BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8463

Length=806
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009620291.1|  PREDICTED: zinc-finger homeodomain protein 9...    125   9e-30   Nicotiana tomentosiformis
ref|XP_003543789.1|  PREDICTED: transcription factor HB29-like          121   2e-28   Glycine max [soybeans]
ref|XP_010655937.1|  PREDICTED: zinc-finger homeodomain protein 1...    116   1e-27   Vitis vinifera
emb|CBI22215.3|  unnamed protein product                                117   1e-27   Vitis vinifera
emb|CDP02232.1|  unnamed protein product                                119   2e-27   Coffea canephora [robusta coffee]
ref|XP_002283533.1|  PREDICTED: zinc-finger homeodomain protein 9       118   3e-27   Vitis vinifera
ref|XP_004233363.1|  PREDICTED: zinc-finger homeodomain protein 9...    117   4e-27   
ref|XP_011655994.1|  PREDICTED: zinc-finger homeodomain protein 1...    117   4e-27   Cucumis sativus [cucumbers]
gb|ABY61030.1|  zinc finger-homeodomain protein 1                       117   4e-27   Cucumis sativus [cucumbers]
ref|XP_009787877.1|  PREDICTED: zinc-finger homeodomain protein 9...    117   7e-27   Nicotiana sylvestris
ref|XP_009376317.1|  PREDICTED: zinc-finger homeodomain protein 9       116   9e-27   Pyrus x bretschneideri [bai li]
gb|KJB75739.1|  hypothetical protein B456_012G054300                    116   1e-26   Gossypium raimondii
ref|XP_011085755.1|  PREDICTED: zinc-finger homeodomain protein 9       116   1e-26   Sesamum indicum [beniseed]
ref|XP_006363398.1|  PREDICTED: transcription factor HB29-like          116   1e-26   Solanum tuberosum [potatoes]
ref|XP_008443414.1|  PREDICTED: zinc-finger homeodomain protein 9...    115   2e-26   Cucumis melo [Oriental melon]
ref|XP_008467057.1|  PREDICTED: zinc-finger homeodomain protein 1...    115   2e-26   Cucumis melo [Oriental melon]
ref|XP_004147471.1|  PREDICTED: zinc-finger homeodomain protein 9...    115   2e-26   Cucumis sativus [cucumbers]
ref|XP_006357111.1|  PREDICTED: transcription factor HB29-like          115   3e-26   Solanum tuberosum [potatoes]
ref|XP_009621030.1|  PREDICTED: zinc-finger homeodomain protein 9...    115   3e-26   Nicotiana tomentosiformis
ref|XP_009797863.1|  PREDICTED: zinc-finger homeodomain protein 9...    115   3e-26   Nicotiana sylvestris
emb|CBI29005.3|  unnamed protein product                                117   3e-26   Vitis vinifera
ref|XP_012084702.1|  PREDICTED: zinc-finger homeodomain protein 9...    114   4e-26   Jatropha curcas
ref|XP_010088163.1|  hypothetical protein L484_013608                   112   4e-26   
ref|XP_006357697.1|  PREDICTED: transcription factor HB29-like          114   4e-26   Solanum tuberosum [potatoes]
gb|KHN13618.1|  ZF-HD homeobox protein                                  110   5e-26   Glycine soja [wild soybean]
ref|XP_010693250.1|  PREDICTED: zinc-finger homeodomain protein 9...    115   5e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011098625.1|  PREDICTED: zinc-finger homeodomain protein 9...    114   6e-26   Sesamum indicum [beniseed]
gb|KJB33553.1|  hypothetical protein B456_006G017200                    114   7e-26   Gossypium raimondii
gb|KDP27147.1|  hypothetical protein JCGZ_19846                         110   8e-26   Jatropha curcas
ref|XP_008379353.1|  PREDICTED: zinc-finger homeodomain protein 9...    113   2e-25   Malus domestica [apple tree]
ref|XP_008341574.1|  PREDICTED: zinc-finger homeodomain protein 1...    112   2e-25   
ref|XP_004233362.1|  PREDICTED: zinc-finger homeodomain protein 9       112   2e-25   Solanum lycopersicum
ref|XP_003618493.1|  Zinc finger-homeodomain protein                    110   2e-25   
ref|XP_004304301.1|  PREDICTED: zinc-finger homeodomain protein 9       112   4e-25   Fragaria vesca subsp. vesca
ref|XP_006602909.1|  PREDICTED: transcription factor HB29-like          111   8e-25   Glycine max [soybeans]
ref|XP_003621193.1|  ZF-HD homeobox protein                             111   9e-25   Medicago truncatula
ref|XP_008230766.1|  PREDICTED: zinc-finger homeodomain protein 9...    111   9e-25   Prunus mume [ume]
ref|XP_010258352.1|  PREDICTED: zinc-finger homeodomain protein 9...    110   1e-24   Nelumbo nucifera [Indian lotus]
ref|XP_004489395.1|  PREDICTED: transcription factor HB29-like          110   1e-24   Cicer arietinum [garbanzo]
ref|XP_002324056.2|  hypothetical protein POPTR_0017s11920g             110   1e-24   
gb|AES74711.2|  transcription factor HB29-like protein                  110   1e-24   Medicago truncatula
ref|XP_010936702.1|  PREDICTED: zinc-finger homeodomain protein 6...    110   1e-24   Elaeis guineensis
ref|XP_007151228.1|  hypothetical protein PHAVU_004G028600g             110   1e-24   Phaseolus vulgaris [French bean]
ref|XP_007139577.1|  hypothetical protein PHAVU_008G041300g             109   3e-24   Phaseolus vulgaris [French bean]
ref|XP_011097503.1|  PREDICTED: zinc-finger homeodomain protein 2...    108   3e-24   
ref|XP_011010066.1|  PREDICTED: zinc-finger homeodomain protein 9...    109   3e-24   Populus euphratica
gb|EPS61017.1|  hypothetical protein M569_13783                         107   4e-24   Genlisea aurea
ref|XP_010257380.1|  PREDICTED: zinc-finger homeodomain protein 9       108   5e-24   Nelumbo nucifera [Indian lotus]
ref|XP_008782488.1|  PREDICTED: zinc-finger homeodomain protein 6...    107   8e-24   Phoenix dactylifera
ref|XP_011100018.1|  PREDICTED: zinc-finger homeodomain protein 1...    105   1e-23   Sesamum indicum [beniseed]
ref|XP_002534012.1|  conserved hypothetical protein                     107   1e-23   Ricinus communis
emb|CAC34413.1|  ZF-HD homeobox protein                                 106   1e-23   Flaveria trinervia
gb|KHN05023.1|  ZF-HD homeobox protein                                  105   1e-23   Glycine soja [wild soybean]
ref|XP_003555538.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    105   2e-23   Glycine max [soybeans]
gb|AAP44422.1|  ZF-HD homeobox protein-like protein                     103   2e-23   Lactuca sativa [cultivated lettuce]
gb|EPS58358.1|  hypothetical protein M569_16456                         104   2e-23   Genlisea aurea
gb|EYU34567.1|  hypothetical protein MIMGU_mgv1a012253mg                105   3e-23   Erythranthe guttata [common monkey flower]
ref|XP_008220812.1|  PREDICTED: zinc-finger homeodomain protein 5...    107   3e-23   Prunus mume [ume]
gb|AAO62943.1|  ZF-HD homeobox protein-like protein                     102   3e-23   Lactuca sativa [cultivated lettuce]
ref|XP_008220815.1|  PREDICTED: zinc-finger homeodomain protein 5...    107   3e-23   Prunus mume [ume]
ref|XP_007154109.1|  hypothetical protein PHAVU_003G091100g             105   3e-23   Phaseolus vulgaris [French bean]
gb|ABK22835.1|  unknown                                                 105   3e-23   Picea sitchensis
ref|XP_004491795.1|  PREDICTED: transcription factor HB29-like          106   3e-23   Cicer arietinum [garbanzo]
emb|CAC34408.1|  ZF-HD homeobox protein                                 105   3e-23   Flaveria bidentis
ref|XP_001777987.1|  predicted protein                                  103   4e-23   
emb|CDX85230.1|  BnaC07g25410D                                          106   4e-23   
ref|XP_010940074.1|  PREDICTED: zinc-finger homeodomain protein 6...    105   4e-23   Elaeis guineensis
ref|XP_006373320.1|  hypothetical protein POPTR_0017s11920g             105   4e-23   
gb|EPS70696.1|  hypothetical protein M569_04063                         104   5e-23   Genlisea aurea
ref|XP_006482594.1|  PREDICTED: myb-like protein I-like                 105   7e-23   Citrus sinensis [apfelsine]
gb|AAP44426.1|  ZF-HD homeobox protein-like protein                     101   7e-23   Lactuca saligna
ref|XP_011649626.1|  PREDICTED: zinc-finger homeodomain protein 5       105   9e-23   Cucumis sativus [cucumbers]
ref|XP_008388052.1|  PREDICTED: zinc-finger homeodomain protein 2       105   1e-22   
emb|CDX86403.1|  BnaA06g31200D                                          105   1e-22   
ref|XP_008444722.1|  PREDICTED: zinc-finger homeodomain protein 2       105   1e-22   Cucumis melo [Oriental melon]
gb|KJB18247.1|  hypothetical protein B456_003G042700                    104   1e-22   Gossypium raimondii
ref|XP_006431147.1|  hypothetical protein CICLE_v10011968mg             105   1e-22   Citrus clementina [clementine]
ref|XP_007157626.1|  hypothetical protein PHAVU_002G085400g             103   1e-22   Phaseolus vulgaris [French bean]
ref|NP_189534.1|  homeobox protein 34                                   104   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004293203.2|  PREDICTED: zinc-finger homeodomain protein 6       104   2e-22   Fragaria vesca subsp. vesca
ref|XP_002460367.1|  hypothetical protein SORBIDRAFT_02g027040          104   2e-22   Sorghum bicolor [broomcorn]
ref|XP_011070997.1|  PREDICTED: zinc-finger homeodomain protein 10      103   2e-22   Sesamum indicum [beniseed]
ref|XP_003576623.1|  PREDICTED: zinc-finger homeodomain protein 1       103   2e-22   Brachypodium distachyon [annual false brome]
ref|XP_006859182.1|  PREDICTED: zinc-finger homeodomain protein 2       102   2e-22   Amborella trichopoda
sp|A2Z259.1|ZHD1_ORYSI  RecName: Full=Zinc-finger homeodomain pro...    103   2e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_002877141.1|  hypothetical protein ARALYDRAFT_484662             103   2e-22   
ref|NP_001063419.1|  Os09g0466400                                       103   2e-22   
emb|CAC34410.1|  ZF-HD homeobox protein                                 103   2e-22   Flaveria bidentis
ref|XP_006660219.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    103   2e-22   
emb|CDY20008.1|  BnaA09g02430D                                          103   2e-22   Brassica napus [oilseed rape]
ref|XP_006660717.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    103   2e-22   Oryza brachyantha
ref|XP_010554331.1|  PREDICTED: zinc-finger homeodomain protein 4       103   2e-22   
ref|XP_006395326.1|  hypothetical protein EUTSA_v10004599mg             103   2e-22   Eutrema salsugineum [saltwater cress]
ref|XP_002305381.2|  hypothetical protein POPTR_0004s12500g             103   2e-22   
emb|CBI27705.3|  unnamed protein product                              99.8    3e-22   Vitis vinifera
gb|EMT05330.1|  ZF-HD homeobox protein                                98.6    3e-22   
ref|XP_009111615.1|  PREDICTED: zinc-finger homeodomain protein 9...    103   3e-22   Brassica rapa
ref|XP_009151829.1|  PREDICTED: zinc-finger homeodomain protein 9       103   3e-22   Brassica rapa
ref|XP_010681042.1|  PREDICTED: zinc-finger homeodomain protein 1...    103   3e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009395689.1|  PREDICTED: zinc-finger homeodomain protein 5...    103   4e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002273802.1|  PREDICTED: zinc-finger homeodomain protein 11      103   4e-22   Vitis vinifera
gb|ERM94746.1|  hypothetical protein AMTR_s00011p00255340               102   4e-22   Amborella trichopoda
ref|XP_004957068.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    102   4e-22   Setaria italica
gb|EEE69868.1|  hypothetical protein OsJ_29679                          102   4e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CDY00104.1|  BnaC09g01970D                                          103   4e-22   
ref|XP_010682105.1|  PREDICTED: zinc-finger homeodomain protein 3...    103   4e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004230410.1|  PREDICTED: zinc-finger homeodomain protein 4       102   4e-22   Solanum lycopersicum
ref|XP_002267747.1|  PREDICTED: zinc-finger homeodomain protein 3       102   5e-22   Vitis vinifera
ref|XP_007023152.1|  Homeobox protein 31                                102   5e-22   
ref|XP_012081639.1|  PREDICTED: zinc-finger homeodomain protein 2...    102   5e-22   
ref|XP_011623848.1|  PREDICTED: zinc-finger homeodomain protein 2       102   5e-22   Amborella trichopoda
emb|CAN60614.1|  hypothetical protein VITISV_003253                   99.8    5e-22   Vitis vinifera
ref|XP_010102085.1|  hypothetical protein L484_009028                   103   6e-22   Morus notabilis
ref|XP_006470838.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...    102   6e-22   Citrus sinensis [apfelsine]
ref|XP_009407034.1|  PREDICTED: zinc-finger homeodomain protein 2...    102   6e-22   
gb|KDO42061.1|  hypothetical protein CISIN_1g048741mg                   102   6e-22   Citrus sinensis [apfelsine]
ref|XP_008810728.1|  PREDICTED: zinc-finger homeodomain protein 6...    102   6e-22   Phoenix dactylifera
ref|XP_006431432.1|  hypothetical protein CICLE_v10003702mg             102   7e-22   Citrus clementina [clementine]
ref|XP_009396485.1|  PREDICTED: zinc-finger homeodomain protein 6...    103   7e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012071869.1|  PREDICTED: zinc-finger homeodomain protein 5       102   7e-22   Jatropha curcas
emb|CDO97666.1|  unnamed protein product                                102   8e-22   Coffea canephora [robusta coffee]
ref|XP_010527865.1|  PREDICTED: zinc-finger homeodomain protein 4       102   8e-22   Tarenaya hassleriana [spider flower]
ref|XP_009336904.1|  PREDICTED: zinc-finger homeodomain protein 2...    102   8e-22   Pyrus x bretschneideri [bai li]
ref|XP_004238801.1|  PREDICTED: zinc-finger homeodomain protein 1...    102   8e-22   Solanum lycopersicum
ref|XP_007048627.1|  Homeobox protein 21, putative                      101   9e-22   
ref|XP_010425683.1|  PREDICTED: zinc-finger homeodomain protein 9...    102   9e-22   Camelina sativa [gold-of-pleasure]
ref|XP_003551238.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    101   9e-22   Glycine max [soybeans]
gb|KHN01227.1|  ZF-HD homeobox protein                                98.2    9e-22   Glycine soja [wild soybean]
dbj|BAE99230.1|  hypothetical protein                                   102   9e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CAC34409.1|  ZF-HD homeobox protein                                 102   9e-22   Flaveria bidentis
ref|NP_568570.1|  homeobox protein 23                                   102   9e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009613099.1|  PREDICTED: zinc-finger homeodomain protein 4       102   1e-21   Nicotiana tomentosiformis
ref|XP_003550152.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...    102   1e-21   Glycine max [soybeans]
ref|XP_009364948.1|  PREDICTED: zinc-finger homeodomain protein 2...    102   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_010254805.1|  PREDICTED: zinc-finger homeodomain protein 5...    102   1e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010514609.1|  PREDICTED: zinc-finger homeodomain protein 9...    102   1e-21   Camelina sativa [gold-of-pleasure]
gb|EPS61775.1|  hypothetical protein M569_13018                         101   1e-21   Genlisea aurea
ref|XP_010099792.1|  hypothetical protein L484_010980                   102   1e-21   Morus notabilis
gb|KHN03576.1|  ZF-HD homeobox protein                                  101   1e-21   Glycine soja [wild soybean]
gb|EYU35040.1|  hypothetical protein MIMGU_mgv1a014453mg              99.8    1e-21   Erythranthe guttata [common monkey flower]
ref|XP_007017558.1|  Homeobox protein 33 isoform 1                      101   1e-21   
ref|XP_002870762.1|  hypothetical protein ARALYDRAFT_494014             102   1e-21   
gb|AAM64462.1|  unknown                                                 102   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006405598.1|  hypothetical protein EUTSA_v10028098mg             102   1e-21   Eutrema salsugineum [saltwater cress]
ref|XP_009405659.1|  PREDICTED: zinc-finger homeodomain protein 6...    102   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001062055.1|  Os08g0479400                                       101   1e-21   
ref|XP_010502894.1|  PREDICTED: zinc-finger homeodomain protein 9       101   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_009788342.1|  PREDICTED: zinc-finger homeodomain protein 9...    101   1e-21   Nicotiana sylvestris
ref|XP_010527155.1|  PREDICTED: zinc-finger homeodomain protein 1     99.4    2e-21   Tarenaya hassleriana [spider flower]
ref|XP_009381483.1|  PREDICTED: zinc-finger homeodomain protein 2...    101   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN07994.1|  ZF-HD homeobox protein                                  100   2e-21   Glycine soja [wild soybean]
ref|XP_008357201.1|  PREDICTED: zinc-finger homeodomain protein 5...    101   2e-21   
ref|XP_008789175.1|  PREDICTED: zinc-finger homeodomain protein 4...    100   2e-21   Phoenix dactylifera
gb|AAT39967.1|  Putative ZF-HD homeobox protein, identical              101   2e-21   Solanum demissum
gb|ABY61020.1|  zinc finger-homeodomain protein 1                       100   2e-21   Eschscholzia californica
ref|XP_010939727.1|  PREDICTED: zinc-finger homeodomain protein 2       100   2e-21   Elaeis guineensis
gb|KJB48886.1|  hypothetical protein B456_008G092000                    100   2e-21   Gossypium raimondii
ref|XP_006366102.1|  PREDICTED: transcription factor HB29-like          100   2e-21   Solanum tuberosum [potatoes]
ref|XP_003517792.1|  PREDICTED: transcription factor HB29-like          101   2e-21   Glycine max [soybeans]
gb|KHN07993.1|  ZF-HD homeobox protein                                  100   2e-21   Glycine soja [wild soybean]
gb|KHN07995.1|  ZF-HD homeobox protein                                  100   2e-21   Glycine soja [wild soybean]
ref|XP_002510399.1|  transcription factor, putative                     100   2e-21   Ricinus communis
gb|ABO92969.1|  ZF-HD homeobox domain-containing protein                100   2e-21   Solanum tuberosum [potatoes]
ref|XP_008795929.1|  PREDICTED: zinc-finger homeodomain protein 6...    100   2e-21   
gb|KHG22175.1|  hypothetical protein F383_07505                         100   2e-21   Gossypium arboreum [tree cotton]
ref|XP_004142854.1|  PREDICTED: zinc-finger homeodomain protein 4       100   2e-21   Cucumis sativus [cucumbers]
ref|XP_004499360.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    100   2e-21   Cicer arietinum [garbanzo]
ref|NP_001149424.1|  LOC100283050                                       100   2e-21   
ref|XP_009762783.1|  PREDICTED: zinc-finger homeodomain protein 4...    100   2e-21   Nicotiana sylvestris
gb|EPS73952.1|  hypothetical protein M569_00810                       99.0    3e-21   Genlisea aurea
gb|KJB18248.1|  hypothetical protein B456_003G042700                    100   3e-21   Gossypium raimondii
ref|XP_010252306.1|  PREDICTED: zinc-finger homeodomain protein 4       100   3e-21   Nelumbo nucifera [Indian lotus]
ref|XP_011087615.1|  PREDICTED: zinc-finger homeodomain protein 4       100   3e-21   Sesamum indicum [beniseed]
ref|XP_012067956.1|  PREDICTED: zinc-finger homeodomain protein 2...    100   3e-21   Jatropha curcas
ref|XP_006349273.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    100   3e-21   Solanum tuberosum [potatoes]
ref|XP_010065227.1|  PREDICTED: zinc-finger homeodomain protein 4...    100   3e-21   Eucalyptus grandis [rose gum]
ref|XP_006291497.1|  hypothetical protein CARUB_v10017644mg             100   3e-21   Capsella rubella
gb|KJB70777.1|  hypothetical protein B456_011G090900                    100   3e-21   Gossypium raimondii
tpg|DAA48505.1|  TPA: putative homeobox DNA-binding domain superf...    100   3e-21   
ref|XP_003530620.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    100   3e-21   
ref|XP_009365549.1|  PREDICTED: zinc-finger homeodomain protein 2...    100   3e-21   Pyrus x bretschneideri [bai li]
gb|ADK63402.1|  homeobox domain zinc finger protein                   97.8    3e-21   Brassica rapa
ref|XP_009399684.1|  PREDICTED: zinc-finger homeodomain protein 1...    100   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADE77597.1|  unknown                                               99.8    4e-21   Picea sitchensis
ref|XP_007224511.1|  hypothetical protein PRUPE_ppa023369mg             100   4e-21   
ref|XP_010925945.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...    100   4e-21   Elaeis guineensis
gb|KHN40205.1|  ZF-HD homeobox protein                                98.6    4e-21   Glycine soja [wild soybean]
ref|NP_001151888.1|  ZF-HD protein dimerisation region containing...  99.8    4e-21   Zea mays [maize]
ref|XP_009602563.1|  PREDICTED: zinc-finger homeodomain protein 2...  99.8    4e-21   Nicotiana tomentosiformis
ref|XP_011010943.1|  PREDICTED: zinc-finger homeodomain protein 9...    100   4e-21   Populus euphratica
gb|ABY61023.1|  zinc finger homeodomain protein 1                     99.4    4e-21   Saruma henryi
gb|KJB75536.1|  hypothetical protein B456_012G046200                  98.2    4e-21   Gossypium raimondii
ref|XP_009758154.1|  PREDICTED: zinc-finger homeodomain protein 2...  99.4    5e-21   Nicotiana sylvestris
ref|XP_004973708.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    100   5e-21   Setaria italica
ref|XP_011028421.1|  PREDICTED: zinc-finger homeodomain protein 4       100   5e-21   Populus euphratica
ref|XP_011012906.1|  PREDICTED: zinc-finger homeodomain protein 4...  99.8    5e-21   Populus euphratica
ref|XP_003529692.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  99.8    5e-21   
ref|XP_003518249.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  99.4    5e-21   Glycine max [soybeans]
ref|XP_009620302.1|  PREDICTED: zinc-finger homeodomain protein 9...  99.8    5e-21   Nicotiana tomentosiformis
gb|KDO82923.1|  hypothetical protein CISIN_1g046396mg                   100   5e-21   Citrus sinensis [apfelsine]
ref|XP_006438687.1|  hypothetical protein CICLE_v10032160mg             100   5e-21   Citrus clementina [clementine]
emb|CDP01539.1|  unnamed protein product                              99.4    5e-21   Coffea canephora [robusta coffee]
ref|XP_004301574.1|  PREDICTED: zinc-finger homeodomain protein 4...    100   5e-21   Fragaria vesca subsp. vesca
gb|ABY61024.1|  zinc finger-homeodomain protein 2                     99.4    6e-21   Saruma henryi
ref|XP_006285795.1|  hypothetical protein CARUB_v10007269mg             100   6e-21   Capsella rubella
ref|XP_009393647.1|  PREDICTED: zinc-finger homeodomain protein 2...  99.4    6e-21   
gb|KEH32742.1|  homeobox domain, ZF-HD class protein                    100   6e-21   Medicago truncatula
ref|XP_006385095.1|  hypothetical protein POPTR_0004s23860g           99.8    6e-21   
ref|XP_007226172.1|  hypothetical protein PRUPE_ppa015411mg             100   6e-21   
ref|XP_011621016.1|  PREDICTED: zinc-finger homeodomain protein 2     99.4    6e-21   Amborella trichopoda
ref|XP_008338536.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  99.4    7e-21   
ref|XP_003633412.1|  PREDICTED: zinc-finger homeodomain protein 4     99.4    7e-21   Vitis vinifera
emb|CDY33960.1|  BnaC02g43770D                                        99.4    7e-21   Brassica napus [oilseed rape]
gb|KJB64195.1|  hypothetical protein B456_010G036300                  99.0    7e-21   Gossypium raimondii
ref|XP_008218634.1|  PREDICTED: zinc-finger homeodomain protein 4...  99.8    7e-21   Prunus mume [ume]
ref|XP_008460585.1|  PREDICTED: zinc-finger homeodomain protein 4     99.4    8e-21   Cucumis melo [Oriental melon]
ref|XP_007158386.1|  hypothetical protein PHAVU_002G148900g           98.6    8e-21   Phaseolus vulgaris [French bean]
ref|XP_002525870.1|  transcription factor, putative                   99.4    8e-21   
ref|XP_010086552.1|  hypothetical protein L484_001444                 99.8    8e-21   
ref|XP_008219382.1|  PREDICTED: zinc-finger homeodomain protein 2     99.0    8e-21   Prunus mume [ume]
ref|XP_006426395.1|  hypothetical protein CICLE_v10027184mg           98.2    9e-21   Citrus clementina [clementine]
gb|KJB44095.1|  hypothetical protein B456_007G233800                  98.6    9e-21   Gossypium raimondii
ref|XP_006394037.1|  hypothetical protein EUTSA_v10005568mg           99.0    9e-21   Eutrema salsugineum [saltwater cress]
ref|XP_007143929.1|  hypothetical protein PHAVU_007G114300g           97.4    9e-21   Phaseolus vulgaris [French bean]
emb|CDP11470.1|  unnamed protein product                              99.0    9e-21   Coffea canephora [robusta coffee]
ref|XP_007222197.1|  hypothetical protein PRUPE_ppa009679mg           99.0    9e-21   Prunus persica
gb|KHN08326.1|  ZF-HD homeobox protein                                99.0    1e-20   Glycine soja [wild soybean]
ref|XP_006380765.1|  hypothetical protein POPTR_0007s12970g           99.4    1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_002310240.2|  zinc finger family protein                       99.0    1e-20   
ref|XP_003635057.1|  PREDICTED: zinc-finger homeodomain protein 2...  98.2    1e-20   Vitis vinifera
ref|XP_009130511.1|  PREDICTED: zinc-finger homeodomain protein 1...  98.6    1e-20   Brassica rapa
ref|XP_012069129.1|  PREDICTED: zinc-finger homeodomain protein 4...  98.2    1e-20   
ref|XP_006827241.1|  PREDICTED: zinc-finger homeodomain protein 2     97.8    1e-20   Amborella trichopoda
gb|KJB44094.1|  hypothetical protein B456_007G233800                  98.2    1e-20   Gossypium raimondii
ref|XP_006466561.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  97.4    1e-20   Citrus sinensis [apfelsine]
gb|KJB30399.1|  hypothetical protein B456_005G141400                  98.2    1e-20   Gossypium raimondii
ref|XP_009800645.1|  PREDICTED: putative F-box/LRR-repeat protein...    100   1e-20   Nicotiana sylvestris
ref|XP_004288462.1|  PREDICTED: zinc-finger homeodomain protein 1...  98.2    1e-20   Fragaria vesca subsp. vesca
ref|XP_004299701.1|  PREDICTED: zinc-finger homeodomain protein 2...  98.2    1e-20   Fragaria vesca subsp. vesca
ref|XP_006426297.1|  hypothetical protein CICLE_v10027024mg           97.8    1e-20   Citrus clementina [clementine]
ref|XP_009373614.1|  PREDICTED: zinc-finger homeodomain protein 3...  99.4    1e-20   Pyrus x bretschneideri [bai li]
gb|ABY61025.1|  zinc finger-homeodomain protein 3                     97.1    2e-20   Saruma henryi
ref|XP_009139922.1|  PREDICTED: zinc-finger homeodomain protein 10    98.6    2e-20   Brassica rapa
gb|ABK25080.1|  unknown                                               98.2    2e-20   Picea sitchensis
ref|XP_008800713.1|  PREDICTED: zinc-finger homeodomain protein 6...  99.0    2e-20   
ref|XP_002445649.1|  hypothetical protein SORBIDRAFT_07g023360        98.6    2e-20   Sorghum bicolor [broomcorn]
emb|CBI19706.3|  unnamed protein product                              98.6    2e-20   Vitis vinifera
ref|XP_008385681.1|  PREDICTED: zinc-finger homeodomain protein 1...  98.2    2e-20   
gb|ABK25143.1|  unknown                                               98.2    2e-20   Picea sitchensis
ref|XP_006291509.1|  hypothetical protein CARUB_v10017657mg           98.6    2e-20   Capsella rubella
ref|XP_012067955.1|  PREDICTED: zinc-finger homeodomain protein 2...  98.6    2e-20   Jatropha curcas
ref|XP_010552878.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  99.0    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_003520078.1|  PREDICTED: transcription factor HB29-like        98.2    2e-20   Glycine max [soybeans]
emb|CAC34447.1|  ZF-HD homeobox protein                               97.4    2e-20   Flaveria bidentis
ref|XP_003544235.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  97.8    2e-20   Glycine max [soybeans]
ref|XP_008235400.1|  PREDICTED: zinc-finger homeodomain protein 1...  95.9    2e-20   
ref|XP_010060081.1|  PREDICTED: zinc-finger homeodomain protein 2...  98.6    2e-20   Eucalyptus grandis [rose gum]
ref|XP_004237971.1|  PREDICTED: zinc-finger homeodomain protein 2     97.8    2e-20   Solanum lycopersicum
dbj|BAK05545.1|  predicted protein                                    99.4    2e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009355386.1|  PREDICTED: zinc-finger homeodomain protein 3     99.0    2e-20   Pyrus x bretschneideri [bai li]
ref|XP_009607017.1|  PREDICTED: zinc-finger homeodomain protein 4...  97.8    2e-20   Nicotiana tomentosiformis
gb|KJB58256.1|  hypothetical protein B456_009G201300                  98.2    2e-20   Gossypium raimondii
ref|XP_008378952.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  98.6    2e-20   
ref|XP_008378554.1|  PREDICTED: zinc-finger homeodomain protein 2...  97.8    2e-20   
ref|XP_010450775.1|  PREDICTED: zinc-finger homeodomain protein 1...  98.6    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010098663.1|  hypothetical protein L484_026038                 97.8    2e-20   Morus notabilis
gb|KHN07843.1|  ZF-HD homeobox protein                                95.9    2e-20   Glycine soja [wild soybean]
ref|XP_006853040.1|  PREDICTED: zinc-finger homeodomain protein 2     97.4    2e-20   Amborella trichopoda
ref|XP_008670258.1|  PREDICTED: zinc-finger homeodomain protein 1...  98.2    2e-20   
gb|KJB80187.1|  hypothetical protein B456_013G085500                  98.2    2e-20   Gossypium raimondii
ref|XP_011004015.1|  PREDICTED: zinc-finger homeodomain protein 5...  98.2    2e-20   Populus euphratica
gb|KJB58948.1|  hypothetical protein B456_009G231800                  97.4    2e-20   Gossypium raimondii
ref|XP_010441087.1|  PREDICTED: zinc-finger homeodomain protein 10    98.6    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_002514009.1|  transcription factor, putative                   97.8    2e-20   Ricinus communis
ref|XP_010272957.1|  PREDICTED: zinc-finger homeodomain protein 1...  97.1    2e-20   Nelumbo nucifera [Indian lotus]
ref|XP_002994344.1|  hypothetical protein SELMODRAFT_236945           95.5    3e-20   
ref|XP_007156483.1|  hypothetical protein PHAVU_003G289700g           96.7    3e-20   Phaseolus vulgaris [French bean]
ref|XP_006338094.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  97.1    3e-20   Solanum tuberosum [potatoes]
ref|XP_009410127.1|  PREDICTED: zinc-finger homeodomain protein 2...  97.4    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010484369.1|  PREDICTED: zinc-finger homeodomain protein 1...  97.8    3e-20   
ref|XP_010263641.1|  PREDICTED: zinc-finger homeodomain protein 5     98.2    3e-20   
ref|XP_008806398.1|  PREDICTED: zinc-finger homeodomain protein 1...  95.5    3e-20   
ref|XP_009415270.1|  PREDICTED: zinc-finger homeodomain protein 6...  98.2    3e-20   
ref|XP_011003997.1|  PREDICTED: zinc-finger homeodomain protein 2...  97.4    3e-20   
ref|XP_006581501.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  97.4    3e-20   
ref|XP_009341386.1|  PREDICTED: zinc-finger homeodomain protein 3...  98.2    3e-20   
emb|CDY34299.1|  BnaA01g14020D                                        96.7    3e-20   
ref|XP_010444532.1|  PREDICTED: zinc-finger homeodomain protein 1     97.4    3e-20   
ref|XP_008339432.1|  PREDICTED: zinc-finger homeodomain protein 3...  98.2    3e-20   
ref|XP_010463122.1|  PREDICTED: zinc-finger homeodomain protein 1...  97.4    3e-20   
emb|CBI19232.3|  unnamed protein product                              97.1    3e-20   
ref|XP_002966118.1|  hypothetical protein SELMODRAFT_85536            95.1    4e-20   
ref|XP_004489767.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  97.1    4e-20   
ref|XP_006341952.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  97.4    4e-20   
ref|XP_003574645.1|  PREDICTED: zinc-finger homeodomain protein 1...  97.4    4e-20   
ref|XP_012067957.1|  PREDICTED: zinc-finger homeodomain protein 2...  97.1    4e-20   
ref|XP_007141241.1|  hypothetical protein PHAVU_008G179200g           97.1    4e-20   
gb|ABY61028.1|  zinc finger-homeodomain protein 1                     96.7    4e-20   
ref|XP_009403170.1|  PREDICTED: zinc-finger homeodomain protein 9...  97.4    4e-20   
ref|XP_009138327.1|  PREDICTED: zinc-finger homeodomain protein 2     96.3    4e-20   
ref|XP_006280898.1|  hypothetical protein CARUB_v10026891mg           97.4    4e-20   
ref|XP_007046103.1|  Homeobox protein 34, putative                    97.4    4e-20   
gb|AAM10791.1|  hypothetical protein At2g02540/T822.16                97.4    4e-20   
ref|NP_178358.1|  homeobox protein 21                                 97.4    4e-20   
emb|CDY03431.1|  BnaC01g16510D                                        96.3    4e-20   
emb|CDP20040.1|  unnamed protein product                              95.1    5e-20   
ref|XP_008812231.1|  PREDICTED: zinc-finger homeodomain protein 2...  97.1    5e-20   
ref|XP_001785616.1|  predicted protein                                97.1    5e-20   
ref|XP_010266504.1|  PREDICTED: zinc-finger homeodomain protein 1...  95.9    5e-20   
ref|XP_002285709.1|  PREDICTED: zinc-finger homeodomain protein 1     95.9    5e-20   
ref|XP_011075633.1|  PREDICTED: zinc-finger homeodomain protein 1...  94.7    6e-20   
ref|XP_009406459.1|  PREDICTED: zinc-finger homeodomain protein 4...  96.7    6e-20   
emb|CDX81284.1|  BnaC09g06950D                                        96.3    6e-20   
ref|XP_002965557.1|  hypothetical protein SELMODRAFT_68508            95.1    6e-20   
gb|AHC04641.1|  zinc-finger homeodomain 1                             97.4    6e-20   
ref|XP_010502266.1|  PREDICTED: zinc-finger homeodomain protein 3...  97.1    6e-20   
gb|EEC67940.1|  hypothetical protein OsI_35664                        97.4    6e-20   
ref|XP_007018165.1|  Transcription factor, putative                   96.3    6e-20   
ref|XP_011025804.1|  PREDICTED: zinc-finger homeodomain protein 6     97.1    6e-20   
ref|XP_002867654.1|  ATHB22/MEE68                                     95.5    6e-20   
ref|XP_008788352.1|  PREDICTED: zinc-finger homeodomain protein 4...  96.3    6e-20   
ref|XP_010246039.1|  PREDICTED: zinc-finger homeodomain protein 1...  96.7    7e-20   
ref|XP_006376247.1|  hypothetical protein POPTR_0013s11330g           96.3    7e-20   
ref|XP_004495441.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  95.1    7e-20   
ref|XP_003530618.2|  PREDICTED: ZF-HD homeobox protein At4g24660-...  96.3    8e-20   
gb|ABY61021.1|  zinc finger-homeodomain protein 2                     96.3    8e-20   
ref|XP_002306871.1|  zinc finger family protein                       96.3    8e-20   
ref|XP_003519839.2|  PREDICTED: ZF-HD homeobox protein At4g24660-...  96.3    8e-20   
ref|XP_009112180.1|  PREDICTED: zinc-finger homeodomain protein 1...  95.9    8e-20   
ref|XP_010530124.1|  PREDICTED: zinc-finger homeodomain protein 2     95.5    8e-20   
ref|XP_007205692.1|  hypothetical protein PRUPE_ppa009712mg           96.3    9e-20   
emb|CDY54719.1|  BnaA09g52500D                                        95.5    9e-20   
ref|XP_009385760.1|  PREDICTED: zinc-finger homeodomain protein 2...  96.3    9e-20   
ref|XP_009129138.1|  PREDICTED: zinc-finger homeodomain protein 3     96.3    9e-20   
emb|CDP02013.1|  unnamed protein product                              96.7    9e-20   
ref|XP_006376248.1|  hypothetical protein POPTR_0013s11330g           96.3    9e-20   
ref|XP_010927875.1|  PREDICTED: zinc-finger homeodomain protein 4...  95.9    9e-20   
ref|XP_011001095.1|  PREDICTED: zinc-finger homeodomain protein 2...  95.9    1e-19   
ref|NP_565106.1|  homeobox protein 33                                 96.3    1e-19   
ref|XP_003615230.1|  Zinc finger-homeodomain protein                  95.9    1e-19   
ref|XP_010930367.1|  PREDICTED: zinc-finger homeodomain protein 4...  95.9    1e-19   
gb|AES96050.2|  homeobox domain, ZF-HD class protein                  95.9    1e-19   
ref|XP_004232414.1|  PREDICTED: zinc-finger homeodomain protein 5     95.9    1e-19   
gb|KJB43477.1|  hypothetical protein B456_007G202500                  96.3    1e-19   
ref|XP_003530619.2|  PREDICTED: ZF-HD homeobox protein At4g24660-...  95.5    1e-19   
ref|XP_008808961.1|  PREDICTED: zinc-finger homeodomain protein 4...  95.9    1e-19   
ref|XP_009763792.1|  PREDICTED: zinc-finger homeodomain protein 5...  95.9    1e-19   
emb|CDY14559.1|  BnaC03g49000D                                        95.9    1e-19   
gb|KJB37131.1|  hypothetical protein B456_006G190600                  94.0    1e-19   
ref|XP_006395776.1|  hypothetical protein EUTSA_v10004643mg           96.3    1e-19   
ref|XP_009393644.1|  PREDICTED: zinc-finger homeodomain protein 2...  95.9    1e-19   
gb|KHG11042.1|  hypothetical protein F383_15979                       95.9    1e-19   
ref|XP_009403385.1|  PREDICTED: zinc-finger homeodomain protein 4...  95.5    1e-19   
ref|XP_002281371.1|  PREDICTED: zinc-finger homeodomain protein 6     95.9    1e-19   
ref|XP_009150629.1|  PREDICTED: zinc-finger homeodomain protein 1...  95.9    1e-19   
ref|XP_010448536.1|  PREDICTED: zinc-finger homeodomain protein 2     94.7    1e-19   
ref|XP_009393645.1|  PREDICTED: zinc-finger homeodomain protein 2...  95.5    1e-19   
emb|CAN75153.1|  hypothetical protein VITISV_035994                   95.5    1e-19   
ref|XP_009416998.1|  PREDICTED: zinc-finger homeodomain protein 4...  95.5    1e-19   
ref|XP_004501619.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  95.5    1e-19   
ref|XP_004956814.1|  PREDICTED: transcription factor HB29-like        96.3    1e-19   
ref|XP_004490406.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  95.5    1e-19   
ref|XP_006305389.1|  hypothetical protein CARUB_v10009782mg           95.9    1e-19   
ref|XP_008678040.1|  PREDICTED: zinc-finger homeodomain protein 4...  96.3    1e-19   
ref|NP_194197.1|  ZF-HD homeobox protein                              94.7    1e-19   
ref|XP_010433740.1|  PREDICTED: zinc-finger homeodomain protein 2...  94.7    1e-19   
ref|XP_010438998.1|  PREDICTED: zinc-finger homeodomain protein 2...  94.7    2e-19   
gb|ERN02922.1|  hypothetical protein AMTR_s00135p00085840             94.7    2e-19   
ref|XP_008678039.1|  PREDICTED: zinc-finger homeodomain protein 4...  96.7    2e-19   
ref|XP_008781669.1|  PREDICTED: zinc-finger homeodomain protein 8...  94.7    2e-19   
ref|XP_009769508.1|  PREDICTED: zinc-finger homeodomain protein 2...  94.7    2e-19   
ref|XP_006286279.1|  hypothetical protein CARUB_v10007856mg           94.4    2e-19   
ref|XP_003602944.1|  Zinc finger-homeodomain protein                  95.1    2e-19   
ref|XP_002864955.1|  hypothetical protein ARALYDRAFT_919872           95.1    2e-19   
ref|XP_002302329.1|  hypothetical protein POPTR_0002s10330g           95.1    2e-19   
ref|XP_009619186.1|  PREDICTED: zinc-finger homeodomain protein 2...  94.7    2e-19   
ref|XP_011016887.1|  PREDICTED: zinc-finger homeodomain protein 2     95.1    2e-19   
ref|XP_010675490.1|  PREDICTED: zinc-finger homeodomain protein 1...  95.5    2e-19   
gb|KFK28242.1|  hypothetical protein AALP_AA8G490700                  95.1    2e-19   
gb|ADE76551.1|  unknown                                               95.1    2e-19   
gb|EAY87240.1|  hypothetical protein OsI_08642                        92.0    2e-19   
gb|KFK33764.1|  hypothetical protein AALP_AA5G057200                  95.5    2e-19   
ref|XP_009769511.1|  PREDICTED: zinc-finger homeodomain protein 2...  94.7    2e-19   
ref|XP_004143449.1|  PREDICTED: zinc-finger homeodomain protein 1...  94.7    2e-19   
gb|ABR16776.1|  unknown                                               95.1    2e-19   
ref|XP_006413402.1|  hypothetical protein EUTSA_v10026163mg           94.4    2e-19   
ref|XP_002449277.1|  hypothetical protein SORBIDRAFT_05g007050        96.3    2e-19   
ref|XP_006663328.1|  PREDICTED: uncharacterized protein LOC102703731  95.9    2e-19   
ref|XP_008440565.1|  PREDICTED: zinc-finger homeodomain protein 1...  94.4    2e-19   
ref|XP_010104483.1|  hypothetical protein L484_025452                 95.1    2e-19   
ref|XP_002462378.1|  hypothetical protein SORBIDRAFT_02g024650        95.5    3e-19   
ref|XP_010930757.1|  PREDICTED: zinc-finger homeodomain protein 2...  94.4    3e-19   
ref|XP_006340630.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  95.1    3e-19   
ref|XP_012076140.1|  PREDICTED: zinc-finger homeodomain protein 6...  95.1    3e-19   
ref|XP_001772697.1|  predicted protein                                93.2    3e-19   
ref|XP_009373696.1|  PREDICTED: zinc-finger homeodomain protein 2...  94.7    3e-19   
ref|XP_009380358.1|  PREDICTED: zinc-finger homeodomain protein 6...  95.1    3e-19   
ref|XP_009392577.1|  PREDICTED: zinc-finger homeodomain protein 4...  94.4    3e-19   
ref|XP_010496079.1|  PREDICTED: zinc-finger homeodomain protein 4...  95.1    3e-19   
emb|CBI18514.3|  unnamed protein product                              94.4    3e-19   
ref|XP_002875135.1|  hypothetical protein ARALYDRAFT_484166           95.1    3e-19   
ref|XP_008385682.1|  PREDICTED: zinc-finger homeodomain protein 1...  94.7    3e-19   
gb|ACG35864.1|  ZF-HD homeobox protein                                95.5    3e-19   
ref|XP_007136351.1|  hypothetical protein PHAVU_009G037900g           94.7    3e-19   
ref|XP_007046919.1|  Homeobox protein 24, putative                    95.5    3e-19   
ref|XP_010476498.1|  PREDICTED: zinc-finger homeodomain protein 4     95.1    3e-19   
ref|XP_006425664.1|  hypothetical protein CICLE_v10025926mg           95.1    3e-19   
ref|XP_010458941.1|  PREDICTED: zinc-finger homeodomain protein 4...  94.7    3e-19   
ref|XP_006433874.1|  hypothetical protein CICLE_v10002355mg           94.0    3e-19   
ref|XP_008385680.1|  PREDICTED: zinc-finger homeodomain protein 1...  94.7    3e-19   
ref|XP_007047820.1|  ZF-HD homeobox protein, putative                 94.4    3e-19   
emb|CAN64849.1|  hypothetical protein VITISV_004128                   94.0    3e-19   
ref|XP_004152612.1|  PREDICTED: zinc-finger homeodomain protein 2     94.0    3e-19   
ref|XP_010438997.1|  PREDICTED: zinc-finger homeodomain protein 2...  94.0    4e-19   
gb|KFK26902.1|  hypothetical protein AALP_AA8G308300                  94.7    4e-19   
ref|NP_001183843.1|  uncharacterized protein LOC100502436             95.1    4e-19   
ref|XP_003613092.1|  Zinc finger-homeodomain protein                  95.1    4e-19   
ref|XP_010912718.1|  PREDICTED: zinc-finger homeodomain protein 4...  94.4    4e-19   
ref|XP_004961117.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  94.4    4e-19   
ref|XP_008444884.1|  PREDICTED: zinc-finger homeodomain protein 2     93.6    4e-19   
ref|XP_011010389.1|  PREDICTED: zinc-finger homeodomain protein 2...  94.0    4e-19   
ref|XP_006655627.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  91.3    4e-19   
ref|XP_003526539.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  94.4    4e-19   
ref|NP_201344.1|  homeobox protein 25                                 94.4    4e-19   
ref|XP_010665240.1|  PREDICTED: zinc-finger homeodomain protein 2...  94.0    4e-19   
ref|XP_002443023.1|  hypothetical protein SORBIDRAFT_08g006490        94.7    4e-19   
ref|XP_002534484.1|  transcription factor, putative                   93.6    4e-19   
ref|XP_006417011.1|  hypothetical protein EUTSA_v10008236mg           94.4    4e-19   
ref|XP_009624224.1|  PREDICTED: zinc-finger homeodomain protein 2...  93.6    4e-19   
ref|XP_009403138.1|  PREDICTED: zinc-finger homeodomain protein 2...  94.0    4e-19   
emb|CDX81638.1|  BnaC08g39630D                                        94.4    4e-19   
emb|CDY41692.1|  BnaC02g34620D                                        94.4    4e-19   
ref|XP_010908151.1|  PREDICTED: zinc-finger homeodomain protein 4...  94.0    5e-19   
ref|XP_010425030.1|  PREDICTED: zinc-finger homeodomain protein 3...  94.4    5e-19   
emb|CDX85059.1|  BnaC05g19960D                                        93.6    5e-19   
gb|KDP34832.1|  hypothetical protein JCGZ_11194                       93.2    5e-19   
emb|CDY09363.1|  BnaA02g26470D                                        94.4    5e-19   
ref|XP_006363993.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  92.0    5e-19   
gb|AAZ07989.1|  zinc finger homeodomain protein 1                     94.4    5e-19   
ref|XP_006473167.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  92.8    5e-19   
gb|KHG07143.1|  hypothetical protein F383_33189                       94.0    5e-19   
gb|ABY61029.1|  zinc finger-homeodomain protein 1                     94.0    5e-19   
gb|EAZ19969.1|  hypothetical protein OsJ_35560                        90.9    5e-19   
emb|CDX85886.1|  BnaC06g22480D                                        94.0    5e-19   
gb|KDO36261.1|  hypothetical protein CISIN_1g048824mg                 92.8    5e-19   
ref|XP_006434579.1|  hypothetical protein CICLE_v10004050mg           92.8    5e-19   
ref|XP_002325543.2|  hypothetical protein POPTR_0019s11070g           93.2    5e-19   
emb|CDX69541.1|  BnaA10g18900D                                        93.6    6e-19   
ref|XP_008338913.1|  PREDICTED: zinc-finger homeodomain protein 2...  94.0    6e-19   
ref|XP_002306552.2|  hypothetical protein POPTR_0005s17620g           93.6    6e-19   
ref|XP_010539898.1|  PREDICTED: zinc-finger homeodomain protein 5...  93.6    6e-19   
ref|NP_001144285.1|  uncharacterized protein LOC100277167             94.0    6e-19   
ref|XP_001778248.1|  predicted protein                                93.6    6e-19   
ref|XP_010060080.1|  PREDICTED: zinc-finger homeodomain protein 2...  94.4    6e-19   
tpg|DAA40076.1|  TPA: ZF-HD homeobox protein                          94.4    6e-19   
gb|KJB14484.1|  hypothetical protein B456_002G127500                  93.6    6e-19   
gb|ACG39295.1|  hypothetical protein                                  94.0    6e-19   
ref|NP_001145929.1|  uncharacterized protein LOC100279452             94.4    6e-19   
emb|CDY08945.1|  BnaC08g11750D                                        92.4    6e-19   
ref|XP_002892806.1|  ATHB31                                           94.0    6e-19   
ref|XP_004238289.1|  PREDICTED: zinc-finger homeodomain protein 5     93.6    7e-19   
emb|CDX88950.1|  BnaA04g02360D                                        92.4    7e-19   
ref|XP_012075796.1|  PREDICTED: zinc-finger homeodomain protein 2...  93.2    7e-19   
gb|KJB40199.1|  hypothetical protein B456_007G050500                  93.6    7e-19   
ref|NP_001150690.1|  ZF-HD homeobox protein                           94.0    8e-19   
ref|XP_008338912.1|  PREDICTED: zinc-finger homeodomain protein 2...  93.6    8e-19   
pdb|1WH7|A  Chain A, Solution Structure Of Homeobox Domain Of Ara...  89.0    8e-19   
ref|XP_009410002.1|  PREDICTED: zinc-finger homeodomain protein 9     93.6    8e-19   
ref|XP_006383190.1|  hypothetical protein POPTR_0005s12420g           93.6    9e-19   
ref|XP_009121598.1|  PREDICTED: zinc-finger homeodomain protein 8     93.2    9e-19   
ref|NP_001152263.1|  ZF-HD homeobox protein                           92.8    9e-19   
gb|AFW79306.1|  ZF-HD homeobox protein                                92.8    9e-19   
ref|XP_010551857.1|  PREDICTED: zinc-finger homeodomain protein 8...  93.2    9e-19   
ref|XP_008389477.1|  PREDICTED: zinc-finger homeodomain protein 1...  93.6    9e-19   
ref|XP_006290001.1|  hypothetical protein CARUB_v10003631mg           93.2    9e-19   
ref|NP_172896.1|  homeobox protein 31                                 93.2    1e-18   
ref|XP_003576527.1|  PREDICTED: zinc-finger homeodomain protein 9...  93.6    1e-18   
ref|XP_010926548.1|  PREDICTED: zinc-finger homeodomain protein 9...  93.2    1e-18   
ref|XP_009104712.1|  PREDICTED: zinc-finger homeodomain protein 5...  93.2    1e-18   
gb|ABY61018.1|  zinc finger-homeodomain protein 1                     93.2    1e-18   
ref|XP_003522760.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  93.2    1e-18   
ref|XP_006578270.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  92.8    1e-18   
gb|KFK40227.1|  hypothetical protein AALP_AA3G347100                  92.4    1e-18   
gb|AAD39591.1|AC007858_5  10A19I.6                                    93.6    1e-18   
ref|XP_009421143.1|  PREDICTED: zinc-finger homeodomain protein 4...  92.8    1e-18   
ref|XP_004512050.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  92.8    1e-18   
dbj|BAJ92783.1|  predicted protein                                    94.0    1e-18   
ref|XP_001752347.1|  predicted protein                                92.8    1e-18   
ref|XP_007209606.1|  hypothetical protein PRUPE_ppa011508mg           91.7    1e-18   
ref|XP_010514025.1|  PREDICTED: zinc-finger homeodomain protein 3     93.2    1e-18   
ref|XP_010937133.1|  PREDICTED: zinc-finger homeodomain protein 9...  92.8    1e-18   
emb|CDP07504.1|  unnamed protein product                              92.4    2e-18   
sp|B8AX53.1|ZHD6_ORYSI  RecName: Full=Zinc-finger homeodomain pro...  92.0    2e-18   
ref|XP_006400038.1|  hypothetical protein EUTSA_v10016088mg           92.4    2e-18   
ref|XP_011083674.1|  PREDICTED: zinc-finger homeodomain protein 5     92.0    2e-18   
ref|NP_001056419.1|  Os05g0579300                                     92.0    2e-18   
ref|XP_006573021.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  92.0    2e-18   
ref|XP_009589660.1|  PREDICTED: zinc-finger homeodomain protein 2...  90.5    2e-18   
ref|XP_009117900.1|  PREDICTED: zinc-finger homeodomain protein 4...  92.4    2e-18   
ref|XP_010674293.1|  PREDICTED: zinc-finger homeodomain protein 1...  91.3    2e-18   



>ref|XP_009620291.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 87/139 (63%), Gaps = 10/139 (7%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P+  GRKRFRTKFTQDQK +ML+FAE++ WKIQKRDEELINDFC +IGVE+GVLKVWMHN
Sbjct  218  PNGSGRKRFRTKFTQDQKERMLEFAEKVEWKIQKRDEELINDFCSKIGVEKGVLKVWMHN  277

Query  605  NK-----NTVGKIDNITTTPaaaaaADNGNAHSLGFDIGRVNSAPLTSDFNLRPESNNNG  441
            NK      T     N   TP      +          I R N+  + S+F+L  ES+ + 
Sbjct  278  NKCKKDQATAAAAINTVATPNLLNGNNGNGF----GLISRNNTDTIASEFHLHHESSKDN  333

Query  440  SHSQNHYALHSGDVLAANG  384
                +H  LH+ D ++A+G
Sbjct  334  DKDHSHQ-LHNNDSVSAHG  351



>ref|XP_003543789.1| PREDICTED: transcription factor HB29-like [Glycine max]
Length=331

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 85/135 (63%), Gaps = 7/135 (5%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P+P    RKRFRTKFTQ+QK KM +FA+++GWK+Q+RDEE++ +FC EIGV+RGVLKVWM
Sbjct  178  PAPPHHSRKRFRTKFTQEQKEKMHEFADKVGWKMQRRDEEMVMEFCNEIGVDRGVLKVWM  237

Query  611  HNNKNTVGKIDNITTTPaaaaaADNGNAHSLGFDIGRVNSAPLTSDFNLRPES----NNN  444
            HNNKNT  K DN+        A  + N  +    IG V SA + S  ++        N N
Sbjct  238  HNNKNTFAKKDNLNGNSIGNVAIVSANGVA---PIGAVGSATVRSSVHVHEHEHGGINGN  294

Query  443  GSHSQNHYALHSGDV  399
            GS   NH  L S DV
Sbjct  295  GSGDNNHNPLGSRDV  309



>ref|XP_010655937.1| PREDICTED: zinc-finger homeodomain protein 10-like [Vitis vinifera]
Length=195

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -1

Query  806  PSSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            P S  P+    GRKRFRTKF+Q QK KM +FAER+GWK+QKRDEEL+ +FC E+GV++GV
Sbjct  84   PISSSPASGANGRKRFRTKFSQGQKKKMFEFAERVGWKMQKRDEELVAEFCNEVGVDKGV  143

Query  626  LKVWMHNNKNTVGKID  579
            LKVWMHNNKNT GK D
Sbjct  144  LKVWMHNNKNTFGKRD  159



>emb|CBI22215.3| unnamed protein product [Vitis vinifera]
Length=238

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -1

Query  806  PSSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            P S  P+    GRKRFRTKF+Q QK KM +FAER+GWK+QKRDEEL+ +FC E+GV++GV
Sbjct  120  PISSSPASGANGRKRFRTKFSQGQKEKMFEFAERVGWKMQKRDEELVAEFCNEVGVDKGV  179

Query  626  LKVWMHNNKNTVGKID  579
            LKVWMHNNKNT GK D
Sbjct  180  LKVWMHNNKNTFGKRD  195



>emb|CDP02232.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKRFRTKFT +QK KMLDFAE+IGWKIQKRDE+LI +FC EIGV++GVLKVWMHNNKNT
Sbjct  225  GRKRFRTKFTPNQKEKMLDFAEKIGWKIQKRDEDLIAEFCNEIGVDKGVLKVWMHNNKNT  284

Query  593  VGKID  579
             GK D
Sbjct  285  FGKRD  289



>ref|XP_002283533.1| PREDICTED: zinc-finger homeodomain protein 9 [Vitis vinifera]
Length=341

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -1

Query  806  PSSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            P S  P+    GRKRFRTKF+Q QK KM +FAER+GWK+QKRDEEL+ +FC E+GV++GV
Sbjct  191  PISSSPASGANGRKRFRTKFSQGQKEKMFEFAERVGWKMQKRDEELVAEFCNEVGVDKGV  250

Query  626  LKVWMHNNKNTVGKID  579
            LKVWMHNNKNT GK D
Sbjct  251  LKVWMHNNKNTFGKRD  266



>ref|XP_004233363.1| PREDICTED: zinc-finger homeodomain protein 9-like [Solanum lycopersicum]
Length=354

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P  H  GRKRFRTKFT DQK KM +FAER+GWK+QKRDE+L+++FC EIGVE+GVLKVWM
Sbjct  197  PLGHSNGRKRFRTKFTPDQKVKMQEFAERVGWKMQKRDEDLVSNFCNEIGVEKGVLKVWM  256

Query  611  HNNKNTVGK  585
            HNNKNT GK
Sbjct  257  HNNKNTFGK  265



>ref|XP_011655994.1| PREDICTED: zinc-finger homeodomain protein 10-like [Cucumis sativus]
 gb|KGN52458.1| hypothetical protein Csa_5G636510 [Cucumis sativus]
Length=307

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+ +QK KMLDFAER+GWK+QKRDE+L+ DFC ++GVERGVLKVWMHNNKNT+
Sbjct  199  RKRFRTKFSNEQKEKMLDFAERVGWKMQKRDEDLVRDFCNQVGVERGVLKVWMHNNKNTM  258

Query  590  GK  585
            GK
Sbjct  259  GK  260



>gb|ABY61030.1| zinc finger-homeodomain protein 1, partial [Cucumis sativus]
Length=302

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+ +QK KMLDFAER+GWK+QKRDE+L+ DFC ++GVERGVLKVWMHNNKNT+
Sbjct  194  RKRFRTKFSNEQKEKMLDFAERVGWKMQKRDEDLVRDFCNQVGVERGVLKVWMHNNKNTM  253

Query  590  GK  585
            GK
Sbjct  254  GK  255



>ref|XP_009787877.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
sylvestris]
Length=358

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKRFRTKFT DQK KML+FAER+GWK+QKRDE+L+  FC EIGVE+GVLKVWMHNNKNT
Sbjct  214  GRKRFRTKFTPDQKVKMLEFAERVGWKMQKRDEDLVRSFCNEIGVEKGVLKVWMHNNKNT  273

Query  593  VGK  585
             GK
Sbjct  274  FGK  276



>ref|XP_009376317.1| PREDICTED: zinc-finger homeodomain protein 9 [Pyrus x bretschneideri]
Length=323

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = -1

Query  806  PSSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            P  + PSP+   RKRFRTKFTQDQK KM  FAER+GWK+QKRDEE++ +FC E G+E+GV
Sbjct  173  PQIVSPSPN--ARKRFRTKFTQDQKEKMYQFAERVGWKMQKRDEEIVQEFCNEAGIEKGV  230

Query  626  LKVWMHNNKNTVGKID  579
            LKVWMHNNKNT  K D
Sbjct  231  LKVWMHNNKNTFSKRD  246



>gb|KJB75739.1| hypothetical protein B456_012G054300 [Gossypium raimondii]
Length=337

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ QK KML+FAE+IGWKIQKRDEE I +FCRE+GV+RGVLKVWMHNNKNT 
Sbjct  198  KKRFRTKFTQYQKDKMLEFAEKIGWKIQKRDEEDIQEFCREVGVDRGVLKVWMHNNKNTF  257

Query  590  GKID  579
            GK D
Sbjct  258  GKKD  261



>ref|XP_011085755.1| PREDICTED: zinc-finger homeodomain protein 9 [Sesamum indicum]
Length=345

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFTQDQK KM +FAER+GWK+QKRDE++I++FC EIGV++GV KVWMHNNKNT 
Sbjct  201  RKRFRTKFTQDQKEKMFEFAERVGWKMQKRDEDVISEFCSEIGVDKGVFKVWMHNNKNTF  260

Query  590  GKID  579
            GK D
Sbjct  261  GKKD  264



>ref|XP_006363398.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=346

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P  +  GRKRFRTKFT DQK KML+ AERIGWK+QKRDE+L+++FC EIGVE+GVLKVWM
Sbjct  192  PLANSNGRKRFRTKFTPDQKVKMLELAERIGWKMQKRDEDLVSNFCNEIGVEKGVLKVWM  251

Query  611  HNNKNTVGK  585
            HNNKNT GK
Sbjct  252  HNNKNTFGK  260



>ref|XP_008443414.1| PREDICTED: zinc-finger homeodomain protein 9-like [Cucumis melo]
Length=298

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 65/75 (87%), Gaps = 2/75 (3%)
 Frame = -1

Query  803  SSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVL  624
            S + PSP+   RKRFRTKFTQ+QK +M +FAE++GWKIQKRDE++I +FC ++GV+RGVL
Sbjct  191  SIMTPSPN--SRKRFRTKFTQNQKERMYEFAEKVGWKIQKRDEDMIQEFCSDVGVDRGVL  248

Query  623  KVWMHNNKNTVGKID  579
            KVWMHNNKNT+GK D
Sbjct  249  KVWMHNNKNTLGKKD  263



>ref|XP_008467057.1| PREDICTED: zinc-finger homeodomain protein 10-like [Cucumis melo]
Length=315

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+ +QK KMLDFAER+GWK+QKRD++L+ DFC ++GVERGVLKVWMHNNKNT+
Sbjct  207  RKRFRTKFSNEQKEKMLDFAERVGWKMQKRDDDLVRDFCNQVGVERGVLKVWMHNNKNTM  266

Query  590  GK  585
            GK
Sbjct  267  GK  268



>ref|XP_004147471.1| PREDICTED: zinc-finger homeodomain protein 9-like [Cucumis sativus]
 gb|KGN59574.1| hypothetical protein Csa_3G826680 [Cucumis sativus]
Length=298

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = -1

Query  797  IHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKV  618
            + PSP+   RKRFRTKFTQ+QK +M +FAE++GWKIQKRDE++I +FC ++GV+RGVLKV
Sbjct  193  LTPSPN--SRKRFRTKFTQNQKERMYEFAEKVGWKIQKRDEDMIQEFCSDVGVDRGVLKV  250

Query  617  WMHNNKNTVGKID  579
            WMHNNKNT+GK D
Sbjct  251  WMHNNKNTLGKKD  263



>ref|XP_006357111.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=329

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 85/138 (62%), Gaps = 8/138 (6%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKRFRTKFT DQK KML FAE++ WK+QKRDE+L+N+FC EIGVE+GVLKVWMHNNK T
Sbjct  187  GRKRFRTKFTPDQKMKMLKFAEKVEWKMQKRDEDLVNNFCNEIGVEKGVLKVWMHNNKTT  246

Query  593  VGKIDNITTTPaaaaaADNGNAHSL--GFDIGRVNSAP------LTSDFNLRPESNNNGS  438
                  +           NGN +++  GF I   N+          S+F++  ES+ N  
Sbjct  247  SVSGKKLDQPITGNGDHQNGNTNNIVNGFCIVSRNNTTHPDQNNTDSEFHIHHESSMNDD  306

Query  437  HSQNHYALHSGDVLAANG  384
            + + H +  + +V+  NG
Sbjct  307  NKKEHLSFDANNVVVTNG  324



>ref|XP_009621030.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
tomentosiformis]
Length=356

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKRFRTKFT DQK KML+FAER+GWK+QKRDE+L+  FC +IG+E+GVLKVWMHNNKNT
Sbjct  211  GRKRFRTKFTPDQKVKMLEFAERVGWKMQKRDEDLVRSFCNQIGIEKGVLKVWMHNNKNT  270

Query  593  VGK  585
             GK
Sbjct  271  FGK  273



>ref|XP_009797863.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
sylvestris]
Length=358

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = -1

Query  803  SSIHPS-PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            SS H S P+  GRKRFRTKFTQDQK +ML+FAE++ WKIQKRDEELI+DFC +IGVE+GV
Sbjct  208  SSAHLSNPNGSGRKRFRTKFTQDQKERMLEFAEKVEWKIQKRDEELISDFCSKIGVEKGV  267

Query  626  LKVWMHNNK  600
            LKVWMHNNK
Sbjct  268  LKVWMHNNK  276



>emb|CBI29005.3| unnamed protein product [Vitis vinifera]
Length=587

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -1

Query  806  PSSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            P S  P+    GRKRFRTKF+Q QK KM +FAER+GWK+QKRDEEL+ +FC E+GV++GV
Sbjct  90   PISSSPASGANGRKRFRTKFSQGQKKKMFEFAERVGWKMQKRDEELVAEFCNEVGVDKGV  149

Query  626  LKVWMHNNKNTVGKIDN  576
            LKVWMHNNKNT GK D+
Sbjct  150  LKVWMHNNKNTFGKRDD  166



>ref|XP_012084702.1| PREDICTED: zinc-finger homeodomain protein 9-like [Jatropha curcas]
Length=328

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  803  SSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVL  624
            S+I+ S  +  RKRFRTKF+Q+QK +M  FAER+GWK+QKRDEELI +FC E+GV++GVL
Sbjct  195  SNINVSGGVSARKRFRTKFSQNQKERMYQFAERVGWKMQKRDEELIQEFCNEVGVDKGVL  254

Query  623  KVWMHNNKNTVGKID  579
            KVWMHNNKNT GK D
Sbjct  255  KVWMHNNKNTFGKRD  269



>ref|XP_010088163.1| hypothetical protein L484_013608 [Morus notabilis]
 gb|EXB31975.1| hypothetical protein L484_013608 [Morus notabilis]
Length=195

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -1

Query  788  SPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMH  609
            +P    RKRFRTKF+QDQK KM  FAE++GWK+QKRDEEL+ +FC EIGV++GVLKVWMH
Sbjct  42   TPSSSSRKRFRTKFSQDQKEKMCQFAEKVGWKMQKRDEELVREFCGEIGVDKGVLKVWMH  101

Query  608  NNKNTVGKIDN  576
            NNKNT  K D+
Sbjct  102  NNKNTFAKKDH  112



>ref|XP_006357697.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=307

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -1

Query  806  PSSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            P+S  P  +  GRKR+RTKFTQ+QK KML+F+ER+GW++QK+DEE+IN  C EI VE+GV
Sbjct  185  PNSTTPVSNPNGRKRYRTKFTQNQKEKMLEFSERVGWRMQKQDEEIINKLCHEISVEKGV  244

Query  626  LKVWMHNNKNTVGKID  579
            LKVWMHNNKN  G+ D
Sbjct  245  LKVWMHNNKNNFGRKD  260



>gb|KHN13618.1| ZF-HD homeobox protein [Glycine soja]
Length=163

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = -1

Query  803  SSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVL  624
            S+  PS  +  RKRFRTKF+Q+QK KM  FAE++GWKIQKRDE+LI++FC E+GV+R VL
Sbjct  15   STAAPSAALS-RKRFRTKFSQEQKEKMHKFAEKVGWKIQKRDEDLIHEFCNEVGVDRSVL  73

Query  623  KVWMHNNKNTVGKIDN  576
            KVWMHNNKNT  K DN
Sbjct  74   KVWMHNNKNTFAKKDN  89



>ref|XP_010693250.1| PREDICTED: zinc-finger homeodomain protein 9-like [Beta vulgaris 
subsp. vulgaris]
Length=400

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFTQ+QK KM DFAE++GWK+QK +E+++N FC EIGVERGV KVWMHNNKNT 
Sbjct  242  RKRFRTKFTQEQKDKMHDFAEKVGWKMQKTNEDMVNGFCNEIGVERGVFKVWMHNNKNTF  301

Query  590  GKIDNITT  567
            GKI + TT
Sbjct  302  GKIRSNTT  309



>ref|XP_011098625.1| PREDICTED: zinc-finger homeodomain protein 9-like [Sesamum indicum]
Length=325

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFTQDQK KM +FAE++GWK+QKRDE++I++FCREIGV++GV KVWMHNNKNT 
Sbjct  177  RKRFRTKFTQDQKEKMHEFAEKVGWKMQKRDEDVISEFCREIGVDKGVFKVWMHNNKNTF  236

Query  590  GKID  579
             K D
Sbjct  237  AKKD  240



>gb|KJB33553.1| hypothetical protein B456_006G017200 [Gossypium raimondii]
Length=326

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ QK KML+FAE++GWKIQKRDEE I +FC E+GV+RGVLKVWMHNNKNT 
Sbjct  209  KKRFRTKFTQFQKDKMLEFAEKVGWKIQKRDEEAIQEFCSEVGVDRGVLKVWMHNNKNTF  268

Query  590  GKID  579
            GK D
Sbjct  269  GKKD  272



>gb|KDP27147.1| hypothetical protein JCGZ_19846 [Jatropha curcas]
Length=148

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -1

Query  803  SSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVL  624
            S+I+ S  +  RKRFRTKF+QDQK  M   AER+GWK+QKRDEELI +FC E+G ++GVL
Sbjct  17   SNINVSGGVSARKRFRTKFSQDQKEIMYQVAERVGWKMQKRDEELIQEFCNEVGGDKGVL  76

Query  623  KVWMHNNKNTVGKID  579
            KVWMHNNKNT GK D
Sbjct  77   KVWMHNNKNTFGKRD  91



>ref|XP_008379353.1| PREDICTED: zinc-finger homeodomain protein 9-like [Malus domestica]
Length=353

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
             RKRFRTKFTQDQK KM  FAER+GWK+QKRDEE++ +FC E GVE+GVLKVWMHNNKNT
Sbjct  208  ARKRFRTKFTQDQKEKMYQFAERVGWKMQKRDEEIVREFCNEAGVEKGVLKVWMHNNKNT  267

Query  593  VGKID  579
              K D
Sbjct  268  FSKRD  272



>ref|XP_008341574.1| PREDICTED: zinc-finger homeodomain protein 10-like [Malus domestica]
Length=309

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = -1

Query  806  PSSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            P  +  SP+   RKRFRTKFTQDQK KM  FAER+GWK+QKR+EE++ +FC E+GVE+GV
Sbjct  197  PPIVSASPN--ARKRFRTKFTQDQKDKMHQFAERVGWKMQKREEEIVQEFCNEVGVEKGV  254

Query  626  LKVWMHNNKNTVGKID  579
            LKVWMHNNKNT  K D
Sbjct  255  LKVWMHNNKNTFTKRD  270



>ref|XP_004233362.1| PREDICTED: zinc-finger homeodomain protein 9 [Solanum lycopersicum]
Length=331

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 85/138 (62%), Gaps = 8/138 (6%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKRFRTKFT DQK KML+FAE++ WK+QKRDE+L+N+FC EIGVE+GVLKVWMHNNK T
Sbjct  189  GRKRFRTKFTPDQKIKMLEFAEKVEWKMQKRDEDLVNNFCNEIGVEKGVLKVWMHNNKTT  248

Query  593  V---GKIDNITTTPaaaaaADNGNAHSLGFDIGRVNSAP-----LTSDFNLRPESNNNGS  438
                 K+D   T         N N    GF I   N+         S+F++  ES+ N  
Sbjct  249  SISGKKLDQPNTDNGHNHQNGNSNYTVNGFCIVDRNNTTHHHDNTDSEFHIHHESSMNDD  308

Query  437  HSQNHYALHSGDVLAANG  384
            + + + +  + +V+  NG
Sbjct  309  NKKENSSFGANNVVVTNG  326



>ref|XP_003618493.1| Zinc finger-homeodomain protein [Medicago truncatula]
Length=223

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  788  SPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMH  609
            SP    RKRFRTKFTQ+QK KM +FA+++GWK+QKRDEE++N FC E+GV+R VLKVWMH
Sbjct  103  SPMGTSRKRFRTKFTQEQKEKMHEFADKVGWKMQKRDEEMVNGFCNEVGVDRSVLKVWMH  162

Query  608  NNKNTVGK  585
            NNKNT+G+
Sbjct  163  NNKNTLGR  170



>ref|XP_004304301.1| PREDICTED: zinc-finger homeodomain protein 9 [Fragaria vesca 
subsp. vesca]
Length=360

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q+QK KM  FAER+GWK+QKRDE+++++FC EIGV++GVLKVWMHNNKNT 
Sbjct  201  RKRFRTKFSQEQKDKMFQFAERVGWKMQKRDEDIVHEFCNEIGVDKGVLKVWMHNNKNTF  260

Query  590  GKIDNITT  567
             K D + +
Sbjct  261  AKRDGVVS  268



>ref|XP_006602909.1| PREDICTED: transcription factor HB29-like [Glycine max]
Length=338

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = -1

Query  803  SSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVL  624
            S+  PS  +  RKRFRTKF+Q+QK KM  FAE++GWKIQKRDE+LI++FC E+GV+R VL
Sbjct  190  STAAPSAAL-SRKRFRTKFSQEQKEKMHKFAEKVGWKIQKRDEDLIHEFCNEVGVDRSVL  248

Query  623  KVWMHNNKNTVGKIDN  576
            KVWMHNNKNT  K DN
Sbjct  249  KVWMHNNKNTFAKKDN  264



>ref|XP_003621193.1| ZF-HD homeobox protein [Medicago truncatula]
 gb|ABN05735.1| Homeobox domain, ZF-HD class; ZF-HD homeobox protein Cys/His-rich 
dimerisation region; Homeodomain-like [Medicago truncatula]
 gb|ABN08930.1| Homeobox domain, ZF-HD class; ZF-HD homeobox protein Cys/His-rich 
dimerisation region; Homeodomain-like [Medicago truncatula]
 gb|AES77411.1| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=341

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
             RKRFRTKFTQDQK KML FAE++GWK+QK+D+E +++FC EIGV+R VLKVWMHNNKNT
Sbjct  219  SRKRFRTKFTQDQKDKMLKFAEKVGWKMQKKDDEFVHEFCNEIGVDRSVLKVWMHNNKNT  278

Query  593  VGK  585
            + K
Sbjct  279  LAK  281



>ref|XP_008230766.1| PREDICTED: zinc-finger homeodomain protein 9-like [Prunus mume]
Length=357

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = -1

Query  806  PSSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            P  + PSP+   RKR RTKF Q+QK KM  FAER+GWK+QKRDEE++ +FC EI V++GV
Sbjct  200  PPIVSPSPN--ARKRIRTKFCQEQKDKMYQFAERVGWKMQKRDEEIVQEFCNEINVDKGV  257

Query  626  LKVWMHNNKNTVGKIDNI  573
            LKVWMHNNKNT  K D I
Sbjct  258  LKVWMHNNKNTFAKRDVI  275



>ref|XP_010258352.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nelumbo nucifera]
Length=296

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -1

Query  788  SPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMH  609
            +P+  GRKRFRTKF+Q+QK KM  F+ER+GWK+QK DEE++++FC EIGV +GVLKVWMH
Sbjct  191  TPNPNGRKRFRTKFSQEQKEKMYAFSERLGWKMQKSDEEVVDEFCNEIGVGKGVLKVWMH  250

Query  608  NNKNTVGKID  579
            NNK+T GK D
Sbjct  251  NNKHTFGKRD  260



>ref|XP_004489395.1| PREDICTED: transcription factor HB29-like [Cicer arietinum]
Length=322

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -1

Query  788  SPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMH  609
            SP    RKRFRTKFTQ+QK KM +FAE +GWK+QKRDEE +N FC E+GV+R VLKVWMH
Sbjct  206  SPMGTNRKRFRTKFTQEQKEKMHEFAESVGWKMQKRDEETVNGFCNEVGVDRSVLKVWMH  265

Query  608  NNKNTVGK  585
            NNKNT+G+
Sbjct  266  NNKNTLGR  273



>ref|XP_002324056.2| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 ref|XP_006373321.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 gb|EEF04189.2| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 gb|ERP51118.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
Length=340

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 63/78 (81%), Gaps = 4/78 (5%)
 Frame = -1

Query  806  PSSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            P  +  SP    RKRFRTKF+Q QK +M  FAER+GWK+QKRDE+L+ +FC E+GV+RGV
Sbjct  201  PPPVGSSP----RKRFRTKFSQSQKERMYQFAERVGWKMQKRDEDLVQEFCNEVGVDRGV  256

Query  626  LKVWMHNNKNTVGKIDNI  573
            LKVWMHNNKN++GK +++
Sbjct  257  LKVWMHNNKNSLGKKEHL  274



>gb|AES74711.2| transcription factor HB29-like protein [Medicago truncatula]
Length=333

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  788  SPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMH  609
            SP    RKRFRTKFTQ+QK KM +FA+++GWK+QKRDEE++N FC E+GV+R VLKVWMH
Sbjct  216  SPMGTSRKRFRTKFTQEQKEKMHEFADKVGWKMQKRDEEMVNGFCNEVGVDRSVLKVWMH  275

Query  608  NNKNTVGK  585
            NNKNT+G+
Sbjct  276  NNKNTLGR  283



>ref|XP_010936702.1| PREDICTED: zinc-finger homeodomain protein 6-like [Elaeis guineensis]
Length=293

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P+M  +KRFRTKFT +QK +MLDFAER+GW+IQK+DE L+ DFC E+GV R VLKVWMHN
Sbjct  216  PYMASKKRFRTKFTAEQKERMLDFAERMGWRIQKQDEALVEDFCAEVGVSRQVLKVWMHN  275

Query  605  NKNTVGK  585
            NK+T+ K
Sbjct  276  NKHTIRK  282



>ref|XP_007151228.1| hypothetical protein PHAVU_004G028600g [Phaseolus vulgaris]
 gb|ESW23222.1| hypothetical protein PHAVU_004G028600g [Phaseolus vulgaris]
Length=343

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P+     RKRFRTKF+Q+QK KM +FA+++GWK+QKRDE ++ +FC EIGV+RGVLKVWM
Sbjct  190  PAMAHHSRKRFRTKFSQEQKEKMHEFADKVGWKMQKRDENMVMEFCNEIGVDRGVLKVWM  249

Query  611  HNNKNTVGKIDNI  573
            HNNKNT+ K DN+
Sbjct  250  HNNKNTLAKKDNL  262



>ref|XP_007139577.1| hypothetical protein PHAVU_008G041300g [Phaseolus vulgaris]
 gb|ESW11571.1| hypothetical protein PHAVU_008G041300g [Phaseolus vulgaris]
Length=326

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q+QK KM  FA+++GWK+QKRDE+L+++FC EIGV+R VLKVWMHNNKNT+
Sbjct  198  RKRFRTKFSQEQKEKMHKFADKVGWKMQKRDEDLVHEFCNEIGVDRSVLKVWMHNNKNTL  257

Query  590  GKIDN  576
             K DN
Sbjct  258  AKKDN  262



>ref|XP_011097503.1| PREDICTED: zinc-finger homeodomain protein 2-like [Sesamum indicum]
Length=249

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            G+KRFRTKFTQ+QK KML+FAER+GWKIQK+DEE++  FC E+G++R VLKVWMHNNK+T
Sbjct  183  GKKRFRTKFTQEQKDKMLNFAERLGWKIQKQDEEMVQQFCSELGIKRHVLKVWMHNNKHT  242

Query  593  VG  588
            +G
Sbjct  243  LG  244



>ref|XP_011010066.1| PREDICTED: zinc-finger homeodomain protein 9-like [Populus euphratica]
Length=335

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q QK +M  FAER+GWK+QKRDE+L+ +FC E+GV++GVLKVWMHNNKN++
Sbjct  202  RKRFRTKFSQSQKERMFQFAERVGWKMQKRDEDLVQEFCNEVGVDKGVLKVWMHNNKNSL  261

Query  590  GKIDNI  573
            GK +++
Sbjct  262  GKKEHL  267



>gb|EPS61017.1| hypothetical protein M569_13783, partial [Genlisea aurea]
Length=244

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            PS    G+KRFRTKFTQ+QK KML+F+ER+GW+IQK+DEEL+  FC E+G++R VLKVWM
Sbjct  175  PSSSGGGKKRFRTKFTQEQKDKMLNFSERLGWRIQKQDEELVQQFCHEVGIKRHVLKVWM  234

Query  611  HNNKNTVGK  585
            HNNK+T+G+
Sbjct  235  HNNKHTLGE  243



>ref|XP_010257380.1| PREDICTED: zinc-finger homeodomain protein 9 [Nelumbo nucifera]
Length=300

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKRFRTKF+Q+QK KM  F+ER+GWK+QK DEE++ +FC EIGV +GVLKVWMHNNK+T
Sbjct  203  GRKRFRTKFSQEQKEKMHAFSERLGWKMQKTDEEVVEEFCNEIGVGKGVLKVWMHNNKHT  262

Query  593  VGKID  579
             GK D
Sbjct  263  FGKRD  267



>ref|XP_008782488.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=259

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P+M  RKRFRTKF+ +QK +MLDFAER+GW+IQK+DE L+ +FC E+GV R VLKVWMHN
Sbjct  182  PYMVSRKRFRTKFSAEQKERMLDFAERVGWRIQKQDEALVEEFCAEVGVSRQVLKVWMHN  241

Query  605  NKNTVGK  585
            NK+++ K
Sbjct  242  NKHSIRK  248



>ref|XP_011100018.1| PREDICTED: zinc-finger homeodomain protein 1-like [Sesamum indicum]
Length=215

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            G+KRFRTKFTQ+QK KML+ AER+ WKIQK+DEEL+  FC E+GV+R VLKVWMHNNK+T
Sbjct  151  GKKRFRTKFTQEQKDKMLNLAERLDWKIQKQDEELVQQFCSEVGVKRHVLKVWMHNNKHT  210

Query  593  VGK  585
            +GK
Sbjct  211  LGK  213



>ref|XP_002534012.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28370.1| conserved hypothetical protein [Ricinus communis]
Length=335

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q QK +M +FAER+GWK+QKRDEEL+ +FC E+GV++GVLKVWMHNNKNT 
Sbjct  217  RKRFRTKFSQTQKERMHEFAERVGWKMQKRDEELVQEFCNEVGVDKGVLKVWMHNNKNTF  276

Query  590  GKID  579
             + D
Sbjct  277  ARRD  280



>emb|CAC34413.1| ZF-HD homeobox protein [Flaveria trinervia]
Length=263

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  779  MKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNK  600
            + GRKRFRTKF+QDQK KML FAE++GWK+Q+ D++++ DFC EIG+ R VLKVWMHNNK
Sbjct  159  ISGRKRFRTKFSQDQKEKMLTFAEKVGWKLQRCDDKMVADFCSEIGIRRRVLKVWMHNNK  218

Query  599  NTVGK  585
            NT  K
Sbjct  219  NTSAK  223



>gb|KHN05023.1| ZF-HD homeobox protein [Glycine soja]
Length=190

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P+ K +KRFRTKFTQ+QK KML FAER GW+IQK DE L+  FC+EIG++R VLKVWMHN
Sbjct  118  PNEKVKKRFRTKFTQEQKEKMLAFAERAGWRIQKLDESLVQKFCQEIGIKRRVLKVWMHN  177

Query  605  NKNTVGK  585
            NKNT  K
Sbjct  178  NKNTFAK  184



>ref|XP_003555538.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=200

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P+ K +KRFRTKFTQ+QK KML FAER GW+IQK DE L+  FC+EIG++R VLKVWMHN
Sbjct  128  PNEKVKKRFRTKFTQEQKEKMLAFAERAGWRIQKLDESLVQKFCQEIGIKRRVLKVWMHN  187

Query  605  NKNTVGK  585
            NKNT  K
Sbjct  188  NKNTFAK  194



>gb|AAP44422.1| ZF-HD homeobox protein-like protein, partial [Lactuca sativa]
 gb|AAP44423.1| ZF-HD homeobox protein-like protein, partial [Lactuca sativa]
 gb|AAP44424.1| ZF-HD homeobox protein-like protein, partial [Lactuca sativa]
 gb|AAP44425.1| ZF-HD homeobox protein-like protein, partial [Lactuca serriola]
Length=132

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 62/83 (75%), Gaps = 5/83 (6%)
 Frame = -1

Query  806  PSSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            P +I  S    GRKRFRTKF+ DQK KM  FAE++GWK+Q+ D++LI DFC EIG+ RG+
Sbjct  19   PMAIKTS----GRKRFRTKFSLDQKEKMTIFAEKLGWKMQRCDDKLIADFCNEIGIRRGI  74

Query  626  LKVWMHNNKNTVGKID-NITTTP  561
             KVWMHNNKN  GK + +ITTT 
Sbjct  75   FKVWMHNNKNNFGKREKDITTTA  97



>gb|EPS58358.1| hypothetical protein M569_16456, partial [Genlisea aurea]
Length=195

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -1

Query  806  PSSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            P +  P+     RKRFRTKF+Q QK KML+ AE++GWK+QKRD++LIN+ C +IGV++GV
Sbjct  113  PDNTPPNSGSGSRKRFRTKFSQFQKVKMLELAEKVGWKMQKRDDDLINESCSDIGVDKGV  172

Query  626  LKVWMHNNKNTVGKID  579
             KVWMHNNKNT GK D
Sbjct  173  FKVWMHNNKNTFGKKD  188



>gb|EYU34567.1| hypothetical protein MIMGU_mgv1a012253mg [Erythranthe guttata]
Length=256

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 62/73 (85%), Gaps = 2/73 (3%)
 Frame = -1

Query  797  IHPSPHMK--GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVL  624
             + +PHM   G+KRFRTKFT +QK KML+FAER+GW+IQK++EE++  FC E+G++R VL
Sbjct  182  YYSNPHMSSSGKKRFRTKFTAEQKDKMLNFAERLGWRIQKQEEEMVQQFCGEMGIKRHVL  241

Query  623  KVWMHNNKNTVGK  585
            KVWMHNNK+T+GK
Sbjct  242  KVWMHNNKHTLGK  254



>ref|XP_008220812.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X1 [Prunus 
mume]
Length=356

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P    +KRFRTKFTQ+QK +M +FAE++GW+IQK+DEE +  FC E+GV+R VL+VWMHN
Sbjct  257  PFAMSKKRFRTKFTQEQKERMTEFAEKVGWRIQKQDEEEVERFCSEVGVKRQVLRVWMHN  316

Query  605  NKNTVGKIDNITTTP  561
            NKN+  K  +I TTP
Sbjct  317  NKNSAKKQSDILTTP  331



>gb|AAO62943.1| ZF-HD homeobox protein-like protein [Lactuca sativa]
 gb|AAO62944.1| ZF-HD homeobox protein-like protein, partial [Lactuca sativa]
Length=128

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 62/83 (75%), Gaps = 5/83 (6%)
 Frame = -1

Query  806  PSSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            P +I  S    GRKRFRTKF+ DQK KM  FAE++GWK+Q+ D++LI DFC EIG+ RG+
Sbjct  13   PMAIKTS----GRKRFRTKFSLDQKEKMTIFAEKLGWKMQRCDDKLIADFCNEIGIRRGI  68

Query  626  LKVWMHNNKNTVGKID-NITTTP  561
             KVWMHNNKN  GK + +ITTT 
Sbjct  69   FKVWMHNNKNNFGKREKDITTTA  91



>ref|XP_008220815.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X2 [Prunus 
mume]
 ref|XP_008220816.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X2 [Prunus 
mume]
Length=350

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P    +KRFRTKFTQ+QK +M +FAE++GW+IQK+DEE +  FC E+GV+R VL+VWMHN
Sbjct  251  PFAMSKKRFRTKFTQEQKERMTEFAEKVGWRIQKQDEEEVERFCSEVGVKRQVLRVWMHN  310

Query  605  NKNTVGKIDNITTTP  561
            NKN+  K  +I TTP
Sbjct  311  NKNSAKKQSDILTTP  325



>ref|XP_007154109.1| hypothetical protein PHAVU_003G091100g [Phaseolus vulgaris]
 gb|ESW26103.1| hypothetical protein PHAVU_003G091100g [Phaseolus vulgaris]
Length=271

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -1

Query  797  IHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKV  618
            + P P    +KRFRTKFTQ+QK KML+FAER+GWKIQK++E ++  FC+EIGV+R VLKV
Sbjct  193  VQPRPSQLVKKRFRTKFTQEQKEKMLNFAERVGWKIQKQEESVVQQFCQEIGVKRRVLKV  252

Query  617  WMHNNKNTVGKIDNITTT  564
            WMHNNK+ + K +  T  
Sbjct  253  WMHNNKHNLAKKNPPTAA  270



>gb|ABK22835.1| unknown [Picea sitchensis]
Length=249

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK +MLDFAE++GW+IQK DE+ +  FC++IGV+R VLKVWMHNNKNT+
Sbjct  185  KKRFRTKFTQEQKDRMLDFAEKVGWRIQKHDEQAVQQFCQDIGVKRRVLKVWMHNNKNTL  244

Query  590  GK  585
            GK
Sbjct  245  GK  246



>ref|XP_004491795.1| PREDICTED: transcription factor HB29-like [Cicer arietinum]
Length=328

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -1

Query  788  SPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMH  609
            SP    RKRFRTKF+Q+QK KML FAE++GWKIQKRD++LI++ C EIGV+R VLKVWMH
Sbjct  199  SPGSHTRKRFRTKFSQEQKDKMLKFAEKVGWKIQKRDDDLIHEVCNEIGVDRTVLKVWMH  258

Query  608  NNKNTVGKID  579
            NNKN   K D
Sbjct  259  NNKNNFTKRD  268



>emb|CAC34408.1| ZF-HD homeobox protein [Flaveria bidentis]
Length=241

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  779  MKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNK  600
            + GRKRFRTKF+QDQK KML FAE++GWK+Q+ D++++ DFC EIG+ R VLKVWMHNNK
Sbjct  137  ISGRKRFRTKFSQDQKEKMLTFAEKVGWKLQRCDDKMVADFCSEIGIRRRVLKVWMHNNK  196

Query  599  NTVGK  585
            NT+ K
Sbjct  197  NTLAK  201



>ref|XP_001777987.1| predicted protein [Physcomitrella patens]
 gb|EDQ57200.1| predicted protein [Physcomitrella patens]
Length=165

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P+P M GRKRFRTKFT +QK KM  FAE++GWKIQK DE  + +FC E+GV+R VLKVWM
Sbjct  95   PAPIM-GRKRFRTKFTNEQKEKMGVFAEKLGWKIQKHDEAAVQEFCAEVGVKRHVLKVWM  153

Query  611  HNNKNTVGK  585
            HNNKNT+GK
Sbjct  154  HNNKNTIGK  162



>emb|CDX85230.1| BnaC07g25410D [Brassica napus]
Length=339

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            RKRFRTKF+Q QK KM +FA+RIGWKIQKRDE+ + DFCRE+GV++GVLKVWMHNNKNT
Sbjct  202  RKRFRTKFSQTQKDKMHEFADRIGWKIQKRDEDEVRDFCREVGVDKGVLKVWMHNNKNT  260



>ref|XP_010940074.1| PREDICTED: zinc-finger homeodomain protein 6-like [Elaeis guineensis]
Length=302

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P+M  +KRFRTKFT +QK +MLDFAER+GW+IQK+DE L+++FC E+GV R VLKVW+HN
Sbjct  225  PYMVSKKRFRTKFTTEQKERMLDFAERLGWRIQKQDEALVDEFCAEVGVSRQVLKVWIHN  284

Query  605  NKNTVGK  585
            NK++V K
Sbjct  285  NKHSVRK  291



>ref|XP_006373320.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
 gb|ERP51117.1| hypothetical protein POPTR_0017s11920g [Populus trichocarpa]
Length=286

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q QK +M  FAER+GWK+QKRDE+L+ +FC E+GV+RGVLKVWMHNNKN++
Sbjct  209  RKRFRTKFSQSQKERMYQFAERVGWKMQKRDEDLVQEFCNEVGVDRGVLKVWMHNNKNSL  268



>gb|EPS70696.1| hypothetical protein M569_04063, partial [Genlisea aurea]
Length=242

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFTQ QK KML+ AE++GWK+QKRDE+LI  FC +IGV++ V +VWMHNNKNT 
Sbjct  179  RKRFRTKFTQFQKDKMLELAEKVGWKMQKRDEDLIAQFCCDIGVDKAVFRVWMHNNKNTF  238

Query  590  GKID  579
            GK D
Sbjct  239  GKKD  242



>ref|XP_006482594.1| PREDICTED: myb-like protein I-like [Citrus sinensis]
 gb|KDO72568.1| hypothetical protein CISIN_1g016972mg [Citrus sinensis]
Length=379

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q QK KM +FAER+GWK+QKRD++L+++FC E+GV+R VLKVWMHNNK+T 
Sbjct  233  RKRFRTKFSQSQKEKMFEFAERVGWKMQKRDDDLVHEFCNEVGVDRTVLKVWMHNNKSTF  292

Query  590  GKID  579
             K D
Sbjct  293  AKRD  296



>gb|AAP44426.1| ZF-HD homeobox protein-like protein, partial [Lactuca saligna]
 gb|AAP44427.1| ZF-HD homeobox protein-like protein, partial [Lactuca saligna]
 gb|AAP44428.1| ZF-HD homeobox protein-like protein, partial [Lactuca saligna]
Length=132

 Score =   101 bits (252),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 56/74 (76%), Gaps = 4/74 (5%)
 Frame = -1

Query  806  PSSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            P +I  S    GRKRFRTKF+ DQK KM  FAER+GWK+Q+ D++LI DFC EIG+ RG+
Sbjct  19   PMAIKTS----GRKRFRTKFSLDQKEKMTIFAERLGWKMQRCDDKLIADFCNEIGIRRGI  74

Query  626  LKVWMHNNKNTVGK  585
             KVWMHNNKN  GK
Sbjct  75   FKVWMHNNKNNFGK  88



>ref|XP_011649626.1| PREDICTED: zinc-finger homeodomain protein 5 [Cucumis sativus]
 gb|KGN62606.1| hypothetical protein Csa_2G361700 [Cucumis sativus]
Length=320

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            PS     +KRFRTKFTQ+QK +ML+FAE++GW+IQK+DEE +  FC E+GV+R VLKVWM
Sbjct  230  PSSFSLSKKRFRTKFTQEQKDRMLEFAEKVGWRIQKQDEEEVERFCTEVGVKRQVLKVWM  289

Query  611  HNNKNTVGK  585
            HNNKNTV K
Sbjct  290  HNNKNTVKK  298



>ref|XP_008388052.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
 ref|XP_008388053.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
 ref|XP_008388054.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
Length=350

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 64/92 (70%), Gaps = 7/92 (8%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P    +KRFRTKFT +QK +M++FAER+GW+IQK+DEE +  FC E+GV+R VL+VWMHN
Sbjct  251  PFALSKKRFRTKFTVEQKERMMEFAERVGWRIQKQDEEEVERFCAEVGVKRQVLRVWMHN  310

Query  605  NKNTVGKIDNITTTPaaaaaADNGNAHSLGFD  510
            NKNT+ K  ++T T        N  A  L FD
Sbjct  311  NKNTIKKQGDVTAT-------TNAIATGLSFD  335



>emb|CDX86403.1| BnaA06g31200D [Brassica napus]
Length=344

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            RKRFRTKF+Q QK KM +FA+RIGWKIQKRDE+ + DFCR++GV++GVLKVWMHNNKNT
Sbjct  205  RKRFRTKFSQTQKDKMHEFADRIGWKIQKRDEDEVRDFCRDVGVDKGVLKVWMHNNKNT  263



>ref|XP_008444722.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
Length=314

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            PS     +KRFRTKFTQ+QK +ML+FAE++GW+IQK+DEE +  FC E+GV+R VLKVWM
Sbjct  223  PSSFSLSKKRFRTKFTQEQKDRMLEFAEKVGWRIQKQDEEEVERFCTEVGVKRQVLKVWM  282

Query  611  HNNKNTVGK  585
            HNNKNTV K
Sbjct  283  HNNKNTVKK  291



>gb|KJB18247.1| hypothetical protein B456_003G042700 [Gossypium raimondii]
Length=270

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFTQ+QK KML  AER+GW+IQK DEE++  FC E GV+R VLKVWMHNNK+T+
Sbjct  207  RKRFRTKFTQEQKEKMLSLAERLGWRIQKHDEEIVQQFCNETGVKRHVLKVWMHNNKHTL  266

Query  590  GK  585
            GK
Sbjct  267  GK  268



>ref|XP_006431147.1| hypothetical protein CICLE_v10011968mg [Citrus clementina]
 gb|ESR44387.1| hypothetical protein CICLE_v10011968mg [Citrus clementina]
Length=379

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q QK KM +FAER+GWK+QKRD++L++ FC E+GV+R VLKVWMHNNK+T 
Sbjct  232  RKRFRTKFSQSQKEKMFEFAERVGWKMQKRDDDLVHQFCNEVGVDRTVLKVWMHNNKSTF  291

Query  590  GKID  579
             K D
Sbjct  292  AKRD  295



>ref|XP_007157626.1| hypothetical protein PHAVU_002G085400g [Phaseolus vulgaris]
 gb|ESW29620.1| hypothetical protein PHAVU_002G085400g [Phaseolus vulgaris]
Length=264

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -1

Query  803  SSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVL  624
            +S H S    G+KRFRTKF+Q+QK KM +F+E++GW++QK DE L+ DFC EIGV RGV 
Sbjct  162  TSFHLSESPSGKKRFRTKFSQEQKEKMQNFSEKLGWRMQKGDEGLVQDFCNEIGVSRGVF  221

Query  623  KVWMHNNKNTVGK  585
            KVWMHNNKNT  K
Sbjct  222  KVWMHNNKNTCRK  234



>ref|NP_189534.1| homeobox protein 34 [Arabidopsis thaliana]
 sp|Q9LHF0.1|ZHD9_ARATH RecName: Full=Zinc-finger homeodomain protein 9; Short=AtZHD9; 
AltName: Full=Homeobox protein 34; Short=AtHB-34 [Arabidopsis 
thaliana]
 dbj|BAB02255.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13170.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91220.1| unknown protein [Arabidopsis thaliana]
 gb|AEE77508.1| homeobox protein 34 [Arabidopsis thaliana]
Length=312

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -1

Query  794  HPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVW  615
            H S     RKRFRTKF+ +QK KM +FA+RIGWKIQKRDE+ + DFCREIGV++GVLKVW
Sbjct  184  HLSATPGSRKRFRTKFSSNQKEKMHEFADRIGWKIQKRDEDEVRDFCREIGVDKGVLKVW  243

Query  614  MHNNKNT  594
            MHNNKN+
Sbjct  244  MHNNKNS  250



>ref|XP_004293203.2| PREDICTED: zinc-finger homeodomain protein 6 [Fragaria vesca 
subsp. vesca]
Length=349

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 68/92 (74%), Gaps = 5/92 (5%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P+   +KRFRTKFT +QK +M++FAE++GW+IQK+DEE +  FC E+GV+R VL+VWMHN
Sbjct  245  PYSLSKKRFRTKFTAEQKVRMVEFAEKVGWRIQKQDEEDVERFCDEVGVKRQVLRVWMHN  304

Query  605  NKNTVGKID-----NITTTPaaaaaADNGNAH  525
            NKNTV K+      +ITTT +  A  +N  AH
Sbjct  305  NKNTVKKMQHDHDHDITTTTSQLALENNVEAH  336



>ref|XP_002460367.1| hypothetical protein SORBIDRAFT_02g027040 [Sorghum bicolor]
 gb|EER96888.1| hypothetical protein SORBIDRAFT_02g027040 [Sorghum bicolor]
Length=302

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  239  KKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTL  298

Query  590  GK  585
            GK
Sbjct  299  GK  300



>ref|XP_011070997.1| PREDICTED: zinc-finger homeodomain protein 10 [Sesamum indicum]
Length=295

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKRFRTKF+Q+QK KM  F+E++GWK+QK DE  + +FC+EIGV +GVLKVWMHNNKNT
Sbjct  179  GRKRFRTKFSQEQKEKMHSFSEKLGWKMQKSDEVAVREFCQEIGVPKGVLKVWMHNNKNT  238

Query  593  VGKID  579
             GK D
Sbjct  239  FGKKD  243



>ref|XP_003576623.1| PREDICTED: zinc-finger homeodomain protein 1 [Brachypodium distachyon]
Length=290

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK +ML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  225  KKRFRTKFTQEQKDRMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTL  284

Query  590  GKIDNI  573
            GK  +I
Sbjct  285  GKKPSI  290



>ref|XP_006859182.1| PREDICTED: zinc-finger homeodomain protein 2 [Amborella trichopoda]
 gb|ERN20649.1| hypothetical protein AMTR_s00070p00154800 [Amborella trichopoda]
Length=218

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            G KR+RTKFTQDQK KM  FA+++GW+IQK+D+  +  FC E+GV+R VLKVWMHNNKNT
Sbjct  148  GTKRYRTKFTQDQKEKMQAFADKLGWRIQKQDDVALQQFCMEVGVKRHVLKVWMHNNKNT  207

Query  593  VGKIDNITTT  564
            +GK D++T +
Sbjct  208  LGKKDSLTAS  217



>sp|A2Z259.1|ZHD1_ORYSI RecName: Full=Zinc-finger homeodomain protein 1 [Oryza sativa 
Indica Group]
 gb|EAZ09420.1| hypothetical protein OsI_31693 [Oryza sativa Indica Group]
Length=279

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  215  KKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTL  274

Query  590  GK  585
            GK
Sbjct  275  GK  276



>ref|XP_002877141.1| hypothetical protein ARALYDRAFT_484662 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53400.1| hypothetical protein ARALYDRAFT_484662 [Arabidopsis lyrata subsp. 
lyrata]
Length=299

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            RKRFRTKF+ +QK KM +FA RIGWKIQKRDE+ + DFCREIGV++GVLKVWMHNNKN+
Sbjct  184  RKRFRTKFSSNQKEKMHEFAARIGWKIQKRDEDEVRDFCREIGVDKGVLKVWMHNNKNS  242



>ref|NP_001063419.1| Os09g0466400 [Oryza sativa Japonica Group]
 sp|Q6YXH5.1|ZHD1_ORYSJ RecName: Full=Zinc-finger homeodomain protein 1; Short=OsZHD1 
[Oryza sativa Japonica Group]
 dbj|BAD17515.1| putative ZF-HD homeobox protein [Oryza sativa Japonica Group]
 dbj|BAF25333.1| Os09g0466400 [Oryza sativa Japonica Group]
 dbj|BAG98341.1| unnamed protein product [Oryza sativa Japonica Group]
Length=279

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  215  KKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTL  274

Query  590  GK  585
            GK
Sbjct  275  GK  276



>emb|CAC34410.1| ZF-HD homeobox protein [Flaveria bidentis]
Length=259

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            G+KRFRTKFTQDQK KM + AER+GWK+QK+DE+LI +FC EIGV++GV KVWMHNNK T
Sbjct  129  GKKRFRTKFTQDQKQKMHELAERVGWKMQKKDEDLIINFCNEIGVDKGVFKVWMHNNKMT  188

Query  593  -VGKIDN  576
              GK D+
Sbjct  189  SAGKKDS  195



>ref|XP_006660219.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Oryza brachyantha]
Length=290

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P   G+KRFRTKFTQ+QK KML FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHN
Sbjct  222  PSGSGKKRFRTKFTQEQKDKMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHN  281

Query  605  NKNTVGK  585
            NK+T+GK
Sbjct  282  NKHTLGK  288



>emb|CDY20008.1| BnaA09g02430D [Brassica napus]
Length=281

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            RKRFRTKF+Q QK KM +FA+RIGWK QKRDE+ + DFCRE+GV++GVLKVWMHNNKNT
Sbjct  157  RKRFRTKFSQAQKEKMHEFADRIGWKFQKRDEDDVRDFCREVGVDKGVLKVWMHNNKNT  215



>ref|XP_006660717.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Oryza brachyantha]
Length=285

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  221  KKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTL  280

Query  590  GK  585
            GK
Sbjct  281  GK  282



>ref|XP_010554331.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554332.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554333.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554334.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554335.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554336.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
Length=322

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P+   +KRFRTKFTQ+QK KM++FAER+GWKIQ+++E ++  FC+EIGV+R VLKVWMHN
Sbjct  227  PYSHQKKRFRTKFTQEQKEKMMNFAERVGWKIQRQEESVVQQFCQEIGVKRRVLKVWMHN  286

Query  605  NKNTVGKIDNIT  570
            NK+ + K  N T
Sbjct  287  NKHNLAKKKNST  298



>ref|XP_006395326.1| hypothetical protein EUTSA_v10004599mg [Eutrema salsugineum]
 gb|ESQ32612.1| hypothetical protein EUTSA_v10004599mg [Eutrema salsugineum]
Length=323

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            RKRFRTKF+  QK KM +FA+RIGWKIQKRDEE + DFCREIGV++GVLKVWMHNNKNT
Sbjct  192  RKRFRTKFSPIQKEKMHEFADRIGWKIQKRDEEEVRDFCREIGVDKGVLKVWMHNNKNT  250



>ref|XP_002305381.2| hypothetical protein POPTR_0004s12500g [Populus trichocarpa]
 gb|EEE85892.2| hypothetical protein POPTR_0004s12500g [Populus trichocarpa]
Length=334

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q QK +M  FAE++GWK+QKRDE+L+ +FC E+GV+R  LKVWMHNNKN+ 
Sbjct  213  RKRFRTKFSQSQKERMHQFAEKVGWKMQKRDEDLVQEFCNEVGVDRSALKVWMHNNKNSF  272

Query  590  GKIDNI  573
            GK +++
Sbjct  273  GKKEHL  278



>emb|CBI27705.3| unnamed protein product [Vitis vinifera]
Length=127

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML FAER GW+IQK++E L+  FC+EIG++R VLKVWMHNNKN  
Sbjct  61   KKRFRTKFTQEQKEKMLSFAERAGWRIQKQEESLVQQFCQEIGIKRRVLKVWMHNNKNLA  120

Query  590  GK  585
             K
Sbjct  121  RK  122



>gb|EMT05330.1| ZF-HD homeobox protein [Aegilops tauschii]
Length=84

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  18   KKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVLQFCDEVGVKRHVLKVWMHNNKHTL  77

Query  590  GK  585
            GK
Sbjct  78   GK  79



>ref|XP_009111615.1| PREDICTED: zinc-finger homeodomain protein 9-like [Brassica rapa]
Length=309

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            RKRFRTKF+Q QK KM +FA+RIGWK QKRDE+ + DFCRE+GV++GVLKVWMHNNKNT
Sbjct  185  RKRFRTKFSQAQKEKMHEFADRIGWKFQKRDEDDVRDFCREVGVDKGVLKVWMHNNKNT  243



>ref|XP_009151829.1| PREDICTED: zinc-finger homeodomain protein 9 [Brassica rapa]
Length=344

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            RKRFRTKF+Q QK KM +FA+RIGWKIQKRDE  + DFCR++GV++GVLKVWMHNNKNT
Sbjct  205  RKRFRTKFSQTQKDKMHEFADRIGWKIQKRDEGEVRDFCRDVGVDKGVLKVWMHNNKNT  263



>ref|XP_010681042.1| PREDICTED: zinc-finger homeodomain protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=284

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            G+KRFRTKFTQ+QK KMLD AE++GWKIQK+DE +++ FC E GV+R VLKVWMHNNK T
Sbjct  220  GKKRFRTKFTQEQKDKMLDLAEKLGWKIQKQDELVVHQFCHETGVKRHVLKVWMHNNKLT  279

Query  593  VGK  585
            +GK
Sbjct  280  LGK  282



>ref|XP_009395689.1| PREDICTED: zinc-finger homeodomain protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=359

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P+P    RKRFRTKFT +QK KML FAER GW+IQ++D  ++  FC EIGV R VLKVWM
Sbjct  265  PTPATMPRKRFRTKFTAEQKDKMLAFAERAGWRIQRQDSAMVEQFCAEIGVRRQVLKVWM  324

Query  611  HNNKNTV  591
            HNNK+TV
Sbjct  325  HNNKHTV  331



>ref|XP_002273802.1| PREDICTED: zinc-finger homeodomain protein 11 [Vitis vinifera]
Length=326

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKRFRTKF+Q+QK KM  F+E++GWK+QK DE L+ +FC E+GV +GVLKVWMHNNK+T
Sbjct  201  GRKRFRTKFSQEQKEKMFSFSEKLGWKMQKSDEGLVEEFCNEVGVGKGVLKVWMHNNKHT  260

Query  593  VGKID  579
             GK D
Sbjct  261  FGKRD  265



>gb|ERM94746.1| hypothetical protein AMTR_s00011p00255340 [Amborella trichopoda]
Length=242

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -1

Query  767  KRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVG  588
            KRFRTKFTQ+QK +ML FAER+GW+IQK+DE  +  FC E+GV+R VLKVWMHNNKNT+G
Sbjct  178  KRFRTKFTQEQKERMLGFAERVGWRIQKQDEGAVQRFCDEVGVKRHVLKVWMHNNKNTLG  237

Query  587  K  585
            K
Sbjct  238  K  238



>ref|XP_004957068.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Setaria italica]
Length=281

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK +ML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  218  KKRFRTKFTQEQKDRMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTL  277

Query  590  GK  585
            GK
Sbjct  278  GK  279



>gb|EEE69868.1| hypothetical protein OsJ_29679 [Oryza sativa Japonica Group]
Length=247

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML FAER+GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  183  KKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTL  242

Query  590  GK  585
            GK
Sbjct  243  GK  244



>emb|CDY00104.1| BnaC09g01970D [Brassica napus]
Length=312

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            RKRFRTKF+Q QK KM +FA+RIGWK QKRDE+ + DFCRE+GV++GVLKVWMHNNKNT
Sbjct  188  RKRFRTKFSQAQKEKMHEFADRIGWKFQKRDEDDVRDFCREVGVDKGVLKVWMHNNKNT  246



>ref|XP_010682105.1| PREDICTED: zinc-finger homeodomain protein 3-like [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 61/74 (82%), Gaps = 4/74 (5%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKF+Q+QK KM++FAE++GWKIQK++EE++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  268  KKRFRTKFSQEQKEKMMEFAEKVGWKIQKQEEEVVQQFCQEIGVKRRVLKVWMHNNKHNL  327

Query  590  GK----IDNITTTP  561
            GK    IDN    P
Sbjct  328  GKKSDIIDNNINNP  341



>ref|XP_004230410.1| PREDICTED: zinc-finger homeodomain protein 4 [Solanum lycopersicum]
Length=290

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML+FAE++GWKIQK++E ++  FC+E+GV+R VLKVWMHNNK+++
Sbjct  215  KKRFRTKFTQEQKDKMLNFAEKVGWKIQKQEEGVVQQFCQEVGVKRRVLKVWMHNNKHSL  274

Query  590  GKIDNITT  567
             K  NITT
Sbjct  275  AK-KNITT  281



>ref|XP_002267747.1| PREDICTED: zinc-finger homeodomain protein 3 [Vitis vinifera]
Length=250

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            PS   + +KRFRTKFTQ+QK KML FAER GW+IQK++E L+  FC+EIG++R VLKVWM
Sbjct  177  PSSDQQVKKRFRTKFTQEQKEKMLSFAERAGWRIQKQEESLVQQFCQEIGIKRRVLKVWM  236

Query  611  HNNKNTVGK  585
            HNNKN   K
Sbjct  237  HNNKNLARK  245



>ref|XP_007023152.1| Homeobox protein 31 [Theobroma cacao]
 gb|EOY25774.1| Homeobox protein 31 [Theobroma cacao]
Length=292

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            PH   +KRFRTKFTQ+QK KML+FA+++GWKIQK++E ++  FC+EIGV+R VLKVWMHN
Sbjct  210  PHQLVKKRFRTKFTQEQKEKMLNFADKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHN  269

Query  605  NKNTVGK  585
            NK+ + K
Sbjct  270  NKHNLAK  276



>ref|XP_012081639.1| PREDICTED: zinc-finger homeodomain protein 2-like [Jatropha curcas]
 gb|KDP29745.1| hypothetical protein JCGZ_18680 [Jatropha curcas]
Length=246

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFTQDQK +ML  AER+GW+IQK DE ++  FC E GV+R VLKVWMHNNK+T+
Sbjct  183  RKRFRTKFTQDQKERMLSLAERLGWRIQKHDEAVVQQFCNETGVKRHVLKVWMHNNKHTL  242

Query  590  GK  585
            GK
Sbjct  243  GK  244



>ref|XP_011623848.1| PREDICTED: zinc-finger homeodomain protein 2 [Amborella trichopoda]
Length=256

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -1

Query  767  KRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTVG  588
            KRFRTKFTQ+QK +ML FAER+GW+IQK+DE  +  FC E+GV+R VLKVWMHNNKNT+G
Sbjct  192  KRFRTKFTQEQKERMLGFAERVGWRIQKQDEGAVQRFCDEVGVKRHVLKVWMHNNKNTLG  251

Query  587  K  585
            K
Sbjct  252  K  252



>emb|CAN60614.1| hypothetical protein VITISV_003253 [Vitis vinifera]
Length=155

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P    +KRFRTKF+Q+QK KML FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHN
Sbjct  80   PPQLVKKRFRTKFSQEQKEKMLSFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHN  139

Query  605  NKNTVGK  585
            NK+ + K
Sbjct  140  NKHNLAK  146



>ref|XP_010102085.1| hypothetical protein L484_009028 [Morus notabilis]
 gb|EXB91935.1| hypothetical protein L484_009028 [Morus notabilis]
Length=361

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -1

Query  797  IHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKV  618
            + P P    +KRFRTKFTQ+QK +ML+FAE++GW+IQK+DE  +  FC E+GV+R VLKV
Sbjct  249  VPPPPFALSKKRFRTKFTQEQKERMLEFAEKVGWRIQKQDEVEVERFCAEVGVKRQVLKV  308

Query  617  WMHNNKNTVGK  585
            WMHNNK+ V K
Sbjct  309  WMHNNKSAVKK  319



>ref|XP_006470838.1| PREDICTED: ZF-HD homeobox protein At5g65410-like [Citrus sinensis]
Length=314

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KM +FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  241  KKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  300

Query  590  GKIDNI  573
             K +NI
Sbjct  301  AKKNNI  306



>ref|XP_009407034.1| PREDICTED: zinc-finger homeodomain protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=296

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P+P    RKRFRTKFT +QK KML FAER+GW+IQK+DE L+  FC E GV R VLKVWM
Sbjct  199  PTPATTPRKRFRTKFTMEQKEKMLAFAERMGWRIQKQDEGLVEQFCAETGVRRQVLKVWM  258

Query  611  HNNKNTVGK  585
            HNNK+ + K
Sbjct  259  HNNKHLIRK  267



>gb|KDO42061.1| hypothetical protein CISIN_1g048741mg [Citrus sinensis]
Length=314

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KM +FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  241  KKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  300

Query  590  GKIDNI  573
             K +NI
Sbjct  301  AKKNNI  306



>ref|XP_008810728.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=344

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P P +  +KRFRTKFT +QK KML FAER+GW+I K+DE L+  FC E+GV R VLKVWM
Sbjct  251  PPPVVVSKKRFRTKFTAEQKEKMLAFAERVGWRIHKQDEALVEQFCAEVGVRRQVLKVWM  310

Query  611  HNNKNTV  591
            HNNK+T+
Sbjct  311  HNNKHTI  317



>ref|XP_006431432.1| hypothetical protein CICLE_v10003702mg [Citrus clementina]
 gb|ESR44672.1| hypothetical protein CICLE_v10003702mg [Citrus clementina]
Length=314

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KM +FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  241  KKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  300

Query  590  GKIDNI  573
             K +NI
Sbjct  301  AKKNNI  306



>ref|XP_009396485.1| PREDICTED: zinc-finger homeodomain protein 6-like [Musa acuminata 
subsp. malaccensis]
Length=380

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFT +QK KML FAERIGW IQ++D E+I  FC EIGV R VLKVWMHNNK+T+
Sbjct  282  RKRFRTKFTAEQKNKMLAFAERIGWTIQRQDSEMIEQFCAEIGVRRQVLKVWMHNNKHTI  341



>ref|XP_012071869.1| PREDICTED: zinc-finger homeodomain protein 5 [Jatropha curcas]
 gb|KDP38514.1| hypothetical protein JCGZ_04439 [Jatropha curcas]
Length=302

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P P++  RKRFRTKFTQ+QK +M++FAE++GW+I K+DEE +  FC E+GV+R V KVWM
Sbjct  217  PPPYVLSRKRFRTKFTQEQKDRMMEFAEKVGWRINKQDEEEVEKFCAEVGVKRQVFKVWM  276

Query  611  HNNKN  597
            HNNKN
Sbjct  277  HNNKN  281



>emb|CDO97666.1| unnamed protein product [Coffea canephora]
Length=299

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            PH   +KRFRTKFT +QK KML+FAE++GWKIQK++E ++  FC+E+GV+R VLKVWMHN
Sbjct  217  PHQLVKKRFRTKFTPEQKEKMLNFAEKVGWKIQKQEEAVVQQFCQEVGVKRRVLKVWMHN  276

Query  605  NKNTVGK  585
            NK+ + K
Sbjct  277  NKHNLAK  283



>ref|XP_010527865.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
Length=316

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P+   +KRFRTKFTQ+QK KML+FAER+GWKIQ+++E ++  FC+E+GV+R VLKVWMHN
Sbjct  217  PYNNQKKRFRTKFTQEQKEKMLNFAERVGWKIQRQEESVVQQFCQEVGVKRRVLKVWMHN  276

Query  605  NKNTVGK  585
            NK+ + K
Sbjct  277  NKHNLAK  283



>ref|XP_009336904.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=351

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 7/92 (8%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P    +KRFRTKFT +QK +M++FAER+ W+IQK+DEE +  FC E+GV+R VL+VWMHN
Sbjct  252  PFALSKKRFRTKFTVEQKERMMEFAERVEWRIQKQDEEEVERFCAEVGVKRQVLRVWMHN  311

Query  605  NKNTVGKIDNITTTPaaaaaADNGNAHSLGFD  510
            NKNT+ K  ++T T        N  A  L FD
Sbjct  312  NKNTIKKQGDVTAT-------TNAIATGLSFD  336



>ref|XP_004238801.1| PREDICTED: zinc-finger homeodomain protein 10-like [Solanum lycopersicum]
Length=297

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKRFRTKFT +QK KM  F+E++GWK+QK DE  +++FC EIGV +GVL+VWMHNNKNT
Sbjct  171  GRKRFRTKFTAEQKEKMHSFSEKLGWKLQKCDEAAVDEFCNEIGVGKGVLRVWMHNNKNT  230

Query  593  VGKID  579
             GK D
Sbjct  231  FGKKD  235



>ref|XP_007048627.1| Homeobox protein 21, putative [Theobroma cacao]
 gb|EOX92784.1| Homeobox protein 21, putative [Theobroma cacao]
Length=253

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -1

Query  776  KGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKN  597
            K RKRFRTKFTQ+QK KML+FAE+ GW+IQK DE ++  FC+EIG++R VLKVWMHNNK 
Sbjct  184  KMRKRFRTKFTQEQKEKMLNFAEKAGWRIQKLDESVVQQFCQEIGIKRRVLKVWMHNNKQ  243

Query  596  TVGKIDN  576
            ++ K D+
Sbjct  244  SLAKKDS  250



>ref|XP_010425683.1| PREDICTED: zinc-finger homeodomain protein 9-like [Camelina sativa]
Length=323

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            RKRFRTKF+  QK KM +FA+RIGWKIQKRDE+ + +FCREIGV++GVLKVWMHNNKNT
Sbjct  196  RKRFRTKFSSGQKEKMHEFADRIGWKIQKRDEDDVREFCREIGVDKGVLKVWMHNNKNT  254



>ref|XP_003551238.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=250

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ QK KML FAE++GW+IQK DE ++ +FC E GV+R VLKVWMHNNK+T+
Sbjct  187  KKRFRTKFTQQQKDKMLAFAEKLGWRIQKHDEGVVQEFCSETGVQRHVLKVWMHNNKHTL  246

Query  590  GK  585
            GK
Sbjct  247  GK  248



>gb|KHN01227.1| ZF-HD homeobox protein [Glycine soja]
Length=116

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = -1

Query  803  SSIHPSPHMKG-RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            SS H +P   G +KR RTKF+ +QK KM +FAE++GW++QK DE L+ DFC+EIGV RGV
Sbjct  7    SSSHWNPENSGGKKRHRTKFSHEQKEKMHNFAEKLGWRMQKGDEGLVQDFCKEIGVSRGV  66

Query  626  LKVWMHNNKNTVGK  585
             KVWMHNNKNT G+
Sbjct  67   FKVWMHNNKNTSGR  80



>dbj|BAE99230.1| hypothetical protein [Arabidopsis thaliana]
Length=334

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q QK KM +FAER+GWK+QKRDE+ + DFCR+IGV++ VLKVWMHNNKNT 
Sbjct  200  RKRFRTKFSQFQKEKMHEFAERVGWKMQKRDEDDVRDFCRQIGVDKSVLKVWMHNNKNTF  259

Query  590  GKID  579
             + D
Sbjct  260  NRRD  263



>emb|CAC34409.1| ZF-HD homeobox protein [Flaveria bidentis]
Length=339

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            G+KRFRTKFTQDQK KM + AER+GWK+QK+DE+LI  FC EIGV++GV KVWMHNNK T
Sbjct  219  GKKRFRTKFTQDQKEKMHELAERVGWKMQKKDEDLIIGFCNEIGVDKGVFKVWMHNNKMT  278

Query  593  VG  588
             G
Sbjct  279  FG  280



>ref|NP_568570.1| homeobox protein 23 [Arabidopsis thaliana]
 sp|Q9FIW9.1|ZHD10_ARATH RecName: Full=Zinc-finger homeodomain protein 10; Short=AtZHD10; 
AltName: Full=Homeobox protein 23; Short=AtHB-23 [Arabidopsis 
thaliana]
 dbj|BAB11382.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13855.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51422.1| unknown protein [Arabidopsis thaliana]
 gb|AED94472.1| homeobox protein 23 [Arabidopsis thaliana]
Length=334

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q QK KM +FAER+GWK+QKRDE+ + DFCR+IGV++ VLKVWMHNNKNT 
Sbjct  200  RKRFRTKFSQFQKEKMHEFAERVGWKMQKRDEDDVRDFCRQIGVDKSVLKVWMHNNKNTF  259

Query  590  GKID  579
             + D
Sbjct  260  NRRD  263



>ref|XP_009613099.1| PREDICTED: zinc-finger homeodomain protein 4 [Nicotiana tomentosiformis]
Length=304

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KM +FAE++GWKIQK++E ++  FC+E+G++R VLKVWMHNNK+++
Sbjct  231  KKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEETVVQQFCQELGIKRRVLKVWMHNNKHSL  290

Query  590  GKIDNITTTP  561
             K ++ +T P
Sbjct  291  AKKNSNSTIP  300



>ref|XP_003550152.1| PREDICTED: ZF-HD homeobox protein At5g65410-like [Glycine max]
Length=286

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            PS     +KRFRTKF+QDQK KML+FAE++GWKIQK++E ++  FC+EIGV+R VLKVWM
Sbjct  200  PSSAQLVKKRFRTKFSQDQKDKMLNFAEKVGWKIQKQEESVVQHFCQEIGVKRRVLKVWM  259

Query  611  HNNKNTVGK  585
            HNNK+ + K
Sbjct  260  HNNKHNLAK  268



>ref|XP_009364948.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=349

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 7/92 (8%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P    +KRFRTKFT +QK +M++FAER+ W+IQK+DEE +  FC E+GV+R VL+VWMHN
Sbjct  250  PFALSKKRFRTKFTVEQKERMMEFAERVEWRIQKQDEEEVERFCAEVGVKRQVLRVWMHN  309

Query  605  NKNTVGKIDNITTTPaaaaaADNGNAHSLGFD  510
            NKNT+ K  ++T T        N  A  L FD
Sbjct  310  NKNTIKKQGDVTAT-------TNAIATGLSFD  334



>ref|XP_010254805.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
 ref|XP_010254806.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
 ref|XP_010254807.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
Length=363

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P P    +KRFRTKFTQ+QK +ML+FAE+IGWKIQK+DE  +  FC E+GV+R VLKVWM
Sbjct  292  PQPLSLSKKRFRTKFTQEQKDRMLEFAEKIGWKIQKQDEPEVQQFCAEVGVKRQVLKVWM  351

Query  611  HNNKNTVGK  585
            HNNK+++ K
Sbjct  352  HNNKHSMKK  360



>ref|XP_010514609.1| PREDICTED: zinc-finger homeodomain protein 9-like [Camelina sativa]
Length=323

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            RKRFRTKF+  QK KM +FA+RIGWKIQKRDE+ + +FCREIGV++GVLKVWMHNNKNT
Sbjct  199  RKRFRTKFSSSQKEKMHEFADRIGWKIQKRDEDDVREFCREIGVDKGVLKVWMHNNKNT  257



>gb|EPS61775.1| hypothetical protein M569_13018, partial [Genlisea aurea]
Length=276

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML FAE++GWKIQK++E ++  FC+E+GV+R VLKVWMHNNK+T+
Sbjct  213  KKRFRTKFTQEQKEKMLIFAEKVGWKIQKQEESVVQQFCQEVGVKRRVLKVWMHNNKHTL  272

Query  590  GK  585
             K
Sbjct  273  AK  274



>ref|XP_010099792.1| hypothetical protein L484_010980 [Morus notabilis]
 gb|EXB80410.1| hypothetical protein L484_010980 [Morus notabilis]
Length=336

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -1

Query  797  IHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKV  618
            + P+P    +KR RTKFTQ+QK KML+FAE++GWKIQK++E ++  FC+EIGV+R VLKV
Sbjct  257  LRPTPQGVMKKRIRTKFTQEQKEKMLNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKV  316

Query  617  WMHNNKNTVGK  585
            WMHNNK+ + K
Sbjct  317  WMHNNKHNLAK  327



>gb|KHN03576.1| ZF-HD homeobox protein [Glycine soja]
Length=277

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            PS     +KRFRTKF+QDQK KML+FAE++GWKIQK++E ++  FC+EIGV+R VLKVWM
Sbjct  191  PSSAQLVKKRFRTKFSQDQKDKMLNFAEKVGWKIQKQEESVVQHFCQEIGVKRRVLKVWM  250

Query  611  HNNKNTVGK  585
            HNNK+ + K
Sbjct  251  HNNKHNLAK  259



>gb|EYU35040.1| hypothetical protein MIMGU_mgv1a014453mg [Erythranthe guttata]
Length=189

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P M  +KRFRTKF+Q+QK KML FAER+GW+IQK++E ++  FC EIGV+R VLKVWMHN
Sbjct  106  PEMMMKKRFRTKFSQEQKEKMLGFAERVGWRIQKQEESVVQSFCHEIGVKRRVLKVWMHN  165

Query  605  NKNT  594
            NK+T
Sbjct  166  NKHT  169



>ref|XP_007017558.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
 ref|XP_007017559.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
 gb|EOY14783.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
 gb|EOY14784.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
Length=296

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P P++  +KRFRTKFTQ+QK KML+FAE++GW+I K+DEE +  FC E+GV+R V KVWM
Sbjct  225  PPPYVLSKKRFRTKFTQEQKDKMLEFAEKLGWRINKQDEEEVEKFCAEVGVKRQVFKVWM  284

Query  611  HNNKNT  594
            HNNKN 
Sbjct  285  HNNKNV  290



>ref|XP_002870762.1| hypothetical protein ARALYDRAFT_494014 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47021.1| hypothetical protein ARALYDRAFT_494014 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q QK KM +FAER+GWK+QKRDE+ + DFCR+IGV++ VLKVWMHNNKNT 
Sbjct  195  RKRFRTKFSQFQKEKMHEFAERLGWKMQKRDEDDVRDFCRQIGVDKSVLKVWMHNNKNTF  254

Query  590  GKID  579
             + D
Sbjct  255  NRRD  258



>gb|AAM64462.1| unknown [Arabidopsis thaliana]
Length=333

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q QK KM +FAER+GWK+QKRD++ + DFCR+IGV++ VLKVWMHNNKNT 
Sbjct  199  RKRFRTKFSQFQKEKMHEFAERVGWKMQKRDZDDVRDFCRQIGVDKSVLKVWMHNNKNTF  258

Query  590  GKID  579
             + D
Sbjct  259  NRRD  262



>ref|XP_006405598.1| hypothetical protein EUTSA_v10028098mg [Eutrema salsugineum]
 dbj|BAJ34518.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47051.1| hypothetical protein EUTSA_v10028098mg [Eutrema salsugineum]
Length=320

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 74/113 (65%), Gaps = 14/113 (12%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q QK KM +FA+R+GWK+QKRDE+ + DFCR+IGV++ VLKVWMHNNKNT 
Sbjct  187  RKRFRTKFSQFQKEKMHEFADRVGWKMQKRDEDDVRDFCRQIGVDKSVLKVWMHNNKNTF  246

Query  590  GKID-NITTTPaaaaaADNGNAHSLGFDIGRVNSAPLTSDFNLRPESNNNGSH  435
             + D   +   AA A  DNG         G  N AP+ +      E+NNN  H
Sbjct  247  NRRDLPFSVAGAAVAKIDNGG--------GGGNHAPIPAG-----ETNNNEFH  286



>ref|XP_009405659.1| PREDICTED: zinc-finger homeodomain protein 6-like [Musa acuminata 
subsp. malaccensis]
Length=361

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P+P +  RKRFRTKFT +QK KML FAER+GW+IQK++E ++  FC E+GV R VLKVWM
Sbjct  268  PTPAIALRKRFRTKFTAEQKEKMLAFAERVGWRIQKQEEAVVEQFCAEVGVRRQVLKVWM  327

Query  611  HNNK  600
            HNNK
Sbjct  328  HNNK  331



>ref|NP_001062055.1| Os08g0479400 [Oryza sativa Japonica Group]
 sp|Q6ZB90.1|ZHD2_ORYSJ RecName: Full=Zinc-finger homeodomain protein 2; Short=OsZHD2 
[Oryza sativa Japonica Group]
 sp|A2YWA6.1|ZHD2_ORYSI RecName: Full=Zinc-finger homeodomain protein 2 [Oryza sativa 
Indica Group]
 dbj|BAD09750.1| putative ZF-HD homeobox protein [Oryza sativa Japonica Group]
 dbj|BAF23969.1| Os08g0479400 [Oryza sativa Japonica Group]
 gb|EAZ07367.1| hypothetical protein OsI_29618 [Oryza sativa Indica Group]
 dbj|BAG98791.1| unnamed protein product [Oryza sativa Japonica Group]
Length=290

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+
Sbjct  226  KKRFRTKFTQEQKDKMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTL  285

Query  590  GK  585
            GK
Sbjct  286  GK  287



>ref|XP_010502894.1| PREDICTED: zinc-finger homeodomain protein 9 [Camelina sativa]
Length=321

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            RKRFRTKF+  QK KM +FA+RIGWKIQKRDE+ + +FCREIGV++GVLKVWMHNNKNT
Sbjct  198  RKRFRTKFSSGQKEKMHEFADRIGWKIQKRDEDDVREFCREIGVDKGVLKVWMHNNKNT  256



>ref|XP_009788342.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
sylvestris]
Length=265

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKRFRTKFTQ+QK KM  F+E++GWK+QK DE  + +FC E+GV +GVL+VWMHNNKNT
Sbjct  158  GRKRFRTKFTQEQKEKMHSFSEKLGWKLQKCDEAKVEEFCNEVGVGKGVLRVWMHNNKNT  217

Query  593  VGKIDNITTT  564
              K D+   T
Sbjct  218  FAKKDDHNNT  227



>ref|XP_010527155.1| PREDICTED: zinc-finger homeodomain protein 1 [Tarenaya hassleriana]
Length=179

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKRFRTKFT +QK +ML  AERIGW+IQ++DEEL+  FC E GV R VLKVW+HNNK+T
Sbjct  98   GRKRFRTKFTAEQKERMLGLAERIGWRIQRQDEELVQRFCEETGVSRQVLKVWLHNNKHT  157

Query  593  VGK  585
            +GK
Sbjct  158  LGK  160



>ref|XP_009381483.1| PREDICTED: zinc-finger homeodomain protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=281

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFTQ+QK KML FAER+GW+IQK DE  +  FC E  ++R VLKVWMHNNKNT+
Sbjct  218  RKRFRTKFTQEQKDKMLAFAERLGWRIQKHDEAAVQQFCEETCIKRHVLKVWMHNNKNTL  277

Query  590  GK  585
            GK
Sbjct  278  GK  279



>gb|KHN07994.1| ZF-HD homeobox protein [Glycine soja]
Length=214

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ QK KML FAE++GW++QK D+ ++ +FC EIGV+R VLKVWMHNNK+T+
Sbjct  151  KKRFRTKFTQHQKDKMLVFAEKLGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTL  210

Query  590  GK  585
            GK
Sbjct  211  GK  212



>ref|XP_008357201.1| PREDICTED: zinc-finger homeodomain protein 5-like [Malus domestica]
 ref|XP_008357202.1| PREDICTED: zinc-finger homeodomain protein 5-like [Malus domestica]
Length=345

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P    +KRFRTKFT +QK +M++F E++GW+IQK+DEE +  FC E+GV+R VL+VWMHN
Sbjct  248  PFALSKKRFRTKFTVEQKERMMEFGEKVGWRIQKQDEEEVERFCAEVGVKRQVLRVWMHN  307

Query  605  NKNTVGKIDNITTT  564
            NKNT+ K  ++T T
Sbjct  308  NKNTIKKQGDVTAT  321



>ref|XP_008789175.1| PREDICTED: zinc-finger homeodomain protein 4-like [Phoenix dactylifera]
Length=253

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = -1

Query  788  SPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMH  609
            +PHM  RKRFRTKFT +QK KML+FA+RIGW++Q+++E ++  FC+EIGV+R VLKVWMH
Sbjct  181  APHMV-RKRFRTKFTPEQKEKMLNFADRIGWRLQRQEESMVQQFCQEIGVKRRVLKVWMH  239

Query  608  NNKNTVGK  585
            NNK+++ K
Sbjct  240  NNKHSLAK  247



>gb|AAT39967.1| Putative ZF-HD homeobox protein, identical [Solanum demissum]
Length=291

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKRFRTKFT +QK KM  F+E++GWK+QK DE  +++FC EIGV + VL+VWMHNNKNT
Sbjct  165  GRKRFRTKFTAEQKEKMHSFSEKLGWKLQKCDETAVDEFCNEIGVGKSVLRVWMHNNKNT  224

Query  593  VGKID  579
            +GK D
Sbjct  225  IGKKD  229



>gb|ABY61020.1| zinc finger-homeodomain protein 1 [Eschscholzia californica]
Length=267

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KM+ FAER+GW+IQK DEE++  FC E GV R VLKVWMHNNK+T+
Sbjct  204  KKRFRTKFTQEQKDKMIVFAERLGWRIQKHDEEIVQQFCNETGVRRQVLKVWMHNNKHTL  263

Query  590  GK  585
            GK
Sbjct  264  GK  265



>ref|XP_010939727.1| PREDICTED: zinc-finger homeodomain protein 2 [Elaeis guineensis]
Length=281

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML FAER+GW+IQK DE  +  FC E G++R VLKVWMHNNK+T+
Sbjct  218  KKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCNEAGIKRHVLKVWMHNNKHTL  277

Query  590  GK  585
            GK
Sbjct  278  GK  279



>gb|KJB48886.1| hypothetical protein B456_008G092000 [Gossypium raimondii]
Length=231

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFT DQK KML+ AERIGW+IQK DE L+  FC E GV+R V KVWMHNNK+T+
Sbjct  168  RKRFRTKFTHDQKEKMLELAERIGWRIQKHDELLVQQFCNENGVKRQVFKVWMHNNKHTL  227

Query  590  GK  585
            GK
Sbjct  228  GK  229



>ref|XP_006366102.1| PREDICTED: transcription factor HB29-like [Solanum tuberosum]
Length=287

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKRFRTKFT +QK KM  F+E++GWK+QK DE  +++FC EIGV + VL+VWMHNNKNT
Sbjct  165  GRKRFRTKFTAEQKEKMHSFSEKLGWKLQKCDETAVDEFCNEIGVGKSVLRVWMHNNKNT  224

Query  593  VGKID  579
            +GK D
Sbjct  225  IGKKD  229



>ref|XP_003517792.1| PREDICTED: transcription factor HB29-like [Glycine max]
Length=296

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            G+KR RTKF+ +QK KM +FAE++GW++QK DE L+ DFC+EIGV RGV KVWMHNNKNT
Sbjct  198  GKKRHRTKFSHEQKEKMHNFAEKLGWRMQKGDEGLVQDFCKEIGVSRGVFKVWMHNNKNT  257

Query  593  VGK  585
             G+
Sbjct  258  SGR  260



>gb|KHN07993.1| ZF-HD homeobox protein [Glycine soja]
Length=234

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ QK KML FAE++GW++QK D+ ++ +FC EIGV+R VLKVWMHNNK+T+
Sbjct  171  KKRFRTKFTQHQKDKMLVFAEKLGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTL  230

Query  590  GK  585
            GK
Sbjct  231  GK  232



>gb|KHN07995.1| ZF-HD homeobox protein [Glycine soja]
Length=234

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ QK KML FAE++GW++QK D+ ++ +FC EIGV+R VLKVWMHNNK+T+
Sbjct  171  KKRFRTKFTQHQKDKMLVFAEKLGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTL  230

Query  590  GK  585
            GK
Sbjct  231  GK  232



>ref|XP_002510399.1| transcription factor, putative [Ricinus communis]
 gb|EEF52586.1| transcription factor, putative [Ricinus communis]
Length=289

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P P++  +KRFRTKFT DQK KM++FAE++GW+I K+DEE ++ FC EIGV R V KVWM
Sbjct  208  PPPYVLSKKRFRTKFTHDQKDKMMEFAEKVGWRINKQDEEEVDKFCAEIGVRRQVFKVWM  267

Query  611  HNNKN  597
            HNNKN
Sbjct  268  HNNKN  272



>gb|ABO92969.1| ZF-HD homeobox domain-containing protein [Solanum tuberosum]
Length=285

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKRFRTKFT +QK KM  F+E++GWK+QK DE  +++FC EIGV + VL+VWMHNNKNT
Sbjct  159  GRKRFRTKFTAEQKEKMHSFSEKLGWKLQKCDETAVDEFCNEIGVGKNVLRVWMHNNKNT  218

Query  593  VGKID  579
            +GK D
Sbjct  219  IGKKD  223



>ref|XP_008795929.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=267

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P +  +KR RTKFT +QK +MLDFAER+GW+IQK+DE L+ DFC E+GV R VLKVWMHN
Sbjct  191  PSVVTKKRVRTKFTTEQKERMLDFAERVGWRIQKQDEALVQDFCAEVGVSRPVLKVWMHN  250

Query  605  NKNT  594
            NK++
Sbjct  251  NKHS  254



>gb|KHG22175.1| hypothetical protein F383_07505 [Gossypium arboreum]
Length=251

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFTQ+QK KML  AER+GW+IQK DEE++  FC E GV+R VLKVWMHNNK+T+
Sbjct  176  RKRFRTKFTQEQKEKMLSLAERLGWRIQKHDEEIVQQFCNETGVKRQVLKVWMHNNKHTL  235

Query  590  G  588
             
Sbjct  236  A  236



>ref|XP_004142854.1| PREDICTED: zinc-finger homeodomain protein 4 [Cucumis sativus]
 gb|KGN51402.1| hypothetical protein Csa_5G527900 [Cucumis sativus]
Length=301

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -1

Query  779  MKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNK  600
            M  +KRFRTKFT +QK KML FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK
Sbjct  222  MMNKKRFRTKFTAEQKEKMLRFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNK  281

Query  599  NTVGKIDNITTT  564
            + + K D ++ +
Sbjct  282  HNLAKKDTMSPS  293



>ref|XP_004499360.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cicer arietinum]
Length=318

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML FAE++GWKIQK++E L+  FC+EIGV R VLKVWMHNNK+ +
Sbjct  245  KKRFRTKFTQEQKDKMLSFAEKVGWKIQKQEESLVQQFCQEIGVRRRVLKVWMHNNKHNL  304

Query  590  GK  585
             K
Sbjct  305  AK  306



>ref|NP_001149424.1| LOC100283050 [Zea mays]
 gb|ACG35395.1| ZF-HD protein dimerisation region containing protein [Zea mays]
Length=308

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK +ML FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+
Sbjct  245  KKRFRTKFTQEQKXRMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTL  304

Query  590  GK  585
            GK
Sbjct  305  GK  306



>ref|XP_009762783.1| PREDICTED: zinc-finger homeodomain protein 4-like [Nicotiana 
sylvestris]
Length=306

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KM +FAE++GWKIQK++E ++  FC+E+G++R VLKVWMHNNK+ +
Sbjct  233  KKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEETVVQQFCQELGIKRRVLKVWMHNNKHNL  292

Query  590  GKIDNITTTP  561
             K ++  T P
Sbjct  293  AKKNSNVTIP  302



>gb|EPS73952.1| hypothetical protein M569_00810, partial [Genlisea aurea]
Length=199

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -1

Query  779  MKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNK  600
            + GRKRFRTKF+Q+QK KM  F+E+IGWK+QK D+  + DFC EIGV RGV KVWMHNNK
Sbjct  133  LSGRKRFRTKFSQEQKDKMHSFSEKIGWKMQKCDDSEVRDFCSEIGVSRGVFKVWMHNNK  192

Query  599  NTVGKID  579
              + K D
Sbjct  193  TLIAKKD  199



>gb|KJB18248.1| hypothetical protein B456_003G042700 [Gossypium raimondii]
Length=248

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFTQ+QK KML  AER+GW+IQK DEE++  FC E GV+R VLKVWMHNNK+T+
Sbjct  173  RKRFRTKFTQEQKEKMLSLAERLGWRIQKHDEEIVQQFCNETGVKRHVLKVWMHNNKHTL  232

Query  590  G  588
             
Sbjct  233  A  233



>ref|XP_010252306.1| PREDICTED: zinc-finger homeodomain protein 4 [Nelumbo nucifera]
Length=271

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -1

Query  797  IHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKV  618
            I P P    +KRFRTKFTQ+QK KML FAE++GW+IQK++E ++  FC+EIG++R VLKV
Sbjct  195  IVPRPPQVVKKRFRTKFTQEQKEKMLGFAEKVGWRIQKQEEAVVQQFCQEIGIKRRVLKV  254

Query  617  WMHNNKNTVGKIDNITT  567
            WMHNNK+ + K +  T 
Sbjct  255  WMHNNKHNMAKKNAPTA  271



>ref|XP_011087615.1| PREDICTED: zinc-finger homeodomain protein 4 [Sesamum indicum]
Length=291

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 58/69 (84%), Gaps = 2/69 (3%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P+P +K  KRFRTKFTQ+QK KML FAE++GWKIQK++E ++  FC+E+GV+R VLKVWM
Sbjct  213  PTPVVK--KRFRTKFTQEQKEKMLSFAEKVGWKIQKQEESVVQQFCQEVGVKRRVLKVWM  270

Query  611  HNNKNTVGK  585
            HNNK+ + K
Sbjct  271  HNNKHNLAK  279



>ref|XP_012067956.1| PREDICTED: zinc-finger homeodomain protein 2 isoform X2 [Jatropha 
curcas]
Length=288

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KMLDFAER+GW+IQK DE  +  FC E GV+R VLKVWMHNNK+T+
Sbjct  205  KKRFRTKFTQEQKDKMLDFAERLGWRIQKHDEVAVEQFCGENGVKRHVLKVWMHNNKHTL  264

Query  590  -GKIDNIT  570
              KI+NI 
Sbjct  265  ESKINNIA  272



>ref|XP_006349273.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Solanum tuberosum]
Length=287

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML+FAE++GWKIQK++E ++  FC+E+GV+R VLKVWMHNNK+++
Sbjct  215  KKRFRTKFTQEQKDKMLNFAEKVGWKIQKQEEGVVQQFCQEVGVKRRVLKVWMHNNKHSL  274

Query  590  GK  585
             K
Sbjct  275  AK  276



>ref|XP_010065227.1| PREDICTED: zinc-finger homeodomain protein 4-like [Eucalyptus 
grandis]
 gb|KCW62572.1| hypothetical protein EUGRSUZ_G00066 [Eucalyptus grandis]
Length=332

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = -1

Query  788  SPHMKG-RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            +PH +  +KRFRTKFTQ+QK KM  FAE++GWKIQK++E ++  FC+EIGV+R VLKVWM
Sbjct  251  APHHQAVKKRFRTKFTQEQKEKMFSFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWM  310

Query  611  HNNKNTVGK  585
            HNNK+ + K
Sbjct  311  HNNKHNLAK  319



>ref|XP_006291497.1| hypothetical protein CARUB_v10017644mg [Capsella rubella]
 gb|EOA24395.1| hypothetical protein CARUB_v10017644mg [Capsella rubella]
Length=323

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            RKRFRTKF+  QK KM +FA++IGWKIQKRDE+ + +FCREIGV++GVLKVWMHNNKNT
Sbjct  197  RKRFRTKFSSSQKEKMHEFADKIGWKIQKRDEDNVREFCREIGVDKGVLKVWMHNNKNT  255



>gb|KJB70777.1| hypothetical protein B456_011G090900 [Gossypium raimondii]
Length=297

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML+FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  216  KKRFRTKFTQEQKEKMLNFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNL  275

Query  590  GK  585
             +
Sbjct  276  AR  277



>tpg|DAA48505.1| TPA: putative homeobox DNA-binding domain superfamily protein 
[Zea mays]
Length=308

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK +ML FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+
Sbjct  245  KKRFRTKFTQEQKDRMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTL  304

Query  590  GK  585
            GK
Sbjct  305  GK  306



>ref|XP_003530620.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=261

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ QK KML FAE++GW++QK D+ ++ +FC EIGV+R VLKVWMHNNK+T+
Sbjct  198  KKRFRTKFTQHQKDKMLVFAEKLGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTL  257

Query  590  GK  585
            GK
Sbjct  258  GK  259



>ref|XP_009365549.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=344

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P    +KRFRTKFT +QK +M++F E++GW+IQK+DEE +  FC E+GV+R VL+VWMHN
Sbjct  245  PFASSKKRFRTKFTVEQKERMMEFGEKVGWRIQKQDEEEVERFCAEVGVKRQVLRVWMHN  304

Query  605  NKNTVGKIDNITTT  564
            NKNT+ K  ++  T
Sbjct  305  NKNTIKKQGDVAAT  318



>gb|ADK63402.1| homeobox domain zinc finger protein [Brassica rapa]
Length=163

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q QK KM +FA+R+GWK+QKRDE+ + +FCR+IGV++ VLKVWMHNNKN  
Sbjct  28   RKRFRTKFSQFQKEKMHEFADRVGWKMQKRDEDDVREFCRQIGVDKSVLKVWMHNNKNNF  87

Query  590  GKID  579
             + D
Sbjct  88   NRRD  91



>ref|XP_009399684.1| PREDICTED: zinc-finger homeodomain protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=289

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFTQDQK KML FAER+GW+IQK+DE  +  FC E  V+R VLKVWMHNNK+T+
Sbjct  226  RKRFRTKFTQDQKDKMLVFAERVGWRIQKQDEAAVQQFCDETCVKRHVLKVWMHNNKHTL  285

Query  590  GK  585
            GK
Sbjct  286  GK  287



>gb|ADE77597.1| unknown [Picea sitchensis]
Length=249

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KM  FAE++GW+IQK DE  +  FC E+GV+R VLKVWMHNNK+T+
Sbjct  186  KKRFRTKFTQEQKDKMCSFAEKLGWRIQKHDEAAVQQFCMELGVKRHVLKVWMHNNKHTL  245

Query  590  GK  585
            GK
Sbjct  246  GK  247



>ref|XP_007224511.1| hypothetical protein PRUPE_ppa023369mg [Prunus persica]
 gb|EMJ25710.1| hypothetical protein PRUPE_ppa023369mg [Prunus persica]
Length=310

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P    +KRFRTKFTQ+QK +M++FAE++GW+IQK+DEE +  FC E+GV+R VL+VWMHN
Sbjct  239  PFAMSKKRFRTKFTQEQKERMMEFAEKVGWRIQKQDEEEVERFCAEVGVKRQVLRVWMHN  298

Query  605  NKNTVGK  585
            NKN+  K
Sbjct  299  NKNSAKK  305



>ref|XP_010925945.1| PREDICTED: LOW QUALITY PROTEIN: zinc-finger homeodomain protein 
6-like [Elaeis guineensis]
Length=342

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P P +  +KRFRTKFT +QK KML FAER+GW+I K+DE L+  FC E GV R VLKVWM
Sbjct  247  PPPVVVSKKRFRTKFTVEQKEKMLAFAERVGWRIHKQDEALVEQFCAEAGVRRQVLKVWM  306

Query  611  HNNKNTV  591
            HNNK+T+
Sbjct  307  HNNKHTI  313



>gb|KHN40205.1| ZF-HD homeobox protein [Glycine soja]
Length=204

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKF+Q+QK KML+FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  131  KKRFRTKFSQEQKDKMLNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  190

Query  590  GK  585
             K
Sbjct  191  AK  192



>ref|NP_001151888.1| ZF-HD protein dimerisation region containing protein [Zea mays]
 gb|ACG44773.1| ZF-HD protein dimerisation region containing protein [Zea mays]
Length=273

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK +ML FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+
Sbjct  210  KKRFRTKFTQEQKDRMLAFAERVGWRIQKHDEAAVQQFCDEVCVKRHVLKVWMHNNKHTL  269

Query  590  GK  585
            GK
Sbjct  270  GK  271



>ref|XP_009602563.1| PREDICTED: zinc-finger homeodomain protein 2-like [Nicotiana 
tomentosiformis]
Length=254

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFT DQK KML FAER+GW++QK+DE L+  FC E  V+R V KVWMHNNK+T+
Sbjct  191  RKRFRTKFTADQKDKMLAFAERLGWRMQKQDEALVQQFCAETNVQRHVFKVWMHNNKHTL  250

Query  590  GK  585
            GK
Sbjct  251  GK  252



>ref|XP_011010943.1| PREDICTED: zinc-finger homeodomain protein 9-like [Populus euphratica]
Length=324

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q QK +M  FAE++GWK+QK DE+L+ +FC E+GV+R  LKVWMHNNKN+ 
Sbjct  205  RKRFRTKFSQGQKERMHQFAEKVGWKMQKGDEDLVQEFCNEVGVDRSALKVWMHNNKNSF  264

Query  590  GKIDNI  573
            GK +++
Sbjct  265  GKKEHL  270



>gb|ABY61023.1| zinc finger homeodomain protein 1 [Saruma henryi]
Length=242

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML FAER+GW+IQK+DE ++  FC E  V+R VLKVWMHNNK+T+
Sbjct  179  KKRFRTKFTQEQKDKMLGFAERVGWRIQKQDEAVVQQFCMETNVKRHVLKVWMHNNKHTL  238

Query  590  GK  585
            GK
Sbjct  239  GK  240



>gb|KJB75536.1| hypothetical protein B456_012G046200 [Gossypium raimondii]
Length=196

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = -1

Query  806  PSSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGV  627
            PS  +     K RKRFRTKF+Q QK KML FAE+ GW+IQK DE  +  FC+EIG++R V
Sbjct  116  PSETNEKDDGKVRKRFRTKFSQAQKEKMLSFAEKAGWRIQKLDENAVQQFCQEIGIKRRV  175

Query  626  LKVWMHNNKNTVGKIDNITTT  564
            LKVWMHNNK +    +NI+  
Sbjct  176  LKVWMHNNKQSFANKNNISAA  196



>ref|XP_009758154.1| PREDICTED: zinc-finger homeodomain protein 2-like [Nicotiana 
sylvestris]
Length=254

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFT DQK KML FAER+GW++QK+DE L+  FC E  V+R V KVWMHNNK+T+
Sbjct  191  RKRFRTKFTADQKDKMLAFAERLGWRMQKQDEALVQQFCAETNVQRHVFKVWMHNNKHTL  250

Query  590  GK  585
            GK
Sbjct  251  GK  252



>ref|XP_004973708.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Setaria italica]
Length=298

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK +ML FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+
Sbjct  235  KKRFRTKFTQEQKDRMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTL  294

Query  590  GK  585
            GK
Sbjct  295  GK  296



>ref|XP_011028421.1| PREDICTED: zinc-finger homeodomain protein 4 [Populus euphratica]
Length=296

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKF+Q+QK KML+FAE++GWK+QK++E ++  FC+EIGV+R VLKVWMHNNK+++
Sbjct  222  KKRFRTKFSQEQKEKMLNFAEKVGWKLQKQEETVVQQFCQEIGVKRRVLKVWMHNNKHSL  281

Query  590  GK  585
             K
Sbjct  282  AK  283



>ref|XP_011012906.1| PREDICTED: zinc-finger homeodomain protein 4-like [Populus euphratica]
Length=280

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KR+RTKFTQ+QK KML+FAE++GWK+QK++E ++  FC+EIG++R VLKVWMHNNK  +
Sbjct  211  KKRYRTKFTQEQKEKMLNFAEKVGWKLQKQEETVVQQFCQEIGIKRRVLKVWMHNNKLNL  270

Query  590  GKIDNITTT  564
             K +  TTT
Sbjct  271  AKKNPSTTT  279



>ref|XP_003529692.1| PREDICTED: ZF-HD homeobox protein At5g65410-like isoform X1 [Glycine 
max]
 ref|XP_006584131.1| PREDICTED: ZF-HD homeobox protein At5g65410-like isoform X2 [Glycine 
max]
Length=283

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKF+Q+QK KML+FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  210  KKRFRTKFSQEQKDKMLNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  269

Query  590  GK  585
             K
Sbjct  270  AK  271



>ref|XP_003518249.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=258

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML FAE++GW+IQK DE  +  FC EI V+R VLKVWMHNNK+T+
Sbjct  195  KKRFRTKFTQEQKDKMLAFAEQLGWRIQKHDESAVEQFCAEINVKRNVLKVWMHNNKSTL  254

Query  590  GK  585
            GK
Sbjct  255  GK  256



>ref|XP_009620302.1| PREDICTED: zinc-finger homeodomain protein 9-like [Nicotiana 
tomentosiformis]
Length=263

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKRFRTKFTQ QK KM  F+E++GWK+QK DE  + +FC E+GV +GVL+VWMHNNKNT
Sbjct  158  GRKRFRTKFTQQQKEKMHSFSEKLGWKLQKCDEAKVEEFCNEVGVGKGVLRVWMHNNKNT  217

Query  593  VGKIDNI  573
              K + +
Sbjct  218  FAKKEEL  224



>gb|KDO82923.1| hypothetical protein CISIN_1g046396mg [Citrus sinensis]
Length=314

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            G+KR RTKFTQ+QK KML FAER+GWK+ + +E+L  DFC E+GV R V KVWMHNNKN 
Sbjct  203  GKKRSRTKFTQEQKEKMLSFAERLGWKMNRAEEKLTQDFCSEVGVSRRVFKVWMHNNKNA  262

Query  593  VGKID  579
             G+ D
Sbjct  263  SGRKD  267



>ref|XP_006438687.1| hypothetical protein CICLE_v10032160mg [Citrus clementina]
 ref|XP_006483155.1| PREDICTED: transcription factor HB29-like [Citrus sinensis]
 gb|ESR51927.1| hypothetical protein CICLE_v10032160mg [Citrus clementina]
Length=314

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            G+KR RTKFTQ+QK KML FAER+GWK+ + +E+L  DFC E+GV R V KVWMHNNKN 
Sbjct  203  GKKRSRTKFTQEQKEKMLSFAERLGWKMNRAEEKLTQDFCSEVGVSRRVFKVWMHNNKNA  262

Query  593  VGKID  579
             G+ D
Sbjct  263  SGRKD  267



>emb|CDP01539.1| unnamed protein product [Coffea canephora]
Length=252

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKF+Q+QK KM D AE++GWKIQK+DEE++   C E+G++R VLKVWMHNNK+T+
Sbjct  189  KKRFRTKFSQEQKEKMSDLAEKLGWKIQKQDEEVVQQLCNELGIKRQVLKVWMHNNKHTL  248

Query  590  GK  585
            GK
Sbjct  249  GK  250



>ref|XP_004301574.1| PREDICTED: zinc-finger homeodomain protein 4-like [Fragaria vesca 
subsp. vesca]
Length=383

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KM +FAE++GWKIQK++E ++ +FC EIGV+R VLKVWMHNNK+ +
Sbjct  310  KKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEESVVQNFCHEIGVKRRVLKVWMHNNKHNL  369

Query  590  GK  585
             K
Sbjct  370  AK  371



>gb|ABY61024.1| zinc finger-homeodomain protein 2 [Saruma henryi]
Length=258

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML FAE++GW+IQK++E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  190  KKRFRTKFTQEQKEKMLSFAEKVGWRIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  249

Query  590  GK  585
             K
Sbjct  250  AK  251



>ref|XP_006285795.1| hypothetical protein CARUB_v10007269mg [Capsella rubella]
 gb|EOA18693.1| hypothetical protein CARUB_v10007269mg [Capsella rubella]
Length=341

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q QK KM +FAER+GWK+QKRDE+ + +FCR+IGV++ VLKVWMHNNKNT 
Sbjct  204  RKRFRTKFSQFQKEKMHEFAERLGWKMQKRDEDDVREFCRQIGVDKSVLKVWMHNNKNTF  263

Query  590  GKID  579
             + D
Sbjct  264  NRRD  267



>ref|XP_009393647.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=281

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFTQ+QK KML FAER+GW+IQK DE  +  FC E  ++R VLKVWMHNNK+T+
Sbjct  218  RKRFRTKFTQEQKEKMLAFAERLGWRIQKHDEAAVQQFCEETCIKRHVLKVWMHNNKHTL  277

Query  590  GK  585
            GK
Sbjct  278  GK  279



>gb|KEH32742.1| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=365

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML+FAE++GWK QK++E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  284  KKRFRTKFTQEQKEKMLNFAEKVGWKFQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNL  343

Query  590  GK  585
             K
Sbjct  344  AK  345



>ref|XP_006385095.1| hypothetical protein POPTR_0004s23860g, partial [Populus trichocarpa]
 gb|ERP62892.1| hypothetical protein POPTR_0004s23860g, partial [Populus trichocarpa]
Length=312

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKF+Q+QK KML+FAE++GWK+QK++E ++  FC+EIGV+R VLKVWMHNNK+++
Sbjct  239  KKRFRTKFSQEQKEKMLNFAEKVGWKLQKQEETVVQQFCQEIGVKRRVLKVWMHNNKHSL  298

Query  590  GK  585
             K
Sbjct  299  AK  300



>ref|XP_007226172.1| hypothetical protein PRUPE_ppa015411mg [Prunus persica]
 gb|EMJ27371.1| hypothetical protein PRUPE_ppa015411mg [Prunus persica]
Length=341

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P+     +KRFRTKFTQ+QK KM +FAE++GWKIQK+++ ++ +FC+EIGV+R VLKVWM
Sbjct  262  PAAAQLAKKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEDSVVQNFCQEIGVKRRVLKVWM  321

Query  611  HNNKNTVGK  585
            HNNK+ + K
Sbjct  322  HNNKHNLAK  330



>ref|XP_011621016.1| PREDICTED: zinc-finger homeodomain protein 2 [Amborella trichopoda]
 gb|ERM99777.1| hypothetical protein AMTR_s00099p00145100 [Amborella trichopoda]
Length=267

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML FAE++GW+IQK++E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  202  KKRFRTKFTQEQKEKMLSFAEKVGWRIQKQEEGVVQQFCQEIGVKRRVLKVWMHNNKHNL  261

Query  590  GK  585
             K
Sbjct  262  AK  263



>ref|XP_008338536.1| PREDICTED: LOW QUALITY PROTEIN: zinc-finger homeodomain protein 
1-like [Malus domestica]
Length=278

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            G+KRFRTKF+Q+QK +ML  AER+GW+IQK+DE  +  FC E GV+R VLKVWMHNNK+T
Sbjct  214  GKKRFRTKFSQEQKERMLSLAERLGWRIQKQDEPAVQQFCNETGVKRHVLKVWMHNNKHT  273

Query  593  VGK  585
            +GK
Sbjct  274  LGK  276



>ref|XP_003633412.1| PREDICTED: zinc-finger homeodomain protein 4 [Vitis vinifera]
Length=281

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKF+Q+QK KML FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  211  KKRFRTKFSQEQKEKMLSFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNL  270

Query  590  GKIDNITTT  564
             K   + ++
Sbjct  271  AKKTPLPSS  279



>emb|CDY33960.1| BnaC02g43770D [Brassica napus]
Length=269

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFT +QK +ML  AERIGW+IQ++D+E+I  FC+E GV R VLKVW+HNNK+T+
Sbjct  179  RKRFRTKFTAEQKERMLGLAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHNNKHTL  238

Query  590  GK  585
            GK
Sbjct  239  GK  240



>gb|KJB64195.1| hypothetical protein B456_010G036300 [Gossypium raimondii]
Length=245

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFT +QK KMLDFAE++GW+IQK DE  I  FC E GV+R VLKVWMHNNKNT+
Sbjct  183  KKRFRTKFTAEQKEKMLDFAEKLGWRIQKHDEAAIQQFCEETGVKRHVLKVWMHNNKNTL  242



>ref|XP_008218634.1| PREDICTED: zinc-finger homeodomain protein 4-like [Prunus mume]
Length=347

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P+     +KRFRTKFTQ+QK KM +FAE++GWKIQK+++ ++ +FC+EIGV+R VLKVWM
Sbjct  266  PAAAQLAKKRFRTKFTQEQKEKMFNFAEKVGWKIQKQEDSVVQNFCQEIGVKRRVLKVWM  325

Query  611  HNNKNTVGK  585
            HNNK+ + K
Sbjct  326  HNNKHNLAK  334



>ref|XP_008460585.1| PREDICTED: zinc-finger homeodomain protein 4 [Cucumis melo]
Length=298

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -1

Query  779  MKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNK  600
            M  +KRFRTKFT +QK KML FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK
Sbjct  219  MMNKKRFRTKFTTEQKEKMLRFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNK  278

Query  599  NTVGKIDNITTT  564
            + + K + ++ +
Sbjct  279  HNLAKKETMSPS  290



>ref|XP_007158386.1| hypothetical protein PHAVU_002G148900g [Phaseolus vulgaris]
 gb|ESW30380.1| hypothetical protein PHAVU_002G148900g [Phaseolus vulgaris]
Length=236

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KML+ AE++GW+IQK DE ++  FC E GV+R VLKVWMHNNK+T+
Sbjct  173  KKRFRTKFTQEQKDKMLELAEKLGWRIQKHDEGVVQAFCNETGVKRHVLKVWMHNNKHTL  232

Query  590  GK  585
            GK
Sbjct  233  GK  234



>ref|XP_002525870.1| transcription factor, putative [Ricinus communis]
 gb|EEF36564.1| transcription factor, putative [Ricinus communis]
Length=311

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P    +KR+RTKF+Q+QK KML+FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHN
Sbjct  224  PQQLVKKRYRTKFSQEQKEKMLNFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHN  283

Query  605  NKNTVGK  585
            NK+ + K
Sbjct  284  NKHNLAK  290



>ref|XP_010086552.1| hypothetical protein L484_001444 [Morus notabilis]
 gb|EXB20251.1| hypothetical protein L484_001444 [Morus notabilis]
Length=370

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
             RKRFRTKF+Q+QK KM  FAE++GWK+Q+ +E+++ +FC E+G+ +GVLKVWMHNNK+T
Sbjct  245  ARKRFRTKFSQEQKEKMCLFAEKLGWKMQRSEEKVVEEFCNEVGIRKGVLKVWMHNNKHT  304

Query  593  VGK  585
            +GK
Sbjct  305  LGK  307



>ref|XP_008219382.1| PREDICTED: zinc-finger homeodomain protein 2 [Prunus mume]
Length=282

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KR RTKFTQ+QK KML+FAE++GW+IQK DE  + +FC E GV+R VLKVWMHNNK+T+
Sbjct  217  KKRHRTKFTQEQKEKMLEFAEKVGWRIQKHDEAAVEEFCGETGVKRQVLKVWMHNNKHTL  276

Query  590  GK  585
            GK
Sbjct  277  GK  278



>ref|XP_006426395.1| hypothetical protein CICLE_v10027184mg [Citrus clementina]
 gb|ESR39635.1| hypothetical protein CICLE_v10027184mg [Citrus clementina]
Length=219

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  779  MKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNK  600
            M  RKRFRTKFTQ+QK KML FAER  W+IQK DE ++  FC+EIG++R VLKVWMHNNK
Sbjct  148  MMMRKRFRTKFTQEQKEKMLSFAERADWRIQKLDESVVQQFCQEIGIKRRVLKVWMHNNK  207

Query  599  NTVGK  585
             +  K
Sbjct  208  QSFAK  212



>gb|KJB44095.1| hypothetical protein B456_007G233800 [Gossypium raimondii]
Length=238

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFTQ+QK KML  AER+GW+IQK+DE ++  FC E GV+R V KVWMHNNKNT+
Sbjct  176  RKRFRTKFTQEQKEKMLALAERLGWRIQKQDEAIVQQFCNETGVKRHVFKVWMHNNKNTL  235

Query  590  G  588
             
Sbjct  236  A  236



>ref|XP_006394037.1| hypothetical protein EUTSA_v10005568mg [Eutrema salsugineum]
 dbj|BAJ34581.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31323.1| hypothetical protein EUTSA_v10005568mg [Eutrema salsugineum]
Length=286

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFT +QK +ML  AERIGW+IQ++D+ELI  FC+E GV R VLKVW+HNNK+T+
Sbjct  193  RKRFRTKFTAEQKERMLGLAERIGWRIQRQDDELIQRFCQETGVPRQVLKVWLHNNKHTL  252

Query  590  GK  585
            GK
Sbjct  253  GK  254



>ref|XP_007143929.1| hypothetical protein PHAVU_007G114300g [Phaseolus vulgaris]
 gb|ESW15923.1| hypothetical protein PHAVU_007G114300g [Phaseolus vulgaris]
Length=197

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -1

Query  785  PHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHN  606
            P  K +KRFRTKFTQ+QK KML FAER GW++QK DE ++  FC+EIG++R VLKVW+HN
Sbjct  125  PTEKVKKRFRTKFTQEQKEKMLLFAERAGWRLQKLDESVVQKFCQEIGIKRRVLKVWIHN  184

Query  605  NKNTVGK  585
            NKNT  K
Sbjct  185  NKNTFVK  191



>emb|CDP11470.1| unnamed protein product [Coffea canephora]
Length=268

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFT DQK KML FAER+GW+IQK+DE L+  FC E  V+R VLKVWMHNNK+++
Sbjct  205  KKRFRTKFTPDQKEKMLAFAERLGWRIQKQDEALVQQFCAETNVKRHVLKVWMHNNKHSL  264

Query  590  GK  585
            GK
Sbjct  265  GK  266



>ref|XP_007222197.1| hypothetical protein PRUPE_ppa009679mg [Prunus persica]
 gb|EMJ23396.1| hypothetical protein PRUPE_ppa009679mg [Prunus persica]
Length=282

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KR RTKFTQ+QK KML+FAE++GW+IQK DE  + +FC E GV+R VLKVWMHNNK+T+
Sbjct  217  KKRHRTKFTQEQKEKMLEFAEKVGWRIQKHDEAAVEEFCGETGVKRQVLKVWMHNNKHTL  276

Query  590  GK  585
            GK
Sbjct  277  GK  278



>gb|KHN08326.1| ZF-HD homeobox protein [Glycine soja]
Length=273

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ QK KML FAE++GW++QK DE ++ +FC EIGV+R VLKVWMHNNK+ +
Sbjct  165  KKRFRTKFTQHQKDKMLVFAEKLGWRMQKNDESIVQEFCSEIGVQRHVLKVWMHNNKHIL  224

Query  590  GKIDNITT  567
              +  I +
Sbjct  225  ASLRRIIS  232



>ref|XP_006380765.1| hypothetical protein POPTR_0007s12970g [Populus trichocarpa]
 gb|ERP58562.1| hypothetical protein POPTR_0007s12970g [Populus trichocarpa]
Length=331

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 3/73 (4%)
 Frame = -1

Query  803  SSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVL  624
            +S+ PS     RKRFRTKF+QDQK KM +FAE++GW+IQK+DE+ +  FC ++GV+R V 
Sbjct  259  ASVQPS---MSRKRFRTKFSQDQKDKMTEFAEKLGWRIQKQDEQEVQQFCSQVGVKRKVF  315

Query  623  KVWMHNNKNTVGK  585
            KVWMHNNK  + K
Sbjct  316  KVWMHNNKQAMKK  328



>ref|XP_002310240.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE90690.2| zinc finger family protein [Populus trichocarpa]
Length=296

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 3/73 (4%)
 Frame = -1

Query  803  SSIHPSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVL  624
            +S+ PS     RKRFRTKF+QDQK KM +FAE++GW+IQK+DE+ +  FC ++GV+R V 
Sbjct  224  ASVQPS---MSRKRFRTKFSQDQKDKMTEFAEKLGWRIQKQDEQEVQQFCSQVGVKRKVF  280

Query  623  KVWMHNNKNTVGK  585
            KVWMHNNK  + K
Sbjct  281  KVWMHNNKQAMKK  293



>ref|XP_003635057.1| PREDICTED: zinc-finger homeodomain protein 2-like [Vitis vinifera]
Length=244

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            PS     +KRFRTKFTQ+QK KM   AER+GW+IQK DE ++  FC E GV+R VLKVWM
Sbjct  157  PSGAGSSKKRFRTKFTQEQKDKMFGLAERLGWRIQKHDEAVVQQFCSETGVKRHVLKVWM  216

Query  611  HNNKNTVG  588
            HNNK+T+G
Sbjct  217  HNNKHTLG  224



>ref|XP_009130511.1| PREDICTED: zinc-finger homeodomain protein 1-like [Brassica rapa]
 emb|CDY37827.1| BnaAnng04880D [Brassica napus]
Length=272

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFT +QK +ML  AERIGW+IQ++D+E+I  FC+E GV R VLKVW+HNNK+T+
Sbjct  183  RKRFRTKFTAEQKERMLGLAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHNNKHTL  242

Query  590  GK  585
            GK
Sbjct  243  GK  244



>ref|XP_012069129.1| PREDICTED: zinc-finger homeodomain protein 4-like [Jatropha curcas]
 gb|KDP40895.1| hypothetical protein JCGZ_24894 [Jatropha curcas]
Length=262

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK KM +FAE++GWKIQK++E ++  FC+EIGV+R VLKVWMHNNK+ +
Sbjct  181  KKRFRTKFTQEQKEKMHNFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNL  240

Query  590  GK  585
             K
Sbjct  241  AK  242



>ref|XP_006827241.1| PREDICTED: zinc-finger homeodomain protein 2 [Amborella trichopoda]
 gb|ERM94478.1| hypothetical protein AMTR_s00010p00261450 [Amborella trichopoda]
Length=232

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFT +QK KM  F++++GWK+QK+DE LI +FC EIG+ R VLKVWMHNNK+T+
Sbjct  160  RKRFRTKFTAEQKEKMYGFSDKLGWKMQKQDEGLIQEFCDEIGIRRSVLKVWMHNNKSTL  219

Query  590  GKID  579
            G+ D
Sbjct  220  GRKD  223



>gb|KJB44094.1| hypothetical protein B456_007G233800 [Gossypium raimondii]
Length=254

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFTQ+QK KML  AER+GW+IQK+DE ++  FC E GV+R V KVWMHNNKNT+
Sbjct  176  RKRFRTKFTQEQKEKMLALAERLGWRIQKQDEAIVQQFCNETGVKRHVFKVWMHNNKNTL  235



>ref|XP_006466561.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Citrus sinensis]
Length=219

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -1

Query  779  MKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNK  600
            M  RKRFRTKFTQ+QK KML FAER  W+IQK DE ++  FC+E+G++R VLKVWMHNNK
Sbjct  148  MMMRKRFRTKFTQEQKEKMLSFAERADWRIQKLDESVVQQFCQEVGIKRRVLKVWMHNNK  207

Query  599  NTVGK  585
             +  K
Sbjct  208  QSFAK  212



>gb|KJB30399.1| hypothetical protein B456_005G141400 [Gossypium raimondii]
Length=262

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRKR RTKFT++QK KM  FAER+GW++ K +E+LI +FC E+GV RGVLKVWMHNNKNT
Sbjct  146  GRKRSRTKFTKEQKEKMHAFAERLGWRMPKGEEKLIQEFCNEVGVNRGVLKVWMHNNKNT  205

Query  593  VGK  585
              K
Sbjct  206  FSK  208



>ref|XP_009800645.1| PREDICTED: putative F-box/LRR-repeat protein At5g41840 [Nicotiana 
sylvestris]
Length=456

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            GRK+ RT F+Q QK KML+FAER+GWK+QKRD+ELI+DFC +IGV++ +LKVWMH+N+NT
Sbjct  11   GRKQIRTIFSQYQKKKMLEFAERVGWKLQKRDDELISDFCSKIGVKKRLLKVWMHDNENT  70

Query  593  VGKID  579
                D
Sbjct  71   FATAD  75



>ref|XP_004288462.1| PREDICTED: zinc-finger homeodomain protein 1-like [Fragaria vesca 
subsp. vesca]
Length=267

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKF+Q+QK +ML+ AER+GW+IQK+DE  +  FC E GV+R VLKVWMHNNK+T+
Sbjct  204  KKRFRTKFSQEQKERMLELAERLGWRIQKQDEAAVQSFCDETGVKRHVLKVWMHNNKHTL  263

Query  590  GK  585
            GK
Sbjct  264  GK  265



>ref|XP_004299701.1| PREDICTED: zinc-finger homeodomain protein 2-like [Fragaria vesca 
subsp. vesca]
Length=254

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFT +QK KM++FAE++GW+IQK DE  + +FC   GV+R VLKVWMHNNK+T+
Sbjct  191  RKRFRTKFTAEQKEKMVEFAEKVGWRIQKHDEAAVEEFCAVTGVKRQVLKVWMHNNKHTI  250

Query  590  GK  585
            GK
Sbjct  251  GK  252



>ref|XP_006426297.1| hypothetical protein CICLE_v10027024mg [Citrus clementina]
 ref|XP_006466284.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Citrus sinensis]
 gb|ESR39537.1| hypothetical protein CICLE_v10027024mg [Citrus clementina]
 gb|KDO60627.1| hypothetical protein CISIN_1g026161mg [Citrus sinensis]
Length=242

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFT +QK +ML+ AE++GW+IQK DEE++  FC + GV+R VLKVWMHNNK+T+
Sbjct  179  RKRFRTKFTPEQKDRMLELAEKLGWRIQKHDEEVVQQFCNDTGVKRHVLKVWMHNNKHTL  238

Query  590  GK  585
            GK
Sbjct  239  GK  240



>ref|XP_009373614.1| PREDICTED: zinc-finger homeodomain protein 3-like [Pyrus x bretschneideri]
Length=379

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNK-N  597
             +KRFRTKFTQ+QK KML+FAE++GWKIQK++E  + +FC+EIGV+R VLKVWMHNNK N
Sbjct  305  AKKRFRTKFTQEQKEKMLNFAEKVGWKIQKQEETFVQNFCQEIGVKRRVLKVWMHNNKHN  364

Query  596  TVGKID  579
               KI+
Sbjct  365  LANKIN  370



>gb|ABY61025.1| zinc finger-homeodomain protein 3, partial [Saruma henryi]
Length=211

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  779  MKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNK  600
            + G+KRFRTKF Q+QK KM+ FAE++GW+IQK ++  +  FC EIGV+R VLKVWMHNNK
Sbjct  134  VSGKKRFRTKFMQEQKEKMVAFAEKLGWRIQKENDVELEKFCSEIGVKRQVLKVWMHNNK  193

Query  599  NTVGK  585
            NT+GK
Sbjct  194  NTLGK  198



>ref|XP_009139922.1| PREDICTED: zinc-finger homeodomain protein 10 [Brassica rapa]
 emb|CDX74428.1| BnaA04g09610D [Brassica napus]
Length=317

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKF+Q QK KM +FA+R+GWK+QKRDE+ + +FCR+IGV++ VLKVWMHNNKN  
Sbjct  182  RKRFRTKFSQFQKEKMHEFADRVGWKMQKRDEDDVREFCRQIGVDKSVLKVWMHNNKNNF  241

Query  590  GKID  579
             + D
Sbjct  242  NRRD  245



>gb|ABK25080.1| unknown [Picea sitchensis]
Length=279

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKF+QDQK KM  FA+++GW++QK+DE ++  FC EIGV +GVLKVWMHNNK+T+
Sbjct  216  KKRFRTKFSQDQKEKMYMFADKMGWRMQKQDEAIVQQFCNEIGVGKGVLKVWMHNNKHTL  275

Query  590  GK  585
            GK
Sbjct  276  GK  277



>ref|XP_008800713.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
 ref|XP_008800714.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
 ref|XP_008800715.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=330

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -1

Query  791  PSPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWM  612
            P P +  +KRFRTKFT +QK KML FAE +GW+I K+DE L+   C E+GV R VLKVWM
Sbjct  243  PPPGLASKKRFRTKFTAEQKEKMLAFAESVGWRIHKQDEALVQQVCAEVGVRRQVLKVWM  302

Query  611  HNNKNTV  591
            HNNK+T+
Sbjct  303  HNNKHTI  309



>ref|XP_002445649.1| hypothetical protein SORBIDRAFT_07g023360 [Sorghum bicolor]
 gb|EES15144.1| hypothetical protein SORBIDRAFT_07g023360 [Sorghum bicolor]
Length=311

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKFTQ+QK +ML FAER+GW+IQK DE  +  FC E+ V+R VLKVWMHNNK+T+
Sbjct  248  KKRFRTKFTQEQKDRMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTL  307

Query  590  GK  585
            GK
Sbjct  308  GK  309



>emb|CBI19706.3| unnamed protein product [Vitis vinifera]
Length=321

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = -1

Query  806  PSSIHP--SPHMKGRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVER  633
            PS +H     H + RKRFRTKFTQ+QK KML++AE++GW++QK+ EE +   C E+GV+R
Sbjct  204  PSHVHGFWDEHRRHRKRFRTKFTQEQKEKMLEYAEKVGWRMQKQYEEQVQQLCAEVGVKR  263

Query  632  GVLKVWMHNNKNTVGK  585
             V KVWMHNNKNT+ K
Sbjct  264  QVFKVWMHNNKNTLKK  279



>ref|XP_008385681.1| PREDICTED: zinc-finger homeodomain protein 1-like isoform X2 
[Malus domestica]
Length=274

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  773  GRKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNT  594
            G+KRFRTKF+Q+QK +ML  AER+GW+IQK+DE  +  FC E GV R VLKVWMHNNK+T
Sbjct  210  GKKRFRTKFSQEQKERMLSLAERLGWRIQKQDEPAVQQFCNETGVNRHVLKVWMHNNKHT  269

Query  593  VGK  585
            +GK
Sbjct  270  LGK  272



>gb|ABK25143.1| unknown [Picea sitchensis]
Length=279

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            +KRFRTKF+QDQK KM  FA+++GW++QK+DE ++  FC EIGV +GVLKVWMHNNK+T+
Sbjct  216  KKRFRTKFSQDQKEKMYMFADKMGWRMQKQDEAIVQQFCNEIGVGKGVLKVWMHNNKHTL  275

Query  590  GK  585
            GK
Sbjct  276  GK  277



>ref|XP_006291509.1| hypothetical protein CARUB_v10017657mg [Capsella rubella]
 gb|EOA24407.1| hypothetical protein CARUB_v10017657mg [Capsella rubella]
Length=320

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  770  RKRFRTKFTQDQKGKMLDFAERIGWKIQKRDEELINDFCREIGVERGVLKVWMHNNKNTV  591
            RKRFRTKFTQ+QK KM+ FAER+GWK+Q+++E  + +FC+EIG+ R VLKVWMHNNK+ +
Sbjct  225  RKRFRTKFTQEQKEKMVSFAERVGWKMQRQEESAVQEFCQEIGIRRRVLKVWMHNNKHNL  284

Query  590  GK  585
             K
Sbjct  285  SK  286



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1669417592084