BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8385

Length=770
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AIC33040.1|  glucose-6-phosphate/phosphate translocator 1            239   1e-75   Panax ginseng [Asiatic ginseng]
ref|XP_006368049.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    236   2e-74   Solanum tuberosum [potatoes]
ref|XP_011095359.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    241   1e-73   Sesamum indicum [beniseed]
ref|XP_006366041.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    241   1e-73   Solanum tuberosum [potatoes]
ref|XP_004244144.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    241   2e-73   Solanum lycopersicum
ref|XP_004294354.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    241   2e-73   Fragaria vesca subsp. vesca
ref|XP_009785267.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    241   2e-73   Nicotiana sylvestris
ref|XP_009601121.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    241   3e-73   Nicotiana tomentosiformis
ref|XP_008226825.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    240   4e-73   Prunus mume [ume]
gb|EYU33618.1|  hypothetical protein MIMGU_mgv1a0131841mg               234   5e-73   Erythranthe guttata [common monkey flower]
ref|XP_007213874.1|  hypothetical protein PRUPE_ppa006795mg             239   8e-73   Prunus persica
ref|XP_006401535.1|  hypothetical protein EUTSA_v10013772mg             238   2e-72   Eutrema salsugineum [saltwater cress]
gb|EYU19234.1|  hypothetical protein MIMGU_mgv1a007836mg                238   3e-72   Erythranthe guttata [common monkey flower]
ref|XP_007026011.1|  Glucose-6-phosphate/phosphate translocator 2       238   3e-72   
gb|KJB81792.1|  hypothetical protein B456_013G161500                    237   4e-72   Gossypium raimondii
ref|XP_011009303.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    237   4e-72   Populus euphratica
ref|XP_010267729.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    238   5e-72   Nelumbo nucifera [Indian lotus]
ref|XP_007020964.1|  Glucose-6-phosphate/phosphate translocator 2...    235   5e-72   
ref|XP_011030834.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    237   6e-72   Populus euphratica
emb|CDY55220.1|  BnaA01g36280D                                          237   6e-72   Brassica napus [oilseed rape]
ref|XP_009105258.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    237   7e-72   Brassica rapa
ref|XP_007026012.1|  Glucose-6-phosphate/phosphate translocator 2...    236   7e-72   
emb|CBI23953.3|  unnamed protein product                                232   8e-72   Vitis vinifera
ref|XP_008365529.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    236   9e-72   
ref|XP_010276000.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    236   1e-71   Nelumbo nucifera [Indian lotus]
ref|XP_009342585.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    236   1e-71   Pyrus x bretschneideri [bai li]
ref|XP_010694203.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    236   1e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007020963.1|  Glucose 6-phosphate/phosphate translocator 1...    236   1e-71   Theobroma cacao [chocolate]
gb|AAM63660.1|  glucose-6-phosphate/phosphate translocator              236   2e-71   Arabidopsis thaliana [mouse-ear cress]
gb|EEE68168.1|  hypothetical protein OsJ_26287                          235   2e-71   Oryza sativa Japonica Group [Japonica rice]
emb|CDP05779.1|  unnamed protein product                                236   2e-71   Coffea canephora [robusta coffee]
ref|XP_009358127.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    236   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_002266056.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    236   2e-71   Vitis vinifera
gb|KHG03254.1|  Glucose-6-phosphate/phosphate translocator 2, chl...    236   2e-71   Gossypium arboreum [tree cotton]
ref|XP_006659185.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    235   2e-71   Oryza brachyantha
gb|KFK27093.1|  hypothetical protein AALP_AA8G333200                    235   3e-71   Arabis alpina [alpine rockcress]
ref|XP_010482887.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    235   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_004972694.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    234   4e-71   Setaria italica
ref|NP_568812.1|  glucose-6-phosphate/phosphate translocator 1          234   4e-71   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001061152.1|  Os08g0187800                                       234   5e-71   
ref|XP_003519000.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    234   5e-71   
ref|XP_010443058.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    234   6e-71   Camelina sativa [gold-of-pleasure]
gb|EEC83014.1|  hypothetical protein OsI_28073                          234   6e-71   Oryza sativa Indica Group [Indian rice]
ref|XP_002443966.1|  hypothetical protein SORBIDRAFT_07g005200          234   6e-71   Sorghum bicolor [broomcorn]
gb|KHM99601.1|  Glucose-6-phosphate/phosphate translocator 1, chl...    234   6e-71   Glycine soja [wild soybean]
emb|CDP11791.1|  unnamed protein product                                234   6e-71   Coffea canephora [robusta coffee]
ref|XP_002864355.1|  glucose-6-phosphate transporter 1                  234   6e-71   Arabidopsis lyrata subsp. lyrata
gb|ABK91082.1|  putative glucose-6-phosphate translocator               234   7e-71   Sorghum bicolor [broomcorn]
gb|ABK91097.1|  putative glucose-6-phosphate translocator               234   8e-71   Sorghum bicolor [broomcorn]
gb|ABK91094.1|  putative glucose-6-phosphate translocator               234   8e-71   Sorghum bicolor [broomcorn]
ref|XP_012070764.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    234   8e-71   Jatropha curcas
ref|XP_007142250.1|  hypothetical protein PHAVU_008G265100g             234   8e-71   Phaseolus vulgaris [French bean]
ref|XP_009132423.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    234   9e-71   Brassica rapa
gb|ABK91091.1|  putative glucose-6-phosphate translocator               234   9e-71   Sorghum bicolor [broomcorn]
ref|XP_008784551.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    234   9e-71   Phoenix dactylifera
gb|ABK91093.1|  putative glucose-6-phosphate translocator               234   9e-71   Sorghum bicolor [broomcorn]
gb|ABK91102.1|  putative glucose-6-phosphate translocator               234   1e-70   Sorghum bicolor [broomcorn]
ref|XP_006449072.1|  hypothetical protein CICLE_v10015210mg             234   1e-70   
ref|XP_006279646.1|  hypothetical protein CARUB_v10026569mg             233   1e-70   Capsella rubella
gb|AAK54618.1|AF375053_1  glucose-6-phosphate/phosphate translocator    233   2e-70   Oryza sativa [red rice]
ref|XP_006383937.1|  hypothetical protein POPTR_0004s01930g             233   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_010060420.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    233   2e-70   Eucalyptus grandis [rose gum]
gb|KJB13621.1|  hypothetical protein B456_002G085200                    233   2e-70   Gossypium raimondii
ref|XP_002316985.2|  glucose-6-phosphate/phosphate-translocator p...    233   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_010533829.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    233   2e-70   Tarenaya hassleriana [spider flower]
ref|XP_010665533.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    233   2e-70   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB67150.1|  hypothetical protein B456_010G178300                    233   2e-70   Gossypium raimondii
ref|XP_006370658.1|  glucose-6-phosphate/phosphate-translocator p...    233   3e-70   
ref|XP_002281493.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    233   3e-70   Vitis vinifera
gb|AAX47109.1|  putative plastid glucose 6 phosphate/phosphate tr...    233   3e-70   Glycine max [soybeans]
ref|XP_011009302.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    233   3e-70   Populus euphratica
ref|XP_006391961.1|  hypothetical protein EUTSA_v10023518mg             232   3e-70   Eutrema salsugineum [saltwater cress]
ref|XP_003551900.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    233   3e-70   Glycine max [soybeans]
ref|XP_009420544.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    233   3e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010931815.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    233   3e-70   Elaeis guineensis
ref|XP_002888066.1|  glucose-6-phosphate/phosphate translocator 2       232   4e-70   
ref|XP_003573402.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    232   4e-70   Brachypodium distachyon [annual false brome]
gb|AAP80864.1|  glucose-6-phosphate/phosphate translocator              232   4e-70   Triticum aestivum [Canadian hard winter wheat]
gb|KFK40647.1|  hypothetical protein AALP_AA2G023600                    232   5e-70   Arabis alpina [alpine rockcress]
ref|XP_011037695.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    232   7e-70   Populus euphratica
gb|KJB81793.1|  hypothetical protein B456_013G161500                    233   7e-70   Gossypium raimondii
ref|NP_001131942.1|  uncharacterized protein LOC100193334               231   8e-70   Zea mays [maize]
gb|KHG04645.1|  Glucose-6-phosphate/phosphate translocator 1, chl...    233   8e-70   Gossypium arboreum [tree cotton]
ref|XP_007026013.1|  Glucose-6-phosphate/phosphate translocator 2...    232   1e-69   
ref|XP_009120008.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    231   1e-69   Brassica rapa
ref|XP_006302377.1|  hypothetical protein CARUB_v10020443mg             231   1e-69   Capsella rubella
ref|NP_001059819.1|  Os07g0523600                                       227   1e-69   
ref|XP_004486132.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    231   1e-69   Cicer arietinum [garbanzo]
gb|ACG36927.1|  glucose-6-phosphate/phosphate translocator 2            231   1e-69   Zea mays [maize]
ref|XP_010092109.1|  Glucose-6-phosphate/phosphate translocator 1       233   1e-69   
emb|CDY25324.1|  BnaC01g29930D                                          231   1e-69   Brassica napus [oilseed rape]
gb|EMS59907.1|  hypothetical protein TRIUR3_26958                       226   2e-69   Triticum urartu
emb|CDY52572.1|  BnaC03g71800D                                          231   2e-69   Brassica napus [oilseed rape]
ref|XP_010493043.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    231   2e-69   Camelina sativa [gold-of-pleasure]
emb|CDY43022.1|  BnaA03g11690D                                          231   2e-69   Brassica napus [oilseed rape]
ref|XP_010473399.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    231   2e-69   Camelina sativa [gold-of-pleasure]
gb|KHN19649.1|  Glucose-6-phosphate/phosphate translocator 2, chl...    227   2e-69   Glycine soja [wild soybean]
gb|AFW61083.1|  glucose-6-phosphate/phosphate translocator 2            232   2e-69   
ref|XP_003519563.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    230   2e-69   Glycine max [soybeans]
gb|AFW56904.1|  glucose-6-phosphate/phosphate translocator 2Gluco...    230   2e-69   
gb|ACV60359.1|  putative glucose-6-phosphate/phosphate translocator     230   2e-69   Camellia sinensis [black tea]
ref|XP_007147746.1|  hypothetical protein PHAVU_006G151500g             230   3e-69   Phaseolus vulgaris [French bean]
ref|NP_001105604.1|  glucose-6-phosphate/phosphate-translocator p...    230   3e-69   Zea mays [maize]
ref|XP_012070763.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    230   3e-69   
gb|ACN36392.1|  unknown                                                 230   3e-69   Zea mays [maize]
ref|XP_006594434.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    230   3e-69   Glycine max [soybeans]
ref|NP_564785.1|  glucose-6-phosphate/phosphate translocator 2          229   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003545023.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    229   4e-69   Glycine max [soybeans]
dbj|BAJ93997.1|  predicted protein                                      229   4e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007146406.1|  hypothetical protein PHAVU_006G037800g             229   4e-69   Phaseolus vulgaris [French bean]
dbj|BAB08759.1|  glucose-6-phosphate/phosphate translocator             229   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004500037.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    229   5e-69   
gb|KEH36805.1|  glucose-6-phosphate/phosphate translocator-like p...    229   5e-69   Medicago truncatula
ref|XP_009127064.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    229   5e-69   Brassica rapa
gb|AJV90962.1|  GPT2-c                                                  231   5e-69   Vitis vinifera
ref|XP_012091392.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    229   5e-69   Jatropha curcas
ref|XP_002305598.2|  hypothetical protein POPTR_0004s01930g             229   6e-69   
ref|XP_009802193.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    229   6e-69   Nicotiana sylvestris
ref|XP_010042185.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    229   6e-69   Eucalyptus grandis [rose gum]
gb|AAF86908.1|AF223360_1  glucose-6P/phosphate translocator precu...    229   6e-69   Mesembryanthemum crystallinum
ref|XP_006654288.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    229   7e-69   Oryza brachyantha
ref|XP_009617374.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    229   8e-69   Nicotiana tomentosiformis
ref|XP_010476089.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    229   9e-69   Camelina sativa [gold-of-pleasure]
gb|KHN38297.1|  Glucose-6-phosphate/phosphate translocator 1, chl...    229   9e-69   Glycine soja [wild soybean]
ref|XP_010458564.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    229   9e-69   Camelina sativa [gold-of-pleasure]
gb|KFK31943.1|  hypothetical protein AALP_AA6G180100                    228   1e-68   Arabis alpina [alpine rockcress]
gb|AAY85658.1|  plastid glucose-6-phosphate/phosphate translocato...    228   1e-68   Helianthus annuus
gb|KDO75519.1|  hypothetical protein CISIN_1g039814mg                   230   1e-68   Citrus sinensis [apfelsine]
ref|XP_006367280.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    228   1e-68   Solanum tuberosum [potatoes]
gb|KJB45583.1|  hypothetical protein B456_007G313700                    228   1e-68   Gossypium raimondii
gb|AAC08525.1|  glucose-6-phosphate/phosphate-translocator precursor    228   2e-68   Pisum sativum [garden pea]
ref|XP_006307580.1|  hypothetical protein CARUB_v10009203mg             229   2e-68   
gb|KHN11941.1|  Glucose-6-phosphate/phosphate translocator 2, chl...    226   2e-68   Glycine soja [wild soybean]
ref|XP_010317737.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    227   2e-68   Solanum lycopersicum
ref|XP_002518517.1|  Glucose-6-phosphate/phosphate translocator 2...    228   2e-68   Ricinus communis
ref|XP_009589013.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    228   2e-68   Nicotiana tomentosiformis
ref|XP_011097912.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    228   2e-68   Sesamum indicum [beniseed]
ref|XP_006417337.1|  hypothetical protein EUTSA_v10007876mg             227   3e-68   Eutrema salsugineum [saltwater cress]
dbj|BAC57673.1|  putative glucose-6-phosphate/phosphate- transloc...    227   3e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006449073.1|  hypothetical protein CICLE_v10015210mg             229   3e-68   
ref|XP_010418155.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    227   4e-68   Camelina sativa [gold-of-pleasure]
gb|EEE67296.1|  hypothetical protein OsJ_24501                          228   4e-68   Oryza sativa Japonica Group [Japonica rice]
gb|EMT13790.1|  Glucose-6-phosphate/phosphate translocator 2, chl...    226   5e-68   
ref|XP_003599946.1|  Glucose-6-phosphate/phosphate-translocator         227   5e-68   Medicago truncatula
ref|XP_010430199.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    226   7e-68   Camelina sativa [gold-of-pleasure]
gb|KHN37588.1|  Glucose-6-phosphate/phosphate translocator 2, chl...    225   8e-68   Glycine soja [wild soybean]
ref|XP_006343413.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    226   9e-68   Solanum tuberosum [potatoes]
gb|AAK68814.1|  Similar to glucose-6-phosphate/phosphate-transloc...    226   9e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004500035.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    226   1e-67   
emb|CDY19859.1|  BnaC09g31250D                                          226   1e-67   Brassica napus [oilseed rape]
emb|CDY17274.1|  BnaA10g09080D                                          226   2e-67   Brassica napus [oilseed rape]
ref|XP_002889879.1|  predicted protein                                  225   2e-67   
emb|CDY34641.1|  BnaC08g42000D                                          224   2e-67   Brassica napus [oilseed rape]
gb|KHN33046.1|  Glucose-6-phosphate/phosphate translocator 2, chl...    225   2e-67   Glycine soja [wild soybean]
gb|AAC28500.1|  Similar to glucose-6-phosphate/phosphate-transloc...    225   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417336.1|  hypothetical protein EUTSA_v10007876mg             224   5e-67   Eutrema salsugineum [saltwater cress]
ref|XP_009794811.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    216   7e-67   Nicotiana sylvestris
ref|XP_004957888.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    224   7e-67   
gb|EEC82168.1|  hypothetical protein OsI_26255                          223   9e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_002462940.1|  hypothetical protein SORBIDRAFT_02g034980          223   1e-66   
ref|XP_004152937.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    223   1e-66   Cucumis sativus [cucumbers]
gb|KHG27528.1|  Glucose-6-phosphate/phosphate translocator 1, chl...    223   1e-66   Gossypium arboreum [tree cotton]
emb|CDY06630.1|  BnaC02g13540D                                          224   2e-66   
gb|AIR93780.1|  glucose 6-phosphate phosphate translocator              223   2e-66   Kalanchoe fedtschenkoi [lavender-scallops]
gb|EYU24788.1|  hypothetical protein MIMGU_mgv1a007856mg                223   2e-66   Erythranthe guttata [common monkey flower]
emb|CDY28750.1|  BnaA02g09420D                                          224   2e-66   Brassica napus [oilseed rape]
gb|EEC82167.1|  hypothetical protein OsI_26253                          222   3e-66   Oryza sativa Indica Group [Indian rice]
emb|CAN68645.1|  hypothetical protein VITISV_030812                     222   4e-66   Vitis vinifera
ref|XP_010229653.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    225   4e-66   
ref|XP_008667831.1|  PREDICTED: uncharacterized protein LOC100279...    222   4e-66   Zea mays [maize]
gb|AIR93781.1|  glucose 6-phosphate phosphate translocator              221   7e-66   Kalanchoe fedtschenkoi [lavender-scallops]
gb|KHN03459.1|  Glucose-6-phosphate/phosphate translocator 2, chl...    225   8e-66   Glycine soja [wild soybean]
gb|EPS63359.1|  hypothetical protein M569_11424                         219   8e-66   Genlisea aurea
ref|XP_009408271.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    221   9e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABJ98060.1|  glucose 6-Pi/Pi transporter                             220   2e-65   Eutrema halophilum
ref|NP_001147439.1|  glucose-6-phosphate/phosphate translocator 2       220   2e-65   
ref|XP_009765173.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    226   2e-65   Nicotiana sylvestris
gb|EMS53161.1|  Glucose-6-phosphate/phosphate translocator 1, chl...    221   2e-65   Triticum urartu
gb|ABK91085.1|  putative glucose-6-phosphate translocator               219   3e-65   Sorghum bicolor [broomcorn]
tpg|DAA62951.1|  TPA: glucose-6-phosphate/phosphate translocator 2      219   3e-65   
ref|XP_004957889.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    220   3e-65   
ref|XP_008463436.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    219   3e-65   Cucumis melo [Oriental melon]
ref|XP_003547247.2|  PREDICTED: beta-glucosidase 47-like                228   5e-65   Glycine max [soybeans]
ref|XP_009412013.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    219   6e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB45582.1|  hypothetical protein B456_007G313700                    219   6e-65   Gossypium raimondii
ref|XP_002523008.1|  Glucose-6-phosphate/phosphate translocator 1...    219   7e-65   Ricinus communis
ref|XP_006493943.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    218   9e-65   Citrus sinensis [apfelsine]
ref|XP_007153924.1|  hypothetical protein PHAVU_003G076600g             218   1e-64   Phaseolus vulgaris [French bean]
gb|EMT25193.1|  Glucose-6-phosphate/phosphate translocator 1, chl...    222   2e-64   
dbj|BAD91175.1|  plastidic glucose 6-phoaphate/phosphate transloc...    217   3e-64   Mesembryanthemum crystallinum
ref|XP_009417236.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    217   4e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010930664.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    216   5e-64   Elaeis guineensis
ref|XP_006600314.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    216   6e-64   Glycine max [soybeans]
ref|XP_009378791.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    216   1e-63   Pyrus x bretschneideri [bai li]
ref|XP_008385998.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    216   1e-63   
ref|XP_006452222.1|  hypothetical protein CICLE_v10008564mg             215   1e-63   Citrus clementina [clementine]
ref|XP_008454525.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    215   1e-63   
ref|XP_008778019.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    216   1e-63   Phoenix dactylifera
ref|XP_011628432.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    215   1e-63   Amborella trichopoda
ref|XP_011660235.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    215   1e-63   Cucumis sativus [cucumbers]
gb|ABK91084.1|  putative glucose-6-phosphate translocator               215   2e-63   Sorghum bicolor [broomcorn]
gb|KDO50252.1|  hypothetical protein CISIN_1g0163481mg                  207   2e-63   Citrus sinensis [apfelsine]
gb|KJB62603.1|  hypothetical protein B456_009G425600                    214   2e-63   Gossypium raimondii
gb|KHG14046.1|  Glucose-6-phosphate/phosphate translocator 1, chl...    214   3e-63   Gossypium arboreum [tree cotton]
ref|XP_009357419.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    214   5e-63   Pyrus x bretschneideri [bai li]
gb|ABK24716.1|  unknown                                                 214   7e-63   Picea sitchensis
ref|XP_008384045.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    213   1e-62   
ref|XP_008439971.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    213   1e-62   Cucumis melo [Oriental melon]
ref|XP_010538047.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    213   1e-62   Tarenaya hassleriana [spider flower]
gb|ABO87607.1|  chloroplast glucose-6-phosphate/phosphate translo...    212   2e-62   Pisum sativum [garden pea]
ref|XP_008224795.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    212   2e-62   Prunus mume [ume]
ref|XP_007211968.1|  hypothetical protein PRUPE_ppa006608mg             212   3e-62   
ref|XP_008812143.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    213   3e-62   Phoenix dactylifera
ref|XP_009340951.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    211   5e-62   Pyrus x bretschneideri [bai li]
ref|XP_009397167.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    211   5e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|ERN19519.1|  hypothetical protein AMTR_s00062p00036220               211   6e-62   Amborella trichopoda
ref|XP_004240145.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    211   6e-62   Solanum lycopersicum
ref|XP_006657775.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    209   7e-62   Oryza brachyantha
gb|KJB62604.1|  hypothetical protein B456_009G425600                    211   8e-62   Gossypium raimondii
ref|XP_008384044.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    211   1e-61   
ref|XP_002960055.1|  hypothetical protein SELMODRAFT_70870              208   1e-61   
gb|AAC08526.1|  glucose-6-phosphate/phosphate-translocator precursor    210   1e-61   Solanum tuberosum [potatoes]
ref|XP_006356920.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    210   1e-61   Solanum tuberosum [potatoes]
ref|XP_009619233.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    210   1e-61   Nicotiana tomentosiformis
ref|XP_004293269.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    210   2e-61   Fragaria vesca subsp. vesca
ref|XP_002984083.1|  hypothetical protein SELMODRAFT_45116              207   4e-61   
ref|XP_010545200.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    206   4e-60   Tarenaya hassleriana [spider flower]
ref|XP_004134753.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    206   5e-60   Cucumis sativus [cucumbers]
ref|XP_002960052.1|  hypothetical protein SELMODRAFT_270155             206   6e-60   Selaginella moellendorffii
ref|XP_002984086.1|  hypothetical protein SELMODRAFT_156336             206   6e-60   Selaginella moellendorffii
ref|XP_001764779.1|  predicted protein                                  203   7e-60   
ref|XP_001775355.1|  predicted protein                                  202   3e-59   
gb|AAT08746.1|  glucose-6-phosphate/phosphate-translocator              189   6e-57   Hyacinthus orientalis [common hyacinth]
ref|XP_001778585.1|  predicted protein                                  196   7e-57   
ref|XP_001755644.1|  predicted protein                                  194   2e-56   
gb|ACJ84767.1|  unknown                                                 183   1e-54   Medicago truncatula
ref|XP_002965611.1|  hypothetical protein SELMODRAFT_83926              192   2e-54   
ref|XP_002962396.1|  hypothetical protein SELMODRAFT_79231              191   4e-54   
gb|KJB67151.1|  hypothetical protein B456_010G178300                    186   1e-52   Gossypium raimondii
dbj|BAD94591.1|  Similar to glucose-6-phosphate/phosphate-translo...    174   3e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KHN03064.1|  Glucose-6-phosphate/phosphate translocator 1, chl...    179   5e-51   Glycine soja [wild soybean]
ref|XP_006391960.1|  hypothetical protein EUTSA_v10023518mg             181   6e-51   
ref|XP_010475728.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    178   2e-49   Camelina sativa [gold-of-pleasure]
gb|AES92596.2|  glucose 6-phosphate/phosphate translocator 1            177   1e-46   Medicago truncatula
ref|XP_003610399.1|  Glucose-6-phosphate/phosphate translocator         174   3e-45   
gb|AEW08100.1|  hypothetical protein 0_18849_01                         160   4e-45   Pinus lambertiana
gb|AFG51543.1|  hypothetical protein 0_18849_01                         160   7e-45   Pinus taeda
gb|AEW08101.1|  hypothetical protein 0_18849_01                         159   2e-44   Pinus radiata
gb|AFG51542.1|  hypothetical protein 0_18849_01                         159   2e-44   Pinus taeda
ref|XP_001751511.1|  predicted protein                                  160   4e-43   
gb|AEQ94115.1|  putative Glu-6-Phosphate translocator                   150   3e-41   Elaeis guineensis
emb|CDY16905.1|  BnaC09g40320D                                          156   4e-41   Brassica napus [oilseed rape]
gb|KHN26298.1|  Glucose-6-phosphate/phosphate translocator 2, chl...    152   5e-41   Glycine soja [wild soybean]
gb|AAK50101.1|AF372964_1  AT5g17630/K10A8_110                           156   8e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197265.1|  nucleotide/sugar transporter family protein           156   8e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25984.1|  hypothetical protein AALP_AA8G188000                    155   9e-41   Arabis alpina [alpine rockcress]
emb|CDY38448.1|  BnaA10g17100D                                          155   9e-41   Brassica napus [oilseed rape]
ref|XP_009107536.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    155   1e-40   Brassica rapa
ref|XP_010453962.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    155   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_002871776.1|  hypothetical protein ARALYDRAFT_909761             155   2e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_010492724.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    154   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010420492.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    154   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006289865.1|  hypothetical protein CARUB_v10003476mg             153   6e-40   Capsella rubella
gb|AAG48163.1|AF209211_1  phosphate/pentose phosphate translocator      153   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006354560.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    152   2e-39   Solanum tuberosum [potatoes]
ref|XP_006400306.1|  hypothetical protein EUTSA_v10015991mg             152   2e-39   Eutrema salsugineum [saltwater cress]
ref|XP_004229531.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    150   8e-39   Solanum lycopersicum
gb|AFK38587.1|  unknown                                                 144   1e-38   Lotus japonicus
ref|XP_012070308.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    150   1e-38   Jatropha curcas
ref|XP_009630413.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    150   2e-38   
gb|ABK91089.1|  putative glucose-6-phosphate translocator               146   5e-38   Sorghum bicolor [broomcorn]
ref|XP_004133935.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    147   2e-37   Cucumis sativus [cucumbers]
ref|XP_004307178.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    147   2e-37   Fragaria vesca subsp. vesca
ref|XP_010097682.1|  Xylulose 5-phosphate/phosphate translocator        146   3e-37   Morus notabilis
ref|XP_006854238.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    145   4e-37   
ref|XP_010942965.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    146   4e-37   Elaeis guineensis
ref|XP_007029845.1|  Nucleotide/sugar transporter family protein        145   5e-37   
gb|AAC28223.1|  similar to chloroplast triose phosphate transloca...    142   6e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192304.2|  Nucleotide/sugar transporter family protein           142   6e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KJB80747.1|  hypothetical protein B456_013G113700                    145   6e-37   
ref|XP_008232176.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    146   6e-37   
ref|XP_010549739.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    145   8e-37   
ref|XP_008232162.1|  PREDICTED: LOW QUALITY PROTEIN: xylulose 5-p...    144   1e-36   
ref|XP_009759570.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    145   1e-36   
ref|XP_002523987.1|  Glucose-6-phosphate/phosphate translocator 1...    145   1e-36   
ref|XP_009348960.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    143   2e-36   
ref|XP_011029327.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    144   2e-36   
ref|XP_010056521.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    144   2e-36   
ref|XP_011004949.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    144   2e-36   
ref|XP_004486439.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    144   2e-36   
ref|XP_007219467.1|  hypothetical protein PRUPE_ppa021368mg             144   2e-36   
ref|XP_002523986.1|  Glucose-6-phosphate/phosphate translocator 2...    144   3e-36   
ref|XP_008808381.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    144   3e-36   
ref|XP_011093419.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    143   3e-36   
gb|EPS71045.1|  hypothetical protein M569_03710                         143   3e-36   
gb|KCW73293.1|  hypothetical protein EUGRSUZ_E01754                     144   4e-36   
ref|XP_010244200.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    144   4e-36   
ref|XP_009341641.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    143   5e-36   
ref|XP_002264736.2|  PREDICTED: xylulose 5-phosphate/phosphate tr...    143   5e-36   
ref|XP_004497714.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    143   5e-36   
ref|XP_002319749.2|  hypothetical protein POPTR_0013s06910g             142   9e-36   
ref|XP_009335044.1|  PREDICTED: LOW QUALITY PROTEIN: xylulose 5-p...    143   1e-35   
gb|ABO87612.1|  chloroplast pentose phosphate transporter               140   1e-35   
gb|KHN13446.1|  Xylulose 5-phosphate/phosphate translocator, chlo...    142   1e-35   
ref|XP_003537155.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    142   1e-35   
ref|XP_009402961.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    142   2e-35   
ref|XP_008347069.1|  PREDICTED: LOW QUALITY PROTEIN: xylulose 5-p...    141   3e-35   
ref|XP_008356880.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    141   3e-35   
ref|XP_006484740.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    140   3e-35   
emb|CDP11321.1|  unnamed protein product                                140   4e-35   
ref|XP_008438208.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    140   4e-35   
ref|XP_003545984.2|  PREDICTED: xylulose 5-phosphate/phosphate tr...    140   4e-35   
ref|XP_010691923.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    140   5e-35   
ref|XP_006437350.1|  hypothetical protein CICLE_v10031652mg             140   5e-35   
gb|EYU42271.1|  hypothetical protein MIMGU_mgv1a007241mg                139   1e-34   
ref|XP_003594481.1|  Glucose 6 phosphate/phosphate translocator-l...    137   5e-34   
gb|KHN45092.1|  Xylulose 5-phosphate/phosphate translocator, chlo...    137   5e-34   
ref|XP_007148882.1|  hypothetical protein PHAVU_005G022300g             137   5e-34   
ref|XP_001416614.1|  DMT family transporter: glucose-6-phosphate/...    130   5e-32   
gb|EPS59356.1|  hypothetical protein M569_15451                         123   8e-32   
ref|XP_003078079.1|  Glucose-6-phosphate/phosphate and phosphoeno...    128   8e-31   
gb|ABO87604.1|  chloroplast pentose phosphate translocator              124   2e-29   
ref|XP_006449070.1|  hypothetical protein CICLE_v10015210mg             120   4e-28   
ref|XP_010041822.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    119   5e-28   
ref|XP_007509749.1|  predicted protein                                  120   5e-28   
ref|XP_006377841.1|  hypothetical protein POPTR_0011s13920g             119   1e-27   
ref|NP_001146331.1|  uncharacterized protein LOC100279907               119   1e-27   
ref|XP_008802981.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    117   8e-27   
gb|ACN40020.1|  unknown                                                 114   4e-26   
gb|EPS72032.1|  glucose-6-phosphate/phosphate translocator 1, chl...    114   4e-26   
gb|EPS58406.1|  hypothetical protein M569_16407                         112   2e-25   
gb|KCW75358.1|  hypothetical protein EUGRSUZ_E04104                     109   2e-24   
ref|XP_010933043.1|  PREDICTED: xylulose 5-phosphate/phosphate tr...    110   3e-24   
ref|XP_011401996.1|  Xylulose 5-phosphate/phosphate translocator,...    107   5e-24   
ref|XP_005707012.1|  sugar-phosphate:phosphate translocator, DMT ...    107   3e-23   
gb|EAZ04103.1|  hypothetical protein OsI_26247                          102   4e-23   
ref|XP_010066847.1|  PREDICTED: triose phosphate/phosphate transl...    105   9e-23   
ref|XP_005704181.1|  sugar-phosphate:phosphate translocator, DMT ...    105   1e-22   
gb|KHN15492.1|  Triose phosphate/phosphate translocator, chloropl...    100   5e-22   
gb|AAX47107.1|  putative plastid triose phophate translocator           102   6e-22   
ref|XP_002960623.1|  hypothetical protein SELMODRAFT_73397              102   1e-21   
ref|XP_008361876.1|  PREDICTED: triose phosphate/phosphate transl...    101   1e-21   
ref|XP_004505096.1|  PREDICTED: triose phosphate/phosphate transl...    102   1e-21   
ref|XP_009128844.1|  PREDICTED: triose phosphate/phosphate transl...    101   2e-21   
ref|NP_001055001.1|  Os05g0241200                                       101   2e-21   
emb|CDY53419.1|  BnaC02g47130D                                          103   2e-21   
ref|XP_002983417.1|  hypothetical protein SELMODRAFT_180174             101   2e-21   
ref|XP_004505095.1|  PREDICTED: triose phosphate/phosphate transl...    101   2e-21   
ref|XP_009128843.1|  PREDICTED: triose phosphate/phosphate transl...    101   2e-21   
gb|KEH30984.1|  triose phosphate/phosphate translocator                 100   3e-21   
ref|XP_004228846.1|  PREDICTED: triose phosphate/phosphate transl...    101   3e-21   
gb|EMS59463.1|  Triose phosphate/phosphate translocator TPT, chlo...    101   3e-21   
ref|XP_008339817.1|  PREDICTED: triose phosphate/phosphate transl...    101   3e-21   
ref|XP_006852582.1|  PREDICTED: triose phosphate/phosphate transl...    100   3e-21   
gb|KHN09965.1|  Triose phosphate/phosphate translocator, chloropl...    100   4e-21   
ref|XP_006655130.1|  PREDICTED: triose phosphate/phosphate transl...    100   4e-21   
gb|EYU22374.1|  hypothetical protein MIMGU_mgv1a006886mg                100   4e-21   
ref|XP_006365139.1|  PREDICTED: triose phosphate/phosphate transl...    100   4e-21   
emb|CDY48790.1|  BnaA02g24310D                                          100   5e-21   
ref|XP_003568711.1|  PREDICTED: triose phosphate/phosphate transl...    100   5e-21   
ref|XP_009101544.1|  PREDICTED: triose phosphate/phosphate transl...  99.8    6e-21   
gb|KFK31493.1|  hypothetical protein AALP_AA6G119600                    100   6e-21   
ref|XP_002454867.1|  hypothetical protein SORBIDRAFT_03g000370          100   7e-21   
ref|XP_009614892.1|  PREDICTED: triose phosphate/phosphate transl...    100   7e-21   
emb|CAA52979.1|  phosphate translocator                                 100   7e-21   
ref|NP_001141460.1|  triose phosphate/phosphate translocator            100   7e-21   
gb|ACG32515.1|  triose phosphate/phosphate translocator                 100   7e-21   
ref|XP_009800275.1|  PREDICTED: triose phosphate/phosphate transl...    100   7e-21   
ref|XP_006398292.1|  hypothetical protein EUTSA_v10000901mg           99.4    8e-21   
emb|CDX77632.1|  BnaC07g18860D                                          100   8e-21   
sp|P52177.1|TPT1_BRAOB  RecName: Full=Triose phosphate/phosphate ...  99.8    8e-21   
gb|KEH30983.1|  triose phosphate/phosphate translocator               99.8    9e-21   
ref|XP_008383694.1|  PREDICTED: triose phosphate/phosphate transl...  99.4    9e-21   
ref|XP_009101543.1|  PREDICTED: triose phosphate/phosphate transl...  99.8    9e-21   
gb|AAD55058.1|  phophate translocator                                 98.6    1e-20   
gb|AES97013.2|  triose phosphate/phosphate translocator               99.8    1e-20   
dbj|BAJ94007.1|  predicted protein                                    99.8    1e-20   
emb|CDY33455.1|  BnaA06g36180D                                        99.4    1e-20   
ref|XP_009765626.1|  PREDICTED: triose phosphate/phosphate transl...  99.4    1e-20   
ref|XP_003614055.1|  Triose phosphate/phosphate translocator          99.8    1e-20   
ref|XP_008383693.1|  PREDICTED: triose phosphate/phosphate transl...  99.4    1e-20   
ref|XP_008225152.1|  PREDICTED: triose phosphate/phosphate transl...  99.4    1e-20   
ref|XP_007211963.1|  hypothetical protein PRUPE_ppa006549mg           99.0    2e-20   
ref|XP_004135437.2|  PREDICTED: triose phosphate/phosphate transl...  99.4    2e-20   
ref|XP_006398293.1|  hypothetical protein EUTSA_v10000901mg           99.0    2e-20   
ref|XP_010518864.1|  PREDICTED: triose phosphate/phosphate transl...  98.6    2e-20   
ref|XP_004297247.1|  PREDICTED: triose phosphate/phosphate transl...  99.0    2e-20   
ref|XP_009344156.1|  PREDICTED: triose phosphate/phosphate transl...  99.0    2e-20   
ref|XP_007222431.1|  hypothetical protein PRUPE_ppa006089mg           99.0    2e-20   
sp|P11869.1|TPT_SPIOL  RecName: Full=Triose phosphate/phosphate t...  99.0    2e-20   
ref|NP_001078720.1|  triose phosphate/phosphate translocator TPT      99.0    2e-20   
ref|XP_007159368.1|  hypothetical protein PHAVU_002G232300g           99.0    2e-20   
ref|XP_006643976.1|  PREDICTED: triose phosphate/phosphate transl...  98.2    2e-20   
ref|XP_002512091.1|  Triose phosphate/phosphate translocator, chl...  99.0    2e-20   
ref|XP_003542721.1|  PREDICTED: triose phosphate/phosphate transl...  98.6    2e-20   
ref|XP_008221496.1|  PREDICTED: triose phosphate/phosphate transl...  99.0    2e-20   
ref|XP_011027773.1|  PREDICTED: triose phosphate/phosphate transl...  97.8    2e-20   
gb|EYU43371.1|  hypothetical protein MIMGU_mgv1a007280mg              98.6    2e-20   
ref|XP_009601375.1|  PREDICTED: triose phosphate/phosphate transl...  98.6    2e-20   
ref|XP_011086038.1|  PREDICTED: triose phosphate/phosphate transl...  97.8    2e-20   
gb|KCW74526.1|  hypothetical protein EUGRSUZ_E03242                   97.8    3e-20   
sp|P49131.1|TPT_FLAPR  RecName: Full=Triose phosphate/phosphate t...  98.6    3e-20   
ref|XP_006837125.1|  PREDICTED: triose phosphate/phosphate transl...  98.6    3e-20   
ref|XP_005843473.1|  hypothetical protein CHLNCDRAFT_28101            97.8    3e-20   
ref|XP_009352853.1|  PREDICTED: triose phosphate/phosphate transl...  98.2    3e-20   
ref|XP_011018499.1|  PREDICTED: triose phosphate/phosphate transl...  98.6    3e-20   
ref|XP_010686401.1|  PREDICTED: triose phosphate/phosphate transl...  98.2    3e-20   
ref|XP_011658226.1|  PREDICTED: triose phosphate/phosphate transl...  97.4    3e-20   
ref|XP_004960676.1|  PREDICTED: triose phosphate/phosphate transl...  98.2    3e-20   
ref|NP_568655.2|  triose phosphate/phosphate translocator TPT         97.4    3e-20   
ref|XP_010529169.1|  PREDICTED: triose phosphate/phosphate transl...  98.2    3e-20   
gb|KJB60802.1|  hypothetical protein B456_009G326400                  97.4    3e-20   
ref|XP_002278829.1|  PREDICTED: triose phosphate/phosphate transl...  98.2    4e-20   
ref|XP_008221497.1|  PREDICTED: triose phosphate/phosphate transl...  98.2    4e-20   
ref|XP_011621106.1|  PREDICTED: triose phosphate/phosphate transl...  98.2    4e-20   
ref|XP_011070946.1|  PREDICTED: triose phosphate/phosphate transl...  98.2    4e-20   
emb|CAN65381.1|  hypothetical protein VITISV_028555                   98.2    4e-20   
ref|XP_012068349.1|  PREDICTED: triose phosphate/phosphate transl...  98.2    4e-20   
sp|P21727.1|TPT_PEA  RecName: Full=Triose phosphate/phosphate tra...  97.8    5e-20   
gb|EEC70273.1|  hypothetical protein OsI_01091                        97.4    5e-20   
ref|XP_011027772.1|  PREDICTED: triose phosphate/phosphate transl...  97.8    5e-20   
ref|XP_009352852.1|  PREDICTED: triose phosphate/phosphate transl...  97.8    5e-20   
gb|EEE54205.1|  hypothetical protein OsJ_01049                        97.4    5e-20   
ref|XP_008439808.1|  PREDICTED: triose phosphate/phosphate transl...  97.8    5e-20   
gb|EYU43370.1|  hypothetical protein MIMGU_mgv1a007280mg              97.8    5e-20   
gb|KJB34875.1|  hypothetical protein B456_006G088300                  97.8    5e-20   
ref|XP_011460580.1|  PREDICTED: triose phosphate/phosphate transl...  96.7    5e-20   
ref|XP_011001227.1|  PREDICTED: triose phosphate/phosphate transl...  96.7    6e-20   
ref|XP_009390726.1|  PREDICTED: triose phosphate/phosphate transl...  97.4    6e-20   
ref|XP_006280560.1|  hypothetical protein CARUB_v10026500mg           97.4    6e-20   
ref|NP_001042544.1|  Os01g0239200                                     97.4    6e-20   
ref|XP_008439809.1|  PREDICTED: triose phosphate/phosphate transl...  97.4    6e-20   
ref|XP_004490170.1|  PREDICTED: triose phosphate/phosphate transl...  97.4    6e-20   
ref|XP_011070947.1|  PREDICTED: triose phosphate/phosphate transl...  97.4    6e-20   
ref|XP_008371418.1|  PREDICTED: triose phosphate/phosphate transl...  97.4    6e-20   
ref|XP_008783133.1|  PREDICTED: triose phosphate/phosphate transl...  96.3    7e-20   
gb|AAM65042.1|  phosphate/triose-phosphate translocator precursor     97.4    7e-20   
ref|NP_851138.1|  triose phosphate/phosphate translocator TPT         97.4    7e-20   
ref|NP_001183033.1|  uncharacterized protein LOC100501361             96.3    8e-20   
ref|XP_002865205.1|  phosphate/triose-phosphate translocator prec...  97.1    8e-20   
dbj|BAB08256.1|  phosphate/triose-phosphate translocator precursor    97.4    8e-20   
ref|XP_004134684.1|  PREDICTED: triose phosphate/phosphate transl...  97.1    8e-20   
gb|KJB34873.1|  hypothetical protein B456_006G088300                  96.3    8e-20   
ref|XP_011086037.1|  PREDICTED: triose phosphate/phosphate transl...  97.1    8e-20   
ref|XP_010441627.1|  PREDICTED: triose phosphate/phosphate transl...  97.1    8e-20   
ref|XP_010916021.1|  PREDICTED: triose phosphate/phosphate transl...  97.1    8e-20   
ref|XP_010481497.1|  PREDICTED: triose phosphate/phosphate transl...  97.1    8e-20   
gb|KJB60800.1|  hypothetical protein B456_009G326400                  97.4    9e-20   
ref|XP_001701487.1|  sugar phosphate/phosphate translocator-like ...  96.7    9e-20   
ref|XP_011001226.1|  PREDICTED: triose phosphate/phosphate transl...  97.1    9e-20   
ref|XP_010057365.1|  PREDICTED: triose phosphate/phosphate transl...  97.1    1e-19   
ref|XP_010494776.1|  PREDICTED: triose phosphate/phosphate transl...  97.1    1e-19   
gb|EYU28857.1|  hypothetical protein MIMGU_mgv1a021623mg              96.7    1e-19   
sp|P49132.1|TPT_FLATR  RecName: Full=Triose phosphate/phosphate t...  96.7    1e-19   
ref|XP_001785212.1|  predicted protein                                95.9    1e-19   
gb|KDO39387.1|  hypothetical protein CISIN_1g0131321mg                95.9    1e-19   
ref|XP_002509428.1|  Triose phosphate/phosphate translocator, chl...  96.7    1e-19   
ref|XP_008446431.1|  PREDICTED: triose phosphate/phosphate transl...  96.7    1e-19   
ref|XP_002439498.1|  hypothetical protein SORBIDRAFT_09g008130        96.7    1e-19   
gb|ACF87930.1|  unknown                                               95.5    1e-19   
ref|XP_010260333.1|  PREDICTED: triose phosphate/phosphate transl...  96.7    1e-19   
ref|XP_006377411.1|  chloroplast import receptor p36 family protein   96.7    1e-19   
ref|XP_010091566.1|  Triose phosphate/phosphate translocator TPT      96.7    1e-19   
gb|KJB34872.1|  hypothetical protein B456_006G088300                  96.3    1e-19   
gb|AAF86906.1|AF223358_1  triose phosphate/phosphate translocator...  96.3    1e-19   
ref|XP_010904919.1|  PREDICTED: triose phosphate/phosphate transl...  96.3    2e-19   
gb|KDO77700.1|  hypothetical protein CISIN_1g013023mg                 94.7    2e-19   
ref|XP_007045891.1|  Glucose-6-phosphate/phosphate translocator-r...  96.7    2e-19   
ref|XP_002267940.1|  PREDICTED: triose phosphate/phosphate transl...  96.3    2e-19   
ref|NP_001274825.1|  triose phosphate/phosphate translocator, chl...  96.3    2e-19   
gb|EMT28314.1|  hypothetical protein F775_26129                       95.1    2e-19   
ref|XP_006437946.1|  hypothetical protein CICLE_v10033753mg           96.3    2e-19   
ref|XP_008783132.1|  PREDICTED: triose phosphate/phosphate transl...  96.3    2e-19   
gb|ABK24702.1|  unknown                                               96.7    2e-19   
gb|ACF79865.1|  unknown                                               92.4    2e-19   
ref|XP_004293808.1|  PREDICTED: triose phosphate/phosphate transl...  95.9    2e-19   
ref|XP_006484188.1|  PREDICTED: triose phosphate/phosphate transl...  96.3    2e-19   
dbj|BAJ84938.1|  predicted protein                                    94.7    2e-19   
ref|XP_004967338.1|  PREDICTED: triose phosphate/phosphate transl...  95.9    2e-19   
gb|EPS63696.1|  hypothetical protein M569_11087                       94.4    2e-19   
ref|XP_001785209.1|  predicted protein                                96.3    2e-19   
emb|CDO99491.1|  unnamed protein product                              95.9    2e-19   
ref|XP_006660067.1|  PREDICTED: phosphoenolpyruvate/phosphate tra...  95.1    2e-19   
ref|XP_002305112.1|  chloroplast import receptor p36 family protein   95.9    2e-19   
ref|XP_002959029.1|  hypothetical protein VOLCADRAFT_70261            94.7    2e-19   
ref|XP_009421474.1|  PREDICTED: triose phosphate/phosphate transl...  95.9    2e-19   
ref|XP_008655365.1|  PREDICTED: uncharacterized protein LOC100501...  95.5    3e-19   
ref|XP_010259537.1|  PREDICTED: triose phosphate/phosphate transl...  95.9    3e-19   
ref|XP_010111175.1|  hypothetical protein L484_015058                 95.5    3e-19   
ref|XP_004248118.1|  PREDICTED: triose phosphate/phosphate transl...  95.5    3e-19   
ref|XP_010259531.1|  PREDICTED: triose phosphate/phosphate transl...  95.9    3e-19   
gb|KDD73011.1|  triose-phosphate transporter                          94.7    3e-19   
ref|XP_002311336.2|  hypothetical protein POPTR_0008s09470g           95.5    3e-19   
ref|XP_006449409.1|  hypothetical protein CICLE_v10015416mg           94.4    4e-19   
ref|NP_001105497.1|  triose phosphate/phosphate translocator, chl...  95.1    4e-19   
gb|KHG24956.1|  Triose phosphate/phosphate translocator, chloropl...  95.1    4e-19   
ref|XP_006467728.1|  PREDICTED: triose phosphate/phosphate transl...  94.4    4e-19   
ref|XP_002503997.1|  Drug/Metabolite transporter superfamily          94.4    4e-19   
ref|XP_005713953.1|  similar to glucose-6-phosphate/phosphate-tra...  95.1    4e-19   
ref|XP_002952945.1|  hypothetical protein VOLCADRAFT_109189           94.4    4e-19   



>gb|AIC33040.1| glucose-6-phosphate/phosphate translocator 1, partial [Panax 
ginseng]
Length=168

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  16   FNMIGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  75

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW +G++ A+SQIGPN IWW++AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  76   MWALGWKTAISQIGPNFIWWVVAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  135

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAK
Sbjct  136  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAK  167



>ref|XP_006368049.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Solanum tuberosum]
Length=161

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/149 (93%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = -3

Query  759  IGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQMWT  580
            +GF GAMISN+AFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQMW 
Sbjct  12   LGFSGAMISNVAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQMWA  71

Query  579  VGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvivssi  400
            +GFEKA+SQIGP I+WWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIVSSI
Sbjct  72   LGFEKAVSQIGPQIVWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIVSSI  131

Query  399  iIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            IIFRTPVQPVNALGAAIAILGTFLYSQAK
Sbjct  132  IIFRTPVQPVNALGAAIAILGTFLYSQAK  160



>ref|XP_011095359.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Sesamum indicum]
Length=391

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKG +VSGMNYYACLSMLSL+ILTPFA AVEGPQ
Sbjct  239  FNMTGFMGAMISNLAFVFRNIFSKKGMKGNAVSGMNYYACLSMLSLLILTPFAFAVEGPQ  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW VGF +ALSQIGP IIWWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  299  MWAVGFREALSQIGPQIIWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF+TPVQPVNALGAAIAILGTFLYSQAK
Sbjct  359  SSIIIFQTPVQPVNALGAAIAILGTFLYSQAK  390



>ref|XP_006366041.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Solanum tuberosum]
Length=396

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN IGF GAMISN+AFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  244  FNWIGFSGAMISNVAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  303

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW +GFEKA+SQIGP I+WWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  304  MWALGFEKAVSQIGPQIVWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  363

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAK
Sbjct  364  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAK  395



>ref|XP_004244144.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Solanum lycopersicum]
Length=396

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN IGF GAMISN+AFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  244  FNWIGFSGAMISNVAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  303

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW +GFEKA+SQIGP I+WWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  304  MWALGFEKAVSQIGPQIVWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  363

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAK
Sbjct  364  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAK  395



>ref|XP_004294354.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=391

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/153 (92%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS++SLVILTPFAIAVEGP+
Sbjct  239  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSIMSLVILTPFAIAVEGPK  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  GFE A++QIGPN+IWWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  299  MWAAGFETAMAQIGPNLIWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIF TPVQPVNALGAAIAI GTFLYSQAKL
Sbjct  359  SSIIIFHTPVQPVNALGAAIAIFGTFLYSQAKL  391



>ref|XP_009785267.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=398

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN IGF GAMISN+AFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  246  FNWIGFSGAMISNVAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  305

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW +GFEKA+SQIGP I+WWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  306  MWALGFEKAVSQIGPQIVWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  365

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAK
Sbjct  366  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAK  397



>ref|XP_009601121.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=398

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN IGF GAMISN+AFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  246  FNWIGFSGAMISNVAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  305

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW +GFEKA+SQIGP I+WWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  306  MWALGFEKAVSQIGPQIVWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  365

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAK
Sbjct  366  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAK  397



>ref|XP_008226825.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Prunus mume]
Length=395

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGP 
Sbjct  243  FNMIGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSMLSLIILTPFAIAVEGPA  302

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  GFE A+SQIGPN+IWWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  303  MWKAGFETAISQIGPNLIWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  362

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAI GTFLYSQ+K
Sbjct  363  SSIIIFHTPVQPVNALGAAIAIFGTFLYSQSK  394



>gb|EYU33618.1| hypothetical protein MIMGU_mgv1a0131841mg, partial [Erythranthe 
guttata]
Length=224

 Score =   234 bits (597),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS++SL++LTPFAIAVEGPQ
Sbjct  72   FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSIMSLLLLTPFAIAVEGPQ  131

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+++A+S IGP I+WWM AQSVFYHLYNQVSYMSLDEISPLTFS+GNTMKR+SVIV
Sbjct  132  MWAAGYKEAMSLIGPQIVWWMAAQSVFYHLYNQVSYMSLDEISPLTFSVGNTMKRVSVIV  191

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQPVNALGAAIA+LGTFLYSQAK
Sbjct  192  SSIIIFRTPVQPVNALGAAIAVLGTFLYSQAK  223



>ref|XP_007213874.1| hypothetical protein PRUPE_ppa006795mg [Prunus persica]
 gb|EMJ15073.1| hypothetical protein PRUPE_ppa006795mg [Prunus persica]
Length=395

 Score =   239 bits (610),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGP 
Sbjct  243  FNMIGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSMLSLIILTPFAIAVEGPA  302

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  GFE A SQIGPN+IWWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  303  MWKAGFETAFSQIGPNLIWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  362

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAI GTFLYSQ+K
Sbjct  363  SSIIIFHTPVQPVNALGAAIAIFGTFLYSQSK  394



>ref|XP_006401535.1| hypothetical protein EUTSA_v10013772mg [Eutrema salsugineum]
 gb|ESQ42988.1| hypothetical protein EUTSA_v10013772mg [Eutrema salsugineum]
Length=389

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  237  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  296

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KALS +GP  +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  297  MWVDGWQKALSDVGPQFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  356

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL
Sbjct  357  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL  389



>gb|EYU19234.1| hypothetical protein MIMGU_mgv1a007836mg [Erythranthe guttata]
Length=394

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFA AVEGPQ
Sbjct  242  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAFAVEGPQ  301

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW VGF++A+SQIGP IIWWM AQS+FYH YNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  302  MWAVGFQQAMSQIGPQIIWWMAAQSIFYHFYNQVSYMSLDEISPLTFSVGNTMKRISVIV  361

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAILGTFLYSQAK
Sbjct  362  SSIIIFHTPVQPVNALGAAIAILGTFLYSQAK  393



>ref|XP_007026011.1| Glucose-6-phosphate/phosphate translocator 2 [Theobroma cacao]
 gb|EOY28633.1| Glucose-6-phosphate/phosphate translocator 2 [Theobroma cacao]
Length=394

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  242  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  301

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W VG++KA+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  302  LWAVGWQKAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  361

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAILGTFLYSQAK
Sbjct  362  SSIIIFHTPVQPVNALGAAIAILGTFLYSQAK  393



>gb|KJB81792.1| hypothetical protein B456_013G161500 [Gossypium raimondii]
Length=390

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLSMLSLVILTPFAIAVEGPQ
Sbjct  238  FNMTGFMGAMISNLAFVFRNIFSKKGMKGNSVSGMNYYACLSMLSLVILTPFAIAVEGPQ  297

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+EKALSQIGP  IWW+ AQS+FYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  298  MWAAGWEKALSQIGPQFIWWVAAQSIFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  357

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNA+GAAIAILGTFLYSQAK
Sbjct  358  SSIIIFHTPVQPVNAVGAAIAILGTFLYSQAK  389



>ref|XP_011009303.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
isoform X2 [Populus euphratica]
Length=392

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  240  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  299

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALS+IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  300  MWAAGWQTALSEIGPNFVWWIAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  359

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIA+LGTFLYSQAK
Sbjct  360  SSIIIFHTPVQPVNALGAAIAVLGTFLYSQAK  391



>ref|XP_010267729.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nelumbo nucifera]
Length=399

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  247  FNMTGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  306

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+++ALSQIGPN IWW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  307  MWADGWQRALSQIGPNFIWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  366

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  367  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  398



>ref|XP_007020964.1| Glucose-6-phosphate/phosphate translocator 2 isoform 2, partial 
[Theobroma cacao]
 gb|EOY12489.1| Glucose-6-phosphate/phosphate translocator 2 isoform 2, partial 
[Theobroma cacao]
Length=323

 Score =   235 bits (599),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS++SL+ILTPFAIAVEGPQ
Sbjct  171  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSLMSLLILTPFAIAVEGPQ  230

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+EKALSQIGP  IWW+ AQS+FYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  231  MWAAGWEKALSQIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  290

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  291  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  322



>ref|XP_011030834.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Populus euphratica]
Length=391

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  239  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALSQIGPN IWW+ AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKRISVIV
Sbjct  299  MWAAGWQTALSQIGPNFIWWLAAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  359  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  390



>emb|CDY55220.1| BnaA01g36280D [Brassica napus]
Length=387

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SL+ILTPFAIAVEGP+
Sbjct  235  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLLILTPFAIAVEGPK  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+E A+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWENAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            +SIIIF TPVQPVNALGAAIAILGTFLYSQAK+
Sbjct  355  ASIIIFHTPVQPVNALGAAIAILGTFLYSQAKM  387



>ref|XP_009105258.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Brassica rapa]
Length=387

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SL+ILTPFAIAVEGP+
Sbjct  235  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLLILTPFAIAVEGPK  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+E A+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWENAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            +SIIIF TPVQPVNALGAAIAILGTFLYSQAK+
Sbjct  355  ASIIIFHTPVQPVNALGAAIAILGTFLYSQAKI  387



>ref|XP_007026012.1| Glucose-6-phosphate/phosphate translocator 2 isoform 1 [Theobroma 
cacao]
 gb|EOY28634.1| Glucose-6-phosphate/phosphate translocator 2 isoform 1 [Theobroma 
cacao]
Length=387

 Score =   236 bits (603),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  235  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W VG++KA+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  LWAVGWQKAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAA+AILGTFLYSQAK
Sbjct  355  SSIIIFHTPVQPVNALGAAVAILGTFLYSQAK  386



>emb|CBI23953.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   232 bits (591),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SL+ILTPFAIAVEGPQ
Sbjct  97   FNMIGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLLILTPFAIAVEGPQ  156

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQIGP+ +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  157  MWAAGWQNAVSQIGPHFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  216

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  217  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  248



>ref|XP_008365529.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Malus domestica]
 ref|XP_008345056.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Malus domestica]
Length=398

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYA LS++SLVILTPFAIAVEGPQ
Sbjct  246  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYALLSIMSLVILTPFAIAVEGPQ  305

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  GF+ A +QIGPN+IWWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  306  MWKAGFDSAFAQIGPNLIWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  365

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQPVNALGAAIAI GTFLYSQAK
Sbjct  366  SSIIIFRTPVQPVNALGAAIAIFGTFLYSQAK  397



>ref|XP_010276000.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010276002.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010276003.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nelumbo nucifera]
Length=399

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSK+GMKGKSV GMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  247  FNMTGFMGAMISNLAFVFRNIFSKRGMKGKSVGGMNYYACLSMLSLLILTPFAIAVEGPQ  306

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+EKA+SQIGP+ IWW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  307  MWAAGWEKAISQIGPHFIWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  366

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NA+GAAIAILGTFLYSQAK
Sbjct  367  SSIIIFHTPVQPINAMGAAIAILGTFLYSQAK  398



>ref|XP_009342585.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=398

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYA LS++SLVILTPFAIAVEGPQ
Sbjct  246  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYALLSIMSLVILTPFAIAVEGPQ  305

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  GF+ A +QIGPN+IWWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  306  MWKAGFDSAFAQIGPNLIWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  365

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQPVNALGAAIAI GTFLYSQAK
Sbjct  366  SSIIIFRTPVQPVNALGAAIAIFGTFLYSQAK  397



>ref|XP_010694203.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=395

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSLV+LTPFAIAVEGPQ
Sbjct  243  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLVLLTPFAIAVEGPQ  302

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G+E A+SQIGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  303  VWAAGWETAISQIGPNFVWWLAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  362

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQPVNALGAAIA+LGTF YSQAK
Sbjct  363  SSIIIFRTPVQPVNALGAAIAVLGTFFYSQAK  394



>ref|XP_007020963.1| Glucose 6-phosphate/phosphate translocator 1 isoform 1 [Theobroma 
cacao]
 gb|EOY12488.1| Glucose 6-phosphate/phosphate translocator 1 isoform 1 [Theobroma 
cacao]
Length=391

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS++SL+ILTPFAIAVEGPQ
Sbjct  239  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSLMSLLILTPFAIAVEGPQ  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+EKALSQIGP  IWW+ AQS+FYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  299  MWAAGWEKALSQIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  359  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  390



>gb|AAM63660.1| glucose-6-phosphate/phosphate translocator [Arabidopsis thaliana]
Length=388

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  236  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ AL+ +GP  +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKR SVIV
Sbjct  296  MWVDGWQTALATVGPQFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRNSVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL
Sbjct  356  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL  388



>gb|EEE68168.1| hypothetical protein OsJ_26287 [Oryza sativa Japonica Group]
Length=361

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  209  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  268

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN++WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  269  MWAAGWQKALAEVGPNVVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  328

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  329  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  360



>emb|CDP05779.1| unnamed protein product [Coffea canephora]
Length=408

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLSM+SL+ILTPFAIAVEGPQ
Sbjct  256  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSMMSLLILTPFAIAVEGPQ  315

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W +G++KA+S+IGP +IWWM AQSVFYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  316  VWALGWQKAVSEIGPQLIWWMAAQSVFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  375

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAILGTFLYSQAK
Sbjct  376  SSIIIFHTPVQPVNALGAAIAILGTFLYSQAK  407



>ref|XP_009358127.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=398

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYA LS++SL+ILTPFAIAVEGPQ
Sbjct  246  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYALLSIMSLIILTPFAIAVEGPQ  305

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  GF+ A +QIGPN+IWWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  306  MWKAGFDSAFAQIGPNLIWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  365

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQPVNALGAAIAI GTFLYSQAK
Sbjct  366  SSIIIFRTPVQPVNALGAAIAIFGTFLYSQAK  397



>ref|XP_002266056.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Vitis vinifera]
 emb|CBI23184.3| unnamed protein product [Vitis vinifera]
 gb|AJV90960.1| GPT2-a [Vitis vinifera]
Length=393

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSK+GMKGKSV GMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  241  FNMTGFMGAMISNLAFVFRNIFSKRGMKGKSVGGMNYYACLSMLSLLILTPFAIAVEGPQ  300

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KA+SQIGPN IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  301  MWAAGWQKAISQIGPNFIWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  360

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  361  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  392



>gb|KHG03254.1| Glucose-6-phosphate/phosphate translocator 2, chloroplastic -like 
protein [Gossypium arboreum]
Length=397

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAM+SNLAFVFRNIFSKKGM GKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  245  FNMTGFMGAMLSNLAFVFRNIFSKKGMNGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  304

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W VG++KA+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  305  LWAVGWQKAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  364

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  365  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  396



>ref|XP_006659185.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Oryza brachyantha]
Length=387

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN++WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALTEVGPNVVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  386



>gb|KFK27093.1| hypothetical protein AALP_AA8G333200 [Arabis alpina]
Length=385

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  233  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  292

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+ KALS IGP  + W++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  293  MWVEGYHKALSDIGPQFVGWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  352

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL
Sbjct  353  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL  385



>ref|XP_010482887.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Camelina sativa]
Length=394

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  242  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  301

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+  AL+ +GP  +WW+LAQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  302  MWVDGWHNALAAVGPQFVWWVLAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  361

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL
Sbjct  362  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL  394



>ref|XP_004972694.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Setaria italica]
Length=387

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN+IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALAEVGPNVIWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  386



>ref|NP_568812.1| glucose-6-phosphate/phosphate translocator 1 [Arabidopsis thaliana]
 sp|Q9M5A9.1|GPT1_ARATH RecName: Full=Glucose-6-phosphate/phosphate translocator 1, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF42936.1|AF233658_1 glucose 6 phosphate/phosphate translocator [Arabidopsis thaliana]
 gb|AAL15310.1| AT5g54800/MBG8_6 [Arabidopsis thaliana]
 gb|AAN72224.1| At5g54800/MBG8_6 [Arabidopsis thaliana]
 dbj|BAE98621.1| glucose-6-phosphate/phosphate translocator [Arabidopsis thaliana]
 gb|AED96542.1| glucose-6-phosphate/phosphate translocator 1 [Arabidopsis thaliana]
Length=388

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  236  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ AL+ +GP  +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  296  MWVDGWQTALATVGPQFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL
Sbjct  356  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL  388



>ref|NP_001061152.1| Os08g0187800 [Oryza sativa Japonica Group]
 dbj|BAD03325.1| glucose-6-phosphate/phosphate translocator [Oryza sativa Japonica 
Group]
 dbj|BAD05754.1| glucose-6-phosphate/phosphate translocator [Oryza sativa Japonica 
Group]
 dbj|BAF23066.1| Os08g0187800 [Oryza sativa Japonica Group]
 dbj|BAG87501.1| unnamed protein product [Oryza sativa Japonica Group]
Length=387

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN++WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALAEVGPNVVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  386



>ref|XP_003519000.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Glycine max]
 gb|ACU23286.1| unknown [Glycine max]
Length=395

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL ILTPFAIAVEGPQ
Sbjct  243  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLAILTPFAIAVEGPQ  302

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQIGP  IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  303  MWAAGWQTAMSQIGPQFIWWLAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  362

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAKL
Sbjct  363  SSIIIFHTPVQPINALGAAIAILGTFLYSQAKL  395



>ref|XP_010443058.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Camelina sativa]
Length=391

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  239  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ AL+ +GP  +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  299  MWVDGWQNALAAVGPQFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL
Sbjct  359  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL  391



>gb|EEC83014.1| hypothetical protein OsI_28073 [Oryza sativa Indica Group]
Length=395

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  243  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  302

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN++WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  303  MWAAGWQKALAEVGPNVVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  362

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  363  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  394



>ref|XP_002443966.1| hypothetical protein SORBIDRAFT_07g005200 [Sorghum bicolor]
 gb|ABK91081.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91083.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91088.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91090.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91092.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91095.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91099.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91101.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|EES13461.1| hypothetical protein SORBIDRAFT_07g005200 [Sorghum bicolor]
Length=387

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN+IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALAEVGPNVIWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  386



>gb|KHM99601.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic [Glycine 
soja]
Length=395

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL ILTPFAIAVEGPQ
Sbjct  243  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLAILTPFAIAVEGPQ  302

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQIGP  IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  303  MWAAGWQTAMSQIGPQFIWWLAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  362

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAKL
Sbjct  363  SSIIIFHTPVQPINALGAAIAILGTFLYSQAKL  395



>emb|CDP11791.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAM+SNLAFVFRNIFSKKGM GKSV GMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  251  FNMTGFMGAMVSNLAFVFRNIFSKKGMNGKSVGGMNYYACLSMLSLLILTPFAIAVEGPQ  310

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W +G++KA+SQIGPN IWW++AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKRISVIV
Sbjct  311  VWAIGWQKAVSQIGPNFIWWVVAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRISVIV  370

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAILGTFLYSQAK
Sbjct  371  SSIIIFHTPVQPVNALGAAIAILGTFLYSQAK  402



>ref|XP_002864355.1| glucose-6-phosphate transporter 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40614.1| glucose-6-phosphate transporter 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  234  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  293

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ AL+ +GP  +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  294  MWVDGWQTALATVGPQFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  353

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL
Sbjct  354  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL  386



>gb|ABK91082.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91086.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91087.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91096.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91098.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
 gb|ABK91100.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN+IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALAEVGPNVIWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  386



>gb|ABK91097.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score =   234 bits (596),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN+IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALAEVGPNVIWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  386



>gb|ABK91094.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score =   234 bits (596),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN+IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALAEVGPNVIWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  386



>ref|XP_012070764.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
isoform X2 [Jatropha curcas]
 gb|KDP39078.1| hypothetical protein JCGZ_00835 [Jatropha curcas]
Length=392

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  240  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  299

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+SQIGP+ +WW++AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  300  LWAAGWQTAVSQIGPHFVWWVVAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  359

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  360  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  391



>ref|XP_007142250.1| hypothetical protein PHAVU_008G265100g [Phaseolus vulgaris]
 gb|ESW14244.1| hypothetical protein PHAVU_008G265100g [Phaseolus vulgaris]
Length=397

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGK+VSGMNYYACLS+LSLVILTPFAIAVEGPQ
Sbjct  245  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKAVSGMNYYACLSILSLVILTPFAIAVEGPQ  304

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALSQIGP  IWW+ AQS+FYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  305  MWAAGWQTALSQIGPQFIWWVAAQSIFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  364

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAILGTFLYSQAK
Sbjct  365  SSIIIFHTPVQPVNALGAAIAILGTFLYSQAK  396



>ref|XP_009132423.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Brassica rapa]
Length=385

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFA AVEGPQ
Sbjct  233  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAFAVEGPQ  292

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KALS IGP  +WW+ AQSV YHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  293  MWIDGWQKALSDIGPQFVWWVAAQSVLYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  352

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL
Sbjct  353  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL  385



>gb|ABK91091.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN+IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALAEVGPNVIWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  386



>ref|XP_008784551.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Phoenix dactylifera]
Length=399

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSK+GM GKSVSGMNYYACLS+LSL ILTPFA+A+EGPQ
Sbjct  247  FNMIGFMGAMISNLAFVFRNIFSKRGMTGKSVSGMNYYACLSILSLFILTPFAVAIEGPQ  306

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW+ G+E ALSQIGP  IWW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  307  MWSAGWETALSQIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  366

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  367  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  398



>gb|ABK91093.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN+IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALAEVGPNVIWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  386



>gb|ABK91102.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN+IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALAEVGPNVIWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  386



>ref|XP_006449072.1| hypothetical protein CICLE_v10015210mg [Citrus clementina]
 ref|XP_006467999.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Citrus sinensis]
 gb|ESR62312.1| hypothetical protein CICLE_v10015210mg [Citrus clementina]
Length=396

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSV GMNYYACLSM+SL+ILTPFAIAVEGPQ
Sbjct  244  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVGGMNYYACLSMMSLLILTPFAIAVEGPQ  303

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KA++QIGPN +WW+ AQS+FYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  304  MWAAGWQKAIAQIGPNFVWWVAAQSIFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  363

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAILGTF+YSQAK
Sbjct  364  SSIIIFHTPVQPVNALGAAIAILGTFIYSQAK  395



>ref|XP_006279646.1| hypothetical protein CARUB_v10026569mg [Capsella rubella]
 gb|EOA12544.1| hypothetical protein CARUB_v10026569mg [Capsella rubella]
Length=389

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  237  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  296

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ AL+ +GP  +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  297  MWVDGWQTALATVGPQFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  356

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL
Sbjct  357  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL  389



>gb|AAK54618.1|AF375053_1 glucose-6-phosphate/phosphate translocator [Oryza sativa]
Length=387

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GP+++WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALAEVGPDVVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  386



>ref|XP_006383937.1| hypothetical protein POPTR_0004s01930g [Populus trichocarpa]
 gb|ERP61734.1| hypothetical protein POPTR_0004s01930g [Populus trichocarpa]
Length=400

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGM GKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  248  FNMTGFMGAMISNLAFVFRNIFSKKGMSGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  307

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ AL+QIGPN +WW+ AQS+FYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  308  MWAAGWQNALAQIGPNFVWWVAAQSIFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  367

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAILGTFLYSQAK
Sbjct  368  SSIIIFHTPVQPVNALGAAIAILGTFLYSQAK  399



>ref|XP_010060420.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW67181.1| hypothetical protein EUGRSUZ_F00969 [Eucalyptus grandis]
Length=390

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 138/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGM        NYYACLSMLSLVILTPFAIAVEGPQ
Sbjct  239  FNMIGFMGAMISNLAFVFRNIFSKKGMSKSVSGM-NYYACLSMLSLVILTPFAIAVEGPQ  297

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KALS IGP+ +WW++AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  298  MWAAGWQKALSDIGPHFVWWVVAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  357

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAI GTFLYSQ+K
Sbjct  358  SSIIIFHTPVQPVNALGAAIAIFGTFLYSQSK  389



>gb|KJB13621.1| hypothetical protein B456_002G085200 [Gossypium raimondii]
Length=390

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFV RNIFSKKGMKGKSVSGMNYYACLS+LSLVILTPFAIAVEGPQ
Sbjct  238  FNMTGFMGAMISNLAFVLRNIFSKKGMKGKSVSGMNYYACLSLLSLVILTPFAIAVEGPQ  297

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+E ALSQIGP  IWW+ AQS+FYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  298  MWAAGWETALSQIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  357

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  358  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  389



>ref|XP_002316985.2| glucose-6-phosphate/phosphate-translocator precursor family protein 
[Populus trichocarpa]
 gb|EEE97597.2| glucose-6-phosphate/phosphate-translocator precursor family protein 
[Populus trichocarpa]
Length=391

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS+LSL ILTPFAIAVEGPQ
Sbjct  239  FNMIGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSILSLFILTPFAIAVEGPQ  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALSQIGPN IWW+ AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKRISVIV
Sbjct  299  MWAAGWQTALSQIGPNFIWWLAAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TP+QP+NALGAAIA+LGTFLYSQAK
Sbjct  359  SSIIIFHTPIQPINALGAAIAVLGTFLYSQAK  390



>ref|XP_010533829.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Tarenaya hassleriana]
Length=397

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGM GKSVSGMNYYACLSMLSL+ILTPFA+AVEGPQ
Sbjct  245  FNMTGFMGAMISNLAFVFRNIFSKKGMSGKSVSGMNYYACLSMLSLLILTPFAVAVEGPQ  304

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A++QIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  305  MWAAGWQNAVAQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  364

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAILGTFLYSQAK
Sbjct  365  SSIIIFHTPVQPVNALGAAIAILGTFLYSQAK  396



>ref|XP_010665533.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=390

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLV+LTPFAIAVEGPQ
Sbjct  238  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLVLLTPFAIAVEGPQ  297

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+SQIGPN +WW+ AQS+FYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVI+
Sbjct  298  VWAAGWQNAISQIGPNFVWWVAAQSIFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVII  357

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAKL
Sbjct  358  SSIIIFHTPVQPINALGAAIAILGTFLYSQAKL  390



>gb|KJB67150.1| hypothetical protein B456_010G178300 [Gossypium raimondii]
Length=397

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGM GKSVSGMNYYACLSMLSL+ILTPFAIAVEG Q
Sbjct  245  FNMTGFMGAMISNLAFVFRNIFSKKGMNGKSVSGMNYYACLSMLSLLILTPFAIAVEGHQ  304

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W VG++KA+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  305  LWAVGWQKAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  364

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  365  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  396



>ref|XP_006370658.1| glucose-6-phosphate/phosphate-translocator precursor family protein 
[Populus trichocarpa]
 gb|ERP67227.1| glucose-6-phosphate/phosphate-translocator precursor family protein 
[Populus trichocarpa]
Length=400

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  240  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  299

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALS+IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  300  MWAAGWQTALSEIGPNFVWWIAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  359

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPVQPVNALGAAIA+LGTFLYSQ
Sbjct  360  SSIIIFHTPVQPVNALGAAIAVLGTFLYSQ  389



>ref|XP_002281493.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Vitis vinifera]
 gb|AJV90959.1| GPT1 [Vitis vinifera]
Length=389

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SL+ILTPFAIAVEGPQ
Sbjct  237  FNMIGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLLILTPFAIAVEGPQ  296

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQIGP+ +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  297  MWAAGWQNAVSQIGPHFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  356

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  357  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  388



>gb|AAX47109.1| putative plastid glucose 6 phosphate/phosphate translocator [Glycine 
max]
Length=402

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL ILTPFAIAVEGPQ
Sbjct  242  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLAILTPFAIAVEGPQ  301

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQIGP  IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  302  MWAAGWQTAMSQIGPQFIWWLAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  361

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  362  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  393



>ref|XP_011009302.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
isoform X1 [Populus euphratica]
Length=400

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  240  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  299

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALS+IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  300  MWAAGWQTALSEIGPNFVWWIAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  359

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPVQPVNALGAAIA+LGTFLYSQ
Sbjct  360  SSIIIFHTPVQPVNALGAAIAVLGTFLYSQ  389



>ref|XP_006391961.1| hypothetical protein EUTSA_v10023518mg [Eutrema salsugineum]
 gb|ESQ29247.1| hypothetical protein EUTSA_v10023518mg [Eutrema salsugineum]
Length=387

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+IGFMGAMISNLAFVFRNIFSKKGMKGKS+SGMNYYACLSM+SL+ILTPFAIA+EGP 
Sbjct  235  FNLIGFMGAMISNLAFVFRNIFSKKGMKGKSLSGMNYYACLSMMSLLILTPFAIAIEGPT  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+E A+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWENAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            +SIIIF TP+QPVNALGAAIAILGTFLYSQAK+
Sbjct  355  ASIIIFHTPIQPVNALGAAIAILGTFLYSQAKM  387



>ref|XP_003551900.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Glycine max]
Length=394

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL ILTPFAIAVEGPQ
Sbjct  242  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLAILTPFAIAVEGPQ  301

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQIGP  IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  302  MWAAGWQTAMSQIGPQFIWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  361

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  362  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  393



>ref|XP_009420544.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=399

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISN+AFVFRNIFSK+GMKG SVSGMNYYACLSMLSL+ILTPFAIA+EGPQ
Sbjct  247  FNMTGFMGAMISNVAFVFRNIFSKRGMKGTSVSGMNYYACLSMLSLLILTPFAIAIEGPQ  306

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQIGP+ IWW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  307  MWAAGWQTAISQIGPHFIWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  366

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  367  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  398



>ref|XP_010931815.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Elaeis guineensis]
Length=399

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSK+GMKG+SVSGMNYYACLSMLS +ILTPFA+A+EGPQ
Sbjct  247  FNMTGFMGAMISNLAFVFRNIFSKRGMKGQSVSGMNYYACLSMLSFLILTPFAVAIEGPQ  306

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW+ G+E ALSQIGP  IWW+ AQS+FYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  307  MWSAGWETALSQIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  366

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  367  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  398



>ref|XP_002888066.1| glucose-6-phosphate/phosphate translocator 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH64325.1| glucose-6-phosphate/phosphate translocator 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=388

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+ GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SLVILTPFAIAVEGPQ
Sbjct  236  FNITGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLVILTPFAIAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQ+GPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  296  MWAAGWQNAVSQVGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TP+QPVNALGAAIAILGTFLYSQAK
Sbjct  356  ASIIIFHTPIQPVNALGAAIAILGTFLYSQAK  387



>ref|XP_003573402.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Brachypodium distachyon]
Length=387

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN++WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALAEVGPNVLWWIGAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAI GTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAIFGTFLYSQAK  386



>gb|AAP80864.1| glucose-6-phosphate/phosphate translocator [Triticum aestivum]
Length=385

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  233  FNMIGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  292

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+ +GPN++WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  293  MWAAGWQKALADVGPNVLWWIGAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  352

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPV+PVNALGAAIAI GTFLYSQAK
Sbjct  353  SSIIIFRTPVRPVNALGAAIAIFGTFLYSQAK  384



>gb|KFK40647.1| hypothetical protein AALP_AA2G023600 [Arabis alpina]
Length=389

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLS++SL+ILTPFAIAVEGP+
Sbjct  237  FNMIGFMGAMISNLAFVFRNIFSKKGMKGNSVSGMNYYACLSIMSLLILTPFAIAVEGPK  296

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+E A+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  297  MWAAGWENAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  356

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TP+QPVNALGAAIA+LGTFLYSQAK
Sbjct  357  ASIIIFHTPIQPVNALGAAIAVLGTFLYSQAK  388



>ref|XP_011037695.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Populus euphratica]
Length=400

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGM GKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  248  FNMTGFMGAMISNLAFVFRNIFSKKGMSGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  307

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ AL+QIGPN +WW+ AQS+FYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  308  MWAAGWQNALAQIGPNFVWWVAAQSIFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  367

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF +PVQPVNALGAAIAILGTFLYSQAK
Sbjct  368  SSIIIFHSPVQPVNALGAAIAILGTFLYSQAK  399



>gb|KJB81793.1| hypothetical protein B456_013G161500 [Gossypium raimondii]
Length=439

 Score =   233 bits (594),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLSMLSLVILTPFAIAVEGPQ
Sbjct  238  FNMTGFMGAMISNLAFVFRNIFSKKGMKGNSVSGMNYYACLSMLSLVILTPFAIAVEGPQ  297

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+EKALSQIGP  IWW+ AQS+FYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  298  MWAAGWEKALSQIGPQFIWWVAAQSIFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  357

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPVQPVNA+GAAIAILGTFLYSQ
Sbjct  358  SSIIIFHTPVQPVNAVGAAIAILGTFLYSQ  387



>ref|NP_001131942.1| uncharacterized protein LOC100193334 [Zea mays]
 gb|ACF80573.1| unknown [Zea mays]
Length=387

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGK VSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKFVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KA++++GPN++WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKAVAEVGPNVVWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  386



>gb|KHG04645.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic -like 
protein [Gossypium arboreum]
Length=439

 Score =   233 bits (593),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLSMLSLVILTPFAIAVEGPQ
Sbjct  238  FNMTGFMGAMISNLAFVFRNIFSKKGMKGNSVSGMNYYACLSMLSLVILTPFAIAVEGPQ  297

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+EKALSQIGP  IWW+ AQS+FYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  298  MWAAGWEKALSQIGPQFIWWVAAQSIFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  357

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPVQPVNA+GAAIAILGTFLYSQ
Sbjct  358  SSIIIFHTPVQPVNAVGAAIAILGTFLYSQ  387



>ref|XP_007026013.1| Glucose-6-phosphate/phosphate translocator 2 isoform 2 [Theobroma 
cacao]
 gb|EOY28635.1| Glucose-6-phosphate/phosphate translocator 2 isoform 2 [Theobroma 
cacao]
Length=417

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  235  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W VG++KA+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  LWAVGWQKAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPVQPVNALGAA+AILGTFLYSQ
Sbjct  355  SSIIIFHTPVQPVNALGAAVAILGTFLYSQ  384



>ref|XP_009120008.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Brassica rapa]
Length=388

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  236  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KALS +GP  + W+ AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  296  MWIDGWQKALSDVGPQFVGWVAAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL
Sbjct  356  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL  388



>ref|XP_006302377.1| hypothetical protein CARUB_v10020443mg [Capsella rubella]
 gb|EOA35275.1| hypothetical protein CARUB_v10020443mg [Capsella rubella]
Length=388

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+ GFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLSM+SL+ILTPFAIAVEGPQ
Sbjct  236  FNITGFMGAMISNLAFVFRNIFSKKGMKGNSVSGMNYYACLSMMSLLILTPFAIAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQ+GPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  296  MWAAGWQNAVSQVGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TP+QPVNALGAAIAILGTFLYSQAK
Sbjct  356  ASIIIFHTPIQPVNALGAAIAILGTFLYSQAK  387



>ref|NP_001059819.1| Os07g0523600 [Oryza sativa Japonica Group]
 dbj|BAF21733.1| Os07g0523600, partial [Oryza sativa Japonica Group]
Length=275

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLVIL PFA A+EGP+
Sbjct  123  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLVILLPFAFAMEGPK  182

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++KA+++IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  183  VWAAGWQKAVAEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  242

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TPVQP+NALGAAIAILGTF+YSQAK
Sbjct  243  ASIIIFHTPVQPINALGAAIAILGTFIYSQAK  274



>ref|XP_004486132.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Cicer arietinum]
Length=387

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGK   GMNYYACLSM+SL+ILTPFAIAVEGP+
Sbjct  235  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKXXXGMNYYACLSMMSLLILTPFAIAVEGPK  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W VG++ A+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  VWAVGWQTAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSI+IF TP+QP+NALGAAIAILGTF+YSQAK
Sbjct  355  SSILIFHTPLQPINALGAAIAILGTFIYSQAK  386



>gb|ACG36927.1| glucose-6-phosphate/phosphate translocator 2 [Zea mays]
Length=387

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAM+SNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMMSNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KA++++GPN++WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKAVAEVGPNVVWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  386



>ref|XP_010092109.1| Glucose-6-phosphate/phosphate translocator 1 [Morus notabilis]
 gb|EXB50260.1| Glucose-6-phosphate/phosphate translocator 1 [Morus notabilis]
Length=470

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL+ILTPFAIAVEGPQ
Sbjct  310  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLIILTPFAIAVEGPQ  369

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
             W  G+EKA+SQIGP ++WWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  370  AWAAGWEKAISQIGPQLLWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  429

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPVQP+NALGAAIAILGTFLYSQ
Sbjct  430  SSIIIFHTPVQPINALGAAIAILGTFLYSQ  459



>emb|CDY25324.1| BnaC01g29930D [Brassica napus]
Length=395

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SL+ILTPFAIAVEGP+
Sbjct  238  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLLILTPFAIAVEGPK  297

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+E A+S+IGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  298  MWAAGWENAVSRIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  357

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            +SIIIF TPVQPVNALGAAIAILGTFLYSQ  +
Sbjct  358  ASIIIFHTPVQPVNALGAAIAILGTFLYSQVNI  390



>gb|EMS59907.1| hypothetical protein TRIUR3_26958 [Triticum urartu]
Length=249

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGF+GAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLVIL PFA A+EGP+
Sbjct  97   FNMIGFLGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLVILLPFAFAMEGPK  156

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+++IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  157  VWAAGWQNAVAEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  216

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIFRTPVQPVNALGAAIAILGTF+YSQAK
Sbjct  217  ASIIIFRTPVQPVNALGAAIAILGTFIYSQAK  248



>emb|CDY52572.1| BnaC03g71800D [Brassica napus]
Length=390

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFA AVEGPQ
Sbjct  233  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAFAVEGPQ  292

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KALS IGP  +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  293  MWIDGWQKALSDIGPQFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  352

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQ
Sbjct  353  SSIIIFRTPVQPVNALGAAIAILGTFLYSQ  382



>ref|XP_010493043.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Camelina sativa]
Length=390

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SL+I+TPFAIAVEGPQ
Sbjct  238  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLLIVTPFAIAVEGPQ  297

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MWT G++ A+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  298  MWTAGWQNAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  357

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF+ P++PVNALGAAIAILGTF+YSQAK
Sbjct  358  ASIIIFQNPIKPVNALGAAIAILGTFIYSQAK  389



>emb|CDY43022.1| BnaA03g11690D [Brassica napus]
Length=390

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFA AVEGPQ
Sbjct  233  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAFAVEGPQ  292

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KALS IGP  +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  293  MWIDGWQKALSDIGPQFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  352

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQ
Sbjct  353  SSIIIFRTPVQPVNALGAAIAILGTFLYSQ  382



>ref|XP_010473399.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Camelina sativa]
Length=390

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+ GFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLSM+SL+ILTPFAIAVEGPQ
Sbjct  238  FNITGFMGAMISNLAFVFRNIFSKKGMKGNSVSGMNYYACLSMMSLLILTPFAIAVEGPQ  297

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQ+GPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  298  MWAAGWQNAVSQVGPNFVWWVMAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  357

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TP+QP+NALGAAIAILGTFLYSQAK
Sbjct  358  ASIIIFHTPIQPINALGAAIAILGTFLYSQAK  389



>gb|KHN19649.1| Glucose-6-phosphate/phosphate translocator 2, chloroplastic [Glycine 
soja]
Length=285

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL ILTPFAIAVEGPQ
Sbjct  98   FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLAILTPFAIAVEGPQ  157

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQIGP  IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  158  MWAAGWQTAMSQIGPQFIWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  217

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQA  316
            SSIIIF TPVQP+NALGAAIAILGTFLYSQ 
Sbjct  218  SSIIIFHTPVQPINALGAAIAILGTFLYSQG  248



>gb|AFW61083.1| glucose-6-phosphate/phosphate translocator 2 [Zea mays]
Length=440

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGK VSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  288  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKFVSGMNYYACLSIMSLVILTPFAIAMEGPQ  347

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KA++++GPN++WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  348  MWAAGWQKAVAEVGPNVVWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  407

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  408  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  439



>ref|XP_003519563.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Glycine max]
Length=395

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFV RNI+SKKGMKGK +SGMNYYACLSMLSLVILTPFAIAVEGPQ
Sbjct  243  FNMIGFMGAMISNLAFVLRNIYSKKGMKGKDISGMNYYACLSMLSLVILTPFAIAVEGPQ  302

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALSQIGP +IWW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  303  MWAAGWQTALSQIGPQVIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  362

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQA  316
            SSIIIF TPVQP+NALGAAIAI GTFLYSQA
Sbjct  363  SSIIIFHTPVQPINALGAAIAIFGTFLYSQA  393



>gb|AFW56904.1| glucose-6-phosphate/phosphate translocator 2Glucose-6-phosphate/phosphate-translocator 
Precursor [Zea mays]
Length=391

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  239  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN++WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  299  MWAAGWQKALAEVGPNVVWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+ VNALGAAIAILGTFLYSQAK
Sbjct  359  SSIIIFHTPVRAVNALGAAIAILGTFLYSQAK  390



>gb|ACV60359.1| putative glucose-6-phosphate/phosphate translocator [Camellia 
sinensis]
Length=401

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+ GFMGAMISNLAFVFRNIFSK+GMKGKSV GMNYYACLSM+SL+ILTPFAIAVEGPQ
Sbjct  249  FNLTGFMGAMISNLAFVFRNIFSKRGMKGKSVGGMNYYACLSMMSLLILTPFAIAVEGPQ  308

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW VG++KA++QIGPN IWW++AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKRISVIV
Sbjct  309  MWAVGWDKAIAQIGPNFIWWVVAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRISVIV  368

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SII+F+TP+QP+NALGAAIAI GTFLYSQ K
Sbjct  369  ASIIVFQTPLQPINALGAAIAIFGTFLYSQTK  400



>ref|XP_007147746.1| hypothetical protein PHAVU_006G151500g [Phaseolus vulgaris]
 gb|ESW19740.1| hypothetical protein PHAVU_006G151500g [Phaseolus vulgaris]
Length=391

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLSM+SL+ILTPFAIAVEGP+
Sbjct  239  FNMIGFMGAMISNLAFVFRNIFSKKGMKGMSVSGMNYYACLSMMSLLILTPFAIAVEGPK  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+SQIGPN +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRI+VIV
Sbjct  299  VWAAGWQSAVSQIGPNFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRITVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSI+IF TPVQP+NALGAAIAILGTFLYSQ K
Sbjct  359  SSILIFHTPVQPINALGAAIAILGTFLYSQGK  390



>ref|NP_001105604.1| glucose-6-phosphate/phosphate-translocator precursor [Zea mays]
 gb|AAC08524.1| glucose-6-phosphate/phosphate-translocator precursor [Zea mays]
 gb|ACF80436.1| unknown [Zea mays]
 gb|ACG37447.1| glucose-6-phosphate/phosphate translocator 2 [Zea mays]
 gb|AFW56906.1| glucose-6-phosphate/phosphate translocator 2Glucose-6-phosphate/phosphate-translocator 
Precursor isoform 1 [Zea mays]
 gb|AFW56907.1| glucose-6-phosphate/phosphate translocator 2Glucose-6-phosphate/phosphate-translocator 
Precursor isoform 2 [Zea mays]
Length=387

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN++WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALAEVGPNVVWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+ VNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRAVNALGAAIAILGTFLYSQAK  386



>ref|XP_012070763.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
isoform X1 [Jatropha curcas]
Length=396

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  240  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  299

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+SQIGP+ +WW++AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  300  LWAAGWQTAVSQIGPHFVWWVVAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  359

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPV+PVNALGAAIAILGTFLYSQ
Sbjct  360  SSIIIFHTPVRPVNALGAAIAILGTFLYSQ  389



>gb|ACN36392.1| unknown [Zea mays]
 gb|AFW56905.1| glucose-6-phosphate/phosphate translocator 2Glucose-6-phosphate/phosphate-translocator 
Precursor [Zea mays]
Length=394

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  242  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  301

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN++WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  302  MWAAGWQKALAEVGPNVVWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  361

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+ VNALGAAIAILGTFLYSQAK
Sbjct  362  SSIIIFHTPVRAVNALGAAIAILGTFLYSQAK  393



>ref|XP_006594434.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Glycine max]
Length=391

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLS++SL+ILTPFAIAVEGP+
Sbjct  239  FNMIGFMGAMISNLAFVFRNIFSKKGMKGMSVSGMNYYACLSIMSLLILTPFAIAVEGPK  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+SQIGPN +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  299  VWAAGWQTAVSQIGPNFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSI+IF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  359  SSILIFHTPVQPINALGAAIAILGTFLYSQAK  390



>ref|NP_564785.1| glucose-6-phosphate/phosphate translocator 2 [Arabidopsis thaliana]
 sp|Q94B38.2|GPT2_ARATH RecName: Full=Glucose-6-phosphate/phosphate translocator 2, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AEE33888.1| glucose-6-phosphate/phosphate translocator 2 [Arabidopsis thaliana]
Length=388

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+ GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SLVILTPF+IAVEGPQ
Sbjct  236  FNITGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLVILTPFSIAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQ+GPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  296  MWAAGWQNAVSQVGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TP+QPVNALGAAIAI GTFLYSQAK
Sbjct  356  ASIIIFHTPIQPVNALGAAIAIFGTFLYSQAK  387



>ref|XP_003545023.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Glycine max]
Length=395

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFV RNI+SKKGMKGK +SGMNYY CLSMLSLVILTPFAIAVEGPQ
Sbjct  243  FNMIGFMGAMISNLAFVLRNIYSKKGMKGKDISGMNYYGCLSMLSLVILTPFAIAVEGPQ  302

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALSQIGP IIWW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  303  MWAAGWQTALSQIGPQIIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  362

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQA  316
            SSIIIF TPVQP+NALGAAIAI GTFLYSQA
Sbjct  363  SSIIIFHTPVQPINALGAAIAIFGTFLYSQA  393



>dbj|BAJ93997.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=385

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVIL PFAIA+EGPQ
Sbjct  233  FNMIGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILAPFAIAMEGPQ  292

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+++AL+ +GPN++WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  293  MWAAGWQRALADVGPNVLWWIGAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  352

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPV+PVNALGAAIAI GTFLYSQAK
Sbjct  353  SSIIIFRTPVRPVNALGAAIAIFGTFLYSQAK  384



>ref|XP_007146406.1| hypothetical protein PHAVU_006G037800g [Phaseolus vulgaris]
 gb|ESW18400.1| hypothetical protein PHAVU_006G037800g [Phaseolus vulgaris]
Length=393

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL ILTPFAIAVEGPQ
Sbjct  241  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLAILTPFAIAVEGPQ  300

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQIG  +IWW+ AQS+FYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  301  MWIAGWQTAVSQIGNQLIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  360

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAILGTFLYSQAK
Sbjct  361  SSIIIFHTPVQPVNALGAAIAILGTFLYSQAK  392



>dbj|BAB08759.1| glucose-6-phosphate/phosphate translocator [Arabidopsis thaliana]
Length=391

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  236  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ AL+ +GP  +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  296  MWVDGWQTALATVGPQFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQ  +
Sbjct  356  SSIIIFRTPVQPVNALGAAIAILGTFLYSQVNI  388



>ref|XP_004500037.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
isoform X3 [Cicer arietinum]
Length=399

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLS+LSL ILTPFAIAVEGPQ
Sbjct  247  FNMIGFMGAMISNLAFVFRNIFSKKGMKGNSVSGMNYYACLSILSLAILTPFAIAVEGPQ  306

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALS+IGP  IWW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  307  MWAAGWQTALSEIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  366

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIA+ GTFLYSQ+K
Sbjct  367  SSIIIFHTPVQPVNALGAAIAVFGTFLYSQSK  398



>gb|KEH36805.1| glucose-6-phosphate/phosphate translocator-like protein [Medicago 
truncatula]
Length=396

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGM G SVSGMNYYACLSMLSL+ILTPFAIAVEGP+
Sbjct  243  FNMIGFMGAMISNLAFVFRNIFSKKGMNGMSVSGMNYYACLSMLSLLILTPFAIAVEGPK  302

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  303  VWVAGWQTAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  362

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TP+QP+NALGAAIAILGTF+YSQAK
Sbjct  363  SSIIIFHTPLQPINALGAAIAILGTFIYSQAK  394



>ref|XP_009127064.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Brassica rapa]
Length=386

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFA AVEGPQ
Sbjct  234  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAFAVEGPQ  293

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KALS IGP  + W+ AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  294  MWADGWQKALSDIGPQFVGWVAAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  353

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL
Sbjct  354  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAKL  386



>gb|AJV90962.1| GPT2-c [Vitis vinifera]
Length=456

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSK+GMKGKSV GMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  241  FNMTGFMGAMISNLAFVFRNIFSKRGMKGKSVGGMNYYACLSMLSLLILTPFAIAVEGPQ  300

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KA+SQIGPN IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  301  MWAAGWQKAISQIGPNFIWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  360

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPVQP+NALGAAIAILGTFLYSQ
Sbjct  361  SSIIIFHTPVQPINALGAAIAILGTFLYSQ  390



>ref|XP_012091392.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Jatropha curcas]
 gb|KDP20779.1| hypothetical protein JCGZ_21250 [Jatropha curcas]
Length=396

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPF+IA+EGPQ
Sbjct  244  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFSIAMEGPQ  303

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++KAL+QIGPN +WW+ AQS+FYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  304  IWAAGWQKALAQIGPNFVWWVAAQSIFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  363

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF+TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  364  SSIIIFQTPVRPVNALGAAIAILGTFLYSQAK  395



>ref|XP_002305598.2| hypothetical protein POPTR_0004s01930g [Populus trichocarpa]
 gb|EEE86109.2| hypothetical protein POPTR_0004s01930g [Populus trichocarpa]
Length=405

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGM GKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  248  FNMTGFMGAMISNLAFVFRNIFSKKGMSGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  307

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ AL+QIGPN +WW+ AQS+FYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  308  MWAAGWQNALAQIGPNFVWWVAAQSIFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  367

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPVQPVNALGAAIAILGTFLYSQ
Sbjct  368  SSIIIFHTPVQPVNALGAAIAILGTFLYSQ  397



>ref|XP_009802193.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nicotiana sylvestris]
Length=386

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS++SL+ILTPFAIA+EGPQ
Sbjct  234  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSIMSLLILTPFAIAMEGPQ  293

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW VG++ ALSQIGPN +WW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  294  MWAVGWQNALSQIGPNFVWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  353

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF+TPV+P+NALGAAIAILGTF+YSQ+K
Sbjct  354  SSIIIFQTPVRPINALGAAIAILGTFIYSQSK  385



>ref|XP_010042185.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Eucalyptus grandis]
Length=396

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEG Q
Sbjct  244  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGHQ  303

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KA+SQIGPN + W++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  304  MWAAGWQKAVSQIGPNFVRWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  363

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  364  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  395



>gb|AAF86908.1|AF223360_1 glucose-6P/phosphate translocator precursor [Mesembryanthemum 
crystallinum]
Length=395

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSLV+LTPFA+ VEGP+
Sbjct  243  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLVLLTPFALYVEGPK  302

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KA+S IG N IWW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  303  MWAAGWDKAVSDIGSNFIWWLTAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  362

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQPVNALGAAIA+ GTFLYSQAK
Sbjct  363  SSIIIFRTPVQPVNALGAAIAVFGTFLYSQAK  394



>ref|XP_006654288.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Oryza brachyantha]
Length=387

 Score =   229 bits (583),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAI++EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAISMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++G N++WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALAEVGSNVVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAA AILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAATAILGTFLYSQAK  386



>ref|XP_009617374.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Nicotiana tomentosiformis]
Length=387

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS++SL+ILTPFAIA+EGPQ
Sbjct  235  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSIMSLLILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW VG++ ALSQIGPN +WW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  295  MWAVGWQNALSQIGPNFVWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF+TPV+P+NALGAAIAILGTF+YSQ+K
Sbjct  355  SSIIIFQTPVRPINALGAAIAILGTFIYSQSK  386



>ref|XP_010476089.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Camelina sativa]
Length=392

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SL+I+TPFAIAVEGPQ
Sbjct  240  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLLIVTPFAIAVEGPQ  299

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  300  MWAAGWQNAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  359

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF+ P++PVNALGAAIAILGTF+YSQAK
Sbjct  360  ASIIIFQNPIKPVNALGAAIAILGTFIYSQAK  391



>gb|KHN38297.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic [Glycine 
soja]
Length=396

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFV RNI+SKKGMKGK +SGMNYYACLSMLSLVILTPFAIAVEGPQ
Sbjct  243  FNMIGFMGAMISNLAFVLRNIYSKKGMKGKDISGMNYYACLSMLSLVILTPFAIAVEGPQ  302

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALSQIGP +IWW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  303  MWAAGWQTALSQIGPQVIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  362

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPVQP+NALGAAIAI GTFLYSQ
Sbjct  363  SSIIIFHTPVQPINALGAAIAIFGTFLYSQ  392



>ref|XP_010458564.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Camelina sativa]
Length=394

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SL+I+TPFAIAVEGPQ
Sbjct  239  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLLIVTPFAIAVEGPQ  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  299  MWAAGWQNAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF+ P++PVNALGAAIAILGTF+YSQAK
Sbjct  359  ASIIIFQNPIKPVNALGAAIAILGTFIYSQAK  390



>gb|KFK31943.1| hypothetical protein AALP_AA6G180100 [Arabis alpina]
Length=389

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SL ILTPFAIAVEGPQ
Sbjct  237  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLFILTPFAIAVEGPQ  296

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+S+IGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  297  MWAAGWQNAVSEIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  356

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF+ PV+PVNALGAAIAILGTF+YSQAK
Sbjct  357  ASIIIFQNPVKPVNALGAAIAILGTFIYSQAK  388



>gb|AAY85658.1| plastid glucose-6-phosphate/phosphate translocator precursor 
[Helianthus annuus]
Length=379

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGP+
Sbjct  227  FNMTGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPK  286

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+++IGP+ IWW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  287  MWAAGWQNAVTEIGPHFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  346

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAI GTFLYSQAK
Sbjct  347  SSIIIFHTPVQPINALGAAIAIFGTFLYSQAK  378



>gb|KDO75519.1| hypothetical protein CISIN_1g039814mg, partial [Citrus sinensis]
Length=454

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSV GMNYYACLSM+SL+ILTPFAIAVEGPQ
Sbjct  287  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVGGMNYYACLSMMSLLILTPFAIAVEGPQ  346

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KA++QIGPN +WW+ AQS+FYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  347  MWAAGWQKAIAQIGPNFVWWVAAQSIFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  406

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPVQPVNALGAAIAILGTF+YSQ
Sbjct  407  SSIIIFHTPVQPVNALGAAIAILGTFIYSQ  436



>ref|XP_006367280.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Solanum tuberosum]
Length=405

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+ GFMGAMISNLAFVFRNIFSKKGMKGKSV GMNYYACLSM+SL+ILTPFAIAVEGP+
Sbjct  244  FNLTGFMGAMISNLAFVFRNIFSKKGMKGKSVGGMNYYACLSMMSLLILTPFAIAVEGPK  303

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W +G++ A+SQIGPN IWW++AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKRI VIV
Sbjct  304  VWALGWQNAVSQIGPNFIWWVVAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRIVVIV  363

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK-L*RFGQKE  289
            SSIIIF+ P+QPVNALGA IAI GTFLYSQAK L +FG+K+
Sbjct  364  SSIIIFQNPIQPVNALGATIAIFGTFLYSQAKQLEKFGKKD  404



>gb|KJB45583.1| hypothetical protein B456_007G313700 [Gossypium raimondii]
Length=383

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEG  
Sbjct  231  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGAH  290

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+++A+S+IGP  IWW+ AQS+FYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  291  MWAAGWKEAVSEIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  350

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQP+NALGAAIAILGTFLYSQAK
Sbjct  351  SSIIIFRTPVQPINALGAAIAILGTFLYSQAK  382



>gb|AAC08525.1| glucose-6-phosphate/phosphate-translocator precursor [Pisum sativum]
 gb|ABO14803.1| plastid phosphate translocator [Vicia narbonensis]
Length=401

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL ILTPFAIAVEGP 
Sbjct  249  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLAILTPFAIAVEGPA  308

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALS+IGP  IWW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  309  MWAAGWQTALSEIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  368

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TP+QPVNALGAAIA+ GTFLYSQAK
Sbjct  369  SSIIIFHTPIQPVNALGAAIAVFGTFLYSQAK  400



>ref|XP_006307580.1| hypothetical protein CARUB_v10009203mg, partial [Capsella rubella]
 gb|EOA40478.1| hypothetical protein CARUB_v10009203mg, partial [Capsella rubella]
Length=430

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SL+I+TPFAIAVEGPQ
Sbjct  278  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLLIVTPFAIAVEGPQ  337

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  338  MWAAGWQNAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  397

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF+ P++PVNALGAAIAILGTF+YSQAK
Sbjct  398  ASIIIFQNPIKPVNALGAAIAILGTFIYSQAK  429



>gb|KHN11941.1| Glucose-6-phosphate/phosphate translocator 2, chloroplastic [Glycine 
soja]
Length=338

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFV RNI+SKKGMKGK +SGMNYY CLSMLSLVILTPFAIAVEGPQ
Sbjct  96   FNMIGFMGAMISNLAFVLRNIYSKKGMKGKDISGMNYYGCLSMLSLVILTPFAIAVEGPQ  155

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALSQIGP IIWW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  156  MWAAGWQTALSQIGPQIIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  215

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPVQP+NALGAAIAI GTFLYSQ
Sbjct  216  SSIIIFHTPVQPINALGAAIAIFGTFLYSQ  245



>ref|XP_010317737.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Solanum lycopersicum]
Length=381

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLS++SL+ILTPFAIA+EGPQ
Sbjct  229  FNMTGFMGAMISNLAFVFRNIFSKKGMKGNSVSGMNYYACLSIMSLLILTPFAIAMEGPQ  288

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW +G+  ALSQIGPN +WW++AQS+FYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  289  MWALGWRNALSQIGPNFVWWIVAQSIFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  348

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF+TPV+P+NALGAAIAILGTF+YSQ+K
Sbjct  349  SSIIIFQTPVRPINALGAAIAILGTFIYSQSK  380



>ref|XP_002518517.1| Glucose-6-phosphate/phosphate translocator 2, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF43904.1| Glucose-6-phosphate/phosphate translocator 2, chloroplast precursor, 
putative [Ricinus communis]
Length=399

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN  GFMGAMISNLAFVFRNIFSKKGM GKSVSGMNYYACLSMLSL+ILTPFAIA+EGPQ
Sbjct  247  FNKTGFMGAMISNLAFVFRNIFSKKGMNGKSVSGMNYYACLSMLSLLILTPFAIAMEGPQ  306

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A++QIGPN +WW+ AQS+FYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  307  MWAAGWQNAVAQIGPNFVWWVAAQSIFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  366

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAILGTFLYSQAK
Sbjct  367  SSIIIFHTPVQPVNALGAAIAILGTFLYSQAK  398



>ref|XP_009589013.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=401

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+IGFMGAMISNLAFVFRNIFSKKGMKGKSV GMNYYACL+++SL+ILTPFAIAVEGPQ
Sbjct  249  FNLIGFMGAMISNLAFVFRNIFSKKGMKGKSVGGMNYYACLTIMSLLILTPFAIAVEGPQ  308

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W +G++KA+SQIGPN +WW++AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKRISVIV
Sbjct  309  VWALGWQKAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRISVIV  368

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF+ P+QPVNALGAAIAI GTFLYSQAK
Sbjct  369  SSIIIFQNPIQPVNALGAAIAIFGTFLYSQAK  400



>ref|XP_011097912.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Sesamum indicum]
Length=391

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL+ILTPFAIAVEGPQ
Sbjct  239  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLLILTPFAIAVEGPQ  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  GF++ALSQIGP I+WWM AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  299  MWATGFKEALSQIGPQIVWWMAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAK
Sbjct  359  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAK  390



>ref|XP_006417337.1| hypothetical protein EUTSA_v10007876mg [Eutrema salsugineum]
 gb|ESQ35690.1| hypothetical protein EUTSA_v10007876mg [Eutrema salsugineum]
Length=389

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SL+I+TPFAIAVEGPQ
Sbjct  237  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLLIVTPFAIAVEGPQ  296

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+S+IGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  297  VWAAGWQNAVSEIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  356

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TP++PVNALGAAIAILGTF+YSQAK
Sbjct  357  ASIIIFHTPIRPVNALGAAIAILGTFIYSQAK  388



>dbj|BAC57673.1| putative glucose-6-phosphate/phosphate- translocator precursor 
[Oryza sativa Japonica Group]
 dbj|BAC57677.1| putative glucose-6-phosphate/phosphate- translocator precursor 
[Oryza sativa Japonica Group]
 dbj|BAD30854.1| putative glucose-6-phosphate/phosphate- translocator precursor 
[Oryza sativa Japonica Group]
Length=392

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLVIL PFA A+EGP+
Sbjct  240  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLVILLPFAFAMEGPK  299

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++KA+++IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  300  VWAAGWQKAVAEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  359

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TPVQP+NALGAAIAILGTF+YSQAK
Sbjct  360  ASIIIFHTPVQPINALGAAIAILGTFIYSQAK  391



>ref|XP_006449073.1| hypothetical protein CICLE_v10015210mg [Citrus clementina]
 gb|ESR62313.1| hypothetical protein CICLE_v10015210mg [Citrus clementina]
Length=451

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSV GMNYYACLSM+SL+ILTPFAIAVEGPQ
Sbjct  244  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVGGMNYYACLSMMSLLILTPFAIAVEGPQ  303

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KA++QIGPN +WW+ AQS+FYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  304  MWAAGWQKAIAQIGPNFVWWVAAQSIFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  363

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPVQPVNALGAAIAILGTF+YSQ
Sbjct  364  SSIIIFHTPVQPVNALGAAIAILGTFIYSQ  393



>ref|XP_010418155.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Camelina sativa]
Length=389

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+ GFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLSM+SL+ILTPFAIAVEGPQ
Sbjct  237  FNITGFMGAMISNLAFVFRNIFSKKGMKGNSVSGMNYYACLSMMSLLILTPFAIAVEGPQ  296

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW   ++ A+SQ+GPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  297  MWAAVWQNAVSQVGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  356

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TP+QPVNALGAAIAILGTFLYSQAK
Sbjct  357  ASIIIFHTPIQPVNALGAAIAILGTFLYSQAK  388



>gb|EEE67296.1| hypothetical protein OsJ_24501 [Oryza sativa Japonica Group]
Length=426

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLVIL PFA A+EGP+
Sbjct  274  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLVILLPFAFAMEGPK  333

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++KA+++IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  334  VWAAGWQKAVAEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  393

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TPVQP+NALGAAIAILGTF+YSQAK
Sbjct  394  ASIIIFHTPVQPINALGAAIAILGTFIYSQAK  425



>gb|EMT13790.1| Glucose-6-phosphate/phosphate translocator 2, chloroplastic [Aegilops 
tauschii]
Length=384

 Score =   226 bits (577),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGF+GAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLVIL PFA A+EGP+
Sbjct  232  FNMIGFLGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLVILLPFAFAMEGPK  291

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+++IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  292  VWAAGWQNAVAEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  351

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIFRTPVQPVNALGAAIAILGTF+YSQAK
Sbjct  352  ASIIIFRTPVQPVNALGAAIAILGTFIYSQAK  383



>ref|XP_003599946.1| Glucose-6-phosphate/phosphate-translocator [Medicago truncatula]
 gb|AES70197.1| glucose-6-phosphate/phosphate translocator-like protein [Medicago 
truncatula]
 gb|AFK43777.1| unknown [Medicago truncatula]
Length=401

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL ILTPFAIAVEGP 
Sbjct  249  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLAILTPFAIAVEGPA  308

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ AL++IGP  +WW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  309  MWAAGYKTALAEIGPQFLWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  368

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TP+QPVNALGAAIA+ GTFLYSQAK
Sbjct  369  SSIIIFHTPIQPVNALGAAIAVFGTFLYSQAK  400



>ref|XP_010430199.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Camelina sativa]
Length=388

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+ GFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLSM+SL+ILTPFAIAVEGPQ
Sbjct  236  FNITGFMGAMISNLAFVFRNIFSKKGMKGNSVSGMNYYACLSMMSLLILTPFAIAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQ+GPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  296  MWAAGWQNAVSQVGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TP+Q VNALGAAIAILGTFLYSQAK
Sbjct  356  ASIIIFHTPIQLVNALGAAIAILGTFLYSQAK  387



>gb|KHN37588.1| Glucose-6-phosphate/phosphate translocator 2, chloroplastic [Glycine 
soja]
Length=355

 Score =   225 bits (573),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLS++SL+ILTPFAIAVEGP+
Sbjct  198  FNMIGFMGAMISNLAFVFRNIFSKKGMKGMSVSGMNYYACLSIMSLLILTPFAIAVEGPK  257

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+SQIGPN +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  258  VWAAGWQTAVSQIGPNFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  317

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSI+IF TPVQP+NALGAAIAILGTFLYSQ
Sbjct  318  SSILIFHTPVQPINALGAAIAILGTFLYSQ  347



>ref|XP_006343413.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Solanum tuberosum]
Length=381

 Score =   226 bits (575),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKG SV+GMNYYACLS++SL+ILTPFAIA+EGPQ
Sbjct  229  FNMTGFMGAMISNLAFVFRNIFSKKGMKGNSVNGMNYYACLSIMSLLILTPFAIAMEGPQ  288

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW +G+  A SQIGPN +WW++AQS+FYHLYNQVSYMSLDEISPLTFS+GNTMKR+SVIV
Sbjct  289  MWALGWRNAFSQIGPNFVWWIIAQSIFYHLYNQVSYMSLDEISPLTFSVGNTMKRLSVIV  348

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF+TPV+P+NALGAAIAILGTF+YSQ+K
Sbjct  349  SSIIIFQTPVRPINALGAAIAILGTFIYSQSK  380



>gb|AAK68814.1| Similar to glucose-6-phosphate/phosphate-translocator [Arabidopsis 
thaliana]
 gb|AAM10041.1| similar to glucose-6-phosphate/phosphate-translocator [Arabidopsis 
thaliana]
Length=388

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+ GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SLVILTPF+IAVE PQ
Sbjct  236  FNITGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLVILTPFSIAVEVPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQ+GPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  296  MWAAGWQNAVSQVGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TP+QPVNALGAAIAI GTFLYSQAK
Sbjct  356  ASIIIFHTPIQPVNALGAAIAIFGTFLYSQAK  387



>ref|XP_004500035.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
isoform X1 [Cicer arietinum]
 ref|XP_004500036.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=412

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLS+LSL ILTPFAIAVEGPQ
Sbjct  247  FNMIGFMGAMISNLAFVFRNIFSKKGMKGNSVSGMNYYACLSILSLAILTPFAIAVEGPQ  306

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALS+IGP  IWW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  307  MWAAGWQTALSEIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  366

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPVQPVNALGAAIA+ GTFLYSQ
Sbjct  367  SSIIIFHTPVQPVNALGAAIAVFGTFLYSQ  396



>emb|CDY19859.1| BnaC09g31250D [Brassica napus]
Length=414

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  236  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KALS +GP  + W+ AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  296  MWIDGWQKALSDVGPQFVGWVAAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQ
Sbjct  356  SSIIIFRTPVQPVNALGAAIAILGTFLYSQ  385



>emb|CDY17274.1| BnaA10g09080D [Brassica napus]
Length=414

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  236  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KALS +GP  + W+ AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  296  MWIDGWQKALSDVGPQFVGWVAAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQ
Sbjct  356  SSIIIFRTPVQPVNALGAAIAILGTFLYSQ  385



>ref|XP_002889879.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66138.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGM+GKSVSGMNYYACLSM+SL+I+TPFAIAVEGPQ
Sbjct  237  FNMIGFMGAMISNLAFVFRNIFSKKGMEGKSVSGMNYYACLSMMSLLIVTPFAIAVEGPQ  296

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQIGPN +WW++AQSVFYHLYNQVSYMSL++ISPLTFS+GNTMKRISVIV
Sbjct  297  MWAAGWQNAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLNQISPLTFSVGNTMKRISVIV  356

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF+ PV+PVNALGAAIAILGTF+YSQ K
Sbjct  357  ASIIIFQNPVKPVNALGAAIAILGTFIYSQVK  388



>emb|CDY34641.1| BnaC08g42000D [Brassica napus]
Length=363

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SL+++TPFAIAVEGPQ
Sbjct  195  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLLLVTPFAIAVEGPQ  254

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+S+IGPN +WW++AQSVFYHLYNQVSYMSLD+I+PLTFS+GNTMKRISVIV
Sbjct  255  MWAAGWQNAVSEIGPNFVWWVVAQSVFYHLYNQVSYMSLDQITPLTFSVGNTMKRISVIV  314

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TP++PVN LGAAIAILGTF+YSQ K
Sbjct  315  ASIIIFHTPIRPVNGLGAAIAILGTFIYSQVK  346



>gb|KHN33046.1| Glucose-6-phosphate/phosphate translocator 2, chloroplastic [Glycine 
soja]
Length=396

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLS++SL+ILTPFAIAVEGP+
Sbjct  239  FNMIGFMGAMISNLAFVFRNIFSKKGMKGMSVSGMNYYACLSIMSLLILTPFAIAVEGPK  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+SQIGPN +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  299  VWIAGWQTAVSQIGPNFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSI+IF TPVQP+NALGAAIAILGTFLYSQ
Sbjct  359  SSILIFHTPVQPINALGAAIAILGTFLYSQ  388



>gb|AAC28500.1| Similar to glucose-6-phosphate/phosphate-translocator (GPT) gb|AF020814 
from Pisum sativum [Arabidopsis thaliana]
Length=410

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+ GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SLVILTPF+IAVEGPQ
Sbjct  236  FNITGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLVILTPFSIAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQ+GPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  296  MWAAGWQNAVSQVGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            +SIIIF TP+QPVNALGAAIAI GTFLYSQ
Sbjct  356  ASIIIFHTPIQPVNALGAAIAIFGTFLYSQ  385



>ref|XP_006417336.1| hypothetical protein EUTSA_v10007876mg [Eutrema salsugineum]
 gb|ESQ35689.1| hypothetical protein EUTSA_v10007876mg [Eutrema salsugineum]
Length=388

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SL+I+TPFAIAVEGPQ
Sbjct  237  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLLIVTPFAIAVEGPQ  296

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+S+IGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  297  VWAAGWQNAVSEIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  356

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TP++PVNALGAAIAILGTF+YSQ +
Sbjct  357  ASIIIFHTPIRPVNALGAAIAILGTFIYSQVE  388



>ref|XP_009794811.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like, 
partial [Nicotiana sylvestris]
Length=162

 Score =   216 bits (551),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = -3

Query  756  GFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQMWTV  577
            GFMGAM+SNLAFVFRNIFSKKGMKGKSV GMNYYACLS++SL+ILTPFAIAVEGPQ+W +
Sbjct  3    GFMGAMVSNLAFVFRNIFSKKGMKGKSVGGMNYYACLSIMSLLILTPFAIAVEGPQVWAL  62

Query  576  GFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvivssii  397
            G++ A+SQIGPN +WW++AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKRISVIVSSII
Sbjct  63   GWQNAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRISVIVSSII  122

Query  396  IFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            IF+ P+QPVNALGAAIAI GTFLYSQ K+
Sbjct  123  IFQNPIQPVNALGAAIAIFGTFLYSQVKI  151



>ref|XP_004957888.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
isoform X1 [Setaria italica]
Length=388

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFV R IFSKKGMKGKSVSGMNYYACLS++SLVIL PFAIA+EGP+
Sbjct  236  FNMVGFMGAMISNLAFVVRTIFSKKGMKGKSVSGMNYYACLSIMSLVILLPFAIAMEGPK  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++KA+++IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  296  VWAAGWQKAVAEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF+TPVQP+NALGAAIAILGTF+YSQAK
Sbjct  356  ASIIIFQTPVQPINALGAAIAILGTFIYSQAK  387



>gb|EEC82168.1| hypothetical protein OsI_26255 [Oryza sativa Indica Group]
Length=390

 Score =   223 bits (569),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLVIL PFA A+EGP+
Sbjct  240  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLVILLPFAFAMEGPK  299

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++KA+++IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  300  VWAAGWQKAVAEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  359

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            +SIIIF TPVQP+NALGAAIAILGTF+YSQ
Sbjct  360  ASIIIFHTPVQPINALGAAIAILGTFIYSQ  389



>ref|XP_002462940.1| hypothetical protein SORBIDRAFT_02g034980 [Sorghum bicolor]
 gb|EER99461.1| hypothetical protein SORBIDRAFT_02g034980 [Sorghum bicolor]
Length=395

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFR IFSKKGMKGKSVSGMNYYACLS++SLVIL PFAIA+EGP+
Sbjct  243  FNMVGFMGAMISNLAFVFRTIFSKKGMKGKSVSGMNYYACLSIMSLVILLPFAIAMEGPK  302

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+++IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  303  VWAAGWQNAVAEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  362

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF+TPVQP+NALGAAIAILGTF+YSQAK
Sbjct  363  ASIIIFQTPVQPINALGAAIAILGTFIYSQAK  394



>ref|XP_004152937.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Cucumis sativus]
 gb|KGN56144.1| hypothetical protein Csa_3G078260 [Cucumis sativus]
Length=396

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLS+LSL++LTPFAIAVEGPQ
Sbjct  244  FNMIGFMGAMISNLAFVFRNIFSKKGMKGNSVSGMNYYACLSILSLLLLTPFAIAVEGPQ  303

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALS+IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  304  MWAAGWKTALSEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  363

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            S+IIIFRTPVQPVNALGAAIA+LGTFLYSQAK
Sbjct  364  SAIIIFRTPVQPVNALGAAIAVLGTFLYSQAK  395



>gb|KHG27528.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic -like 
protein [Gossypium arboreum]
Length=387

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 141/152 (93%), Gaps = 3/152 (2%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFV RNIFSKKGMKGKSVSGMNYYACLS+LSLVILTPFAIAVEGPQ
Sbjct  238  FNMTGFMGAMISNLAFVLRNIFSKKGMKGKSVSGMNYYACLSLLSLVILTPFAIAVEGPQ  297

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+E ALSQIGP    W+ AQS+FYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  298  MWAAGWETALSQIGPQ---WVAAQSIFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  386



>emb|CDY06630.1| BnaC02g13540D [Brassica napus]
Length=452

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFA AVEGPQ
Sbjct  236  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAFAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KALS+IGP  + W+ AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  296  MWADGWQKALSEIGPQFVGWVAAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIFRTPVQPVNALGAA+AILGTFLYSQ
Sbjct  356  SSIIIFRTPVQPVNALGAAVAILGTFLYSQ  385



>gb|AIR93780.1| glucose 6-phosphate phosphate translocator [Kalanchoe fedtschenkoi]
Length=395

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS+LSL+ILTPFAIAVEGPQ
Sbjct  243  FNMIGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSILSLLILTPFAIAVEGPQ  302

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+E A+SQIGP  IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  303  MWAAGWENAISQIGPQFIWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  362

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQAK
Sbjct  363  SSIIIFRTPVQPVNALGAAIAILGTFLYSQAK  394



>gb|EYU24788.1| hypothetical protein MIMGU_mgv1a007856mg [Erythranthe guttata]
Length=393

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 140/153 (92%), Gaps = 1/153 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsg-MNYYACLSMLSLVILTPFAIAVEGP  592
            FN+ GFMGAM+SNLAFVFRNIFSK+GM      G MNYYACLSMLSL+I+TPFAIAVEGP
Sbjct  240  FNLTGFMGAMVSNLAFVFRNIFSKRGMMKGKSVGGMNYYACLSMLSLLIVTPFAIAVEGP  299

Query  591  QMWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvi  412
            Q+W VG++ ALSQIGPN IWW++AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKRISVI
Sbjct  300  QLWAVGWQNALSQIGPNFIWWVVAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRISVI  359

Query  411  vssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            V SIIIF+TP+QP+NALGAAIAI GTFLYSQAK
Sbjct  360  VVSIIIFQTPLQPINALGAAIAISGTFLYSQAK  392



>emb|CDY28750.1| BnaA02g09420D [Brassica napus]
Length=450

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFA AVEGPQ
Sbjct  234  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAFAVEGPQ  293

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KALS IGP  + W+ AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  294  MWADGWQKALSDIGPQFVGWVAAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  353

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIFRTPVQPVNALGAAIAILGTFLYSQ
Sbjct  354  SSIIIFRTPVQPVNALGAAIAILGTFLYSQ  383



>gb|EEC82167.1| hypothetical protein OsI_26253 [Oryza sativa Indica Group]
Length=390

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL IL PFA A+EGP+
Sbjct  240  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLAILLPFAFAMEGPK  299

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++KA+++IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  300  VWAAGWQKAVAEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  359

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            +SIIIF TPVQP+NALGAAIAILGTF+YSQ
Sbjct  360  ASIIIFHTPVQPINALGAAIAILGTFIYSQ  389



>emb|CAN68645.1| hypothetical protein VITISV_030812 [Vitis vinifera]
Length=391

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSK+GMKGKSV GMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  231  FNMTGFMGAMISNLAFVFRNIFSKRGMKGKSVGGMNYYACLSMLSLLILTPFAIAVEGPQ  290

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KA+SQIGPN IWW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  291  MWAAGWQKAISQIGPNFIWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  350

Query  408  ssiiIFRTPVQPVNALGAAIAILGT  334
            SSIIIF TPVQPVNALGAAIAILGT
Sbjct  351  SSIIIFHTPVQPVNALGAAIAILGT  375



>ref|XP_010229653.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Brachypodium distachyon]
Length=508

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLVIL PFA A+EGP+
Sbjct  356  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLVILLPFAFAMEGPK  415

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+++IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  416  VWAAGWQNAVAEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  475

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TPVQP+NALGAAIAILGTF+YSQAK
Sbjct  476  ASIIIFHTPVQPINALGAAIAILGTFIYSQAK  507



>ref|XP_008667831.1| PREDICTED: uncharacterized protein LOC100279907 isoform X1 [Zea 
mays]
 tpg|DAA41023.1| TPA: hypothetical protein ZEAMMB73_640449 [Zea mays]
Length=394

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFV R IFSKKGMKGKSVSGMNYYACLS++SLVIL PFA+A+EGP+
Sbjct  242  FNMVGFMGAMISNLAFVVRTIFSKKGMKGKSVSGMNYYACLSIMSLVILLPFAVAMEGPK  301

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G+++A+++IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  302  LWAAGWQQAVAEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  361

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF+TPVQP+NALGAAIAILGTF+YSQAK
Sbjct  362  ASIIIFQTPVQPINALGAAIAILGTFIYSQAK  393



>gb|AIR93781.1| glucose 6-phosphate phosphate translocator [Kalanchoe fedtschenkoi]
Length=397

 Score =   221 bits (564),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSV GMNYYACLSM+SL+ILTPF +  EGP+
Sbjct  245  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVGGMNYYACLSMMSLMILTPFTLVAEGPK  304

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQ+GP  IWW++AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKRISVIV
Sbjct  305  MWAAGWDSAVSQVGPQFIWWVVAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRISVIV  364

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TP+QPVN LGAAIA+LGTFLYSQAK
Sbjct  365  TSIIIFSTPIQPVNTLGAAIAVLGTFLYSQAK  396



>gb|KHN03459.1| Glucose-6-phosphate/phosphate translocator 2, chloroplastic [Glycine 
soja]
Length=560

 Score =   225 bits (574),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFV RNIFSKKGMKG SVSGMNYYACL +LSL+ILTPFAIAVEGP+
Sbjct  238  FNMIGFMGAMISNLAFVLRNIFSKKGMKGMSVSGMNYYACLPILSLLILTPFAIAVEGPK  297

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALS+IGPN +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  298  MWAAGWQTALSEIGPNFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  357

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSI+IF TP+QPVNALGAAIAILGTFLYSQ +
Sbjct  358  SSILIFHTPIQPVNALGAAIAILGTFLYSQVQ  389



>gb|EPS63359.1| hypothetical protein M569_11424, partial [Genlisea aurea]
Length=324

 Score =   219 bits (558),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 137/150 (91%), Gaps = 2/150 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+ GFMGAMISNLAFVFRN+FSKKGMK  S    NYYACLSMLSL+ILTPFA+AVEGPQ
Sbjct  177  FNLTGFMGAMISNLAFVFRNVFSKKGMKSVSGM--NYYACLSMLSLLILTPFALAVEGPQ  234

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W VG++KA+SQIGPN IWW+ AQSVFYHLYNQVSYMSL EISPLTFSIGNTMKRISVIV
Sbjct  235  LWAVGWQKAVSQIGPNFIWWVAAQSVFYHLYNQVSYMSLSEISPLTFSIGNTMKRISVIV  294

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            +SI++F TP++P+NALGAAIA+ GTFLYSQ
Sbjct  295  ASILVFHTPLKPINALGAAIALSGTFLYSQ  324



>ref|XP_009408271.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=393

 Score =   221 bits (563),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GF+GAMISNLAFVFRNIFSKKGMKGKSV GMNYYACLS+LSL+ILTPFAIA+EGPQ
Sbjct  241  FNMTGFVGAMISNLAFVFRNIFSKKGMKGKSVGGMNYYACLSILSLLILTPFAIAIEGPQ  300

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MWT G++KALSQIGP+ +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  301  MWTAGWQKALSQIGPHFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  360

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAILGTFLYSQAK
Sbjct  361  SSIIIFHTPVQPVNALGAAIAILGTFLYSQAK  392



>gb|ABJ98060.1| glucose 6-Pi/Pi transporter [Eutrema halophilum]
Length=388

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSM+SL+I+TPFAIAVEGPQ
Sbjct  237  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLLIVTPFAIAVEGPQ  296

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+S+IGPN +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  297  VWAAGWQNAVSEIGPNFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  356

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TP++PVNALGAAIAILGTF+Y Q +
Sbjct  357  ASIIIFHTPIRPVNALGAAIAILGTFIYFQVE  388



>ref|NP_001147439.1| glucose-6-phosphate/phosphate translocator 2 [Zea mays]
 gb|ACG27520.1| glucose-6-phosphate/phosphate translocator 2 [Zea mays]
Length=400

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFV R IFSKKGMKGKSVSGMNYYACLS++SLVIL PFAIA+EGP+
Sbjct  248  FNMVGFMGAMISNLAFVVRTIFSKKGMKGKSVSGMNYYACLSIMSLVILLPFAIAMEGPK  307

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+++IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  308  VWAAGWQTAVAEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  367

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF+TPVQP+NALGAAIAILGTF+YSQAK
Sbjct  368  ASIIIFQTPVQPINALGAAIAILGTFIYSQAK  399



>ref|XP_009765173.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nicotiana sylvestris]
Length=622

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+IGFMGAM+SNLAFVFRNIFSKKGMKGKSV GMNYYACLS++SL+ILTPFAIAVEGPQ
Sbjct  470  FNLIGFMGAMVSNLAFVFRNIFSKKGMKGKSVGGMNYYACLSIMSLLILTPFAIAVEGPQ  529

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W +G++ A+SQIGPN +WW++AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKRISVIV
Sbjct  530  VWALGWQNAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRISVIV  589

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF+ P+QPVNALGAAIAI GTFLYSQAK
Sbjct  590  SSIIIFQNPIQPVNALGAAIAIFGTFLYSQAK  621



>gb|EMS53161.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic [Triticum 
urartu]
Length=459

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = -3

Query  756  GFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQMWTV  577
            GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQMW  
Sbjct  276  GFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQMWAT  335

Query  576  GFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvivssii  397
            G++KAL+ +GPN++WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIVSSII
Sbjct  336  GWQKALADVGPNVLWWIGAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIVSSII  395

Query  396  IFRTPVQPVNALGAAIAILGTFLYSQAK  313
            IFRTPV+PVNALGAAIAI GTFLYSQ +
Sbjct  396  IFRTPVRPVNALGAAIAIFGTFLYSQDR  423



>gb|ABK91085.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN+IWW+ AQSVF     QVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALAEVGPNVIWWIAAQSVFXXXXXQVSYMSLDQISPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  386



>tpg|DAA62951.1| TPA: glucose-6-phosphate/phosphate translocator 2 [Zea mays]
Length=391

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFV R IFSKKGMKGKSVSGMNYYACLS++SLVIL PFA+A+EGP+
Sbjct  239  FNMVGFMGAMISNLAFVVRTIFSKKGMKGKSVSGMNYYACLSIMSLVILLPFAVAMEGPK  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+++IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  299  VWAAGWQTAVAEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF+TPVQP+NALGAAIAILGTF+YSQAK
Sbjct  359  ASIIIFQTPVQPINALGAAIAILGTFIYSQAK  390



>ref|XP_004957889.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
isoform X2 [Setaria italica]
Length=398

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFV R IFSKKGMKGKSVSGMNYYACLS++SLVIL PFAIA+EGP+
Sbjct  236  FNMVGFMGAMISNLAFVVRTIFSKKGMKGKSVSGMNYYACLSIMSLVILLPFAIAMEGPK  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++KA+++IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  296  VWAAGWQKAVAEIGPNFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            +SIIIF+TPVQP+NALGAAIAILGTF+YSQ
Sbjct  356  ASIIIFQTPVQPINALGAAIAILGTFIYSQ  385



>ref|XP_008463436.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Cucumis melo]
Length=396

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL++LTPFAIAVEGPQ
Sbjct  244  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLLLLTPFAIAVEGPQ  303

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALS+IGPN  WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  304  MWAAGWKTALSEIGPNFAWWVTAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  363

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            S+IIIFRTP+QPVNALGAAIA+ GTFLYSQAK
Sbjct  364  SAIIIFRTPIQPVNALGAAIAVFGTFLYSQAK  395



>ref|XP_003547247.2| PREDICTED: beta-glucosidase 47-like [Glycine max]
Length=929

 Score =   228 bits (582),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLS++SL+ILTPFAIAVEGP+
Sbjct  239  FNMIGFMGAMISNLAFVFRNIFSKKGMKGMSVSGMNYYACLSIMSLLILTPFAIAVEGPK  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+SQIGPN +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  299  VWIAGWQTAVSQIGPNFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSI+IF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  359  SSILIFHTPVQPINALGAAIAILGTFLYSQAK  390



>ref|XP_009412013.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=399

 Score =   219 bits (558),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSK+GMKG SVSGMNYYACLS+LSL+ILTPFAIA+EGPQ
Sbjct  247  FNMTGFMGAMISNLAFVFRNIFSKRGMKGTSVSGMNYYACLSILSLLILTPFAIAIEGPQ  306

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALSQIGP+ IWW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  307  MWAAGWQTALSQIGPHFIWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  366

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  367  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  398



>gb|KJB45582.1| hypothetical protein B456_007G313700 [Gossypium raimondii]
Length=411

 Score =   219 bits (558),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  756  GFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQMWTV  577
             FMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEG  MW  
Sbjct  263  SFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGAHMWAA  322

Query  576  GFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvivssii  397
            G+++A+S+IGP  IWW+ AQS+FYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIVSSII
Sbjct  323  GWKEAVSEIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIVSSII  382

Query  396  IFRTPVQPVNALGAAIAILGTFLYSQAK  313
            IFRTPVQP+NALGAAIAILGTFLYSQAK
Sbjct  383  IFRTPVQPINALGAAIAILGTFLYSQAK  410



>ref|XP_002523008.1| Glucose-6-phosphate/phosphate translocator 1, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF39438.1| Glucose-6-phosphate/phosphate translocator 1, chloroplast precursor, 
putative [Ricinus communis]
Length=392

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS+LSL+ILTPFAIAVEGPQ
Sbjct  240  FNMIGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSILSLLILTPFAIAVEGPQ  299

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+SQIGP+ +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  300  LWAAGWKTAVSQIGPHFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  359

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAILGTFLYSQAK
Sbjct  360  SSIIIFHTPVQPVNALGAAIAILGTFLYSQAK  391



>ref|XP_006493943.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Citrus sinensis]
Length=391

 Score =   218 bits (556),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL+ILTPFAIAVEGPQ
Sbjct  239  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLLILTPFAIAVEGPQ  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+SQIGP  IWW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  299  LWAAGYKTAMSQIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  359  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  390



>ref|XP_007153924.1| hypothetical protein PHAVU_003G076600g [Phaseolus vulgaris]
 gb|ESW25918.1| hypothetical protein PHAVU_003G076600g [Phaseolus vulgaris]
Length=389

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKG SVSGMNYYACLS+LSL+ILTPFAIAVEGP+
Sbjct  237  FNMIGFMGAMISNLAFVFRNIFSKKGMKGMSVSGMNYYACLSILSLLILTPFAIAVEGPK  296

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ ALSQIGPN +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  297  LWAAGWQTALSQIGPNFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  356

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSI+IF TP+QPVNALGAAIAILGTFLYSQAK
Sbjct  357  SSILIFHTPIQPVNALGAAIAILGTFLYSQAK  388



>gb|EMT25193.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic [Aegilops 
tauschii]
Length=548

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -3

Query  756  GFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQMWTV  577
            GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQMW  
Sbjct  395  GFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQMWAA  454

Query  576  GFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvivssii  397
            G++KAL+ +GPN++WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIVSSII
Sbjct  455  GWQKALADVGPNVLWWIGAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIVSSII  514

Query  396  IFRTPVQPVNALGAAIAILGTFLYSQ  319
            IFRTPV+PVNALGAAIAI GTFLYSQ
Sbjct  515  IFRTPVRPVNALGAAIAIFGTFLYSQ  540



>dbj|BAD91175.1| plastidic glucose 6-phoaphate/phosphate translocator2 [Mesembryanthemum 
crystallinum]
Length=388

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISN+AFVFRNIFSKKGM G+SVSGMNYYACLSMLSL++LTPFAIAVEGPQ
Sbjct  236  FNMIGFMGAMISNVAFVFRNIFSKKGMNGQSVSGMNYYACLSMLSLLLLTPFAIAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++KA+SQIGPN +WW+ AQS+FYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  296  VWAAGWQKAVSQIGPNFVWWVAAQSIFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIF TP+QPVNALGAAIAILGTF+YSQAK+
Sbjct  356  SSIIIFHTPIQPVNALGAAIAILGTFIYSQAKV  388



>ref|XP_009417236.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=401

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+IL PFAIAVEGPQ
Sbjct  249  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILMPFAIAVEGPQ  308

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+ KA+SQIGP+ +WWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  309  MWAAGWNKAVSQIGPHFVWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  368

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TPVQP+NALGAAIAI GTFLYSQAK
Sbjct  369  ASIIIFHTPVQPINALGAAIAIFGTFLYSQAK  400



>ref|XP_010930664.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Elaeis guineensis]
Length=397

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS+LSL+ILTPFAIAVEGPQ
Sbjct  245  FNMTGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSILSLLILTPFAIAVEGPQ  304

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+++A SQIGP  +WW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  305  MWAAGWQEACSQIGPQFVWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  364

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TP+QP+NALGAAIAILGTFLYSQAK
Sbjct  365  SSIIIFHTPIQPINALGAAIAILGTFLYSQAK  396



>ref|XP_006600314.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Glycine max]
Length=392

 Score =   216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFV RNIFSKKGMKG SVSGMNYYACLS+LSL+ILTPFAIAVEGP+
Sbjct  240  FNMIGFMGAMISNLAFVLRNIFSKKGMKGMSVSGMNYYACLSILSLLILTPFAIAVEGPK  299

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ ALS+IGPN +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  300  MWAAGWQTALSEIGPNFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  359

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSI+IF TP+QPVNALGAAIAILGTFLYSQAK
Sbjct  360  SSILIFHTPIQPVNALGAAIAILGTFLYSQAK  391



>ref|XP_009378791.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=398

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYA LS++SL+IL PFAIAVEGPQ
Sbjct  246  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYALLSIMSLLILIPFAIAVEGPQ  305

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  GF+ A +QIGPN+IWWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  306  MWKAGFDTAFTQIGPNLIWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  365

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAI GTFLYSQ K
Sbjct  366  SSIIIFHTPVQPVNALGAAIAIFGTFLYSQVK  397



>ref|XP_008385998.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Malus domestica]
Length=398

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYA LS++SL+IL PFAIAVEGPQ
Sbjct  246  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYALLSIMSLLILIPFAIAVEGPQ  305

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  GF+ A +QIGPN+IWWM AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  306  MWKAGFDTAFAQIGPNLIWWMAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  365

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAI GTFLYSQ K
Sbjct  366  SSIIIFHTPVQPVNALGAAIAIFGTFLYSQVK  397



>ref|XP_006452222.1| hypothetical protein CICLE_v10008564mg [Citrus clementina]
 gb|ESR65462.1| hypothetical protein CICLE_v10008564mg [Citrus clementina]
Length=391

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL+ILTPFAIAVEGPQ
Sbjct  239  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLLILTPFAIAVEGPQ  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+SQ GP  IWW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  299  LWAAGYKTAMSQNGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  359  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  390



>ref|XP_008454525.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Cucumis melo]
Length=396

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS+LSL++LTPFA AVEGPQ
Sbjct  244  FNMTGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSILSLLLLTPFAFAVEGPQ  303

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+SQIGP+ +WW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  304  LWAAGWQTAVSQIGPHFVWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  363

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQPVNALGAAIA+LGTF+YSQAK
Sbjct  364  SSIIIFRTPVQPVNALGAAIAVLGTFIYSQAK  395



>ref|XP_008778019.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Phoenix dactylifera]
Length=399

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS+LSL IL PFA+AVEGPQ
Sbjct  247  FNMTGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSLLSLFILIPFAVAVEGPQ  306

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+E ALSQIGP  +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  307  MWAAGWENALSQIGPQFVWWIAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  366

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIA+LGTFLYSQ+K
Sbjct  367  SSIIIFHTPVQPINALGAAIAVLGTFLYSQSK  398



>ref|XP_011628432.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Amborella trichopoda]
Length=394

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS+LSL+ILTPFAIAVEGP+
Sbjct  242  FNMIGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSILSLLILTPFAIAVEGPK  301

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL  IGP+ +WW+ AQSVFYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  302  MWAAGWQKALVDIGPHFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  361

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTF YSQAK
Sbjct  362  SSIIIFHTPVQPINALGAAIAILGTFFYSQAK  393



>ref|XP_011660235.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Cucumis sativus]
 gb|KGN66695.1| hypothetical protein Csa_1G660150 [Cucumis sativus]
Length=396

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL++LTPFA AVEGPQ
Sbjct  244  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLLLLTPFAFAVEGPQ  303

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+SQIGP+ +WW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  304  LWAAGWQTAVSQIGPHFVWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  363

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIFRTPVQPVNALGAAIA+LGTF+YSQAK
Sbjct  364  SSIIIFRTPVQPVNALGAAIAVLGTFIYSQAK  395



>gb|ABK91084.1| putative glucose-6-phosphate translocator [Sorghum bicolor]
Length=387

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM+GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS++SLVILTPFAIA+EGPQ
Sbjct  235  FNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQ  294

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL+++GPN+IWW+ AQSVFYHLYNQ         SPLTFSIGNTMKRISVIV
Sbjct  295  MWAAGWQKALAEVGPNVIWWIAAQSVFYHLYNQXXXXXXXXXSPLTFSIGNTMKRISVIV  354

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPV+PVNALGAAIAILGTFLYSQAK
Sbjct  355  SSIIIFHTPVRPVNALGAAIAILGTFLYSQAK  386



>gb|KDO50252.1| hypothetical protein CISIN_1g0163481mg, partial [Citrus sinensis]
Length=148

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -3

Query  753  FMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQMWTVG  574
            FMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL+ILTPFAIAVEGPQ+W  G
Sbjct  1    FMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLLILTPFAIAVEGPQLWAAG  60

Query  573  FEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvivssiiI  394
            ++ A+SQIGP  IWW+ AQS+FYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIVSSIII
Sbjct  61   YKTAMSQIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIVSSIII  120

Query  393  FRTPVQPVNALGAAIAILGTFLYSQAK  313
            F TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  121  FHTPVQPINALGAAIAILGTFLYSQAK  147



>gb|KJB62603.1| hypothetical protein B456_009G425600 [Gossypium raimondii]
Length=388

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISN AFV RNIFSKKGMKGKSVSGMNYYACLS+LSL+ILTPFA+AVEGPQ
Sbjct  236  FNMTGFMGAMISNFAFVLRNIFSKKGMKGKSVSGMNYYACLSLLSLLILTPFAVAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KALS+IGP  IWW+ AQS+FYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  296  MWAAGWQKALSEIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  356  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  387



>gb|KHG14046.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic -like 
protein [Gossypium arboreum]
Length=388

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISN AFV RNIFSKKGMKGKSVSGMNYYACLS+LSL+ILTPFA+AVEGPQ
Sbjct  236  FNMTGFMGAMISNFAFVLRNIFSKKGMKGKSVSGMNYYACLSLLSLLILTPFAVAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KALS+IGP  +WW+ AQS+FYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  296  MWAAGWQKALSEIGPQFVWWVAAQSIFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  356  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  387



>ref|XP_009357419.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009340952.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=394

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+IL PFAIAVEGP+
Sbjct  242  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILIPFAIAVEGPK  301

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+  AL+QIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  302  MWAAGWNTALAQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  361

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TP+QPVNALGAAIAILGTFLYSQ K
Sbjct  362  ASIIIFHTPIQPVNALGAAIAILGTFLYSQGK  393



>gb|ABK24716.1| unknown [Picea sitchensis]
Length=420

 Score =   214 bits (545),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsg-MNYYACLSMLSLVILTPFAIAVEGP  592
            FNM GFMGAMISNLAFVFRNIFSKKGMK     G MNYYACLSM+SL +LTPFA AVEGP
Sbjct  267  FNMTGFMGAMISNLAFVFRNIFSKKGMKAGKSVGGMNYYACLSMMSLALLTPFAFAVEGP  326

Query  591  QMWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvi  412
            Q W  G+++AL  IGP  +WW+ AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKR+SVI
Sbjct  327  QAWAAGWQEALRAIGPQFVWWVAAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRVSVI  386

Query  411  vssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
             SSIIIFRT V+PVN LGAAIAILGTFLYSQAK
Sbjct  387  GSSIIIFRTEVRPVNGLGAAIAILGTFLYSQAK  419



>ref|XP_008384045.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
isoform X2 [Malus domestica]
 ref|XP_008358747.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
isoform X2 [Malus domestica]
Length=394

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+IL PFAIAVEGP+
Sbjct  242  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILIPFAIAVEGPK  301

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+  AL+QIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  302  MWAAGWNTALAQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  361

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TP+QP+NALGAAIAILGTFLYSQ K
Sbjct  362  ASIIIFHTPIQPINALGAAIAILGTFLYSQGK  393



>ref|XP_008439971.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Cucumis melo]
Length=391

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+IGF GAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL+ILTPFAIAVEGP+
Sbjct  239  FNIIGFSGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSLLSLLILTPFAIAVEGPK  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  GF+KALSQIGPN IWW+ AQS+FYHLYNQVSYMSLD+ISPLTFS+GNTMKRI VIV
Sbjct  299  LWAEGFQKALSQIGPNFIWWLGAQSMFYHLYNQVSYMSLDQISPLTFSVGNTMKRIFVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIF TP++PVNA+GAAIAILGTFLYSQAKL
Sbjct  359  SSIIIFHTPIRPVNAIGAAIAILGTFLYSQAKL  391



>ref|XP_010538047.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=389

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL+ILTPFAIAVEGPQ
Sbjct  237  FNMTGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLLILTPFAIAVEGPQ  296

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KALS IGP  + W+ AQSVFYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  297  MWVDGWQKALSDIGPQFVAWVAAQSVFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  356

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  357  SSIIIFHTPVQPINALGAAIAILGTFLYSQAK  388



>gb|ABO87607.1| chloroplast glucose-6-phosphate/phosphate translocator [Pisum 
sativum]
Length=385

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISN+AFVFRNIFSKKGMKG SVSGMNYYACLS+LSL++LTPFAIAVEGP 
Sbjct  233  FNMIGFMGAMISNVAFVFRNIFSKKGMKGMSVSGMNYYACLSILSLLLLTPFAIAVEGPA  292

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++ A+SQIGPN +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGN MKRISVIV
Sbjct  293  LWAAGWQTAVSQIGPNFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNXMKRISVIV  352

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSI+IFRTP+QP NALGAAIAILGTFLYSQAK
Sbjct  353  SSILIFRTPIQPNNALGAAIAILGTFLYSQAK  384



>ref|XP_008224795.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Prunus mume]
Length=393

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+IL PFAIAVEGP+
Sbjct  241  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILIPFAIAVEGPK  300

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G+  AL+QIGPN +WW+ AQS+FYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  301  VWAAGWNTALAQIGPNFVWWVAAQSIFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  360

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAILGTFLYSQ K
Sbjct  361  SSIIIFHTPVQPVNALGAAIAILGTFLYSQGK  392



>ref|XP_007211968.1| hypothetical protein PRUPE_ppa006608mg [Prunus persica]
 gb|EMJ13167.1| hypothetical protein PRUPE_ppa006608mg [Prunus persica]
Length=403

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+IL PFAIAVEGP+
Sbjct  240  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILIPFAIAVEGPK  299

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G+  AL+QIGPN +WW+ AQS+FYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  300  VWAAGWNTALAQIGPNFVWWVAAQSIFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  359

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQPVNALGAAIAILGTFLYSQ K
Sbjct  360  SSIIIFHTPVQPVNALGAAIAILGTFLYSQRK  391



>ref|XP_008812143.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Phoenix dactylifera]
Length=417

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS+LSL+ILTPFAIAVEGPQ
Sbjct  265  FNMTGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSILSLLILTPFAIAVEGPQ  324

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++ A+SQIGP+ +WW+ AQS+FYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  325  MWAAGWQMAISQIGPHFVWWVAAQSIFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  384

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TP+QP+NALGAAIAI GTF YSQAK
Sbjct  385  SSIIIFHTPIQPINALGAAIAIFGTFFYSQAK  416



>ref|XP_009340951.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=398

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+IL PFAIAVEGP+
Sbjct  242  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILIPFAIAVEGPK  301

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+  AL+QIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  302  MWAAGWNTALAQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  361

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            +SIIIF TP+QPVNALGAAIAILGTFLYSQ
Sbjct  362  ASIIIFHTPIQPVNALGAAIAILGTFLYSQ  391



>ref|XP_009397167.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009397168.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=393

 Score =   211 bits (537),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            F+M GFMGAMISNLAFVFRNIFSK+GMK  SVSGMNYYACLSMLSL+IL PFAI VEGPQ
Sbjct  241  FDMTGFMGAMISNLAFVFRNIFSKRGMKVTSVSGMNYYACLSMLSLLILLPFAIGVEGPQ  300

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G+ +A+S IGP+ +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  301  LWAAGWHEAISHIGPHFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  360

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSII+F TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  361  SSIIVFHTPVQPINALGAAIAILGTFLYSQAK  392



>gb|ERN19519.1| hypothetical protein AMTR_s00062p00036220 [Amborella trichopoda]
Length=403

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSK+GMKGKSVSGMNYYACLS+LSL+ILTPFAIAVEGP+
Sbjct  242  FNMIGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSILSLLILTPFAIAVEGPK  301

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KAL  IGP+ +WW+ AQSVFYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  302  MWAAGWQKALVDIGPHFVWWVAAQSVFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  361

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPVQP+NALGAAIAILGTF YSQ
Sbjct  362  SSIIIFHTPVQPINALGAAIAILGTFFYSQ  391



>ref|XP_004240145.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Solanum lycopersicum]
Length=401

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+IGFMGAMISNLAFVFRNIFSKKGMKGKSV GMNYYACLSM+SL+ILTPFAIAVEGPQ
Sbjct  249  FNLIGFMGAMISNLAFVFRNIFSKKGMKGKSVGGMNYYACLSMMSLLILTPFAIAVEGPQ  308

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W +G++ A++QIGPN IWW++AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKRISVIV
Sbjct  309  VWALGWQNAVTQIGPNFIWWVVAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRISVIV  368

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF+ P+QP+NALGAAIAILGTFLYSQAK
Sbjct  369  SSIIIFQIPIQPINALGAAIAILGTFLYSQAK  400



>ref|XP_006657775.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like, 
partial [Oryza brachyantha]
Length=325

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGMKG+SVSGMNYYACLSMLSL+IL PFA+A+EGP+
Sbjct  173  FNMTGFMGAMISNLAFVFRNIFSKKGMKGRSVSGMNYYACLSMLSLLILLPFALAMEGPK  232

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G+ KA+++IGPN +WW+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  233  VWAAGWHKAVAEIGPNFLWWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  292

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            +SIIIF TPVQP+NALGAAIAILGTF+YSQAK
Sbjct  293  ASIIIFHTPVQPINALGAAIAILGTFIYSQAK  324



>gb|KJB62604.1| hypothetical protein B456_009G425600 [Gossypium raimondii]
Length=405

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISN AFV RNIFSKKGMKGKSVSGMNYYACLS+LSL+ILTPFA+AVEGPQ
Sbjct  236  FNMTGFMGAMISNFAFVLRNIFSKKGMKGKSVSGMNYYACLSLLSLLILTPFAVAVEGPQ  295

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G++KALS+IGP  IWW+ AQS+FYHLYNQVSYMSLDEISPLTFS+GNTMKRISVIV
Sbjct  296  MWAAGWQKALSEIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSVGNTMKRISVIV  355

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIF TPVQP+NALGAAIAILGTFLYSQ
Sbjct  356  SSIIIFHTPVQPINALGAAIAILGTFLYSQ  385



>ref|XP_008384044.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
isoform X1 [Malus domestica]
 ref|XP_008358746.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
isoform X1 [Malus domestica]
Length=399

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+IL PFAIAVEGP+
Sbjct  242  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILIPFAIAVEGPK  301

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+  AL+QIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKRISVIV
Sbjct  302  MWAAGWNTALAQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIV  361

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            +SIIIF TP+QP+NALGAAIAILGTFLYSQ
Sbjct  362  ASIIIFHTPIQPINALGAAIAILGTFLYSQ  391



>ref|XP_002960055.1| hypothetical protein SELMODRAFT_70870, partial [Selaginella moellendorffii]
 gb|EFJ37594.1| hypothetical protein SELMODRAFT_70870, partial [Selaginella moellendorffii]
Length=320

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsg-MNYYACLSMLSLVILTPFAIAVEGP  592
            FNM GFMGAMISN+AFVFRNIFSKKGMK     G +NYYACLS++SL++LTPFAIA+EGP
Sbjct  169  FNMTGFMGAMISNVAFVFRNIFSKKGMKAGKAVGGLNYYACLSIMSLLLLTPFAIAMEGP  228

Query  591  QMWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvi  412
            Q+W  G++ A+  +GP+ IWW++AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKR+SVI
Sbjct  229  QLWVSGWQNAVHNVGPHFIWWVVAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRVSVI  288

Query  411  vssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            VSSIIIFRTPVQ +N +GAAIAILGTFLYSQ
Sbjct  289  VSSIIIFRTPVQLINGVGAAIAILGTFLYSQ  319



>gb|AAC08526.1| glucose-6-phosphate/phosphate-translocator precursor [Solanum 
tuberosum]
Length=393

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+IGFMGAMISNLAFVFRNIFSKKGMKGKSV GMNYYACLSM+SL+IL PFAIAVEGPQ
Sbjct  241  FNLIGFMGAMISNLAFVFRNIFSKKGMKGKSVGGMNYYACLSMMSLLILIPFAIAVEGPQ  300

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W +G++ A+SQIGPN IWW++AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKRISVIV
Sbjct  301  VWALGWQNAVSQIGPNFIWWVVAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRISVIV  360

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF+ P+QP+NALGAAIAILGTFLYSQAK
Sbjct  361  SSIIIFQIPIQPINALGAAIAILGTFLYSQAK  392



>ref|XP_006356920.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Solanum tuberosum]
 gb|AAO19451.1| glucose-6-phosphate/phosphate translocator 2 [Solanum tuberosum]
Length=401

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+IGFMGAMISNLAFVFRNIFSKKGMKGKSV GMNYYACLSM+SL+IL PFAIAVEGPQ
Sbjct  249  FNLIGFMGAMISNLAFVFRNIFSKKGMKGKSVGGMNYYACLSMMSLLILIPFAIAVEGPQ  308

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W +G++ A+SQIGPN IWW++AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKRISVIV
Sbjct  309  VWALGWQNAVSQIGPNFIWWVVAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRISVIV  368

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF+ P+QP+NALGAAIAILGTFLYSQAK
Sbjct  369  SSIIIFQIPIQPINALGAAIAILGTFLYSQAK  400



>ref|XP_009619233.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=401

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+ GFMGAMISNLAFVFRNIFSKKGMKGKSV GMNYYACLSM+SL+ILTPFAIAVEGPQ
Sbjct  249  FNLTGFMGAMISNLAFVFRNIFSKKGMKGKSVGGMNYYACLSMMSLLILTPFAIAVEGPQ  308

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W +G++ A+SQIGPN IWW++AQSV YHLYNQVSYMSL+EISPLTFSIGNT KRISVIV
Sbjct  309  VWALGWQNAVSQIGPNFIWWVVAQSVLYHLYNQVSYMSLNEISPLTFSIGNTTKRISVIV  368

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF+  +QPVNALGAAIAI GTFLYSQAK
Sbjct  369  SSIIIFQISIQPVNALGAAIAIFGTFLYSQAK  400



>ref|XP_004293269.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=402

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+IL PFAIAVEGPQ
Sbjct  243  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILIPFAIAVEGPQ  302

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
             W  G++ AL+QIGPN +WW+ AQS+FYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  303  AWAAGWKTALAQIGPNFVWWVAAQSIFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  362

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            SSIIIFRTP+QPVN LGAAIAI GTFLYSQ
Sbjct  363  SSIIIFRTPIQPVNCLGAAIAIFGTFLYSQ  392



>ref|XP_002984083.1| hypothetical protein SELMODRAFT_45116, partial [Selaginella moellendorffii]
 gb|EFJ15095.1| hypothetical protein SELMODRAFT_45116, partial [Selaginella moellendorffii]
Length=320

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsg-MNYYACLSMLSLVILTPFAIAVEGP  592
            FNM GFMGAMISN+AFVFRNIFSKKGMK     G +NYYACLS++SL++LTPF+IA+EGP
Sbjct  169  FNMTGFMGAMISNVAFVFRNIFSKKGMKAGKAVGGLNYYACLSIMSLLLLTPFSIAMEGP  228

Query  591  QMWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvi  412
            Q+W  G++ A+  +GP+ IWW++AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKR+SVI
Sbjct  229  QLWVSGWQNAVHNVGPHFIWWVVAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRVSVI  288

Query  411  vssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            VSSIIIFRTPVQ +N +GAAIAILGTFLYSQ
Sbjct  289  VSSIIIFRTPVQLINGVGAAIAILGTFLYSQ  319



>ref|XP_010545200.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Tarenaya hassleriana]
Length=391

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFV RNIFSKKGMKGKSVSGMNYYACLS+LSL+ILTPFA AVEGPQ
Sbjct  239  FNMTGFMGAMISNLAFVLRNIFSKKGMKGKSVSGMNYYACLSLLSLLILTPFAFAVEGPQ  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G++KALS IGP  I W+ AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV
Sbjct  299  IWIDGWQKALSDIGPQFIAWVAAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            SSIIIF TPVQP+NALGAAIAILGTFLYSQAK
Sbjct  359  SSIIIFSTPVQPINALGAAIAILGTFLYSQAK  390



>ref|XP_004134753.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic 
[Cucumis sativus]
 gb|KGN49125.1| hypothetical protein Csa_6G514860 [Cucumis sativus]
Length=391

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+IGF GAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLS+LSL+ILTPFAIAVEGP+
Sbjct  239  FNIIGFSGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSLLSLLILTPFAIAVEGPK  298

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            +W  G + AL+QIGPN IWW+ AQS+FYHLYNQVSYMSLD+ISPLTFS+GNTMKRI VIV
Sbjct  299  LWAEGLQNALAQIGPNFIWWLGAQSMFYHLYNQVSYMSLDQISPLTFSVGNTMKRIFVIV  358

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SSIIIF TP++PVN +GAAIAILGTFLYSQAKL
Sbjct  359  SSIIIFHTPIRPVNGIGAAIAILGTFLYSQAKL  391



>ref|XP_002960052.1| hypothetical protein SELMODRAFT_270155 [Selaginella moellendorffii]
 gb|EFJ37591.1| hypothetical protein SELMODRAFT_270155 [Selaginella moellendorffii]
Length=390

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsg-MNYYACLSMLSLVILTPFAIAVEGP  592
            FNM GF+GAM+SN+AFVFRNIFSKKGMK     G +NYYACLS++SLV+LTPFA+ VE P
Sbjct  237  FNMTGFVGAMVSNIAFVFRNIFSKKGMKAGKAVGGLNYYACLSIMSLVLLTPFALVVEPP  296

Query  591  QMWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvi  412
            Q W  G+  A+  +GP + WW++AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKR+SVI
Sbjct  297  QQWISGWNVAVQNVGPQLFWWVMAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRVSVI  356

Query  411  vssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            VSSIIIFRTP+QP+NA+GAAIA+LGTF YSQAK
Sbjct  357  VSSIIIFRTPIQPINAVGAAIAVLGTFFYSQAK  389



>ref|XP_002984086.1| hypothetical protein SELMODRAFT_156336 [Selaginella moellendorffii]
 gb|EFJ15098.1| hypothetical protein SELMODRAFT_156336 [Selaginella moellendorffii]
Length=390

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsg-MNYYACLSMLSLVILTPFAIAVEGP  592
            FNM GF+GAM+SN+AFVFRNIFSKKGMK     G +NYYACLS++SLV+LTPFA+ VE P
Sbjct  237  FNMTGFVGAMVSNIAFVFRNIFSKKGMKAGKAVGGLNYYACLSIMSLVLLTPFALVVEPP  296

Query  591  QMWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvi  412
            Q W  G+  A+  +GP + WW++AQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKR+SVI
Sbjct  297  QQWISGWNVAVQNVGPQLFWWVMAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRVSVI  356

Query  411  vssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            VSSIIIFRTP+QP+NA+GAAIA+LGTF YSQAK
Sbjct  357  VSSIIIFRTPIQPINAVGAAIAVLGTFFYSQAK  389



>ref|XP_001764779.1| predicted protein [Physcomitrella patens]
 gb|EDQ70478.1| predicted protein [Physcomitrella patens]
Length=298

 Score =   203 bits (516),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsg-MNYYACLSMLSLVILTPFAIAVEGP  592
            FNM GF+GAM+SN+AFVFRNIFSKKGM      G MNYYACLSM+SLV+LTPFA+AVEGP
Sbjct  145  FNMTGFVGAMVSNIAFVFRNIFSKKGMTTGKSVGGMNYYACLSMMSLVLLTPFAVAVEGP  204

Query  591  QMWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvi  412
            + W  G++ A + +GP I WW++AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKR++VI
Sbjct  205  KAWMAGWDVANATVGPQIFWWVVAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRVTVI  264

Query  411  vssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            VSSIIIF T V+PVNA+GAAIAILGTFLYSQ
Sbjct  265  VSSIIIFHTQVRPVNAVGAAIAILGTFLYSQ  295



>ref|XP_001775355.1| predicted protein [Physcomitrella patens]
 gb|EDQ59825.1| predicted protein [Physcomitrella patens]
Length=351

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsg-MNYYACLSMLSLVILTPFAIAVEGP  592
            FNM GF+GAM+SN+AFVFRNIFSKKGM      G MNYYACLSM+SLV LTPFAIAVEGP
Sbjct  183  FNMTGFVGAMVSNIAFVFRNIFSKKGMTSGKSVGGMNYYACLSMMSLVFLTPFAIAVEGP  242

Query  591  QMWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvi  412
            + WT G++ A   +GP I WW++AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKR++VI
Sbjct  243  KSWTAGWDAANLTVGPKIFWWVVAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRVTVI  302

Query  411  vssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            VSSIIIF T VQP+NA+GAAIAI GTFLYSQ
Sbjct  303  VSSIIIFHTQVQPMNAVGAAIAIFGTFLYSQ  333



>gb|AAT08746.1| glucose-6-phosphate/phosphate-translocator [Hyacinthus orientalis]
Length=120

 Score =   189 bits (481),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -3

Query  663  NYYACLSMLSLVILTPFAIAVEGPQMWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVS  484
            NYYACLSMLSL+ILTPFAIA   P MW VG++ A+SQIGPN IWW+ AQS+FYHLYNQVS
Sbjct  3    NYYACLSMLSLLILTPFAIAERAPSMWAVGWQNAMSQIGPNFIWWVAAQSIFYHLYNQVS  62

Query  483  YMSLDEISPLTFSIGNTMKRisvivssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            YMSLDEISPLTFSIGNTMKRISVIVSSIIIF TPVQPVNALGAAIAILGTFLYSQAK
Sbjct  63   YMSLDEISPLTFSIGNTMKRISVIVSSIIIFHTPVQPVNALGAAIAILGTFLYSQAK  119



>ref|XP_001778585.1| predicted protein [Physcomitrella patens]
 gb|EDQ56615.1| predicted protein, partial [Physcomitrella patens]
Length=317

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsg-MNYYACLSMLSLVILTPFAIAVEGP  592
            FNM GF GAMISN+AFVFRNIFSKKGM      G MNYYACLSM+SLV LTPFA AVEGP
Sbjct  167  FNMTGFAGAMISNIAFVFRNIFSKKGMSKGKNVGGMNYYACLSMMSLVFLTPFAFAVEGP  226

Query  591  QMWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvi  412
            + WT G++ A    G  I+WW++AQSVFYHLYNQVSYMSL+EISPLTFSIGNTMKR++VI
Sbjct  227  KAWTTGWQAARLAHGNQILWWVVAQSVFYHLYNQVSYMSLNEISPLTFSIGNTMKRVTVI  286

Query  411  vssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            VSSIIIF T V P+NALGAAIAI GTFLYSQ
Sbjct  287  VSSIIIFHTKVLPINALGAAIAIFGTFLYSQ  317



>ref|XP_001755644.1| predicted protein [Physcomitrella patens]
 gb|EDQ79704.1| predicted protein, partial [Physcomitrella patens]
Length=313

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgM-NYYACLSMLSLVILTPFAIAVEGP  592
            FNM GF GAMISN+ FVFRNIFSKKGM      G  NYYACLSM+SLV LTPFAIAVEGP
Sbjct  157  FNMTGFTGAMISNIFFVFRNIFSKKGMSKSKKMGGMNYYACLSMMSLVFLTPFAIAVEGP  216

Query  591  QMWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvi  412
            + WT G++ A    G  + WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTMKR++VI
Sbjct  217  RAWTAGWQAATLAHGDQVFWWVVAQSVFYHLYNQVSYMSLDKISPLTFSVGNTMKRVTVI  276

Query  411  vssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            VSSII+F T V P+NA+GAAIA+ GTFLYSQ  L
Sbjct  277  VSSIIMFNTKVSPINAVGAAIAVFGTFLYSQVDL  310



>gb|ACJ84767.1| unknown [Medicago truncatula]
Length=119

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -3

Query  663  NYYACLSMLSLVILTPFAIAVEGPQMWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVS  484
            NYYACLS+LSL ILTPFAIAVEGP MW  G++ AL++IGP  +WW+ AQS+FYHLYNQVS
Sbjct  2    NYYACLSILSLAILTPFAIAVEGPAMWAAGYKTALAEIGPQFLWWVAAQSIFYHLYNQVS  61

Query  483  YMSLDEISPLTFSIGNTMKRisvivssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            YMSLDEISPLTFSIGNTMKRISVIVSSIIIF TP+QPVNALGAAIA+ GTFLY QAK
Sbjct  62   YMSLDEISPLTFSIGNTMKRISVIVSSIIIFHTPIQPVNALGAAIAVFGTFLYFQAK  118



>ref|XP_002965611.1| hypothetical protein SELMODRAFT_83926 [Selaginella moellendorffii]
 gb|EFJ33031.1| hypothetical protein SELMODRAFT_83926 [Selaginella moellendorffii]
Length=410

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 124/150 (83%), Gaps = 1/150 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            F+MIGF+GA ISN+AFVFRN FSK+GM  K     NYY CL ++SL ILTPFAIA+EG  
Sbjct  239  FDMIGFLGANISNVAFVFRNFFSKRGMSKKVSGL-NYYGCLCIMSLAILTPFAIAIEGFH  297

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
             W VG++ A   IGP  +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKR+SVI 
Sbjct  298  NWNVGWQTASRAIGPPFLWWVIAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRVSVIA  357

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            +SI IF+TPVQPVN +GAAIAI GTFLYSQ
Sbjct  358  ASIFIFKTPVQPVNLIGAAIAIFGTFLYSQ  387



>ref|XP_002962396.1| hypothetical protein SELMODRAFT_79231 [Selaginella moellendorffii]
 gb|EFJ35859.1| hypothetical protein SELMODRAFT_79231 [Selaginella moellendorffii]
Length=410

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 124/150 (83%), Gaps = 1/150 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            F+MIGF+GA +SN+AFVFRN FSK+GM  K     NYY CL ++SL ILTPFAIA+EG  
Sbjct  239  FDMIGFLGANVSNVAFVFRNFFSKRGMSKKVSGL-NYYGCLCIMSLAILTPFAIAIEGFH  297

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
             W VG++ A   IGP  +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKR+SVI 
Sbjct  298  NWNVGWQTASRAIGPPFLWWVIAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRVSVIA  357

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQ  319
            +SI IF+TPVQPVN +GAAIAI GTFLYSQ
Sbjct  358  ASIFIFKTPVQPVNLIGAAIAIFGTFLYSQ  387



>gb|KJB67151.1| hypothetical protein B456_010G178300 [Gossypium raimondii]
Length=397

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNM GFMGAMISNLAFVFRNIFSKKGM GKSVSGMNYYACLSMLSL+ILTPFAIAVEG Q
Sbjct  245  FNMTGFMGAMISNLAFVFRNIFSKKGMNGKSVSGMNYYACLSMLSLLILTPFAIAVEGHQ  304

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKR  424
            +W VG++KA+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKR
Sbjct  305  LWAVGWQKAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKR  359



>dbj|BAD94591.1| Similar to glucose-6-phosphate/phosphate-translocator [Arabidopsis 
thaliana]
Length=110

 Score =   174 bits (442),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -3

Query  639  LSLVILTPFAIAVEGPQMWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEIS  460
            +SLVILTPF+IAVEGPQMW  G++ A+SQ+GPN +WW++AQSVFYHLYNQVSYMSLD+IS
Sbjct  1    VSLVILTPFSIAVEGPQMWAAGWQNAVSQVGPNFVWWVVAQSVFYHLYNQVSYMSLDQIS  60

Query  459  PLTFSIGNTMKRisvivssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
            PLTFSIGNTMKRISVIV+SIIIF TP+QPVNALGAAIAI GTFLYSQAK
Sbjct  61   PLTFSIGNTMKRISVIVASIIIFHTPIQPVNALGAAIAIFGTFLYSQAK  109



>gb|KHN03064.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic, 
partial [Glycine soja]
Length=267

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGF+GAMISNLAFV RNIFSKKGMKG SVSGMNYYACL +LSL+ILTPFAIAVEGP+
Sbjct  151  FNMIGFVGAMISNLAFVLRNIFSKKGMKGMSVSGMNYYACLPILSLLILTPFAIAVEGPK  210

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKR  424
            MW  G++ ALS+IGPN +WW+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKR
Sbjct  211  MWAAGWQTALSEIGPNFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKR  265



>ref|XP_006391960.1| hypothetical protein EUTSA_v10023518mg [Eutrema salsugineum]
 gb|ESQ29246.1| hypothetical protein EUTSA_v10023518mg [Eutrema salsugineum]
Length=355

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 114/153 (75%), Gaps = 32/153 (21%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FN+IGFMGAMISNLAFVFRNIF                                + +GP 
Sbjct  235  FNLIGFMGAMISNLAFVFRNIF--------------------------------SKKGPT  262

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisviv  409
            MW  G+E A+SQIGPN +WW++AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIV
Sbjct  263  MWAAGWENAVSQIGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIV  322

Query  408  ssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            +SIIIF TP+QPVNALGAAIAILGTFLYSQAK+
Sbjct  323  ASIIIFHTPIQPVNALGAAIAILGTFLYSQAKM  355



>ref|XP_010475728.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Camelina sativa]
Length=384

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSL+ILTPFAIAVEGPQ
Sbjct  243  FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQ  302

Query  588  MWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTM  430
            MW  G++ AL+ +GP  +WW++AQSVFYHLYNQVSYMSLD+ISPLTFS+GNTM
Sbjct  303  MWVDGWQNALAAVGPQFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTM  355



>gb|AES92596.2| glucose 6-phosphate/phosphate translocator 1 [Medicago truncatula]
Length=1029

 Score =   177 bits (449),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 138/179 (77%), Gaps = 29/179 (16%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISN+AFVFRNIFSKKGMKG SVSGMNYYACLS+LSL++LTPFAIAVEGP 
Sbjct  240  FNMIGFMGAMISNVAFVFRNIFSKKGMKGMSVSGMNYYACLSILSLLLLTPFAIAVEGPT  299

Query  588  MWTVGFEKALSQIGPN--------------------------IIWWMLAQSVFYHLYNQV  487
            MW  G++ A+S   PN                           + W+ AQSVFYHLYNQV
Sbjct  300  MWAAGWQTAVS---PNWSQFCLVSITIYKSQPIAVCYFISIISLRWVAAQSVFYHLYNQV  356

Query  486  SYMSLDEISPLTFSIGNTMKRisvivssiiIFRTPVQPVNALGAAIAILGTFLYSQAKL  310
            SYMSLD+ISPLTFSIGNTMKRISVIVSSIIIF TP+QP NALGAAIAILGTFLYSQ + 
Sbjct  357  SYMSLDQISPLTFSIGNTMKRISVIVSSIIIFHTPIQPNNALGAAIAILGTFLYSQMRF  415



>ref|XP_003610399.1| Glucose-6-phosphate/phosphate translocator [Medicago truncatula]
Length=1051

 Score =   174 bits (440),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 138/198 (70%), Gaps = 45/198 (23%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsgMNYYACLSMLSLVILTPFAIAVEGPQ  589
            FNMIGFMGAMISN+AFVFRNIFSKKGMKG SVSGMNYYACLS+LSL++LTPFAIAVEGP 
Sbjct  240  FNMIGFMGAMISNVAFVFRNIFSKKGMKGMSVSGMNYYACLSILSLLLLTPFAIAVEGPT  299

Query  588  MWTVGFEKALSQ---------------------------------------------IGP  544
            MW  G++ A+S                                              +G 
Sbjct  300  MWAAGWQTAVSPNWSQFCLLFFPNRHLTMNIDNASSKGSMEELQELFYSVCHWTNELMGC  359

Query  543  NIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvivssiiIFRTPVQPVNA  364
            N   W+ AQSVFYHLYNQVSYMSLD+ISPLTFSIGNTMKRISVIVSSIIIF TP+QP NA
Sbjct  360  NFFRWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIVSSIIIFHTPIQPNNA  419

Query  363  LGAAIAILGTFLYSQAKL  310
            LGAAIAILGTFLYSQ + 
Sbjct  420  LGAAIAILGTFLYSQMRF  437



>gb|AEW08100.1| hypothetical protein 0_18849_01, partial [Pinus lambertiana]
Length=164

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkg-ksvsgMNYYACLSMLSLVILTPFAIAVEGP  592
            FN  G  GAMISN+ FVFRNI+SKK +K  K + G+N Y C+++LSL  L P +I VEG 
Sbjct  4    FNFGGLWGAMISNVGFVFRNIYSKKSLKKFKEIDGLNLYGCITILSLFYLFPVSIVVEGS  63

Query  591  QMWTVGFEKALSQIGPNIIW-WMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisv  415
            Q W  G++KA++ IG N  + W++   VFYHLYNQ SY +LDEISPLTFS+GNTMKR+ V
Sbjct  64   Q-WVAGYQKAIATIGNNTFYIWVILSGVFYHLYNQSSYQALDEISPLTFSVGNTMKRVVV  122

Query  414  ivssiiIFRTPVQPVNALGAAIAILGTFLYSQA  316
            IV++I++FR P++P+NALG+AIAILGTFLYSQA
Sbjct  123  IVATILVFRNPIKPLNALGSAIAILGTFLYSQA  155



>gb|AFG51543.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
Length=164

 Score =   160 bits (404),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkg-ksvsgMNYYACLSMLSLVILTPFAIAVEGP  592
            FN  G  GAMISN+ FVFRNI+SKK ++  K + G+N Y C+++LSL  L P AI VEG 
Sbjct  4    FNFGGLWGAMISNVGFVFRNIYSKKSLQKFKEIDGLNLYGCITILSLFYLFPLAIVVEGS  63

Query  591  QMWTVGFEKALSQIGPNIIW-WMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisv  415
            Q W  G++KA++ IG +  + W++   +FYHLYNQ SY +LDEISPLTFS+GNTMKR+ V
Sbjct  64   Q-WVAGYQKAIATIGNSTFYIWVIVSGIFYHLYNQTSYQALDEISPLTFSVGNTMKRVVV  122

Query  414  ivssiiIFRTPVQPVNALGAAIAILGTFLYSQA  316
            IV+++++FR PV+P+NALG+AIAILGTFLYSQA
Sbjct  123  IVATVLVFRNPVKPLNALGSAIAILGTFLYSQA  155



>gb|AEW08101.1| hypothetical protein 0_18849_01, partial [Pinus radiata]
Length=164

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkg-ksvsgMNYYACLSMLSLVILTPFAIAVEGP  592
            FN  G  GAMISN+ FVFRNI+SKK ++  K + G+N Y C+++LSL  L P AI VEG 
Sbjct  4    FNFGGLWGAMISNVGFVFRNIYSKKSLQKFKEIDGLNLYGCITILSLFYLFPAAIVVEGS  63

Query  591  QMWTVGFEKALSQIGPNIIW-WMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisv  415
            Q W  G++KA++ IG +  + W++   +FYHLYNQ SY +LDEISPLTFS+GNTMKR+ V
Sbjct  64   Q-WAAGYQKAIAAIGNSTFYIWVIVSGIFYHLYNQTSYQALDEISPLTFSVGNTMKRVVV  122

Query  414  ivssiiIFRTPVQPVNALGAAIAILGTFLYSQA  316
            IV+++++FR PV+P+NALG+AIAILGTFLYSQA
Sbjct  123  IVATVLVFRNPVKPLNALGSAIAILGTFLYSQA  155



>gb|AFG51542.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51544.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51545.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51546.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51547.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51548.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51549.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51550.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51551.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51552.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51553.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51554.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51555.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51556.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51557.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51558.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
 gb|AFG51559.1| hypothetical protein 0_18849_01, partial [Pinus taeda]
Length=164

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkg-ksvsgMNYYACLSMLSLVILTPFAIAVEGP  592
            FN  G  GAMISN+ FVFRNI+SKK ++  K + G+N Y C+++LSL  L P AI VEG 
Sbjct  4    FNFGGLWGAMISNVGFVFRNIYSKKSLQKFKEIDGLNLYGCITILSLFYLFPAAIVVEGS  63

Query  591  QMWTVGFEKALSQIGPNIIW-WMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisv  415
            Q W  G++KA++ IG +  + W++   +FYHLYNQ SY +LDEISPLTFS+GNTMKR+ V
Sbjct  64   Q-WVAGYQKAIATIGNSTFYIWVIVSGIFYHLYNQTSYQALDEISPLTFSVGNTMKRVVV  122

Query  414  ivssiiIFRTPVQPVNALGAAIAILGTFLYSQA  316
            IV+++++FR PV+P+NALG+AIAILGTFLYSQA
Sbjct  123  IVATVLVFRNPVKPLNALGSAIAILGTFLYSQA  155



>ref|XP_001751511.1| predicted protein [Physcomitrella patens]
 gb|EDQ83828.1| predicted protein [Physcomitrella patens]
Length=317

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = -3

Query  768  FNMIGFMGAMISNLAFVFRNIFskkgmkgksvsg-MNYYACLSMLSLVILTPFAIAVEGP  592
            F+MIGF+GAM+SN+AFVFRNI SK+GMK     G MNYYACLSM+S V+L PFA  VEGP
Sbjct  165  FSMIGFLGAMLSNIAFVFRNIASKRGMKAGKSVGGMNYYACLSMMSFVLLLPFAFVVEGP  224

Query  591  QMWTVGFEKALSQIGPNIIWWMLAQSVFYHLYNQVSYMSLDEISPLTFSIGNTMKRisvi  412
            ++W  G+  A+  +G     W++ Q + YHL+NQVSYMSLD+ISPL+FSIGNTMKR++VI
Sbjct  225  KVWAAGWTTAIQSVGRQFPLWVVLQCLLYHLHNQVSYMSLDQISPLSFSIGNTMKRVTVI  284

Query  411  vssiiIFRTPVQPVNALGAAIAILGTFLYSQAK  313
             +SI+IFR PV P+NA+GAAIAILGTF YSQAK
Sbjct  285  ATSILIFRNPVSPINAIGAAIAILGTFFYSQAK  317



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1524835419250