYETESMDVIKSFEMPTLVYGASLHPD-KSCFVAGGEDLKIYK  156

Query  278  FDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQ  147
            FD+  G+++   KGH GPVHCVR+SP GE   SGSEDGT+R+WQ
Sbjct  157  FDYDTGKELESYKGHFGPVHCVRYSPDGELYASGSEDGTLRLWQ  200



>ref|XP_003972671.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Takifugu rubripes]
Length=329

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 100/166 (60%), Gaps = 2/166 (1%)
 Frame = -3

Query  638  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  459
            DA P++I G   +++   W + D+ ILS+  D + +RLWD  S E V+ L   +SV+S E
Sbjct  133  DAAPQEIAGHTSAIKKALWCNGDKHILSAAEDKT-IRLWDRCSMEEVKRLSFDTSVSSME  191

Query  458  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVRL  279
               DG  +    G ++ F++A    L+KS D P  + SASL P     F+AGGED  +  
Sbjct  192  YVADGEVLVITYGKTIAFYNALSLDLIKSVDAPAPINSASLHPE-KDFFVAGGEDFKLYK  250

Query  278  FDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
            FD+   E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  251  FDYSNKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|NP_001090526.1| serine/threonine kinase receptor associated protein [Xenopus 
laevis]
 gb|AAH97832.1| Strap protein [Xenopus laevis]
Length=273

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 102/168 (61%), Gaps = 2/168 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P +I G   +++   W +ND  ILS+  D + VRLWD  S   V+TL   +SV+S
Sbjct  75   KPEAEPWEISGHTSAIKKALWYNNDNQILSAADDKT-VRLWDRVSMTEVKTLQFGASVSS  133

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   +G  +    G ++  +D++   L+KS++ P  + SASL P   +  +A G+D  +
Sbjct  134  MEYIPEGEALLITYGRTIALYDSSSLELIKSFEAPAPINSASLHPD-KECIVAAGDDFKL  192

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              +DF  GE++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  193  YKYDFTTGEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  240



>ref|XP_011700897.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Wasmannia auropunctata]
Length=288

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 102/167 (61%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P+   G    +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S
Sbjct  90   KPEAAPQIFSGHTSGIRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEVKRLDFPAIPSS  148

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS+DG  ITT   + V FWD+ +   +K + +P  V SASL P     F+ GGED  +
Sbjct  149  MEVSKDGKIITTTHSNLVTFWDSKELTKIKEFMVPTQVNSASLHPD-CTIFVCGGEDFKM  207

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD++ G ++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  208  YKFDYNTGAELESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  254



>ref|XP_006006111.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Latimeria chalumnae]
Length=329

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 101/167 (60%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P +I G   +++   W + D+ ILS+  D + VRLWD ++   V+TL+  +SV+S
Sbjct  131  KPEAEPEEISGHTSAIKKALWCNGDEQILSAADDKT-VRLWDRKTMTEVKTLNFGTSVSS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E    G  +    G  + F+ A    L+KS+D P  + S SL P     F+AGG+D  +
Sbjct  190  MEYIPGGEILVITYGKVIAFYHAQSLDLIKSFDAPAPINSTSLHPE-KDFFVAGGDDFKL  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              +D++  E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  249  YKYDYNTSEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  295



>ref|XP_011873478.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Vollenhovia emeryi]
Length=330

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 102/167 (61%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P+   G    +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S
Sbjct  132  KPEAAPQIFSGHTSGIRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEVKRLDFPAIPSS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS+DG+ ITT   + V FWD+ +   +K + +P  V SA L P     F+ GGED  +
Sbjct  191  MEVSKDGNVITTTHSNIVTFWDSKELTKIKEFMVPTQVNSACLHPD-STIFVCGGEDFKM  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD++ G +I   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  250  YKFDYNTGAEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_012145976.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Megachile rotundata]
 ref|XP_012145977.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Megachile rotundata]
Length=288

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 102/167 (61%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P+   G    +R V + +N+ T L +C+D   +R+WD+ S + V+ L+  +   S
Sbjct  90   KPEAAPQIFSGHKNGIRHVTFFNNN-TALITCADDKTLRVWDINSGQEVKRLNFPAIPNS  148

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E+S+DG+ ITT   + V FWD+ +   +  Y  P  + SASL P     F+ GGED+ +
Sbjct  149  MELSKDGNIITTTHSNIVTFWDSKELTKLHEYTAPTQMNSASLHPDC-SIFVCGGEDLKM  207

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD+  G +I   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  208  YKFDYITGAEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  254



>ref|XP_011642000.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Pogonomyrmex barbatus]
Length=331

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 103/167 (62%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PDA P+   G    +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S
Sbjct  132  KPDAAPQIFSGHTSGIRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEVKRLDFPAIPSS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS+DG+ ITT   + V FW++ +   +K + +P  V SASL P     F+ GGED  +
Sbjct  191  MEVSKDGNVITTTHSNIVTFWNSKELTKIKEFMVPTQVNSASLHPD-CTIFVCGGEDFKM  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD++ G ++   KGH GPVHC+RFSP GE   SGSEDGT+R+WQT
Sbjct  250  YKFDYNTGAELESFKGHFGPVHCIRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_011700896.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Wasmannia auropunctata]
Length=330

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 102/167 (61%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P+   G    +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S
Sbjct  132  KPEAAPQIFSGHTSGIRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEVKRLDFPAIPSS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS+DG  ITT   + V FWD+ +   +K + +P  V SASL P     F+ GGED  +
Sbjct  191  MEVSKDGKIITTTHSNLVTFWDSKELTKIKEFMVPTQVNSASLHPD-CTIFVCGGEDFKM  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD++ G ++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  250  YKFDYNTGAELESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_011335793.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Cerapachys biroi]
 gb|EZA56461.1| Serine-threonine kinase receptor-associated protein [Cerapachys 
biroi]
Length=330

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 101/167 (60%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P+   G    +R V +  N+  +++ C+D   +R+WD  S + ++ LD  +  +S
Sbjct  132  KPEASPQIFSGHASGIRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEIKRLDFPAIPSS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS+DG  ITT   + V FWD+ +   +K +  P  V SASL P     F+ GGED  +
Sbjct  191  MEVSKDGSIITTTHSNIVTFWDSKELTKIKEFAAPTQVNSASLHPD-CTMFVCGGEDFKM  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD++ G ++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  250  YKFDYNTGAELESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_007527681.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Erinaceus europaeus]
Length=350

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 101/168 (60%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RPDA PR+I G    ++   W  +D+ ILS+  D   VRLWD  +   V++L+   SV+S
Sbjct  131  RPDAEPREISGHTSGIKKALWCSDDKQILSA--DDKTVRLWDHATMTEVKSLNFNMSVSS  188

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F +AGGED  
Sbjct  189  MEYIPEGEILVITYGRSIAFHSAISLEPIKSFEAPATINSASLHPE--KEFLVAGGEDFK  246

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  247  LYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  294



>ref|XP_005805514.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Xiphophorus maculatus]
Length=333

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 100/163 (61%), Gaps = 2/163 (1%)
 Frame = -3

Query  629  PRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEVSR  450
            P++I G   +++   W ++D  ILS+  D + VRLWD RS E V+TL   +SV+S E   
Sbjct  140  PQEIAGHSSAIKKSLWCNDDSQILSAAEDKT-VRLWDSRSMEEVKTLTFDTSVSSMEYLA  198

Query  449  DGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVRLFDF  270
            DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGG+D  +  FD+
Sbjct  199  DGEILVITYGKTIAFYNALSLDLIKTVEAPAPINSASLHPE-KDFFVAGGDDFKLYKFDY  257

Query  269  HXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
               E++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  258  STKEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  300



>ref|XP_008544371.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Microplitis demolitor]
Length=330

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 102/167 (61%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PD+PP+   G    ++ V +  ND  ++ SC+D   +R+WD  + + VR +D  +  +S
Sbjct  132  KPDSPPQVFSGHTSFIKQVMFF-NDNKLIVSCADDKTLRVWDRSNGQEVRRIDFPALPSS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS+DG  ITT   ++V FW++     ++ Y +P  V S SL P     F+ GGED+ +
Sbjct  191  MEVSKDGKIITTTHSNTVSFWNSLDLTKIREYTIPTQVNSVSLHPD-CSIFVCGGEDLKM  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD+  G ++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  250  YKFDYSTGVEMESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>gb|EPQ08116.1| Serine-threonine kinase receptor-associated protein [Myotis brandtii]
Length=309

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 100/168 (60%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P++I G    ++   W   D+ ILS+  D   VRLWD  +   V++L    SV+S
Sbjct  90   KPEAEPKEISGHTSGIKKALWCSEDKQILSA--DDKTVRLWDHATMTEVKSLSFNMSVSS  147

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G S+ F  A    L+KS++ P  + SASL P   K F +AGGED  
Sbjct  148  MEYIPEGEILVITYGRSIAFHSAVSLELIKSFETPATINSASLHPE--KEFLVAGGEDFK  205

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  206  LYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  253



>ref|XP_003705564.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Megachile rotundata]
Length=330

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 102/167 (61%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P+   G    +R V + +N+ T L +C+D   +R+WD+ S + V+ L+  +   S
Sbjct  132  KPEAAPQIFSGHKNGIRHVTFFNNN-TALITCADDKTLRVWDINSGQEVKRLNFPAIPNS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E+S+DG+ ITT   + V FWD+ +   +  Y  P  + SASL P     F+ GGED+ +
Sbjct  191  MELSKDGNIITTTHSNIVTFWDSKELTKLHEYTAPTQMNSASLHPDC-SIFVCGGEDLKM  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD+  G +I   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  250  YKFDYITGAEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_011052618.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Acromyrmex echinatior]
 gb|EGI66547.1| Serine-threonine kinase receptor-associated protein [Acromyrmex 
echinatior]
Length=330

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 103/167 (62%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P+   G    +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S
Sbjct  132  KPEAAPQIFSGHASGIRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEVKRLDFPAIPSS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS+DG+ ITT   + V FW++ +   +K + +P  V SASL P     F+ GGED  +
Sbjct  191  MEVSKDGNIITTTHSNIVTFWNSKELTKIKEFMVPTQVNSASLHPD-CTIFVCGGEDFKM  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD++ G ++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  250  YKFDYNTGAELESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>gb|KDR13003.1| Serine-threonine kinase receptor-associated protein [Zootermopsis 
nevadensis]
Length=370

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 100/167 (60%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P    G    +R V +   D T L +C+D   +R+WD  S + V+ LD  +  +S
Sbjct  175  KPEATPTVFSGHTSGIRHVIFFRGD-THLVTCADDRTLRVWDRTSGQEVQKLDFSAIPSS  233

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EV+RDG  +T   G+ V FWDA   + ++ + +P  V SASL P     F+ GGED+ +
Sbjct  234  LEVARDGSTLTVTHGNVVSFWDAQSLKKIREFTVPTQVNSASLHPD-KTIFVCGGEDLKM  292

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD+  G +I   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  293  YKFDYTTGTEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  339



>ref|XP_012056282.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Atta cephalotes]
Length=330

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 103/167 (62%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P+   G    +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S
Sbjct  132  KPEAAPQIFSGHTSGIRHVTFFDNNSALIT-CADDKTLRVWDRNSGQEVKRLDFPAIPSS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS+DG+ ITT   + V FW++ +   +K + +P  V SASL P     F+ GGED  +
Sbjct  191  MEVSKDGNIITTTHSNIVTFWNSKELTKIKEFMVPTQVNSASLHPD-CTIFVCGGEDFKM  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD++ G ++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  250  YKFDYNTGAELESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_001361095.1| GA17804 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002018243.1| GL17603 [Drosophila persimilis]
 gb|EAL25671.1| GA17804 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW36082.1| GL17603 [Drosophila persimilis]
Length=328

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 108/191 (57%), Gaps = 14/191 (7%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P +  G  G+++   +  +D+ I+S+  D + VRLWD  +   V+ L   S   S
Sbjct  134  QPEAKPEEYSGHAGAIKRALFCRDDKCIVSAAEDKT-VRLWDRMTGIEVQRLQFNSHPNS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E+SRD H +T A GSS+ FW+ +  + +K   +P NV SASL P     F+ GGED  +
Sbjct  193  LEISRDNHILTIAHGSSISFWEVDTLKKLKEVKVPTNVASASLHPD-KHVFVCGGEDFKM  251

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG------------  141
              FD+  G +I   KGH GPVH V+FSP GE   SGSEDGT+R+WQT             
Sbjct  252  YKFDYITGNEIESFKGHFGPVHAVKFSPDGELYASGSEDGTLRLWQTTVGKTYGLWKCTE  311

Query  140  PNEATDASAGP  108
            PNE  ++ + P
Sbjct  312  PNELNNSMSSP  322



>ref|XP_011498271.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Ceratosolen solmsi marchali]
Length=330

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 101/167 (60%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P+   G    +R V++  ND T+L SC++   +R+WD  + + +R LD +S   S
Sbjct  132  KPEAEPQIFSGHTSGLRHVSFYEND-TLLVSCAEDKTMRVWDRHNGKEIRNLDFQSVPRS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS+DG  ITT   + V FWD+ +   ++ + +P  V SASL P     FI GGED+ +
Sbjct  191  MEVSKDGSIITTTHSNIVTFWDSKELTKLREFTVPTQVNSASLHPD-NSVFICGGEDLKM  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD   G +I   KGH GP+HCV FSP GE   S SEDGT+R+WQT
Sbjct  250  YKFDCSTGVEIESLKGHFGPIHCVCFSPDGELYASCSEDGTLRLWQT  296



>ref|XP_006084353.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Myotis lucifugus]
Length=350

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 100/168 (60%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P++I G    ++   W   D+ ILS+  D   VRLWD  +   V++L    SV+S
Sbjct  131  KPEAEPKEISGHTSGIKKALWCSEDKQILSA--DDKTVRLWDHATMTEVKSLSFNMSVSS  188

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G S+ F  A    L+KS++ P  + SASL P   K F +AGGED  
Sbjct  189  MEYIPEGEILVITYGRSIAFHSAVSLELIKSFETPATINSASLHPE--KEFLVAGGEDFK  246

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  247  LYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  294



>ref|XP_005866835.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Myotis brandtii]
Length=350

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 100/168 (60%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P++I G    ++   W   D+ ILS+  D   VRLWD  +   V++L    SV+S
Sbjct  131  KPEAEPKEISGHTSGIKKALWCSEDKQILSA--DDKTVRLWDHATMTEVKSLSFNMSVSS  188

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G S+ F  A    L+KS++ P  + SASL P   K F +AGGED  
Sbjct  189  MEYIPEGEILVITYGRSIAFHSAVSLELIKSFETPATINSASLHPE--KEFLVAGGEDFK  246

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  247  LYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  294



>gb|EMP35054.1| Serine-threonine kinase receptor-associated protein, partial 
[Chelonia mydas]
Length=246

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 99/168 (59%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P+ + G    ++   W  +D+ ILS+  D   VRLWD  +   V+ ++   SV+S
Sbjct  49   KPEAEPQVVSGHTSGIKKALWSSDDKQILSA--DDKTVRLWDRNTMTEVKAINVAMSVSS  106

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G ++ F  A     +KS+D P  V SASL P   K F +AGGED  
Sbjct  107  MEYVPEGEILVITYGRTIAFHSAETLEQIKSFDAPATVNSASLHPE--KEFLVAGGEDFK  164

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  165  LYKYDYNTGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  212



>ref|NP_001087814.1| serine/threonine kinase receptor associated protein [Xenopus 
laevis]
 gb|AAH81265.1| MGC86380 protein [Xenopus laevis]
Length=329

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 103/168 (61%), Gaps = 2/168 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P +I G   +++   W +N+  ILS+ SD   VRLWD  S   V+TL    SV+S
Sbjct  131  KPEAEPWEISGHTSAIKKALWYNNNTQILSA-SDDRTVRLWDRVSMTEVKTLQFGVSVSS  189

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   +G  +    G ++  +D++   L+KS++ P ++ SASL P   +  +AGG+D  +
Sbjct  190  MEYIPEGEALLITYGRTIALYDSSSLELIKSFEAPASINSASLHPD-KECIVAGGDDFKL  248

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              +DF  GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  249  YKYDFTTGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTA  296



>ref|XP_004564826.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform X3 [Maylandia zebra]
Length=343

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 103/181 (57%), Gaps = 16/181 (9%)
 Frame = -3

Query  641  PDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSA  462
            P+A P++I G   +++   W +NDQ ILS+  D + +RLWD  S E V+TL   +SV+S 
Sbjct  132  PEAAPQEISGHTSAIKKALWCNNDQQILSAADDKT-IRLWDRSSMEEVKTLTFDTSVSSM  190

Query  461  EVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVR  282
            E   DG  +    G ++ F++A    L+K+ + P  + SASL P     F+AGG+D  + 
Sbjct  191  EYVADGQILVITYGKTIAFYNALSLELIKTVEAPAPINSASLHPE-KDFFVAGGDDFKLY  249

Query  281  LFDFHXGEQIG--------------CNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
             FD+   E++                 KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  250  KFDYSTKEELDQSETDGAAAHVSAESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  309

Query  143  G  141
             
Sbjct  310  A  310



>gb|KFH62158.1| hypothetical protein MVEG_11797 [Mortierella verticillata NRRL 
6337]
Length=320

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 96/170 (56%), Gaps = 3/170 (2%)
 Frame = -3

Query  638  DAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAE  459
            + P    +G    +R V W      ILSS  D   +R+WD R+   V +      + S E
Sbjct  140  NGPLLTAEGHTSVIRNVVWDGARNMILSSGDDME-IRVWDPRTFNQVHSCKMDGPIASME  198

Query  458  VSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGE-DMWVR  282
            +S DG YIT+  G SV FWDA  + L K      +V + SL P    RF+AGG  D+WVR
Sbjct  199  LSADGQYITSTTGKSVYFWDAQTYTLRKQIKTEYDVSAVSLHPNH-TRFVAGGSSDLWVR  257

Query  281  LFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNE  132
            ++DF  G ++   KGHHGPVH V +SP GE   +GSEDGTIR+WQT P +
Sbjct  258  IYDFESGRELEVYKGHHGPVHTVSYSPDGELYATGSEDGTIRLWQTTPGK  307



>ref|XP_007942645.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Orycteropus afer afer]
Length=270

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 100/168 (60%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P++I G    ++   W   D+ ILS+  D   VRLWD  +   V++L+   SV+S
Sbjct  51   KPEAEPKEISGHTSGIKKALWCSEDKQILSA--DDKTVRLWDQATMTEVKSLNFNMSVSS  108

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F +AGGED  
Sbjct  109  MEYIPEGEILVITYGRSIAFHSAISLDPIKSFEAPATINSASLHPE--KEFLVAGGEDFK  166

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  167  LYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  214



>ref|XP_002732021.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
[Saccoglossus kowalevskii]
Length=326

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 99/166 (60%), Gaps = 2/166 (1%)
 Frame = -3

Query  641  PDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSA  462
            P++ P+ I G   S+R   W    +TI+S+  D + VR+WD+ S   +  +D  SS  + 
Sbjct  133  PESEPQVISGHTSSIRDALWCQKGKTIISAAEDKT-VRMWDVASNREIMKIDLDSSNLNL  191

Query  461  EVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWVR  282
            +++ DG  +    G S+ F+  +    +KSY+ P  V SASL P     F+AGGED  + 
Sbjct  192  DINNDGSILVITHGKSISFYKTDSLEKLKSYEAPTPVYSASLHPE-KLCFVAGGEDFKIY  250

Query  281  LFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
             FD+  G+++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  251  KFDYETGQELESYKGHFGPVHCVRFSPDGELYSSGSEDGTLRLWQT  296



>ref|XP_969569.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Tribolium castaneum]
 gb|EFA09026.1| hypothetical protein TcasGA2_TC006736 [Tribolium castaneum]
Length=327

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 99/167 (59%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P +  G    +R V +  ND T L SC+D   +R+WD  S + V+ +D  S   S
Sbjct  132  KPEAKPEEFTGHTSGIRHVIFFRND-THLVSCADDKTLRVWDRSSGKEVQKMDFPSIPNS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVSRDG  +T    + V F D+     ++ + +P  V SASL P     F+AGG+D+ V
Sbjct  191  LEVSRDGTVLTVTHSNHVTFLDSESLNKIREFSVPTTVNSASLHPD-KTIFVAGGDDLKV  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD+  G +I   KGH GPVHCV+FSP GE   SGSEDGT+R+WQT
Sbjct  250  YKFDYTTGNEIESFKGHFGPVHCVKFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_004460359.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform 1 [Dasypus novemcinctus]
Length=350

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 100/168 (60%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PDA P++I G    ++   W  +D+ ILS+  D   VRLWD  S   V++L    SV+S
Sbjct  131  KPDADPKEISGHTSGIKKALWCSDDKQILSA--DDKTVRLWDQASMTEVKSLSFNMSVSS  188

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F +AGGED  
Sbjct  189  MEYIPEGEILVITYGRSIAFHSAVSLEPIKSFEAPATINSASLHPE--KEFLVAGGEDFK  246

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  247  LYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  294



>ref|XP_007060631.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Chelonia mydas]
Length=274

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 99/168 (59%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P+ + G    ++   W  +D+ ILS+  D   VRLWD  +   V+ ++   SV+S
Sbjct  55   KPEAEPQVVSGHTSGIKKALWSSDDKQILSA--DDKTVRLWDRNTMTEVKAINVAMSVSS  112

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G ++ F  A     +KS+D P  V SASL P   K F +AGGED  
Sbjct  113  MEYVPEGEILVITYGRTIAFHSAETLEQIKSFDAPATVNSASLHPE--KEFLVAGGEDFK  170

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  171  LYKYDYNTGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  218



>ref|XP_011560266.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Plutella xylostella]
Length=327

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 105/170 (62%), Gaps = 4/170 (2%)
 Frame = -3

Query  644  RPDA-PPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVT  468
            +P+A P  +      S+R   +LHN +  ++S SD   +R+WD  S + V  ++  S   
Sbjct  132  KPEAGPVEKFPAHTSSIRHAVFLHNAR--IASVSDDGTLRIWDRASGQEVHKIEFPSVPN  189

Query  467  SAEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMW  288
            S E+SRDG  +T A G++V F+  +  R ++SY +P    SASL P     F+ GGED+ 
Sbjct  190  SLELSRDGAILTVAHGTNVAFYSTDTMRAMRSYCVPTKCLSASLAPGRAA-FVCGGEDLK  248

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGP  138
            V  FD++ G +I CNKGH GPVHCVR+SP GE   +GSEDGT+R+WQ+ P
Sbjct  249  VYKFDYNSGNEIECNKGHFGPVHCVRWSPDGELYATGSEDGTLRLWQSSP  298



>ref|XP_004460360.1| PREDICTED: serine-threonine kinase receptor-associated protein-like 
isoform 2 [Dasypus novemcinctus]
Length=349

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 100/168 (60%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +PDA P++I G    ++   W  +D+ ILS+  D   VRLWD  S   V++L    SV+S
Sbjct  131  KPDADPKEISGHTSGIKKALWCSDDKQILSA--DDKTVRLWDQASMTEVKSLSFNMSVSS  188

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F +AGGED  
Sbjct  189  MEYIPEGEILVITYGRSIAFHSAVSLEPIKSFEAPATINSASLHPE--KEFLVAGGEDFK  246

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  247  LYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  294



>ref|XP_005179105.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Musca domestica]
Length=289

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 98/167 (59%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P A P    G  G+++   +  ND+ I+S+  D + VRLWD  S   V+ L   ++  S
Sbjct  95   QPQAEPEMYSGHGGAIKQALFCRNDKCIISAAEDKT-VRLWDRLSGNEVQRLTFPNNPNS  153

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E+S D H +T A G+S+ FWD    + +K   +P NV SASL P     F+ GGED  +
Sbjct  154  LEISADNHILTVAHGTSISFWDVESLKKLKEVKVPTNVSSASLHPD-KHVFVCGGEDFKM  212

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD+  G +I   KGH GPVH V+FSP GE   SGSEDGT+R+WQT
Sbjct  213  YKFDYITGNEIESFKGHFGPVHSVKFSPDGELYASGSEDGTLRLWQT  259



>ref|XP_011150584.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Harpegnathos saltator]
 gb|EFN77156.1| Serine-threonine kinase receptor-associated protein [Harpegnathos 
saltator]
Length=330

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 101/167 (60%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+  P+   G    +R V +  N+  +++ C+D   +R+WD  S + V+ LD  +  +S
Sbjct  132  KPEEAPQIFSGHTSGIRHVTFFDNNSALVT-CADDKTLRVWDRNSGQEVKRLDFPAIPSS  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             EVS+DG  ITT   + V FW++ +   +K + +P  V SASL P     F+ GGED+ +
Sbjct  191  MEVSKDGKIITTTHSNIVTFWNSKELTKIKEFTVPTQVNSASLHPDCSI-FVCGGEDLKM  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD+  G +I   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT
Sbjct  250  YKFDYSTGAEIESFKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_001959831.1| GF11838 [Drosophila ananassae]
 gb|EDV36653.1| GF11838 [Drosophila ananassae]
Length=328

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 101/167 (60%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P +  G  GS++   +   D+ I+S+  D + VRLWD  +   V+ L   ++  S
Sbjct  134  QPNAQPEEYAGHTGSIKRALFCRGDKCIISAAEDKT-VRLWDRMTGIEVQRLQFPNNPNS  192

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E+SRD H +T A GSSV FW+ +  + +K   +P NV SASL P     F+ GGED  +
Sbjct  193  LEISRDNHILTIAHGSSVSFWEIDTMKKLKEVKVPTNVSSASLHPD-KHVFVCGGEDFKM  251

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FDF  G +I   KGH GPVH V+FSP GE   SGSEDGT+R+WQT
Sbjct  252  YKFDFITGNEIESFKGHFGPVHSVKFSPDGELYASGSEDGTLRLWQT  298



>ref|NP_001120495.1| serine/threonine kinase receptor associated protein [Xenopus 
(Silurana) tropicalis]
 gb|AAI61374.1| LOC100145616 protein [Xenopus (Silurana) tropicalis]
Length=327

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 101/168 (60%), Gaps = 2/168 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P +I G   +++   W +ND  ILS+ SD   VRLWD  S   V+TL    SV+S
Sbjct  129  KPEAEPWEISGHTSAIKKALWYNNDNQILSA-SDDKTVRLWDRVSMTEVKTLQFGVSVSS  187

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   +G  +    G ++  ++A    L+KS++ P  + SASL P   +  +AGG+D  +
Sbjct  188  MEYIPEGEALLITYGRTIALYNALSLDLIKSFEAPAPINSASLHPD-KECIVAGGDDFKL  246

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTG  141
              +DF  GE++   KGH GPVHCVRFSP GE   SGSEDGT+R+WQT 
Sbjct  247  YKYDFTTGEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQTA  294



>ref|XP_005253351.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Homo sapiens]
 dbj|BAF98782.1| unnamed protein product [Homo sapiens]
Length=256

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 100/168 (60%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P++I G    ++   W   D+ ILS+  D   VRLWD  +   V++L+   SV+S
Sbjct  37   KPEAEPKEISGHTSGIKKALWCSEDKQILSA--DDKTVRLWDHATMTEVKSLNFNMSVSS  94

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F +AGGED  
Sbjct  95   MEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPE--KEFLVAGGEDFK  152

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  153  LYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  200



>ref|XP_006773325.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Myotis davidii]
Length=350

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 100/168 (60%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P++I G    ++   W   D+ ILS+  D   VRLWD  +   +++L    SV+S
Sbjct  131  KPEAEPKEISGHTSGIKKALWCSEDKQILSA--DDKTVRLWDHATMTELKSLSFNMSVSS  188

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G S+ F  A    L+KS++ P  + SASL P   K F +AGGED  
Sbjct  189  MEYIPEGEILVITYGRSIAFHSAVSLELIKSFETPATINSASLHPE--KEFLVAGGEDFK  246

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  247  LYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  294



>ref|XP_005761541.1| hypothetical protein EMIHUDRAFT_428205 [Emiliania huxleyi CCMP1516]
 gb|EOD09112.1| hypothetical protein EMIHUDRAFT_428205 [Emiliania huxleyi CCMP1516]
Length=322

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 100/174 (57%), Gaps = 8/174 (5%)
 Frame = -3

Query  635  APPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTSAEV  456
            A P  + G    V+   ++ + QT+LS+  D + +RLWDLR+    R ++   SV S E+
Sbjct  135  ADPLLLQGHTACVKVCHFIGDRQTLLSAGEDKT-MRLWDLRTGSTQREIEFSGSVNSVEL  193

Query  455  SRDGHYITTADGSSVKFWDANQFRLVKSYDMPC------NVESASLEPRFGKRFIAGGED  294
            + DG  +T A G+ V FWD   ++ +K + +         V SASL P   K F+AGG +
Sbjct  194  TADGRIMTVAAGTEVSFWDLTSWQCLKRFSLGVIAANGYGVNSASLHPNR-KAFVAGGGN  252

Query  293  MWVRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQTGPNE  132
             WV   DF  GE++ CNKGHHGPV+ VRF+P G++  S  +DGTIR W   P E
Sbjct  253  FWVYQHDFETGEELACNKGHHGPVYGVRFTPDGKAYASAGDDGTIRFWNFAPPE  306



>ref|XP_004611421.1| PREDICTED: serine-threonine kinase receptor-associated protein, 
partial [Sorex araneus]
Length=316

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 100/168 (60%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A PR+I G    ++   W   D+ ILS+  D   VRLWD  +   V++L+   SV+S
Sbjct  97   KPEAEPREISGHTSGIKKALWCSEDKQILSA--DDKTVRLWDHATMTEVKSLNFNMSVSS  154

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F +AGGED  
Sbjct  155  MEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPE--KEFLVAGGEDFK  212

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  213  LYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  260



>ref|XP_007196086.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Balaenoptera acutorostrata scammoni]
Length=349

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 100/168 (60%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P++I G    ++   W   DQ ILS+  D   VRLWD  +   V++L+   SV+S
Sbjct  131  KPEAEPKEISGHTSGIKKALWCSEDQQILSA--DDKTVRLWDHATMTEVKSLNFNMSVSS  188

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F +AGGED  
Sbjct  189  MEYIPEGEMLVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPE--KEFLVAGGEDFK  246

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  247  LYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  294



>ref|XP_005072957.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X2 [Mesocricetus auratus]
Length=256

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 101/168 (60%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P++I G    ++   W  +D+ ILS+  D   VRLWD  +   V++++   SV+S
Sbjct  37   KPEAEPKEISGHTSGIKKALWCSDDKQILSA--DDKTVRLWDHATMTEVKSVNFNMSVSS  94

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G ++ F  A     +KS++ P  + SASL P   K F +AGGED  
Sbjct  95   MEYIPEGEVLVLTYGRTIAFHSAVSLEPIKSFEAPATINSASLHPE--KEFLVAGGEDFK  152

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  153  LYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  200



>ref|XP_005179104.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Musca domestica]
Length=327

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 98/167 (59%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P A P    G  G+++   +  ND+ I+S+  D + VRLWD  S   V+ L   ++  S
Sbjct  133  QPQAEPEMYSGHGGAIKQALFCRNDKCIISAAEDKT-VRLWDRLSGNEVQRLTFPNNPNS  191

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E+S D H +T A G+S+ FWD    + +K   +P NV SASL P     F+ GGED  +
Sbjct  192  LEISADNHILTVAHGTSISFWDVESLKKLKEVKVPTNVSSASLHPD-KHVFVCGGEDFKM  250

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FD+  G +I   KGH GPVH V+FSP GE   SGSEDGT+R+WQT
Sbjct  251  YKFDYITGNEIESFKGHFGPVHSVKFSPDGELYASGSEDGTLRLWQT  297



>ref|XP_007196085.1| PREDICTED: serine-threonine kinase receptor-associated protein 
isoform X1 [Balaenoptera acutorostrata scammoni]
Length=350

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 100/168 (60%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P++I G    ++   W   DQ ILS+  D   VRLWD  +   V++L+   SV+S
Sbjct  131  KPEAEPKEISGHTSGIKKALWCSEDQQILSA--DDKTVRLWDHATMTEVKSLNFNMSVSS  188

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F +AGGED  
Sbjct  189  MEYIPEGEMLVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPE--KEFLVAGGEDFK  246

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  247  LYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  294



>gb|KFM64458.1| Serine-threonine kinase receptor-associated protein, partial 
[Stegodyphus mimosarum]
Length=333

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 101/167 (60%), Gaps = 2/167 (1%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            RP+     + G   +V+   +L +++ I+S+  D S VR WDL S E ++ L+ ++   +
Sbjct  132  RPEESGVCLSGHTSAVKKALFLQDEKRIVSAADDKS-VRFWDLTSHEEIKKLEFETQPNN  190

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E+S +G+ +    G SV FWD N F  +K+Y +P  V SASL P     F+ GG+D  +
Sbjct  191  LELSLNGNILVIPHGHSVSFWDVNNFEKLKTYSVPSQVNSASLHPD-QSVFVCGGDDFKM  249

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              FDF  G ++   KGH GPVHCV+FSP GE   SGSEDGT+R+WQT
Sbjct  250  YKFDFETGMELESFKGHFGPVHCVQFSPDGELYASGSEDGTLRLWQT  296



>ref|XP_004693302.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Condylura cristata]
Length=350

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 101/168 (60%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A PR+I G    ++   W  +D+ ILS+  D   VRLWD  +   V++L+   SV+S
Sbjct  131  KPEAEPREISGHTSGIKKALWCSDDKQILSA--DDKTVRLWDHATMTEVKSLNFNMSVSS  188

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F +AGGED  
Sbjct  189  MEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPE--KEFLVAGGEDFK  246

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  247  LYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  294



>ref|XP_010212611.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Tinamus guttatus]
Length=309

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 99/167 (59%), Gaps = 3/167 (2%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A P+ I G    ++   W  +D+ ILS+  D   VRLWD  +   V+ L+   SV+S
Sbjct  90   KPEAEPQVISGHTSGIKKALWSSDDKQILSA--DDKTVRLWDRNTMTEVKALNVAMSVSS  147

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRFIAGGEDMWV  285
             E   +G  +    G ++ F  A     +KS++ P  + SASL P+  +  +AGGED  +
Sbjct  148  MEYVPEGQILVITYGKTIAFHSAETLEQIKSFEAPATINSASLHPQ-KECLVAGGEDFKL  206

Query  284  RLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
              +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  207  YKYDYNTGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  253



>ref|XP_006866087.1| PREDICTED: serine-threonine kinase receptor-associated protein 
[Chrysochloris asiatica]
Length=350

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 100/168 (60%), Gaps = 5/168 (3%)
 Frame = -3

Query  644  RPDAPPRQIDGGPGSVRTVAWLHNDQTILSSCSDTSGVRLWDLRSCEVVRTLDTKSSVTS  465
            +P+A PR+I G    ++   W   D+ ILS+  D   VRLWD  +   V++L+   SV+S
Sbjct  131  KPEAEPREISGHTSGIKKALWCSEDKQILSA--DDKTVRLWDQATMTEVKSLNFNMSVSS  188

Query  464  AEVSRDGHYITTADGSSVKFWDANQFRLVKSYDMPCNVESASLEPRFGKRF-IAGGEDMW  288
             E   +G  +    G S+ F  A     +KS++ P  + SASL P   K F +AGGED  
Sbjct  189  MEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPE--KEFLVAGGEDFK  246

Query  287  VRLFDFHXGEQIGCNKGHHGPVHCVRFSPggesxxsgsEDGTIRIWQT  144
            +  +D++ GE++   KGH GP+HCVRFSP GE   SGSEDGT+R+WQT
Sbjct  247  LYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQT  294



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1012179015936