BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8286

Length=801
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP21507.1|  unnamed protein product                                171   6e-47   Coffea canephora [robusta coffee]
ref|XP_009603015.1|  PREDICTED: heat stress transcription factor ...    167   1e-45   Nicotiana tomentosiformis
ref|XP_011076201.1|  PREDICTED: heat stress transcription factor ...    165   9e-45   Sesamum indicum [beniseed]
ref|XP_009803855.1|  PREDICTED: heat stress transcription factor ...    159   2e-42   Nicotiana sylvestris
ref|XP_007152318.1|  hypothetical protein PHAVU_004G119600g             149   8e-39   Phaseolus vulgaris [French bean]
ref|XP_007218740.1|  hypothetical protein PRUPE_ppa009180mg             142   2e-36   Prunus persica
ref|XP_010107420.1|  Heat stress transcription factor B-2a              142   3e-36   Morus notabilis
ref|XP_004234371.1|  PREDICTED: heat stress transcription factor ...    141   1e-35   Solanum lycopersicum
ref|XP_008234272.1|  PREDICTED: heat stress transcription factor ...    138   5e-35   Prunus mume [ume]
ref|XP_011084402.1|  PREDICTED: heat stress transcription factor ...    137   2e-34   Sesamum indicum [beniseed]
ref|XP_003555375.1|  PREDICTED: heat stress transcription factor ...    136   3e-34   
ref|XP_004515711.1|  PREDICTED: heat stress transcription factor ...    135   2e-33   Cicer arietinum [garbanzo]
ref|XP_006353396.1|  PREDICTED: heat stress transcription factor ...    134   3e-33   
gb|AFQ93677.1|  heat shock transcription factor HSFB2a                  131   4e-32   Glycine max [soybeans]
ref|XP_007038632.1|  Heat shock transcription factor B2A, putative      130   6e-32   
ref|XP_009371307.1|  PREDICTED: heat stress transcription factor ...    129   1e-31   
ref|XP_003533211.1|  PREDICTED: heat stress transcription factor ...    130   1e-31   
gb|KHN31519.1|  Heat stress transcription factor B-2a                   124   1e-30   Glycine soja [wild soybean]
ref|XP_003535620.1|  PREDICTED: heat stress transcription factor ...    124   8e-30   
ref|XP_003548209.1|  PREDICTED: heat stress transcription factor ...    124   2e-29   
ref|XP_012090286.1|  PREDICTED: heat stress transcription factor ...    123   2e-29   Jatropha curcas
gb|KEH17358.1|  heat shock transcription factor B2A                     122   6e-29   Medicago truncatula
gb|KDO60052.1|  hypothetical protein CISIN_1g020146mg                   122   1e-28   Citrus sinensis [apfelsine]
gb|KJB39397.1|  hypothetical protein B456_007G010900                    122   1e-28   Gossypium raimondii
gb|AIG20087.1|  HSF20                                                   122   1e-28   Gossypium hirsutum [American cotton]
ref|XP_006421885.1|  hypothetical protein CICLE_v10005403mg             122   1e-28   Citrus clementina [clementine]
ref|XP_008376546.1|  PREDICTED: heat stress transcription factor ...    120   2e-28   Malus domestica [apple tree]
ref|XP_007143381.1|  hypothetical protein PHAVU_007G067800g             117   3e-27   Phaseolus vulgaris [French bean]
ref|XP_010278594.1|  PREDICTED: heat stress transcription factor ...    116   1e-26   Nelumbo nucifera [Indian lotus]
gb|KJB25778.1|  hypothetical protein B456_004G208800                    112   2e-25   Gossypium raimondii
gb|KJB25779.1|  hypothetical protein B456_004G208800                    112   3e-25   Gossypium raimondii
ref|XP_002510816.1|  Heat shock factor protein, putative                112   3e-25   Ricinus communis
gb|EPS62621.1|  hypothetical protein M569_12169                         110   1e-24   Genlisea aurea
ref|XP_010940869.1|  PREDICTED: heat stress transcription factor ...    108   1e-23   Elaeis guineensis
ref|XP_006440567.1|  hypothetical protein CICLE_v10021287mg             107   2e-23   Citrus clementina [clementine]
ref|XP_006477425.1|  PREDICTED: heat stress transcription factor ...    106   2e-23   Citrus sinensis [apfelsine]
ref|XP_006396868.1|  hypothetical protein EUTSA_v10028744mg             106   4e-23   Eutrema salsugineum [saltwater cress]
ref|XP_009151322.1|  PREDICTED: heat stress transcription factor ...    103   2e-22   Brassica rapa
ref|XP_010538799.1|  PREDICTED: heat stress transcription factor ...    102   1e-21   Tarenaya hassleriana [spider flower]
ref|XP_007040152.1|  Winged-helix DNA-binding transcription facto...    100   1e-21   
emb|CDX86938.1|  BnaC03g52080D                                          100   2e-21   
ref|XP_002273914.2|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    100   3e-21   
gb|AII99903.1|  heat shock transcription factor                         100   3e-21   Gossypium hirsutum [American cotton]
ref|XP_007040151.1|  Winged-helix DNA-binding transcription facto...    100   4e-21   
ref|XP_012086969.1|  PREDICTED: heat stress transcription factor ...    100   6e-21   Jatropha curcas
gb|KDP25483.1|  hypothetical protein JCGZ_20639                         100   6e-21   Jatropha curcas
emb|CDY00246.1|  BnaA06g21470D                                        99.8    6e-21   
gb|ACN76855.1|  heat shock transcription factor                       99.0    7e-21   Cicer arietinum [garbanzo]
ref|XP_002283139.1|  PREDICTED: heat stress transcription factor ...  99.4    8e-21   Vitis vinifera
ref|XP_004496590.1|  PREDICTED: heat stress transcription factor ...  98.6    1e-20   Cicer arietinum [garbanzo]
ref|XP_010523506.1|  PREDICTED: heat stress transcription factor ...  99.0    1e-20   Tarenaya hassleriana [spider flower]
gb|KHG06980.1|  Heat stress transcription factor B-2b -like protein   99.0    1e-20   Gossypium arboreum [tree cotton]
gb|KHG11685.1|  Heat stress transcription factor B-2b -like protein   99.0    1e-20   Gossypium arboreum [tree cotton]
ref|NP_001281281.1|  heat shock factor protein 4                      97.8    2e-20   Malus domestica [apple tree]
gb|ADC94861.1|  HSP transcription factor                              98.2    2e-20   Vitis pseudoreticulata
ref|NP_201008.2|  heat stress transcription factor B-2a               97.8    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394443.1|  hypothetical protein EUTSA_v10004690mg           97.4    3e-20   Eutrema salsugineum [saltwater cress]
ref|XP_006857851.1|  PREDICTED: heat stress transcription factor ...  97.1    6e-20   Amborella trichopoda
ref|XP_010693477.1|  PREDICTED: heat stress transcription factor ...  97.1    6e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004511596.1|  PREDICTED: heat stress transcription factor ...  97.1    7e-20   
ref|XP_006358879.1|  PREDICTED: heat stress transcription factor ...  96.3    1e-19   Solanum tuberosum [potatoes]
ref|XP_008369462.1|  PREDICTED: heat stress transcription factor ...  96.3    1e-19   
ref|XP_002318823.2|  hypothetical protein POPTR_0012s13430g           95.1    3e-19   
ref|XP_006280765.1|  hypothetical protein CARUB_v10026734mg           95.1    3e-19   
ref|XP_008803040.1|  PREDICTED: heat stress transcription factor ...  95.1    3e-19   Phoenix dactylifera
gb|KJB20712.1|  hypothetical protein B456_003G160600                  94.7    4e-19   Gossypium raimondii
ref|XP_010934470.1|  PREDICTED: heat stress transcription factor ...  94.4    5e-19   Elaeis guineensis
ref|XP_010444038.1|  PREDICTED: heat stress transcription factor ...  93.2    1e-18   Camelina sativa [gold-of-pleasure]
emb|CAN82265.1|  hypothetical protein VITISV_009283                   94.7    1e-18   Vitis vinifera
ref|XP_009134244.1|  PREDICTED: heat stress transcription factor ...  92.8    1e-18   Brassica rapa
gb|AII99900.1|  heat shock transcription factor                       92.8    1e-18   Gossypium hirsutum [American cotton]
ref|XP_010483895.1|  PREDICTED: heat stress transcription factor ...  92.4    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010035111.1|  PREDICTED: heat stress transcription factor ...  91.3    4e-18   Eucalyptus grandis [rose gum]
gb|KDO63532.1|  hypothetical protein CISIN_1g048246mg                 89.4    4e-18   Citrus sinensis [apfelsine]
ref|XP_008800793.1|  PREDICTED: heat stress transcription factor ...  91.7    5e-18   Phoenix dactylifera
gb|KFK31930.1|  hypothetical protein AALP_AA6G177400                  91.7    5e-18   Arabis alpina [alpine rockcress]
gb|KJB52055.1|  hypothetical protein B456_008G244400                  90.9    6e-18   Gossypium raimondii
gb|KJB52056.1|  hypothetical protein B456_008G244400                  90.9    7e-18   Gossypium raimondii
emb|CBI34728.3|  unnamed protein product                              89.7    2e-17   Vitis vinifera
ref|XP_010422122.1|  PREDICTED: heat stress transcription factor ...  89.7    3e-17   Camelina sativa [gold-of-pleasure]
gb|EYU29725.1|  hypothetical protein MIMGU_mgv11b015037mg             88.6    4e-17   Erythranthe guttata [common monkey flower]
ref|XP_010455582.1|  PREDICTED: heat stress transcription factor ...  89.4    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010919270.1|  PREDICTED: heat stress transcription factor ...  88.2    6e-17   Elaeis guineensis
ref|XP_009760921.1|  PREDICTED: heat stress transcription factor ...  88.2    7e-17   Nicotiana sylvestris
ref|XP_010434580.1|  PREDICTED: heat stress transcription factor ...  88.2    9e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009130190.1|  PREDICTED: heat stress transcription factor ...  87.0    9e-17   Brassica rapa
ref|XP_004143930.1|  PREDICTED: heat stress transcription factor ...  87.8    1e-16   Cucumis sativus [cucumbers]
gb|KFK27929.1|  hypothetical protein AALP_AA8G449200                  87.0    1e-16   Arabis alpina [alpine rockcress]
ref|XP_010933854.1|  PREDICTED: heat stress transcription factor ...  87.0    2e-16   Elaeis guineensis
ref|XP_010540690.1|  PREDICTED: heat stress transcription factor ...  86.3    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_008790507.1|  PREDICTED: heat stress transcription factor ...  85.9    4e-16   Phoenix dactylifera
ref|XP_002864765.1|  hypothetical protein ARALYDRAFT_919451           85.5    4e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_004308106.1|  PREDICTED: heat stress transcription factor ...  85.5    4e-16   Fragaria vesca subsp. vesca
ref|XP_008799550.1|  PREDICTED: heat stress transcription factor ...  85.1    8e-16   Phoenix dactylifera
ref|XP_007158472.1|  hypothetical protein PHAVU_002G155300g           85.1    1e-15   Phaseolus vulgaris [French bean]
emb|CDP09791.1|  unnamed protein product                              84.3    1e-15   Coffea canephora [robusta coffee]
ref|XP_003611134.1|  Heat stress transcription factor B-2b            84.7    1e-15   Medicago truncatula
ref|XP_010255485.1|  PREDICTED: heat stress transcription factor ...  84.0    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010061278.1|  PREDICTED: heat stress transcription factor ...  83.6    2e-15   Eucalyptus grandis [rose gum]
ref|XP_011029218.1|  PREDICTED: heat stress transcription factor ...  83.6    3e-15   Populus euphratica
ref|XP_002298053.1|  heat shock transcription factor HSF29 family...  83.6    3e-15   Populus trichocarpa [western balsam poplar]
gb|AFK40914.1|  unknown                                               82.8    6e-15   Medicago truncatula
ref|XP_006590529.1|  PREDICTED: heat stress transcription factor ...  82.4    9e-15   Glycine max [soybeans]
emb|CDX90804.1|  BnaA03g24840D                                        81.6    1e-14   
emb|CAA87075.1|  heat shock transcription factor 29                   80.9    1e-14   Glycine max [soybeans]
ref|XP_010676525.1|  PREDICTED: heat stress transcription factor ...  81.6    2e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH43737.1|  heat shock transcription factor B2A                   80.9    2e-14   Medicago truncatula
ref|XP_011081009.1|  PREDICTED: heat stress transcription factor ...  80.9    2e-14   Sesamum indicum [beniseed]
ref|XP_007209340.1|  hypothetical protein PRUPE_ppa008441mg           80.9    3e-14   Prunus persica
gb|AFQ93675.1|  heat shock transcription factor HSFB2b                80.9    3e-14   Glycine max [soybeans]
ref|XP_003517459.1|  PREDICTED: heat stress transcription factor ...  80.9    3e-14   Glycine max [soybeans]
ref|XP_010055608.1|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...  80.5    4e-14   
emb|CBI31816.3|  unnamed protein product                              79.7    4e-14   Vitis vinifera
ref|XP_002872608.1|  hypothetical protein ARALYDRAFT_911518           80.9    4e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_006287969.1|  hypothetical protein CARUB_v10001204mg           80.5    5e-14   Capsella rubella
ref|XP_009345447.1|  PREDICTED: heat stress transcription factor ...  79.7    7e-14   Pyrus x bretschneideri [bai li]
ref|XP_008238806.1|  PREDICTED: heat stress transcription factor ...  79.0    1e-13   
ref|XP_004140783.1|  PREDICTED: heat stress transcription factor ...  77.8    2e-13   Cucumis sativus [cucumbers]
emb|CDY59386.1|  BnaC09g52680D                                        78.2    3e-13   Brassica napus [oilseed rape]
ref|XP_002509743.1|  Heat shock factor protein, putative              77.8    3e-13   Ricinus communis
ref|XP_011030077.1|  PREDICTED: heat stress transcription factor ...  77.0    4e-13   Populus euphratica
ref|XP_009124795.1|  PREDICTED: heat stress transcription factor ...  77.4    5e-13   Brassica rapa
ref|XP_008437221.1|  PREDICTED: heat stress transcription factor ...  76.6    8e-13   Cucumis melo [Oriental melon]
ref|XP_009398726.1|  PREDICTED: heat stress transcription factor ...  76.6    9e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011073942.1|  PREDICTED: heat stress transcription factor ...  75.1    1e-12   Sesamum indicum [beniseed]
emb|CDY64186.1|  BnaC03g73070D                                        75.1    2e-12   Brassica napus [oilseed rape]
ref|XP_008439190.1|  PREDICTED: heat stress transcription factor ...  74.7    2e-12   Cucumis melo [Oriental melon]
gb|KDO65439.1|  hypothetical protein CISIN_1g042043mg                 71.6    3e-12   Citrus sinensis [apfelsine]
emb|CDX86761.1|  BnaA09g21510D                                        74.3    7e-12   
ref|XP_009400005.1|  PREDICTED: heat stress transcription factor ...  73.9    7e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002321902.2|  hypothetical protein POPTR_0015s13390g           72.8    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_004245637.1|  PREDICTED: heat stress transcription factor ...  72.0    3e-11   Solanum lycopersicum
ref|XP_009606739.1|  PREDICTED: heat stress transcription factor ...  72.0    3e-11   Nicotiana tomentosiformis
ref|XP_008652977.1|  PREDICTED: heat stress transcription factor ...  71.2    8e-11   Zea mays [maize]
ref|XP_010458062.1|  PREDICTED: heat stress transcription factor ...  70.5    8e-11   Camelina sativa [gold-of-pleasure]
ref|XP_004957414.1|  PREDICTED: heat stress transcription factor ...  70.9    1e-10   Setaria italica
ref|XP_004957416.1|  PREDICTED: heat stress transcription factor ...  70.9    1e-10   
ref|XP_004957417.1|  PREDICTED: heat stress transcription factor ...  70.5    1e-10   
ref|XP_004300764.1|  PREDICTED: heat stress transcription factor ...  70.5    1e-10   Fragaria vesca subsp. vesca
sp|Q6Z9C8.1|HFB2B_ORYSJ  RecName: Full=Heat stress transcription ...  70.1    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009415832.1|  PREDICTED: heat stress transcription factor ...  69.7    2e-10   
gb|EAZ07882.1|  hypothetical protein OsI_30138                        69.7    3e-10   Oryza sativa Indica Group [Indian rice]
ref|NP_001062423.1|  Os08g0546800                                     70.1    3e-10   
ref|XP_011048671.1|  PREDICTED: heat stress transcription factor ...  67.8    7e-10   Populus euphratica
ref|XP_009130189.1|  PREDICTED: heat stress transcription factor ...  67.4    7e-10   Brassica rapa
gb|KHM99149.1|  Heat stress transcription factor B-2a                 65.9    2e-09   Glycine soja [wild soybean]
ref|XP_006659656.1|  PREDICTED: heat stress transcription factor ...  67.4    2e-09   Oryza brachyantha
ref|XP_009397638.1|  PREDICTED: heat stress transcription factor ...  65.9    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003578478.1|  PREDICTED: heat stress transcription factor ...  65.9    6e-09   Brachypodium distachyon [annual false brome]
emb|CDY67248.1|  BnaCnng54110D                                        64.3    9e-09   Brassica napus [oilseed rape]
ref|XP_009389775.1|  PREDICTED: heat stress transcription factor ...  64.7    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS72138.1|  hypothetical protein M569_02618                       64.3    1e-08   Genlisea aurea
emb|CAB63803.1|  heat shock factor 7                                  64.7    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192903.1|  heat stress transcription factor B-2b               64.7    1e-08   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ85352.1|  predicted protein                                    63.9    2e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW72116.1|  hypothetical protein EUGRSUZ_E00555                   62.0    1e-07   Eucalyptus grandis [rose gum]
gb|AFW65023.1|  hypothetical protein ZEAMMB73_676522                  61.2    2e-07   
gb|AFW65024.1|  heat shock factor protein 7                           61.2    2e-07   
ref|NP_001149902.1|  heat shock factor protein 7                      61.2    2e-07   Zea mays [maize]
gb|EMT20815.1|  Heat stress transcription factor B-2b                 61.2    2e-07   
ref|XP_008677301.1|  PREDICTED: heat shock factor protein 7 isofo...  60.8    2e-07   Zea mays [maize]
gb|AEB26596.1|  heat shock factor B2c                                 60.1    5e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD46358.1|  putative heat shock factor                           57.4    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063726.1|  Os09g0526600                                     57.4    5e-06   
gb|EAZ09820.1|  hypothetical protein OsI_32108                        57.4    5e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_008241456.1|  PREDICTED: heat shock factor protein HSF24       56.2    7e-06   Prunus mume [ume]
gb|AFI61331.1|  HSF3                                                  56.6    7e-06   Triticum aestivum [Canadian hard winter wheat]
gb|AJR10106.1|  heat-responsive transcription factor                  56.2    8e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007202372.1|  hypothetical protein PRUPE_ppa009274mg           55.1    2e-05   Prunus persica
dbj|BAK04233.1|  predicted protein                                    53.5    9e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010235376.1|  PREDICTED: heat stress transcription factor ...  53.1    9e-05   Brachypodium distachyon [annual false brome]
gb|ABG73443.1|  heat shock factor                                     52.8    1e-04   Oryza brachyantha
gb|ACG25742.1|  heat shock factor protein 4                           52.4    2e-04   Zea mays [maize]
emb|CAH66855.1|  OSIGBa0103M18.7                                      52.0    2e-04   Oryza sativa [red rice]
ref|NP_001053591.1|  Os04g0568700                                     52.0    2e-04   
gb|AAQ23055.1|  heat shock factor RHSF1                               51.6    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009375707.1|  PREDICTED: heat stress transcription factor ...  50.8    5e-04   Pyrus x bretschneideri [bai li]
ref|XP_009391581.1|  PREDICTED: heat stress transcription factor ...  50.8    5e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001152384.1|  heat shock factor protein 7                      50.8    6e-04   
ref|XP_008680871.1|  PREDICTED: heat shock factor protein 7 isofo...  50.8    7e-04   
gb|EEE70081.1|  hypothetical protein OsJ_30075                        50.4    8e-04   Oryza sativa Japonica Group [Japonica rice]



>emb|CDP21507.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 140/194 (72%), Gaps = 13/194 (7%)
 Frame = -2

Query  758  PSKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMK  579
            P +TV+P++SGEEQVVSS SSP      A+ GGST+ELIGENERLRKEN++LNKELS MK
Sbjct  149  PPRTVSPTDSGEEQVVSSTSSPSGFRETATAGGSTAELIGENERLRKENMQLNKELSHMK  208

Query  578  SLCNNIYALMsnysgnnsnssnqsae--sslqSLKPLDLMPat-----atatAGCGGENQ  420
            S+C+N+Y LMSNYS +++ ++  S    SS Q+LK LDL+P       + AT  CGGE++
Sbjct  209  SMCSNVYVLMSNYSNHSNGATANSKAEGSSSQALKALDLLPPKPIFDESGATTECGGEDR  268

Query  419  TEPDEMRARLFGVSIGSKRVRE-GEDGSAEQDHDLRLQQPGT-DVKSEPENGE----DNE  258
               DE  AR+FGVSIG KR RE G   +AE D +L+LQQPGT DVKSEP + E    D++
Sbjct  269  MAVDEAGARIFGVSIGVKRGRENGAAAAAEHDKELQLQQPGTADVKSEPIDDENSNGDDQ  328

Query  257  ESPWLRQCHRQNQR  216
            ++ WLRQC  QNQR
Sbjct  329  QTHWLRQCRIQNQR  342



>ref|XP_009603015.1| PREDICTED: heat stress transcription factor B-2b [Nicotiana tomentosiformis]
 ref|XP_009603016.1| PREDICTED: heat stress transcription factor B-2b [Nicotiana tomentosiformis]
 ref|XP_009603017.1| PREDICTED: heat stress transcription factor B-2b [Nicotiana tomentosiformis]
Length=333

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 132/191 (69%), Gaps = 22/191 (12%)
 Frame = -2

Query  749  TVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLC  570
             ++ S+SG+EQVVSSNSS G           T+ L+GENERL+KEN++LNKELSQM+SLC
Sbjct  145  VISTSDSGDEQVVSSNSSTG----------GTAGLLGENERLKKENLQLNKELSQMRSLC  194

Query  569  NNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatat-------atAGCGGENQTEP  411
             NIY+LMSNY+ ++++ +  +   S   +KPLDL+P   +         AG GG NQ EP
Sbjct  195  GNIYSLMSNYADSSTSGNQSAESISPA-VKPLDLLPTKLSVDESDINMAAGDGG-NQAEP  252

Query  410  DEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEP---ENGEDNEESPWLR  240
            +++R RLFG SIG KRVR+G++  AE D +LRLQQPG DVKSEP   ENG +NEE  WL 
Sbjct  253  EDIRTRLFGFSIGMKRVRDGDEARAEHDQELRLQQPGHDVKSEPLDEENGCENEERSWLI  312

Query  239  QCHRQNQRVCN  207
             C  +NQRVCN
Sbjct  313  HCSGRNQRVCN  323



>ref|XP_011076201.1| PREDICTED: heat stress transcription factor B-2a-like [Sesamum 
indicum]
 ref|XP_011076202.1| PREDICTED: heat stress transcription factor B-2a-like [Sesamum 
indicum]
Length=346

 Score =   165 bits (418),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 139/211 (66%), Gaps = 27/211 (13%)
 Frame = -2

Query  767  PAQPSKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
            PA P +TV+PS+SGEEQV+SS++SP T        GST+ELIGENERLRKEN++LNKELS
Sbjct  139  PAAPPRTVSPSDSGEEQVISSSNSPATVR---EFSGSTAELIGENERLRKENVQLNKELS  195

Query  587  QMKSLCNNIYALMsnysgnnsnssnqsaesslqSL-------KPLDLMPatat-------  450
            QMKSLCNNIYALMSNY+ NN N  +   +     L       KPLDL+P T         
Sbjct  196  QMKSLCNNIYALMSNYASNNKNDGSNDHQGHSCKLYLAENAVKPLDLLPMTRFCEEMQTA  255

Query  449  ----atAGCGGEN---QTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDV  291
                A A  GGE    ++  +E+ ARLFGV IG KR REGE  S + + DL+LQQPG D+
Sbjct  256  VVAAAAAANGGEESHIRSAAEEISARLFGVPIGMKRGREGEGSSGDHEMDLQLQQPGGDI  315

Query  290  KSEP---ENGEDNEESPWLRQCHRQNQRVCN  207
            KSEP   EN   ++E+ WL++ + +N++VCN
Sbjct  316  KSEPLDQENSGTDQETSWLKRSNSRNRKVCN  346



>ref|XP_009803855.1| PREDICTED: heat stress transcription factor B-2b-like [Nicotiana 
sylvestris]
 ref|XP_009803856.1| PREDICTED: heat stress transcription factor B-2b-like [Nicotiana 
sylvestris]
 ref|XP_009803857.1| PREDICTED: heat stress transcription factor B-2b-like [Nicotiana 
sylvestris]
Length=333

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 128/191 (67%), Gaps = 22/191 (12%)
 Frame = -2

Query  749  TVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLC  570
             ++ S+SG+EQVVSSNSS           G T+ L+GENERLRKEN++LNKELSQM+SLC
Sbjct  145  VISTSDSGDEQVVSSNSS----------AGGTAGLLGENERLRKENLQLNKELSQMRSLC  194

Query  569  NNIYALMsnysgnnsnssnqsaesslqSLKPLDLMP-------atatatAGCGGENQTEP  411
             NIY+LMSNY+  +++ +  +  +S  + KPLDL+P       +      G GG ++ EP
Sbjct  195  GNIYSLMSNYADPSTSGNQSAESTSPAA-KPLDLLPPKRSVDESDINKAVGDGG-SRAEP  252

Query  410  DEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEP---ENGEDNEESPWLR  240
            +++RARLFG SIG KR REG++  AE D +LRL+QPG DVKSEP   ENG +NEE  WL 
Sbjct  253  EDIRARLFGFSIGMKRAREGDEARAEHDQELRLRQPGNDVKSEPLDQENGGENEERSWLI  312

Query  239  QCHRQNQRVCN  207
             C    QR CN
Sbjct  313  HCRGPIQRACN  323



>ref|XP_007152318.1| hypothetical protein PHAVU_004G119600g [Phaseolus vulgaris]
 gb|ESW24312.1| hypothetical protein PHAVU_004G119600g [Phaseolus vulgaris]
Length=340

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 126/206 (61%), Gaps = 42/206 (20%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            ++PSNSGEEQV+SSNSSP  A          +EL+ ENERLRKEN++L KEL++M+SLCN
Sbjct  151  ISPSNSGEEQVISSNSSPSLAP---------AELVDENERLRKENVQLTKELAEMRSLCN  201

Query  566  NIYALMsnysgnnsnssnqsaess--------------lqSLKPLDLMPatatatAGCGG  429
            NIYALMSNY+  N N++   +  +              + +LKPLDLMP          G
Sbjct  202  NIYALMSNYANANGNTNGNGSYQTDGGAGGAQGSRESGMTALKPLDLMPTKR-----ISG  256

Query  428  ENQTEPDEMRARLFGVSIGSKRVRE--------GEDGSAEQDHDLRLQQPG-TDVKSEP-  279
            E+  E   M  +LFGV+IG+KR RE        GE+G  ++D  LRL  PG  DVK EP 
Sbjct  257  EDAAE--VMNPKLFGVAIGAKRAREGGGSCEDCGEEGGGKKDTLLRLHHPGPADVKPEPL  314

Query  278  --ENGEDNEESPWLRQCHRQNQRVCN  207
              ++  +N+E+PWL QCH  NQRVCN
Sbjct  315  DCQSHRENQETPWLSQCHIANQRVCN  340



>ref|XP_007218740.1| hypothetical protein PRUPE_ppa009180mg [Prunus persica]
 gb|EMJ19939.1| hypothetical protein PRUPE_ppa009180mg [Prunus persica]
Length=303

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 119/183 (65%), Gaps = 25/183 (14%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            ++PSNSGEEQV+SS+SSP  A          SEL+ ENE+LRKEN++L KEL+++KSLCN
Sbjct  143  ISPSNSGEEQVISSSSSPIRAP---------SELMDENEKLRKENMQLTKELAEVKSLCN  193

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARLF  387
            NI++++       SN +   +ES    +KPLDLMP          G+ + E +E   +LF
Sbjct  194  NIFSMV-------SNYAYAQSESGFPYVKPLDLMPEKR-----FSGDGEKEEEEASPKLF  241

Query  386  GVSIGSKRVREGE-DGSAEQDHDLRLQQP--GTDVKSEPENGEDNEESPWLRQCHRQNQR  216
            GV+IG+KR RE   DG  E +  LRLQQP  G DVKSEP +  D +E+PWL Q HR NQR
Sbjct  242  GVAIGAKRARETVGDGVEEDETGLRLQQPSGGGDVKSEPID-MDRQETPWLNQRHRANQR  300

Query  215  VCN  207
            VCN
Sbjct  301  VCN  303



>ref|XP_010107420.1| Heat stress transcription factor B-2a [Morus notabilis]
 gb|EXC15958.1| Heat stress transcription factor B-2a [Morus notabilis]
Length=312

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 126/183 (69%), Gaps = 16/183 (9%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            ++PSNSGEEQV+SSNSSP             +EL+ ENERLRKEN++L+KEL++MKS+C+
Sbjct  143  ISPSNSGEEQVISSNSSPTRGP---------AELVDENERLRKENLQLSKELAEMKSICS  193

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARLF  387
            NI++++SNY+   S S  Q+ ES  + ++PLDLMPA   +     GE+ T  ++   +LF
Sbjct  194  NIFSMVSNYACLQSESVFQARESGFREVEPLDLMPAKRFSGE---GEDATAEEKTSPKLF  250

Query  386  GVSIGSKRVREGEDG--SAEQDHDLRLQQP-GTDVKSEPENGEDNEESPWLRQCHRQNQR  216
            GV+IG+KR REG +    AE   DL L+QP G DVKSEP +   ++E PWL+Q HR NQR
Sbjct  251  GVTIGAKRAREGGNDIEPAEDQTDLLLRQPAGVDVKSEPLDVV-HQEKPWLKQPHRLNQR  309

Query  215  VCN  207
            VCN
Sbjct  310  VCN  312



>ref|XP_004234371.1| PREDICTED: heat stress transcription factor B-2a [Solanum lycopersicum]
Length=338

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 122/191 (64%), Gaps = 30/191 (16%)
 Frame = -2

Query  737  SNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCNNIY  558
            S+S EEQV+SSNSS           GST+EL+GENERLR EN++L+KEL+QMK LC NIY
Sbjct  164  SDSCEEQVLSSNSS----------AGSTAELLGENERLRLENLQLSKELNQMKKLCGNIY  213

Query  557  ALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTE----------PD  408
             +M +   + S+S NQSAESS  SLKPLDL+    +      GE+Q +          P+
Sbjct  214  GMM-STYAHPSSSGNQSAESSSPSLKPLDLLGTERSV-----GESQVKAVEDRESHEVPE  267

Query  407  EMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPG-TDVKSEPENGEDN---EESPWLR  240
            E +ARLFG SIG KRVREGE    E  HDLRL+QPG TDVK EP + E N   EE  WL 
Sbjct  268  EAQARLFGFSIGMKRVREGEQAMMEHCHDLRLRQPGTTDVKVEPSDQESNGESEERSWLL  327

Query  239  QCHRQNQRVCN  207
             C  +NQR CN
Sbjct  328  HCGGRNQRTCN  338



>ref|XP_008234272.1| PREDICTED: heat stress transcription factor B-2a [Prunus mume]
Length=303

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 117/183 (64%), Gaps = 25/183 (14%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            ++PSNSGEEQV+SS+SSP  A          SEL+ ENE+LRKEN++L KEL+ +KSLCN
Sbjct  143  ISPSNSGEEQVISSSSSPIRAP---------SELMDENEKLRKENMQLTKELADVKSLCN  193

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARLF  387
            NI++++       SN +   +ES    +KPLDLMP          G+ + E +E   +LF
Sbjct  194  NIFSMV-------SNYAYAQSESGFPYVKPLDLMPEKR-----FSGDGEKEEEEASPKLF  241

Query  386  GVSIGSKRVREGE-DGSAEQDHDLRLQQP--GTDVKSEPENGEDNEESPWLRQCHRQNQR  216
            GV+IG+KR RE   DG  E +  LRLQQP  G DVKSEP +  D +E+PWL Q H  NQR
Sbjct  242  GVAIGAKRARETVGDGVEEDETGLRLQQPSGGGDVKSEPLDV-DRQETPWLNQRHMANQR  300

Query  215  VCN  207
            VCN
Sbjct  301  VCN  303



>ref|XP_011084402.1| PREDICTED: heat stress transcription factor B-2b-like [Sesamum 
indicum]
Length=302

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 118/185 (64%), Gaps = 16/185 (9%)
 Frame = -2

Query  767  PAQPSKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
            PA P +T++PS+SGEEQVVSS+ SP  A   +S   +T+ELIGENERLRKEN++LNKEL+
Sbjct  121  PAAPPRTLSPSDSGEEQVVSSSISPPGAREFSS---NTAELIGENERLRKENVQLNKELT  177

Query  587  QMKSLCNNIYALMsny--sgnnsnssnqsaesslqSLKPLDLMPat-----atatAGCGG  429
             MK+LCNNIY L+SNY  S       +     +  +L+PLDL+P T         A  GG
Sbjct  178  HMKNLCNNIYVLVSNYSGSIIADREHSCKLILTETALRPLDLLPMTRFCEEMATAANGGG  237

Query  428  ENQTEP--DEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEP----ENGE  267
            EN   P  +E+ ARLFGV IG+KR RE E  SAE +  L+LQ PG D K EP    E G+
Sbjct  238  ENNIRPSAEEISARLFGVPIGAKRGREIEGTSAEDEMHLQLQLPGRDSKYEPLDEDERGD  297

Query  266  DNEES  252
              E S
Sbjct  298  HQESS  302



>ref|XP_003555375.1| PREDICTED: heat stress transcription factor B-2a-like [Glycine 
max]
Length=300

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 110/185 (59%), Gaps = 36/185 (19%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            V+PSNS EEQV+SSNSSP  A +         EL+ ENERLRKENI L KEL +M+SLCN
Sbjct  147  VSPSNSAEEQVLSSNSSPARAPV---------ELLDENERLRKENILLTKELVKMRSLCN  197

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARLF  387
            NI+ LMSNY+   ++ S+ +A                      C GE+  E  EM  +LF
Sbjct  198  NIFNLMSNYANAQADGSSAAAAKR-------------------CSGEDAVE--EMNPKLF  236

Query  386  GVSIGSKRVREGEDGSAEQDHDLRLQQPG-TDVKSE----PENGEDNEESPWLRQCHRQN  222
            GV+IG KR RE E   A+ D  L L QP   DVKSE    P  GE N+++PWL QCHR N
Sbjct  237  GVAIGKKRAREEEGHGAKYDTALSLHQPFHADVKSEALDLPGRGE-NKKTPWLNQCHRAN  295

Query  221  QRVCN  207
            QRVCN
Sbjct  296  QRVCN  300



>ref|XP_004515711.1| PREDICTED: heat stress transcription factor B-2b-like [Cicer 
arietinum]
Length=332

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 124/190 (65%), Gaps = 29/190 (15%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            ++PSNSG+EQV+SS+SSP  A          +EL+ ENERLRKEN+ LNKEL+++KSLCN
Sbjct  160  ISPSNSGDEQVISSSSSPLRAP---------AELLDENERLRKENVLLNKELAEIKSLCN  210

Query  566  NIYALMsnysgnnsnssnqs-------aesslqSLKPLDLMPatatatAGCGGENQTEPD  408
            NIY LMS+Y+ NN+N++NQS        ES + ++KPLDLMP      +G          
Sbjct  211  NIYTLMSSYANNNNNNNNQSDGGAQGSRESGMTAVKPLDLMPEEVKRGSGV--------K  262

Query  407  EMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPG-TDVKSEP---ENGEDNEESPWLR  240
            EM  +LFGV+IG KR RE    S E D  LRL QPG TDVKSEP   +   DN+++PWL 
Sbjct  263  EMNPKLFGVAIGVKRTRENGCESGE-DTLLRLHQPGSTDVKSEPLDCQYHRDNKQTPWLN  321

Query  239  QCHRQNQRVC  210
            +C R NQ +C
Sbjct  322  RCRRANQSLC  331



>ref|XP_006353396.1| PREDICTED: heat stress transcription factor B-2c-like [Solanum 
tuberosum]
Length=335

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 118/190 (62%), Gaps = 27/190 (14%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCNN  564
            + S+S EEQV+SSNSS           GST+EL+GENERLR EN++LNKEL+ MK LC N
Sbjct  162  STSDSCEEQVISSNSS----------AGSTAELLGENERLRLENLQLNKELNSMKKLCGN  211

Query  563  IYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEP-------DE  405
            IY +M +     S+S NQSAESS   LKPLDL+           GE+Q +        +E
Sbjct  212  IYGMM-SNYAQPSSSGNQSAESSSPGLKPLDLLRTEQYL-----GESQVKAVEDGESLEE  265

Query  404  MRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPG-TDVKSEPENGEDN---EESPWLRQ  237
              ARLFG SIG KRVREGE+   +   DL+LQQPG TDVKSE  + E N   EE  WL Q
Sbjct  266  PEARLFGFSIGMKRVREGEEERTDHAQDLQLQQPGTTDVKSEASDQESNGESEERSWLVQ  325

Query  236  CHRQNQRVCN  207
            C  +NQR CN
Sbjct  326  CGGRNQRTCN  335



>gb|AFQ93677.1| heat shock transcription factor HSFB2a [Glycine max]
Length=338

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 124/210 (59%), Gaps = 39/210 (19%)
 Frame = -2

Query  767  PAQPSKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
            P      ++PSNSGEEQV SSNSSP             +EL+ ENERLRKEN++L KEL+
Sbjct  145  PLTAIPIISPSNSGEEQVTSSNSSP-------------AELLDENERLRKENVQLMKELA  191

Query  587  QMKSLCNNIYALMsnysgnn--------------snssnqsaesslqSLKPLDLMPatat  450
            +M+SLCNNIY+LMSNY+  N              +  ++ S ES + ++KPLDLMP   +
Sbjct  192  EMRSLCNNIYSLMSNYANANGKGNRNGSYKTEGGAGVAHGSLESGMTAVKPLDLMPVMRS  251

Query  449  atAGCGGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHD-----LRLQQPGT-DVK  288
            +        +  P+EM  +LFGV+IG+KR REG  G            LRL   G+ DVK
Sbjct  252  SDEDAA---EMAPEEMNPKLFGVAIGAKRAREGGGGGDCGGGGEEDTLLRLHHAGSADVK  308

Query  287  SEP---ENGEDNEESPWLRQCHRQNQRVCN  207
            SEP   +N  +N+++PWL  C+R NQRVCN
Sbjct  309  SEPLDFQNHRENQKTPWLSPCYRTNQRVCN  338



>ref|XP_007038632.1| Heat shock transcription factor B2A, putative [Theobroma cacao]
 gb|EOY23133.1| Heat shock transcription factor B2A, putative [Theobroma cacao]
Length=323

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 121/198 (61%), Gaps = 35/198 (18%)
 Frame = -2

Query  746  VTPSNSGEEQ--VVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSL  573
            ++PSNSG+EQ  V+SS SSP         G  T+EL  ENE+LRKEN++LNK+L++MKSL
Sbjct  143  ISPSNSGDEQSPVISSTSSPSRPG---QTGSVTAELREENEKLRKENVQLNKQLAEMKSL  199

Query  572  CNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRAR  393
            CNNI+ LMSNY+ + S SS  +        KPLDL+P    +  G       E +E   R
Sbjct  200  CNNIFNLMSNYASSQSESSFAAT-------KPLDLLPVKRLSEEG-------EDEETSPR  245

Query  392  LFGVSIGS-KRVRE-GEDGSAEQDHDLRLQQPGTD------VKSEPENGED--------N  261
            LFGV IG  KR RE GE  +AE +  L+LQQPG        +KSEP + ++        N
Sbjct  246  LFGVPIGGVKRAREVGESLAAEDETQLQLQQPGGSGTASEMIKSEPLDRQNAGCDDERGN  305

Query  260  EESPWLRQCHRQNQRVCN  207
            +++PWLRQ HR NQRVCN
Sbjct  306  QDTPWLRQFHRANQRVCN  323



>ref|XP_009371307.1| PREDICTED: heat stress transcription factor B-2a [Pyrus x bretschneideri]
Length=297

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 119/182 (65%), Gaps = 23/182 (13%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            ++PSNSG+EQV+SS+SS            ++SE++ ENERLRKEN++L KEL+++KSLCN
Sbjct  137  ISPSNSGDEQVMSSSSS---------PIRASSEIMDENERLRKENVQLTKELAEVKSLCN  187

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARLF  387
            NI+ ++       SN +   +E+    LKPLDLMP    +    G     E +E   +LF
Sbjct  188  NIFTMV-------SNYACAQSENGFPELKPLDLMPGKRFS----GKRKNEEEEEASPKLF  236

Query  386  GVSIGSKRVRE-GEDGSAEQDHDLRLQQP-GTDVKSEPENGEDNEESPWLRQCHRQNQRV  213
            GV IG+KR RE G DG    + DLRLQQP G++VKSEP +   ++E+PWL+QCH  NQRV
Sbjct  237  GVVIGAKRAREAGGDGVENDETDLRLQQPSGSEVKSEPSDI-GHKETPWLKQCHMANQRV  295

Query  212  CN  207
            CN
Sbjct  296  CN  297



>ref|XP_003533211.1| PREDICTED: heat stress transcription factor B-2b-like [Glycine 
max]
Length=338

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 119/203 (59%), Gaps = 39/203 (19%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            ++PSNSGEEQV SSNSSP             +EL+ ENERLRKEN++L KEL++M+SLCN
Sbjct  152  ISPSNSGEEQVTSSNSSP-------------AELLDENERLRKENVQLTKELAEMRSLCN  198

Query  566  NIYALMsnysgnnsnssnqsaessl--------------qSLKPLDLMPatatatAGCGG  429
            NIY+LMSNY+  N   ++  +  +                ++K LDLMP   ++      
Sbjct  199  NIYSLMSNYANANGKGNSNGSYKTKGGAGVAHGSLESGMTAVKLLDLMPVMRSSDEDAA-  257

Query  428  ENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHD-----LRLQQPGT-DVKSEP---E  276
              +  P+EM  +LFGV+IG+KR REG  G            LRL   G+ DVKSEP   +
Sbjct  258  --EMAPEEMNPKLFGVAIGAKRAREGGGGGDCGGGGEEDTLLRLHHAGSADVKSEPLDFQ  315

Query  275  NGEDNEESPWLRQCHRQNQRVCN  207
            N  +N+++PWL  C+R NQRVCN
Sbjct  316  NHRENQKTPWLSPCYRTNQRVCN  338



>gb|KHN31519.1| Heat stress transcription factor B-2a [Glycine soja]
Length=208

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 126/221 (57%), Gaps = 48/221 (22%)
 Frame = -2

Query  767  PAQPSKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
            P      ++PSNSGEEQV+SSNSSP  A          +EL+ ENERLRKEN++L KEL+
Sbjct  2    PLTAIPIISPSNSGEEQVISSNSSPLRAP---------AELLDENERLRKENVQLTKELA  52

Query  587  QMKSLCNNIYALMsnysgnnsnssnqsae------------sslqSLKPLDLMPatatat  444
            +M+SLCNNIY+LMS+Y   N NS+                 S + ++KPLDLMP   ++ 
Sbjct  53   EMRSLCNNIYSLMSSYGNKNGNSNGSYQTDGGAGGAQGSRESGMTAVKPLDLMPVKRSS-  111

Query  443  AGCGGENQ--TEPDEMRA----RLFGVSIGSKRVREGEDGSAEQDHD------------L  318
                GE+   T P E+      +LFGV+IG+KR REG  GS                  L
Sbjct  112  ----GEDAADTVPKEINLIPNPKLFGVAIGAKRAREGGGGSGSGRDCGGGGGGGEEDTLL  167

Query  317  RLQQPGT-DVKSEP---ENGEDNEESPWLRQCHRQNQRVCN  207
            RL   G+ DVKSEP   +N  +N+E+PWL  CHR NQRVCN
Sbjct  168  RLHHVGSADVKSEPLDCQNHRENQETPWLSPCHRTNQRVCN  208



>ref|XP_003535620.1| PREDICTED: heat stress transcription factor B-2a-like [Glycine 
max]
Length=289

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 106/189 (56%), Gaps = 45/189 (24%)
 Frame = -2

Query  758  PSK-TVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQM  582
            P+K  V+PSNS EEQV+SSNSSP              EL+ EN+RLRKENI L KEL +M
Sbjct  141  PAKLIVSPSNSAEEQVISSNSSPA-------------ELLDENDRLRKENILLTKELEEM  187

Query  581  KSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEM  402
            +SLCNNI+ LMSNY+   ++  +    +                    C GE+  E  EM
Sbjct  188  RSLCNNIFNLMSNYANVQADGGSAGVAAR-------------------CFGEDAVE--EM  226

Query  401  RARLFGVSIGSKRVREGEDGSAEQDHDLRLQQP-GTDVKSEPENGE---DNEESPWLRQC  234
              +LFGV IG+KR RE      E D  L L QP   DVKSE  +     +N+++PWL QC
Sbjct  227  NPKLFGVVIGTKRARE------ENDTVLSLHQPFHADVKSEALDFARRGENKKTPWLNQC  280

Query  233  HRQNQRVCN  207
            HR NQRVCN
Sbjct  281  HRANQRVCN  289



>ref|XP_003548209.1| PREDICTED: heat stress transcription factor B-2b-like [Glycine 
max]
Length=348

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 124/214 (58%), Gaps = 48/214 (22%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            ++PSNSGEEQV+SSNSSP  A          +EL+ ENERLRKEN++L KEL++M+SLCN
Sbjct  149  ISPSNSGEEQVISSNSSPLRAP---------AELLDENERLRKENVQLTKELAEMRSLCN  199

Query  566  NIYALMsnysgnnsnssnqsae------------sslqSLKPLDLMPatatatAGCGGEN  423
            NIY+LMS+Y   N NS+                 S + ++KPLDLMP   +      GE+
Sbjct  200  NIYSLMSSYGNKNGNSNGSYQTDGGAGGAQGSRESGMTAVKPLDLMPVKRS-----SGED  254

Query  422  --QTEPDEMR----ARLFGVSIGSKRVREGEDGSAEQDHD------------LRLQQPGT  297
               T P E+      +LFGV+IG+KR REG  GS                  LRL   G+
Sbjct  255  AADTVPKEINLIPNPKLFGVAIGAKRAREGGGGSGSGRDCGGGGGGGEEDTLLRLHHVGS  314

Query  296  -DVKSEP---ENGEDNEESPWLRQCHRQNQRVCN  207
             DVKSEP   +N  +N+E+PWL  CHR NQRVCN
Sbjct  315  ADVKSEPLDCQNHRENQETPWLSPCHRTNQRVCN  348



>ref|XP_012090286.1| PREDICTED: heat stress transcription factor B-2b [Jatropha curcas]
 gb|KDP22306.1| hypothetical protein JCGZ_26137 [Jatropha curcas]
Length=311

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 115/179 (64%), Gaps = 24/179 (13%)
 Frame = -2

Query  749  TVTPSNSGEEQVVSSNSSPGTAAIDASQG-GSTSELIGENERLRKENIELNKELSQMKSL  573
             ++PSNSG+EQV+S+NSSP   A    QG G  +EL+ EN+RLRKEN++L KEL++MK+L
Sbjct  143  VISPSNSGDEQVISTNSSPSRVA----QGSGPNAELLDENDRLRKENVQLTKELTEMKNL  198

Query  572  CNNIYALMsnysgnnsnssnqsaesslq-SLKPLDLMPatatatAGCGGENQTEPDEMRA  396
            CNNI++L+SNY+   S  S  S+ES    + KPLD +P             Q   +E  A
Sbjct  199  CNNIFSLVSNYASTQSEGSFHSSESEGLPTAKPLDFLPV-----------KQFSGEETSA  247

Query  395  RLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTD-VKSEP---ENGE---DNEESPWLR  240
            RLFGV+IG KR REGE  + E D  L+LQQPG + VK EP   +NG    D++ S WL+
Sbjct  248  RLFGVAIGIKRGREGEGATGENDTQLQLQQPGANAVKDEPHDCQNGRVSGDDKNSTWLK  306



>gb|KEH17358.1| heat shock transcription factor B2A [Medicago truncatula]
Length=341

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 119/189 (63%), Gaps = 29/189 (15%)
 Frame = -2

Query  752  KTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSL  573
            + ++PSNSGEEQV+SS+SSP  A          +EL+ ENERLRKEN  LNKEL+ M+ L
Sbjct  167  QMISPSNSGEEQVISSSSSPARAP---------AELLDENERLRKENHLLNKELADMRLL  217

Query  572  CNNIYALMsnysgnnsnssnqsaesslqSLK------PLDLMPatatatAGCGGENQTEP  411
            CNNIY+LMSN++ NNS +   +  S    +       PLDLMPA A         N++  
Sbjct  218  CNNIYSLMSNFANNNSQTDGGAQGSRESGMTAVNPKPPLDLMPAVA---------NRSSG  268

Query  410  DEMRARLFGVSIGSKRVREG--EDGSAEQDHDLRLQQPG-TDVKSEPENGED--NEESPW  246
            +EM  +LFGV+IG+KRVRE   E+G  E D  LRL QPG TDVKSEP +  D  N+ + W
Sbjct  269  EEMNPKLFGVAIGAKRVRENGCENGEKEDDTLLRLHQPGSTDVKSEPLDCSDGGNDRTAW  328

Query  245  LRQCHRQNQ  219
            L Q  R+NQ
Sbjct  329  LNQSRRKNQ  337



>gb|KDO60052.1| hypothetical protein CISIN_1g020146mg [Citrus sinensis]
Length=330

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 120/200 (60%), Gaps = 37/200 (19%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSP--GTAAIDASQ---GGSTSELIGENERLRKENIELNKELSQM  582
            V+PSNSGEEQV+SSNSSP  G A + A     G + +E++ EN++LRKEN +LNK++++M
Sbjct  148  VSPSNSGEEQVISSNSSPAAGAAGVTAHTCGGGHTCAEMVEENDKLRKENAQLNKQVAEM  207

Query  581  KSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEM  402
            K+LCNNI++LMSNY+       +   +++++ L         +     CG     E +EM
Sbjct  208  KNLCNNIFSLMSNYTRGGVGGGDGGGQAAMELL---------SEKRFSCG-----EGEEM  253

Query  401  RARLFGVSIGSKRVRE----GEDGSAEQDHDLRLQQPGTDVKSEPENGE----------D  264
              RLFGV IG+KR RE    GE  S+  ++  RLQ     +KSEP + +          D
Sbjct  254  STRLFGVPIGAKRAREVNCGGEPSSSTAENATRLQ---LQLKSEPLDYQMGGGGGGDHCD  310

Query  263  NEESPWLRQC-HRQNQRVCN  207
             +E+PWLRQ  HR NQRVCN
Sbjct  311  RQETPWLRQSHHRPNQRVCN  330



>gb|KJB39397.1| hypothetical protein B456_007G010900 [Gossypium raimondii]
Length=326

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 122/201 (61%), Gaps = 38/201 (19%)
 Frame = -2

Query  746  VTPSNSGEEQ--VVSSNSSPGTAAIDASQGGST-SELIGENERLRKENIELNKELSQMKS  576
            ++PSNSG+EQ  V+SS SSP       +Q G+  +EL+ ENE+LRKEN++LNK+LS+MKS
Sbjct  143  ISPSNSGDEQSPVISSASSPSRL----NQAGTVMAELMKENEKLRKENVQLNKQLSEMKS  198

Query  575  LCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRA  396
            LCNNI++LMSNY+ + S + +          KPLD +P     + G   E +T P     
Sbjct  199  LCNNIFSLMSNYASSQSENISPVH-------KPLDFLP-AKRLSWGESVEEETSP-----  245

Query  395  RLFGVSIG--SKRVRE------GEDGSAEQDHDLRLQQPGTD--VKSEPEN----GEDN-  261
            RLFGV IG  +KR RE       E  +A  +  L+LQQPG    +K EP +    G D+ 
Sbjct  246  RLFGVPIGGAAKRAREEGEGVGTEAATAADETQLQLQQPGGSEIIKLEPLDCQNRGRDDD  305

Query  260  ---EESPWLRQCHRQNQRVCN  207
               +++PWLRQ HR NQRVCN
Sbjct  306  RGIQDAPWLRQVHRANQRVCN  326



>gb|AIG20087.1| HSF20 [Gossypium hirsutum]
Length=326

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 122/201 (61%), Gaps = 38/201 (19%)
 Frame = -2

Query  746  VTPSNSGEEQ--VVSSNSSPGTAAIDASQGGST-SELIGENERLRKENIELNKELSQMKS  576
            ++PSNSG+EQ  V+SS SSP       +Q G+  +EL+ ENE+LRKEN++LNK+LS+MKS
Sbjct  143  ISPSNSGDEQSPVISSASSPSRL----NQAGTVMAELMKENEKLRKENVQLNKQLSEMKS  198

Query  575  LCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRA  396
            LCNNI++LMSNY+ + S + +          KPLD +P     + G   E +T P     
Sbjct  199  LCNNIFSLMSNYASSQSENISPVH-------KPLDFLP-AKRLSWGESVEEETSP-----  245

Query  395  RLFGVSIG--SKRVRE------GEDGSAEQDHDLRLQQPGTD--VKSEPEN----GEDN-  261
            RLFGV IG  +KR RE       E  +A  +  L+LQQPG    +K EP +    G D+ 
Sbjct  246  RLFGVPIGGAAKRAREEGEGVGTEAATAADETQLQLQQPGGSEIIKLEPLDCQNRGRDDD  305

Query  260  ---EESPWLRQCHRQNQRVCN  207
               +++PWLRQ HR NQRVCN
Sbjct  306  RGIQDAPWLRQVHRANQRVCN  326



>ref|XP_006421885.1| hypothetical protein CICLE_v10005403mg [Citrus clementina]
 ref|XP_006490352.1| PREDICTED: heat stress transcription factor B-2a-like [Citrus 
sinensis]
 gb|ESR35125.1| hypothetical protein CICLE_v10005403mg [Citrus clementina]
Length=330

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 120/200 (60%), Gaps = 37/200 (19%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSP--GTAAIDASQ---GGSTSELIGENERLRKENIELNKELSQM  582
            V+PSNSGEEQV+SSNSSP  G A + A     G + +E++ EN++LRKEN +LNK++++M
Sbjct  148  VSPSNSGEEQVISSNSSPAAGAAGVTAHTCGGGHTCAEIVEENDKLRKENAQLNKQVAEM  207

Query  581  KSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEM  402
            K+LCNNI++LMSNY+       +   +++++ L         +     CG     E +EM
Sbjct  208  KNLCNNIFSLMSNYTRGGVGGGDGGGQAAMELL---------SEKRFSCG-----EGEEM  253

Query  401  RARLFGVSIGSKRVRE----GEDGSAEQDHDLRLQQPGTDVKSEPENGE----------D  264
              RLFGV IG+KR RE    GE  S+  ++  RLQ     +KSEP + +          D
Sbjct  254  STRLFGVPIGAKRAREVNCGGEPSSSTAENATRLQ---LQLKSEPLDYQMGGGGGGDHCD  310

Query  263  NEESPWLRQC-HRQNQRVCN  207
             +E+PWLRQ  HR NQRVCN
Sbjct  311  RQETPWLRQSHHRPNQRVCN  330



>ref|XP_008376546.1| PREDICTED: heat stress transcription factor B-2a-like [Malus 
domestica]
Length=297

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 116/183 (63%), Gaps = 23/183 (13%)
 Frame = -2

Query  749  TVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLC  570
             ++P+NSG+EQV+SS+SS            ++SE++ ENERLRKEN++L KEL ++KSLC
Sbjct  136  IISPANSGDEQVISSSSS---------PIRASSEIMDENERLRKENMQLTKELVELKSLC  186

Query  569  NNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARL  390
            NNI+ ++       SN +   +ES    LKPLDLMP         G     E +E   +L
Sbjct  187  NNIFTMV-------SNYACAQSESGFPELKPLDLMPGKRFP----GKREHEEEEEASPKL  235

Query  389  FGVSIGSKRVREGE-DGSAEQDHDLRLQQP-GTDVKSEPENGEDNEESPWLRQCHRQNQR  216
            FGV+IG+KR RE   DG    + +LRLQQP  ++VKSEP +   ++E+PWL+QCH  NQR
Sbjct  236  FGVAIGAKRAREARGDGVENDETNLRLQQPSASEVKSEPSDI-GHKETPWLKQCHMANQR  294

Query  215  VCN  207
            VCN
Sbjct  295  VCN  297



>ref|XP_007143381.1| hypothetical protein PHAVU_007G067800g [Phaseolus vulgaris]
 gb|ESW15375.1| hypothetical protein PHAVU_007G067800g [Phaseolus vulgaris]
Length=304

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 107/183 (58%), Gaps = 27/183 (15%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            V+PSNS EEQV+SSNSSP  A          +EL+ ENERL+KENI L KEL +M+SLCN
Sbjct  146  VSPSNSTEEQVISSNSSPSRAP---------AELLDENERLKKENILLTKELEEMRSLCN  196

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARLF  387
            NI+ LMSNY+   ++   ++        K L LMP+       C GE   +  EM  +LF
Sbjct  197  NIFNLMSNYATARADGGAEAG-------KMLGLMPSKR-----CSGEGAVK--EMNPKLF  242

Query  386  GVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENGE---DNEESPWLRQCHRQNQR  216
            GV+IG+KR RE E   AE D  L L Q   D+KSEP + E   +N  + WL      N+R
Sbjct  243  GVAIGTKRSRE-EGRGAEYDTVLSLHQFHEDMKSEPLDFERHGENRITSWLNHYRTANER  301

Query  215  VCN  207
            VCN
Sbjct  302  VCN  304



>ref|XP_010278594.1| PREDICTED: heat stress transcription factor B-2b-like [Nelumbo 
nucifera]
Length=318

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 113/191 (59%), Gaps = 15/191 (8%)
 Frame = -2

Query  752  KTVTPSNSGEEQVVSSNSSPGTAAIDA---SQGGSTSELIGENERLRKENIELNKELSQM  582
            +T +P+NSG++QVVSS SSP   A      +   ST+EL+ ENERLRKEN+ L  EL+QM
Sbjct  134  RTGSPTNSGDDQVVSSTSSPSAVAATVCRTTSCSSTAELLDENERLRKENMHLTHELTQM  193

Query  581  KSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatat-----atAGCG-GENQ  420
            K+LCN+I ALM+ Y+ +   +++  AE       PLDL+P         A  G G    +
Sbjct  194  KNLCNSILALMTKYANSQQENASFLAEKPSS---PLDLLPVKRFAEDNNADTGVGQSRVK  250

Query  419  TEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENGEDNEESPWLR  240
            TE +E   RLFGVSIG KR +  ++    Q  + +   P ++VKSEP    D +E PWL+
Sbjct  251  TEEEEGSPRLFGVSIGVKRAKGSDEEQEHQQQEEKEDPPRSEVKSEP---PDQQEHPWLK  307

Query  239  QCHRQNQRVCN  207
               + NQRVCN
Sbjct  308  CSPQPNQRVCN  318



>gb|KJB25778.1| hypothetical protein B456_004G208800 [Gossypium raimondii]
Length=259

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 115/177 (65%), Gaps = 17/177 (10%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            V+PSNSG+EQV+SSNS P    +  +   +T EL+ ENERLRKEN++LN EL+Q+K LCN
Sbjct  87   VSPSNSGDEQVISSNSPPVATVLHRTTSSTTPELLEENERLRKENMQLNHELTQLKGLCN  146

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPata--tatAGCGGENQTEPDE-MRA  396
            NI  LM+NY+   S +++ SAE      K LDL+PA    T   G G +   + +E +  
Sbjct  147  NILTLMTNYASGQSENNSNSAEG-----KALDLLPAKNSGTKAGGVGPKEAVDMEEDVTP  201

Query  395  RLFGVSIGSKRVREGEDGSAEQDHDLRLQQ-----PGTDVKSEPENGE-DNEESPWL  243
            +LFGVSIG KRVR  ED   EQ+++  LQQ     PG  VK+EP +G+ D+++S WL
Sbjct  202  KLFGVSIGLKRVRR-EDSVEEQNNNQELQQEIECEPG--VKAEPLDGKSDDQDSSWL  255



>gb|KJB25779.1| hypothetical protein B456_004G208800 [Gossypium raimondii]
Length=311

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 115/177 (65%), Gaps = 17/177 (10%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            V+PSNSG+EQV+SSNS P    +  +   +T EL+ ENERLRKEN++LN EL+Q+K LCN
Sbjct  139  VSPSNSGDEQVISSNSPPVATVLHRTTSSTTPELLEENERLRKENMQLNHELTQLKGLCN  198

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPata--tatAGCGGENQTEPDE-MRA  396
            NI  LM+NY+   S +++ SAE      K LDL+PA    T   G G +   + +E +  
Sbjct  199  NILTLMTNYASGQSENNSNSAEG-----KALDLLPAKNSGTKAGGVGPKEAVDMEEDVTP  253

Query  395  RLFGVSIGSKRVREGEDGSAEQDHDLRLQQ-----PGTDVKSEPENGE-DNEESPWL  243
            +LFGVSIG KRVR  ED   EQ+++  LQQ     PG  VK+EP +G+ D+++S WL
Sbjct  254  KLFGVSIGLKRVRR-EDSVEEQNNNQELQQEIECEPG--VKAEPLDGKSDDQDSSWL  307



>ref|XP_002510816.1| Heat shock factor protein, putative [Ricinus communis]
 gb|EEF51418.1| Heat shock factor protein, putative [Ricinus communis]
Length=323

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 111/199 (56%), Gaps = 43/199 (22%)
 Frame = -2

Query  749  TVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLC  570
             ++P++SGEEQV+S+NSSP         GG  +EL+ EN+RLRKEN+ L+KEL +MK+LC
Sbjct  149  IISPASSGEEQVISTNSSPSRLG-----GGPATELLDENDRLRKENVHLSKELIEMKNLC  203

Query  569  NNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARL  390
            NNI++L+     ++   +         ++KPLDL+     +          E +E  ARL
Sbjct  204  NNIFSLV-----SSYAGNQPPENGGFSAVKPLDLLSVKQLSVE--------EEEETSARL  250

Query  389  FGVSIGSKRVREGEDGSAEQDHDLRLQQP--GTDVKSEPENGEDN---------------  261
            FGV+IG KR REGED   E D  L+LQQP  G  VK EP + +++               
Sbjct  251  FGVAIGVKRGREGED--RENDTQLQLQQPGGGNAVKIEPVDCQNDAVNGHNHDYDHDHDH  308

Query  260  -EESPWLRQCHRQNQRVCN  207
             +ES WLR     N RVCN
Sbjct  309  DQESTWLR-----NGRVCN  322



>gb|EPS62621.1| hypothetical protein M569_12169, partial [Genlisea aurea]
Length=284

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 103/162 (64%), Gaps = 16/162 (10%)
 Frame = -2

Query  767  PAQPSKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
            PA P +TV+PS+SGEEQV+SS++SP  AA+     G TSELI ENERLR EN++LN+EL 
Sbjct  126  PAVPLRTVSPSDSGEEQVISSSNSP--AAV-REFSGRTSELIRENERLRTENVQLNRELG  182

Query  587  QMKSLCNNIYALMsny----sgnnsnssnqsaesslqSLKPLDLMPa--------tatat  444
            QMKSLCNNIY LMS +      N  N  + +  S   ++KPLDL+P         TA  +
Sbjct  183  QMKSLCNNIYILMSTFGSGHDSNGKNDRSYNLLSPETAVKPLDLLPMTNFCQEIETAMVS  242

Query  443  AGCGGEN-QTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHD  321
            A   G+N ++  +EM ARLFGV I  KR R+ +  S+  D D
Sbjct  243  AASNGDNVRSSAEEMSARLFGVPISMKRGRDIDCSSSGDDED  284



>ref|XP_010940869.1| PREDICTED: heat stress transcription factor B-2b-like [Elaeis 
guineensis]
Length=358

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 108/195 (55%), Gaps = 23/195 (12%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCNN  564
            +P+NSGEEQV+SSNSSPG     A+  G   EL  ENERLRKEN  L++ELSQMK+LCNN
Sbjct  155  SPTNSGEEQVLSSNSSPGALPAPATVAGGAVELRDENERLRKENSRLSRELSQMKNLCNN  214

Query  563  IYALMsnysgnnsnssnqsaesslqS--LKP--LDLMPatatatAGCGGENQTEPDEMR-  399
            I  LMS Y+ +              +  + P  L+L+PA          E + + +E+  
Sbjct  215  IVLLMSKYASSQQQGGGGVEGGEQAAPEVAPPLLELIPARRAEEEEEEEEGRVKAEEVTS  274

Query  398  --------ARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPEN---GEDNEES  252
                    ARLFGVSIG KR+R GEDG   +D   R   P  +VK EP +   G D E  
Sbjct  275  PPSPAGPCARLFGVSIGVKRLR-GEDGG--EDPPDRASAP--EVKPEPLDPGSGPDRES-  328

Query  251  PWLRQCHRQNQRVCN  207
             W+ +C R +QR CN
Sbjct  329  -WILRCPRPSQRACN  342



>ref|XP_006440567.1| hypothetical protein CICLE_v10021287mg [Citrus clementina]
 gb|ESR53807.1| hypothetical protein CICLE_v10021287mg [Citrus clementina]
Length=309

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 107/181 (59%), Gaps = 14/181 (8%)
 Frame = -2

Query  764  AQPSKTVTPSNSGEEQVVSSNSSP----GTAAIDASQGGSTSELIGENERLRKENIELNK  597
            A  +++++P+NSGEEQV+S+NSSP     T  I  +   +  EL+ ENE+LRKEN +LN 
Sbjct  131  AAVARSISPANSGEEQVISANSSPVAVPTTTVIRTTSCTTMPELLEENEKLRKENAQLNN  190

Query  596  ELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQT  417
            ELSQ+K LCNNI ALM+NY+    ++ +          K ++++PA      G   E   
Sbjct  191  ELSQLKGLCNNILALMTNYASGQLDNVSLPEG------KSVEVLPARKADEGGAKVEEAE  244

Query  416  EPDEMRARLFGVSIGSKRVRE-GEDGSAEQDHDLRLQQPGTDVKSEP--ENGEDNEESPW  246
            E D +  RLFGVSIG+KR R   E+   +        +PG+DVKSEP   N + ++E PW
Sbjct  245  ELD-LTPRLFGVSIGAKRARREEEEEQNQLQQQQGENEPGSDVKSEPLDANNDHHQEPPW  303

Query  245  L  243
            L
Sbjct  304  L  304



>ref|XP_006477425.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477426.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X2 [Citrus sinensis]
Length=309

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 107/181 (59%), Gaps = 14/181 (8%)
 Frame = -2

Query  764  AQPSKTVTPSNSGEEQVVSSNSSPG----TAAIDASQGGSTSELIGENERLRKENIELNK  597
            A  +++++P+NSGEEQV+S+NSSP     T  I  +   +  EL+ ENE+LRKEN +LN 
Sbjct  131  AAVARSISPANSGEEQVISANSSPVAVPPTTVIRTTSCTTMPELLEENEKLRKENAQLNN  190

Query  596  ELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQT  417
            ELSQ+K LCNNI ALM+NY+    ++ +          K ++++PA      G   E   
Sbjct  191  ELSQLKGLCNNILALMTNYASGQLDNVSLPEG------KSVEVLPARKADEGGAKVEEAE  244

Query  416  EPDEMRARLFGVSIGSKRVRE-GEDGSAEQDHDLRLQQPGTDVKSEP--ENGEDNEESPW  246
            E D +  RLFGVSIG+KR R   E+   +        +PG+DVKSEP   N + ++E PW
Sbjct  245  ELD-LTPRLFGVSIGAKRARREEEEEQNQLQQQQGENEPGSDVKSEPLDANNDHHQEPPW  303

Query  245  L  243
            L
Sbjct  304  L  304



>ref|XP_006396868.1| hypothetical protein EUTSA_v10028744mg [Eutrema salsugineum]
 gb|ESQ38321.1| hypothetical protein EUTSA_v10028744mg [Eutrema salsugineum]
Length=370

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 110/194 (57%), Gaps = 30/194 (15%)
 Frame = -2

Query  749  TVTPSNSGEEQVVSSNSSPGTAAID-------------ASQGGSTSELIGENERLRKENI  609
            TV+PSNSGEEQV+SSNSSP  AA                +   +T ELI ENERLRKEN+
Sbjct  178  TVSPSNSGEEQVISSNSSPAAAAATTGGAAAVGAVLQRTTSCTTTPELIEENERLRKENV  237

Query  608  ELNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGG  429
            +L++EL+++K L  NIY+LM+N++   ++ ++   E      KPLDL+P     +     
Sbjct  238  QLSQELTKLKGLYANIYSLMANFTTGQADCASLLPEG-----KPLDLLPERQELSEAMAM  292

Query  428  ENQTEP-------DEMRARLFGVSIGSKRVREGED---GSAEQDHDLRLQQPGTDVKSEP  279
             ++ E        +++  RLFGVSIG KR R  E+    + E D ++R  + G+DVKSEP
Sbjct  293  ASRIETGIGLKLDEDLTPRLFGVSIGVKRARRDEELGAATEEDDEEIREGEQGSDVKSEP  352

Query  278  --ENGEDNEESPWL  243
              E    N   PWL
Sbjct  353  MEEKNSSNHNGPWL  366



>ref|XP_009151322.1| PREDICTED: heat stress transcription factor B-2a [Brassica rapa]
Length=302

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 111/191 (58%), Gaps = 31/191 (16%)
 Frame = -2

Query  764  AQPSKTV-TPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
             Q +KTV +PS+S E+Q VS    P       + GG + EL+ ENE+LR +NI+LN+EL+
Sbjct  138  VQTTKTVVSPSSSAEDQAVS----PSWYCQTGNSGGLSVELLEENEKLRSQNIQLNRELT  193

Query  587  QMKSLCNNIYALMsnysgnnsnss-nqsaesslqSLKPLDLMPatatatAGCGGENQTEP  411
            QMKSLC+NI++LMSN+SG+  + + +  A SS + +KP++  PA         GE + E 
Sbjct  194  QMKSLCDNIFSLMSNFSGSPPDQNCSPGASSSHERMKPVEFFPAKR-----FSGETEVE-  247

Query  410  DEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPEN---GEDNEESPWLR  240
            +E   RLFGVSIG KR R                  G  VK+  E    G + EE+PWLR
Sbjct  248  EEASHRLFGVSIGLKRTR----------------SEGVQVKAVGERSGGGGEKEETPWLR  291

Query  239  QCHRQNQRVCN  207
              +R NQRVCN
Sbjct  292  HYNRTNQRVCN  302



>ref|XP_010538799.1| PREDICTED: heat stress transcription factor B-2b-like [Tarenaya 
hassleriana]
Length=336

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 109/195 (56%), Gaps = 30/195 (15%)
 Frame = -2

Query  755  SKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKS  576
            + T++PSNSGEEQV+SSNSSP       +   +T EL+ ENERLRKEN++L++EL+++K 
Sbjct  144  THTISPSNSGEEQVISSNSSPSGILQRTTSCTTTPELMEENERLRKENVQLSQELTKLKG  203

Query  575  LCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCG------GENQTE  414
            L   I+ LM+N+S    +  N +        KPLDL+P    A A         G N   
Sbjct  204  LYGGIHTLMTNFSAGQVDCENLNLMPEG---KPLDLLPGRQQAVAVASRMEEGIGLNH--  258

Query  413  PDEMRARLFGVSIGSKRVRE-----GEDGSAEQDHDLRLQQ----------PGTDVKSEP  279
             D++  RLFGVSIG KR R+      +D   E +++ R Q+           G+DVKSEP
Sbjct  259  -DDLNPRLFGVSIGVKRARQDDEVVADDAEDEVENEERQQRGRRSDSREWGRGSDVKSEP  317

Query  278  ---ENGEDNEESPWL  243
               EN  DN + PWL
Sbjct  318  MEEENNSDNRDGPWL  332



>ref|XP_007040152.1| Winged-helix DNA-binding transcription factor family protein, 
putative isoform 2, partial [Theobroma cacao]
 gb|EOY24653.1| Winged-helix DNA-binding transcription factor family protein, 
putative isoform 2, partial [Theobroma cacao]
Length=234

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 115/178 (65%), Gaps = 16/178 (9%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTS-ELIGENERLRKENIELNKELSQMKSLC  570
            V+PSNS +EQV+SSNS P  A +  +   +T+ EL+ ENERLRKEN++LN EL+Q+K LC
Sbjct  59   VSPSNS-DEQVISSNSPPVVAVVHRTTSCTTTPELLEENERLRKENMQLNHELTQLKGLC  117

Query  569  NNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQ------TEPD  408
            NNI  LM+NY+     + +  AE      K LDL+PA  +A     G ++       E D
Sbjct  118  NNILTLMTNYASGQLENPSNLAEG-----KALDLLPARNSAGTAEDGGSKGAMAMEEEAD  172

Query  407  EMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQ--QPGTDVKSEPENGE-DNEESPWL  243
            ++  +LFGVSIG KR+R  ED   + ++ ++ Q  +PG++VK+EP +G+ D++++ WL
Sbjct  173  DVTPKLFGVSIGVKRLRREEDDEEQNNNQVQQQDIEPGSEVKAEPLDGKTDDQDTAWL  230



>emb|CDX86938.1| BnaC03g52080D [Brassica napus]
Length=300

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 107/189 (57%), Gaps = 27/189 (14%)
 Frame = -2

Query  764  AQPSKTV-TPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
             Q +KTV +PS+S E+Q VS    P       + GG + EL+ ENE+LR +NI+LN+EL+
Sbjct  136  VQTTKTVVSPSSSAEDQAVS----PSWYCQTGNGGGLSVELLEENEKLRSQNIQLNRELT  191

Query  587  QMKSLCNNIYALMsnys-gnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEP  411
            QMKSLC+NI++LMSN+S      SS+  A +S  ++K ++ +PA   +    G E     
Sbjct  192  QMKSLCDNIFSLMSNFSGSPPERSSSPGASTSHDAMKTVEFLPAKRFSVETEGEE-----  246

Query  410  DEMRARLFGVSIGSKRVR-EGEDGSAEQDHDLRLQQPGTDVKSEPENGEDNEESPWLRQC  234
             E   RLFGVSIG KR R EG    A              V   P  G + EE+PWLR  
Sbjct  247  -EASHRLFGVSIGLKRTRSEGVQVKA--------------VGERPGGGGEKEETPWLRHY  291

Query  233  HRQNQRVCN  207
            +R NQRVCN
Sbjct  292  NRTNQRVCN  300



>ref|XP_002273914.2| PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor 
B-2a [Vitis vinifera]
Length=306

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 95/161 (59%), Gaps = 14/161 (9%)
 Frame = -2

Query  758  PSKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMK  579
            P   V+ SN  +E+++SSNS             +T+ LI ENERLRKEN+ELN+EL++MK
Sbjct  117  PISPVSSSNCADERLISSNSP-PATTTTPHATSNTAGLIDENERLRKENVELNRELNRMK  175

Query  578  SLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMR  399
            +LCNNI+AL+S+   NN   +    +      KPL+  P           E   E +EM 
Sbjct  176  TLCNNIFALISSNYTNNIFGNVSQTD------KPLNRFPEKQF-----SSEMMIE-EEMT  223

Query  398  ARLFGVSIGSKRVREGEDG-SAEQDHDLRLQQPGTDVKSEP  279
             RLFGV+IG+KR REGE G  A+ D    LQ+P ++VKSEP
Sbjct  224  PRLFGVAIGAKRAREGEVGLVADPDPVQELQRPWSEVKSEP  264



>gb|AII99903.1| heat shock transcription factor [Gossypium hirsutum]
Length=311

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 113/178 (63%), Gaps = 19/178 (11%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            V+PSNSG+EQV+SSNS P    +  +   +T EL+ ENERLRKEN++LN EL+Q+K LCN
Sbjct  139  VSPSNSGDEQVISSNSPPVATVLHRTTSSTTPELLEENERLRKENMQLNHELTQLKGLCN  198

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMP--atatatAGCGGENQTEPDE-MRA  396
            NI  LM+NY+   S +++ SAE      K LDL+P   + T   G G +   + +E +  
Sbjct  199  NILTLMTNYASGQSENNSNSAEG-----KALDLLPGKNSGTKAGGVGPKEAVDMEEDVTP  253

Query  395  RLFGVSIGSKRVREGEDG------SAEQDHDLRLQQPGTDVKSEPENGE-DNEESPWL  243
            +LFGVSIG KRVR  ED       + EQ  D+   +PG  VK+EP +G+ D+++S WL
Sbjct  254  KLFGVSIGMKRVRR-EDSVEEQNNNQEQQQDIEC-EPG--VKAEPLDGKSDDQDSSWL  307



>ref|XP_007040151.1| Winged-helix DNA-binding transcription factor family protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOY24652.1| Winged-helix DNA-binding transcription factor family protein, 
putative isoform 1 [Theobroma cacao]
Length=314

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 115/178 (65%), Gaps = 16/178 (9%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTS-ELIGENERLRKENIELNKELSQMKSLC  570
            V+PSNS +EQV+SSNS P  A +  +   +T+ EL+ ENERLRKEN++LN EL+Q+K LC
Sbjct  139  VSPSNS-DEQVISSNSPPVVAVVHRTTSCTTTPELLEENERLRKENMQLNHELTQLKGLC  197

Query  569  NNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQ------TEPD  408
            NNI  LM+NY+     + +  AE      K LDL+PA  +A     G ++       E D
Sbjct  198  NNILTLMTNYASGQLENPSNLAEG-----KALDLLPARNSAGTAEDGGSKGAMAMEEEAD  252

Query  407  EMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQ--QPGTDVKSEPENGE-DNEESPWL  243
            ++  +LFGVSIG KR+R  ED   + ++ ++ Q  +PG++VK+EP +G+ D++++ WL
Sbjct  253  DVTPKLFGVSIGVKRLRREEDDEEQNNNQVQQQDIEPGSEVKAEPLDGKTDDQDTAWL  310



>ref|XP_012086969.1| PREDICTED: heat stress transcription factor B-2b [Jatropha curcas]
 ref|XP_012086971.1| PREDICTED: heat stress transcription factor B-2b [Jatropha curcas]
 ref|XP_012086972.1| PREDICTED: heat stress transcription factor B-2b [Jatropha curcas]
Length=333

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 110/192 (57%), Gaps = 26/192 (14%)
 Frame = -2

Query  755  SKTVTPSNSGEEQVVSSNSSP-----GTAAIDASQGGSTSELIGENERLRKENIELNKEL  591
            ++TV+P+ SG+EQV+SSNSSP      T  +  +   +T EL+ ENERLRK N +L++EL
Sbjct  143  ARTVSPTTSGDEQVISSNSSPVATQVATPLLRTTSCTTTPELLEENERLRKVNTQLSQEL  202

Query  590  SQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatA----------  441
            +Q+K LCNNI ALM+NY+    +S N  AE      KPLDL+PA                
Sbjct  203  TQLKGLCNNILALMTNYASGQVDSHNNLAEG-----KPLDLLPAMKMVAQREETDMAISG  257

Query  440  GCGGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQ--QPGTDVKSEPENGE  267
            G         + M  RLFGVSIG+KR+R+ E+   + ++  + Q  +  +DVKSEP +G+
Sbjct  258  GATPATTAAEEAMIPRLFGVSIGAKRMRKDEEEQKQANNRQQSQENESTSDVKSEPLDGK  317

Query  266  ----DNEESPWL  243
                 + +  WL
Sbjct  318  TEQSKHHDPSWL  329



>gb|KDP25483.1| hypothetical protein JCGZ_20639 [Jatropha curcas]
Length=332

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 110/192 (57%), Gaps = 26/192 (14%)
 Frame = -2

Query  755  SKTVTPSNSGEEQVVSSNSSP-----GTAAIDASQGGSTSELIGENERLRKENIELNKEL  591
            ++TV+P+ SG+EQV+SSNSSP      T  +  +   +T EL+ ENERLRK N +L++EL
Sbjct  142  ARTVSPTTSGDEQVISSNSSPVATQVATPLLRTTSCTTTPELLEENERLRKVNTQLSQEL  201

Query  590  SQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatA----------  441
            +Q+K LCNNI ALM+NY+    +S N  AE      KPLDL+PA                
Sbjct  202  TQLKGLCNNILALMTNYASGQVDSHNNLAEG-----KPLDLLPAMKMVAQREETDMAISG  256

Query  440  GCGGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQ--QPGTDVKSEPENGE  267
            G         + M  RLFGVSIG+KR+R+ E+   + ++  + Q  +  +DVKSEP +G+
Sbjct  257  GATPATTAAEEAMIPRLFGVSIGAKRMRKDEEEQKQANNRQQSQENESTSDVKSEPLDGK  316

Query  266  ----DNEESPWL  243
                 + +  WL
Sbjct  317  TEQSKHHDPSWL  328



>emb|CDY00246.1| BnaA06g21470D [Brassica napus]
Length=293

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 108/191 (57%), Gaps = 40/191 (21%)
 Frame = -2

Query  764  AQPSKTV-TPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
             Q +KTV +PS+S E+Q VS              GG + EL+ ENE+LR +NI+LN+EL+
Sbjct  138  VQTTKTVVSPSSSAEDQAVSP-------------GGLSVELLEENEKLRSQNIQLNRELT  184

Query  587  QMKSLCNNIYALMsnysgnnsnss-nqsaesslqSLKPLDLMPatatatAGCGGENQTEP  411
            QMKSLC+NI++LMSN+SG+  + + +    SS + +KP++  PA         GE + E 
Sbjct  185  QMKSLCDNIFSLMSNFSGSPPDQNCSPGPSSSHERMKPVEFFPAKR-----FSGETEVE-  238

Query  410  DEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPEN---GEDNEESPWLR  240
            +E   RLFGVSIG KR R                  G  VK+  E    G + EE+PWLR
Sbjct  239  EEASHRLFGVSIGLKRTRSE----------------GVQVKAVGERSGGGGEKEETPWLR  282

Query  239  QCHRQNQRVCN  207
              +R NQRVCN
Sbjct  283  HYNRTNQRVCN  293



>gb|ACN76855.1| heat shock transcription factor [Cicer arietinum]
Length=267

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 89/156 (57%), Gaps = 20/156 (13%)
 Frame = -2

Query  752  KTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSL  573
            K V+PSNSGEEQV+SSNSSP  A  D         L+ ENERLRKEN++L KEL  MKSL
Sbjct  131  KIVSPSNSGEEQVISSNSSPSIAPAD---------LLDENERLRKENMQLKKELDAMKSL  181

Query  572  CNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRAR  393
            CN I  LMS+Y    +    +   ++    K L+L+PA       C GE+    D    +
Sbjct  182  CNKILNLMSSYGKFQTEERKECCSTAT---KTLNLLPAKR-----CNGEDAAAEDR-NPK  232

Query  392  LFGVSIGSKRVREGEDGSAEQDHDLRLQQP-GTDVK  288
            LFGV+IG+KR R GE    + D  L L QP   DVK
Sbjct  233  LFGVAIGTKRAR-GEGRCFDDDTVLSLHQPVHADVK  267



>ref|XP_002283139.1| PREDICTED: heat stress transcription factor B-2b [Vitis vinifera]
 ref|XP_010661169.1| PREDICTED: heat stress transcription factor B-2b [Vitis vinifera]
Length=305

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 104/176 (59%), Gaps = 16/176 (9%)
 Frame = -2

Query  755  SKTVTPSNSGEEQVVSSNSSPGTAAIDA---SQGGSTSELIGENERLRKENIELNKELSQ  585
            ++ V+P+NSG+EQV+SSNSSP T  +     S   ST E++ ENERLR+EN +L +EL+Q
Sbjct  137  ARAVSPTNSGDEQVLSSNSSPATVPVTVHRTSSCSSTPEILEENERLRRENSQLTQELTQ  196

Query  584  MKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDE  405
            ++ LCNNI ALM+NY+    ++            +PLDL+              + E D 
Sbjct  197  LRGLCNNILALMTNYAAGQIDAGGIPEG------RPLDLLTERQLPVEAGQSGVKAEGD-  249

Query  404  MRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENG--EDNEESPWL  243
            +  RLFGVSIG KRVR   D   E + + + QQ   +VKSEP +G  + +++ PWL
Sbjct  250  LSPRLFGVSIGVKRVR--RDEEEESEKEAQTQQ--QEVKSEPLDGSSDHHQDPPWL  301



>ref|XP_004496590.1| PREDICTED: heat stress transcription factor B-2b-like [Cicer 
arietinum]
Length=267

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 89/156 (57%), Gaps = 20/156 (13%)
 Frame = -2

Query  752  KTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSL  573
            K V+PSNSGEEQV+SSNSSP  A  D         L+ ENERLRKEN++L KEL  MKSL
Sbjct  131  KIVSPSNSGEEQVISSNSSPSIAPAD---------LLDENERLRKENMQLKKELDAMKSL  181

Query  572  CNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRAR  393
            CN I  LMS+Y    S    +   ++    K L+L+PA       C GE+    D    +
Sbjct  182  CNKILNLMSSYGKFQSEERKECCSTAT---KTLNLLPAKR-----CNGEDAAAEDR-NPK  232

Query  392  LFGVSIGSKRVREGEDGSAEQDHDLRLQQP-GTDVK  288
            LFGV+IG+KR R GE    + D  L L QP   DVK
Sbjct  233  LFGVAIGTKRAR-GEGRCFDDDTVLSLHQPVHADVK  267



>ref|XP_010523506.1| PREDICTED: heat stress transcription factor B-2a [Tarenaya hassleriana]
Length=322

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 112/185 (61%), Gaps = 14/185 (8%)
 Frame = -2

Query  749  TVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLC  570
             +TPSNSGEEQV+S  SS  +  + +  GG   EL+ ENE+LRK+NI+LN+EL+QMK+LC
Sbjct  148  VITPSNSGEEQVISP-SSWYSKTVGSGGGGGMMELVEENEKLRKQNIQLNRELAQMKNLC  206

Query  569  NNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARL  390
            N+I++LM+NY+G++ N+  +++          D++PA   +        ++E DE   +L
Sbjct  207  NDIFSLMTNYAGSHPNNRYENSYH--------DVLPAKRFSGETEKPAAESE-DEGSQKL  257

Query  389  FGVSIGSKRVREGEDGSAEQDH---DLRLQQPGTDVKSEPENGEDNEESPWLRQCH-RQN  222
            FG  IG KR R G D  AE+      L L+QPG           ++EE+ WLR+ +   N
Sbjct  258  FGFPIGLKRTRSGGDQKAEEQQKTISLSLRQPGESSDGGGGERRESEETRWLRRHYGIAN  317

Query  221  QRVCN  207
            +RVCN
Sbjct  318  ERVCN  322



>gb|KHG06980.1| Heat stress transcription factor B-2b -like protein [Gossypium 
arboreum]
Length=311

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 111/174 (64%), Gaps = 11/174 (6%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            V+PSNSG+EQV+SSNS P    +  +   +T EL+ ENERLRKEN++LN EL+Q+K LCN
Sbjct  139  VSPSNSGDEQVISSNSPPLATVLYRTTSSTTPELLEENERLRKENMQLNHELTQLKGLCN  198

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPata--tatAGCGGENQTEPDE-MRA  396
            NI  LM+NY+   S +++ SAE      K LDL+PA    T   G G +   + +E +  
Sbjct  199  NILTLMTNYASGQSENNSNSAEG-----KALDLLPAKNSGTKAEGMGPKEAVDMEEDVTP  253

Query  395  RLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTD--VKSEPENGE-DNEESPWL  243
            +LFGVSIG KRVR  +    + ++  + Q+   +  VK+EP +G+ D+++S WL
Sbjct  254  KLFGVSIGLKRVRREDSVEEQNNNQEQQQEMECEAGVKAEPLDGKSDDQDSSWL  307



>gb|KHG11685.1| Heat stress transcription factor B-2b -like protein [Gossypium 
arboreum]
Length=313

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 106/175 (61%), Gaps = 13/175 (7%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAID-ASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            +PSNS +EQV+SSNS P    ++  +   +T+EL+ ENERLRKEN++LN EL+Q+K LCN
Sbjct  140  SPSNSSDEQVISSNSPPVATVLNRTTSCTTTAELLEENERLRKENMQLNHELTQLKRLCN  199

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAG----CGGENQTEPDEMR  399
            NI  LM+NY+     + +  AE      K LDL+PA      G         +   +++R
Sbjct  200  NILNLMTNYASGQVENHSNLAEG-----KALDLLPARTRNGGGSKPVLAETEEEAAEDLR  254

Query  398  ARLFGVSIGSKRVREGEDGSAEQDHDLRLQ--QPGTDVKSEPENG-EDNEESPWL  243
             +LFGVSIG KRVR   +       + + Q  +PG+D+KSEP +G  DN++S WL
Sbjct  255  PKLFGVSIGMKRVRREGEEEEGVMDEEQQQEIKPGSDIKSEPLDGNNDNQDSTWL  309



>ref|NP_001281281.1| heat shock factor protein 4 [Malus domestica]
 gb|ADL36731.1| HSF domain class transcription factor [Malus domestica]
Length=276

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 92/147 (63%), Gaps = 21/147 (14%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            ++PSNSG+EQV+SS+SSP          G+ S+L+ ENERLRKEN+ L KEL+++K+LCN
Sbjct  137  MSPSNSGDEQVISSSSSPN---------GAPSKLMQENERLRKENMHLTKELAEVKTLCN  187

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARLF  387
            +I++++       SN +    ES    LKPLDL+P    +  G   E +      R +LF
Sbjct  188  SIFSMV-------SNYACSQWESGFPELKPLDLIPGKRFSVKGEKEEEEEA----RLKLF  236

Query  386  GVSIGSKRVREGE-DGSAEQDHDLRLQ  309
            GV++G+KR RE   DG  E + DLRLQ
Sbjct  237  GVALGAKRAREASADGVEEDETDLRLQ  263



>gb|ADC94861.1| HSP transcription factor [Vitis pseudoreticulata]
Length=305

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 104/176 (59%), Gaps = 16/176 (9%)
 Frame = -2

Query  755  SKTVTPSNSGEEQVVSSNSSPGTAAIDA---SQGGSTSELIGENERLRKENIELNKELSQ  585
            ++ V+P+NSG+EQV+SSNSSP T  +     S   ST E++ ENERLR+EN +L +EL+Q
Sbjct  137  ARAVSPTNSGDEQVLSSNSSPATVPVTVHRTSSCSSTPEILEENERLRRENSQLTQELTQ  196

Query  584  MKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDE  405
            ++ LCNNI ALM+NY+    ++            +PLDL+              + E D 
Sbjct  197  LRGLCNNILALMTNYAAGQIDAGGIPEG------RPLDLLTERQLPVEAGQSGVKAEGD-  249

Query  404  MRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENG--EDNEESPWL  243
            +  RLFGVSIG KRVR   D   E + + + QQ   +VKSEP +G  + +++ PWL
Sbjct  250  LSPRLFGVSIGVKRVR--RDEEEESEKEGQTQQ--QEVKSEPLDGSSDHHQDPPWL  301



>ref|NP_201008.2| heat stress transcription factor B-2a [Arabidopsis thaliana]
 sp|Q9SCW4.1|HFB2A_ARATH RecName: Full=Heat stress transcription factor B-2a; Short=AtHsfB2a; 
AltName: Full=AtHsf-22; AltName: Full=Heat shock factor 
protein 6; Short=HSF 6; AltName: Full=Heat shock transcription 
factor 6; Short=HSTF 6 [Arabidopsis thaliana]
 emb|CAB63802.1| heat shock factor 6 [Arabidopsis thaliana]
 dbj|BAB10163.1| heat shock factor 6 [Arabidopsis thaliana]
 gb|AAP40369.1| putative heat shock factor 6 [Arabidopsis thaliana]
 gb|AAP40470.1| putative heat shock factor 6 [Arabidopsis thaliana]
 dbj|BAF01530.1| heat shock factor 6 [Arabidopsis thaliana]
 dbj|BAH30646.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED97552.1| heat stress transcription factor B-2a [Arabidopsis thaliana]
Length=299

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 106/190 (56%), Gaps = 34/190 (18%)
 Frame = -2

Query  749  TVTPSNSGEE----QVVSSNSSPGTAAIDASQ----GGSTSELIGENERLRKENIELNKE  594
             V+PSNSGE+    QV+SS  SP +     ++    GG + EL+ ENE+LR +NI+LN+E
Sbjct  135  VVSPSNSGEDNNNNQVMSS--SPSSWYCHQTKTTGNGGLSVELLEENEKLRSQNIQLNRE  192

Query  593  LSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTE  414
            L+QMKS+C+NIY+LMSNY G+     + S   S    +P++ +PA   +      E +  
Sbjct  193  LTQMKSICDNIYSLMSNYVGSQPTDRSYSPGGSSS--QPMEFLPAKRFSEMEIEEEEEAS  250

Query  413  PDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENGED-NEESPWLRQ  237
            P     RLFGV IG KR R                  G  VK+    GE+ +EE+PWLR 
Sbjct  251  P-----RLFGVPIGLKRTRS----------------EGVQVKTTAVVGENSDEETPWLRH  289

Query  236  CHRQNQRVCN  207
             +R NQRVCN
Sbjct  290  YNRTNQRVCN  299



>ref|XP_006394443.1| hypothetical protein EUTSA_v10004690mg [Eutrema salsugineum]
 gb|ESQ31729.1| hypothetical protein EUTSA_v10004690mg [Eutrema salsugineum]
Length=296

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 104/182 (57%), Gaps = 28/182 (15%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            V+PSNSGE+Q VS    P +       GG + EL+ ENE+LR +NI+LN+EL+QMKSLC+
Sbjct  141  VSPSNSGEDQAVS----PSSWFCQTGNGGLSVELLEENEKLRSQNIQLNRELTQMKSLCD  196

Query  566  NIYALMsnys-gnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARL  390
            NI++LMSNY+      S +    SS +++KP++ +PA         GE ++       RL
Sbjct  197  NIFSLMSNYAGSLPDRSYSSGGSSSHEAMKPVEFLPAKT-----VVGEEES------PRL  245

Query  389  FGVSIGSKRVR-EGEDGSAEQDHDLRLQQPGTDVKSEPENGEDNEESPWLRQCHRQNQRV  213
            FGV IG KR R EG              +  T      + G +NE++PWLR  +R NQRV
Sbjct  246  FGVPIGLKRTRSEGVQ-----------VKTVTVAGGGSDGGGENEDTPWLRHYNRANQRV  294

Query  212  CN  207
            C+
Sbjct  295  CH  296



>ref|XP_006857851.1| PREDICTED: heat stress transcription factor B-2b [Amborella trichopoda]
 gb|ERN19318.1| hypothetical protein AMTR_s00069p00068180 [Amborella trichopoda]
Length=326

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 113/210 (54%), Gaps = 30/210 (14%)
 Frame = -2

Query  767  PAQPSKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
            P Q +  ++P+NSG+EQV+SSNSSP    I  +   + +ELI ENERLRK N +LN+EL+
Sbjct  124  PIQGNHPMSPTNSGDEQVLSSNSSPAPREIITAANCTAAELIDENERLRKANTQLNQELT  183

Query  587  QMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLM--------PatatatAGCG  432
            QMK+LCN I+ LM+ Y+GN   +   +        K LD             A A     
Sbjct  184  QMKTLCNKIFVLMAGYAGNQQENGIAAG-------KLLDFWSEKGLPGDADMAVANVAVD  236

Query  431  GEN----QTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQP----GTD------  294
            G +    + + ++   RLFGV IG KR RE  DG  E +  +  + P    GT       
Sbjct  237  GADMVVEEVKVEDSSPRLFGVPIGVKRAREETDGGDEGEEGIGTRGPVPGGGTQGPMPDA  296

Query  293  VKSEP-ENGEDNEESPWLRQCHRQNQRVCN  207
            VK EP + G + +++PWL+   R NQRVCN
Sbjct  297  VKEEPLDPGAECQDTPWLKFSCRPNQRVCN  326



>ref|XP_010693477.1| PREDICTED: heat stress transcription factor B-2a [Beta vulgaris 
subsp. vulgaris]
Length=325

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 118/206 (57%), Gaps = 31/206 (15%)
 Frame = -2

Query  752  KTVTPSNSGEEQVVSSNSSP-----------GTAAIDASQGGSTSELIGENERLRKENIE  606
            K ++  +SGEEQV+S+++SP                + S   +  +LI ENERL++EN+E
Sbjct  127  KQISGGDSGEEQVISNSNSPPLGIPTSVYTNNINNHNYSNNNNKGDLIDENERLKRENLE  186

Query  605  LNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGE  426
            LN+EL+ MK+LCNNI++LM+N++ +  N++  S+ ++    + LDL+P    +     GE
Sbjct  187  LNRELTSMKALCNNIFSLMTNFATSEGNTTATSSSTNCMK-QALDLLPPNLIS----AGE  241

Query  425  NQTEPDEMRARLFGV------SIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPEN---  273
             Q    E   ++FGV       IG KRVRE E+G  +      + +   ++K EP +   
Sbjct  242  GQGSGSE-SPKIFGVPIGIGIGIGMKRVRE-EEGVVQVQVQDDMMETDIEIKCEPSDVGG  299

Query  272  ----GEDNEESPWLRQCHRQNQRVCN  207
                G++   +PWL+QCHRQNQRVCN
Sbjct  300  IIDEGDNQNTTPWLQQCHRQNQRVCN  325



>ref|XP_004511596.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511597.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X2 [Cicer arietinum]
Length=337

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 107/198 (54%), Gaps = 28/198 (14%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTS-----ELIGENERLRKENIELNKELSQM  582
            VTP+ SG+EQVVSSNSSP  A    +   STS     EL+ ENERLRKEN++L+ ELSQ+
Sbjct  142  VTPTTSGDEQVVSSNSSPIMAHNSTTVHLSTSCTTAPELLEENERLRKENMQLSNELSQL  201

Query  581  KSLCNNIYALMsnysgnnsnssnqsaesslqSL------KPLDLMPatatatAGCGGENQ  420
            K LCNNI ++M+NY+   S     S  ++          K LDL+PA    + G GG   
Sbjct  202  KGLCNNILSMMTNYASGFSRQLESSTSAATARGVIVTEGKALDLLPARNVLSVGGGGATT  261

Query  419  TEPDEMRA-RLFGVSIGSKRVREGEDGSAEQDHDLRLQQPG-----------TDVKSEPE  276
                E    +LFGVSIG KR R   +   E++     + P            +DVKSEP 
Sbjct  262  ANLAETEVPKLFGVSIGLKRFRTESEAEPEREEREHNKMPTKAQSSQERDRESDVKSEPL  321

Query  275  NGEDNEESPWLRQCHRQN  222
            +G+D+++     Q HR +
Sbjct  322  DGDDSDD-----QEHRWH  334



>ref|XP_006358879.1| PREDICTED: heat stress transcription factor B-2b-like [Solanum 
tuberosum]
 ref|XP_006368078.1| PREDICTED: heat stress transcription factor B-2b-like [Solanum 
tuberosum]
Length=317

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 109/179 (61%), Gaps = 20/179 (11%)
 Frame = -2

Query  752  KTVTPSNSGEEQVVSSNSSPGTAA---IDASQGGSTSELIGENERLRKENIELNKELSQM  582
            + V+ SNSG+EQV+SSNSSP   A   +  +   +T ELI ENERLRKEN +LN+EL+++
Sbjct  148  RMVSSSNSGDEQVLSSNSSPAATAAAMLRTTTCTTTQELIEENERLRKENAQLNQELNRL  207

Query  581  KSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEM  402
            +SLCNN+Y LMSNYS N ++   +  E      + L+L+        G G       +++
Sbjct  208  RSLCNNVYNLMSNYSVNPADIPARIPEG-----RALELL-------DGSGAAFTAAEEDI  255

Query  401  RARLFGVSIGSKRVREG--EDGSAEQDHDLRLQQPGTDVKSEPEN--GEDNEESPWLRQ  237
              RLFGVSIG KRV+    E+    +D D ++Q  G+D++SEP +     +++ PW+ +
Sbjct  256  SPRLFGVSIGVKRVKRSNEEESDTVEDQD-QVQPHGSDMESEPLDSGSAHHDDQPWIYR  313



>ref|XP_008369462.1| PREDICTED: heat stress transcription factor B-2b [Malus domestica]
 ref|XP_008369463.1| PREDICTED: heat stress transcription factor B-2b [Malus domestica]
 ref|XP_008369464.1| PREDICTED: heat stress transcription factor B-2b [Malus domestica]
Length=337

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 107/192 (56%), Gaps = 30/192 (16%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTA----AIDASQGGSTSELIGENERLRKENIELNKELSQMK  579
            V+PSNSG+EQV+SSNSSP  A    A       STS+++ ENERLRKEN++L+ EL+Q++
Sbjct  148  VSPSNSGDEQVISSNSSPVAAPAMLACRIRSSTSTSDVLEENERLRKENMQLSHELTQLR  207

Query  578  SLCNNIYALMsnysgnnsnssnqsaesslqSL---KPLDLMPat----atatAGCGGEN-  423
             LCNNI ALM+NY+    +S           +   + L+L P      A   AGC G N 
Sbjct  208  GLCNNILALMTNYASGQLDSGGGGGGGGGGGVDDGRTLELSPVKEAEPAAEDAGCNGANA  267

Query  422  ----------QTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPEN  273
                      + E +EMR RLFGVSIG KRVR  ED   E+ H    ++     K EP +
Sbjct  268  EASGAEEEEEEEEEEEMRPRLFGVSIGVKRVRRDED--EEEQH----REGSEGAKQEPSD  321

Query  272  G--EDNEESPWL  243
            G  + + ++ WL
Sbjct  322  GSLKRDCDATWL  333



>ref|XP_002318823.2| hypothetical protein POPTR_0012s13430g [Populus trichocarpa]
 gb|EEE97043.2| hypothetical protein POPTR_0012s13430g [Populus trichocarpa]
Length=301

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 101/196 (52%), Gaps = 49/196 (25%)
 Frame = -2

Query  743  TPSNSG-EEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            T SNS  +EQV+S +SSPG +           +LI ENERLRKEN++L  EL++MKSLC 
Sbjct  138  TSSNSSSDEQVISRSSSPGLSV----------DLIDENERLRKENVQLKGELTEMKSLCA  187

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARLF  387
            NI++L+S Y+ +      +         K LDL+P       G             AR+F
Sbjct  188  NIFSLVSTYANSREGKGVR---------KMLDLLPMKEEEREG-------------ARIF  225

Query  386  GVSIGSKRVREGE-------DGSAEQDHDLRLQQPGT--DVKSEP-------ENGEDNEE  255
            GV +G KR REG            E    L+L+QPG    +K E         NG  +++
Sbjct  226  GVEVGVKRGREGSGDMEEGEAEGEEDGMQLQLRQPGCGGGLKIETNGCQDGNSNGGGDQD  285

Query  254  SPWLRQCHRQNQRVCN  207
            +PWL QCHR NQ++C+
Sbjct  286  APWLEQCHRLNQKMCD  301



>ref|XP_006280765.1| hypothetical protein CARUB_v10026734mg, partial [Capsella rubella]
 gb|EOA13663.1| hypothetical protein CARUB_v10026734mg, partial [Capsella rubella]
Length=339

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 108/193 (56%), Gaps = 33/193 (17%)
 Frame = -2

Query  755  SKTVTPSNSGEE-------QVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNK  597
            +  V+PSNSGE+       QV+SS+ +       A  GG + EL+ ENE+LR +NI+LN+
Sbjct  170  TTVVSPSNSGEDNNNNNNNQVMSSSPTSWYCQTTAGDGGLSVELLEENEKLRNQNIQLNR  229

Query  596  ELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQT  417
            EL+QMKS+C+NI++LMSNY G++ + S     +S    +PL+ +PA          + + 
Sbjct  230  ELTQMKSVCDNIFSLMSNYVGSHPDRSYSLGGTSS---QPLEFLPAKRF------SDAEV  280

Query  416  EPDEMRARLFGVSIGSKRVR-EGEDGSAEQDHDLRLQQPGTDVKSEPENGEDNEESPWLR  240
            E +E   RLFGV IG KR R EG              +  T    E ++G   EE+PWLR
Sbjct  281  EEEEASPRLFGVPIGLKRTRSEGAK-----------VKTTTAAVGEKKSG---EETPWLR  326

Query  239  Q--CHRQNQRVCN  207
                +R NQRVCN
Sbjct  327  HYNYNRTNQRVCN  339



>ref|XP_008803040.1| PREDICTED: heat stress transcription factor B-2c-like [Phoenix 
dactylifera]
Length=341

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 105/184 (57%), Gaps = 14/184 (8%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCNN  564
            +P+NSGEEQV+SSNSS G     A+  GS +EL  ENERLRKEN  L++ELSQMK+LCNN
Sbjct  149  SPTNSGEEQVLSSNSSLGALLAPATAAGSAAELRDENERLRKENSRLSRELSQMKNLCNN  208

Query  563  IYALMsnysgnnsnssnqsaesslqS--LKP--LDLMPatatatAGC-GGENQTEPDEMR  399
            I+ L+S Y+ +              +  + P  L+L+PA+  A  G    E  T P    
Sbjct  209  IFLLVSKYAASQQQGGGGVEGGEQAAPDVAPPVLELIPASRAAEEGWVKAEEVTSPPSPA  268

Query  398  ---ARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEP-ENGEDNEESPWLRQCH  231
               ARLFGVSIG KR+R GEDG   +D   R   P   VK EP + G D +   W+  C 
Sbjct  269  GPCARLFGVSIGGKRLR-GEDGG--EDPPERAAAPV--VKPEPLDPGSDLDRESWVLHCP  323

Query  230  RQNQ  219
            R +Q
Sbjct  324  RSSQ  327



>gb|KJB20712.1| hypothetical protein B456_003G160600 [Gossypium raimondii]
 gb|KJB20713.1| hypothetical protein B456_003G160600 [Gossypium raimondii]
Length=310

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 108/179 (60%), Gaps = 21/179 (12%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAID-ASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            +PSNS +EQV+SSNS P    ++  +   +T+EL+ ENERLRKEN++LN EL+Q+K L N
Sbjct  137  SPSNSSDEQVISSNSPPVATVLNRTTSCTTTAELLEENERLRKENMQLNHELTQLKRLYN  196

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEP--------  411
            NI  LM+NY+     + +  AE      K LDL+PA        GG ++  P        
Sbjct  197  NIVILMTNYASGQVENRSNLAEG-----KALDLLPARTRD----GGGSKPVPAETEEEAA  247

Query  410  DEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQ--QPGTDVKSEPENG-EDNEESPWL  243
            +++R +LFGVSIG KRVR   +       + + Q  +PG+D+KSEP +G  DN++S WL
Sbjct  248  EDLRPKLFGVSIGMKRVRREGEEEEGVMDEEQQQEIKPGSDIKSEPLDGNNDNQDSTWL  306



>ref|XP_010934470.1| PREDICTED: heat stress transcription factor B-2b-like [Elaeis 
guineensis]
Length=358

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 101/192 (53%), Gaps = 23/192 (12%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCNN  564
            +P+NSGEEQV+SSNSSPG         GS +EL  ENERLRKEN  L++ELSQMKSLC+N
Sbjct  151  SPTNSGEEQVLSSNSSPGAPP----PSGSAAELRDENERLRKENSRLSRELSQMKSLCDN  206

Query  563  IYALMsnysgnnsnssnqsaesslqSLKP-----LDLMPatatatAGC------GGENQT  417
            I  L+S Y+ +      +  E    +        L+LMPA   A            E  T
Sbjct  207  ILLLISKYASSQQQGGGEGGEGEAAAAVEVASPVLELMPAAGRAAEEGEEERLKAEEVTT  266

Query  416  EPDEM--RARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEP-ENGEDNEESPW  246
             P      ARLFGVSIG KRVR  +DG   +D   R+  PG  VK EP + G D +   W
Sbjct  267  SPSRAGPCARLFGVSIGVKRVRGEDDG---EDQPQRVSAPG--VKPEPLDPGLDLDRQSW  321

Query  245  LRQCHRQNQRVC  210
            + +      R C
Sbjct  322  ILRGALLAHRAC  333



>ref|XP_010444038.1| PREDICTED: heat stress transcription factor B-2a-like [Camelina 
sativa]
Length=316

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 109/196 (56%), Gaps = 24/196 (12%)
 Frame = -2

Query  761  QPSKTVTPSNSGEE-----QVVSSNSSPGTAAIDASQG----GSTSELIGENERLRKENI  609
            Q +  V+PSNSGE+     QV+SS S P +     + G    G + EL+ ENE+LR +NI
Sbjct  134  QTAVVVSPSNSGEDNNNNNQVMSS-SPPSSWYCQTTTGNNGAGLSVELLEENEKLRNQNI  192

Query  608  ELNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGG  429
            +LN+EL+QMKS+C+NI+ LMS+Y G++ + S         S +P++ +PA       C  
Sbjct  193  QLNRELTQMKSVCDNIFTLMSSYVGSHPDRSYSPGGGGSSSHQPVEFLPAKKRF---CDV  249

Query  428  ENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENGEDNEESP  249
            + + E +E   RLFGV IG KR R      +E  H +R     T    E    + +EE P
Sbjct  250  DGEEEEEEASPRLFGVPIGLKRTR------SEGLHQVRTVSTTTAPVGE---KKSDEEPP  300

Query  248  WLRQ--CHRQNQRVCN  207
            WLR    +R NQRVCN
Sbjct  301  WLRHYNYNRTNQRVCN  316



>emb|CAN82265.1| hypothetical protein VITISV_009283 [Vitis vinifera]
Length=477

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 104/176 (59%), Gaps = 16/176 (9%)
 Frame = -2

Query  755  SKTVTPSNSGEEQVVSSNSSPGTAAIDA---SQGGSTSELIGENERLRKENIELNKELSQ  585
            ++ V+P+NSG+EQV+SSNSSP T  +     S   ST E++ ENERLR+EN +L +EL+Q
Sbjct  309  ARAVSPTNSGDEQVLSSNSSPATVPVTVHRTSSCSSTPEILEENERLRRENSQLTQELTQ  368

Query  584  MKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDE  405
            ++ LCNNI ALM+NY+    ++            +PLDL+              + E D 
Sbjct  369  LRGLCNNILALMTNYAAGQIDAGGIPEG------RPLDLLTERQLPVEAGQSGVKAEGD-  421

Query  404  MRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENG--EDNEESPWL  243
            +  RLFGVSIG KRVR  E+  +E++     Q    +VKSEP +G  + +++ PWL
Sbjct  422  LSPRLFGVSIGVKRVRRDEEEESEKEX----QTQQQEVKSEPLDGSSDHHQDPPWL  473



>ref|XP_009134244.1| PREDICTED: heat stress transcription factor B-2b-like [Brassica 
rapa]
Length=316

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 103/191 (54%), Gaps = 37/191 (19%)
 Frame = -2

Query  755  SKTVTPSNSGEEQVVSSNSSPGTA---------AIDASQGGSTS-ELIGENERLRKENIE  606
            +  ++PSNSGEEQV+SSNSSP            A+  +   +T+ EL+ ENERLRKEN++
Sbjct  139  AHVLSPSNSGEEQVISSNSSPAGTGGGGGSVGVALQRTTSCTTAPELMEENERLRKENVQ  198

Query  605  LNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatat-----A  441
            L++EL+++K L +NIY LM           +         +KPLDLMP     +      
Sbjct  199  LSQELTKLKGLYSNIYKLM-----------SNFTSGGADCVKPLDLMPERQEMSEEAIET  247

Query  440  GCGGENQTEPDEMRARLFGVSIGSKRVREGED---GSAEQDHDLRLQQPGTDVKSEP--E  276
            G G +  T       RLFGVSIG KR R  ++    +AE+D +   ++ G+D KSEP  E
Sbjct  248  GAGLKLLT------PRLFGVSIGVKRARRDQELGAAAAEEDDNQEEEEQGSDDKSEPMEE  301

Query  275  NGEDNEESPWL  243
            N   +   PWL
Sbjct  302  NNSVDHNGPWL  312



>gb|AII99900.1| heat shock transcription factor [Gossypium hirsutum]
Length=310

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 108/179 (60%), Gaps = 21/179 (12%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAID-ASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            +PSNS +EQV+SSNS P    ++  +   +T+EL+ ENERLRKEN++LN EL+Q+K L N
Sbjct  137  SPSNSSDEQVISSNSPPVATVLNRTTSCTTTAELLEENERLRKENMQLNHELTQLKRLYN  196

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEP--------  411
            NI  LM+NY+     + +  AE      K LDL+PA        GG ++  P        
Sbjct  197  NIVILMTNYASGQVENRSNLAEG-----KALDLLPARTRD----GGGSKPVPAETEEEAA  247

Query  410  DEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQ--QPGTDVKSEPENG-EDNEESPWL  243
            +++R +LFGVSIG KRVR   +       + + Q  +PG+D+KSEP +G  +N++S WL
Sbjct  248  EDLRPKLFGVSIGMKRVRREGEEEEGVMDEEQQQEIKPGSDIKSEPLDGNNNNQDSTWL  306



>ref|XP_010483895.1| PREDICTED: heat stress transcription factor B-2a-like [Camelina 
sativa]
Length=320

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 109/200 (55%), Gaps = 31/200 (16%)
 Frame = -2

Query  761  QPSKTVTPSNSGEE------QVVSSNSSPGTAAIDASQG----GSTSELIGENERLRKEN  612
            Q +  V+PSNSGE+      QV+SS S P +  +  + G    G + EL+ ENE+LR +N
Sbjct  137  QTTLVVSPSNSGEDRNNNNTQVMSS-SPPSSWYVQTTTGNNGAGLSVELLEENEKLRNQN  195

Query  611  IELNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCG  432
            I+LN+EL+QMKS+C+NI+ LMS+Y G++ + S         S +P++ +PA       C 
Sbjct  196  IQLNRELTQMKSVCDNIFTLMSSYVGSHPDRSYSPGGGGSSSHQPVEFLPAKKRF---CD  252

Query  431  GENQTEPDEMRARLFGVSIGSKRVR-EGEDGSAEQDHDLRLQQPGTDVKSEPENGEDN--  261
             + + E +E   RLFGV IG KR R EG            L Q  T   +    GE    
Sbjct  253  VDGEEEEEEASPRLFGVPIGLKRTRSEG------------LHQVKTVSTTTAPVGEKKSE  300

Query  260  EESPWLRQ--CHRQNQRVCN  207
            EE PWLR    +R NQRVCN
Sbjct  301  EEPPWLRYYNYNRTNQRVCN  320



>ref|XP_010035111.1| PREDICTED: heat stress transcription factor B-2b [Eucalyptus 
grandis]
 gb|KCW46405.1| hypothetical protein EUGRSUZ_K00238 [Eucalyptus grandis]
Length=286

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 97/184 (53%), Gaps = 34/184 (18%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
             +PSNSG+EQ +SS SSP +A          SE++ ENERLR+EN+ L++ELS+MK+LC+
Sbjct  133  ASPSNSGDEQGISSWSSPPSAC----GRNCASEIMDENERLRRENVLLSRELSRMKTLCS  188

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARLF  387
            +I++LM   S   +      A    + L+PL   P           E          RLF
Sbjct  189  SIFSLM---SNYANGGVRAEAAGEKKPLEPLGGNPEA---------EAAAAAAAESPRLF  236

Query  386  GVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEP----ENGEDNEESPWLRQCHRQNQ  219
            GV IG+KR RE E         +R     T++K EP     NG  +   PW++QCHR NQ
Sbjct  237  GVPIGAKRGREEE---------VR-----TEIKLEPLDCQRNGGRSRAEPWMKQCHRSNQ  282

Query  218  RVCN  207
            RV N
Sbjct  283  RVFN  286



>gb|KDO63532.1| hypothetical protein CISIN_1g048246mg, partial [Citrus sinensis]
Length=163

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 93/165 (56%), Gaps = 14/165 (8%)
 Frame = -2

Query  716  VVSSNSSPG----TAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCNNIYALM  549
            V+S+NSSP     T  I  +   +  EL+ ENE+LRKEN +LN ELSQ+K LCNNI ALM
Sbjct  1    VISANSSPVAVPPTTVIRTTSCTTMPELLEENEKLRKENAQLNNELSQLKGLCNNILALM  60

Query  548  snysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARLFGVSIGS  369
            +NY+    ++ +          K ++++PA      G   E   E D +  RLFGVSIG+
Sbjct  61   TNYASGQLDNVSLPEG------KSVEVLPARKADEGGAKVEEAEELD-LTPRLFGVSIGA  113

Query  368  KRVRE-GEDGSAEQDHDLRLQQPGTDVKSEP--ENGEDNEESPWL  243
            KR R   E+   +        +PG+DVKSEP   N + ++E PWL
Sbjct  114  KRARREEEEEQNQLQQQQGENEPGSDVKSEPLDANNDHHQEPPWL  158



>ref|XP_008800793.1| PREDICTED: heat stress transcription factor B-2b-like [Phoenix 
dactylifera]
Length=338

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 106/202 (52%), Gaps = 33/202 (16%)
 Frame = -2

Query  764  AQPSKTV-TPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
            A+P+  V +P+NSGEEQV+SSNSSPG         GS +EL  ENERLRKEN  L++E S
Sbjct  141  AEPANRVGSPANSGEEQVLSSNSSPGAP----PPSGSAAELRDENERLRKENSRLSREFS  196

Query  587  QMKSLCNNIYALMsnysgn------nsnssnqsaesslqSLKP--LDLMPatatatAG--  438
            QMK+LCNNI  L+S Y+ +             +A +++  + P  L+LMPA   A  G  
Sbjct  197  QMKNLCNNILLLISKYTSSQQQGGGEGGGGEVAATTAVVEVAPPVLELMPAAEEAEEGRL  256

Query  437  CGGENQTEPDEMR--ARLFGVSIGSKRVREGEDG------SAEQDHDLRLQQPGTDVKSE  282
               E    P      ARLFGVSIG KRVR  +DG       A  +    L  PG+D+  +
Sbjct  257  KAEEVTISPSSAGPCARLFGVSIGVKRVRGEDDGENPPPRGAAPEVKPELLDPGSDLNRQ  316

Query  281  PENGEDNEESPWLRQCHRQNQR  216
                       W+ +C R  QR
Sbjct  317  ----------LWILRCPRPGQR  328



>gb|KFK31930.1| hypothetical protein AALP_AA6G177400 [Arabis alpina]
Length=378

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 114/199 (57%), Gaps = 37/199 (19%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAA------------IDASQGGSTS-ELIGENERLRKENIEL  603
            +PSNSGEEQV+SSNSSP  AA            +  +   +T+ EL+ ENERLRKEN++L
Sbjct  181  SPSNSGEEQVISSNSSPAAAAAATGGGAAVGVALQRTTSCTTAPELVEENERLRKENVQL  240

Query  602  NKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPata-tatAGCGGE  426
            ++EL+++K L  NIY LM+N++   +  +N   E      KPLDL+P    T+      +
Sbjct  241  SQELTKLKGLYANIYTLMANFTSGQAECANLLPEG-----KPLDLLPMRQGTSEEAMAMD  295

Query  425  NQTE-------PDEMRARLFGVSIGSKRV-REGEDGSAE------QDHDLRLQ--QPGTD  294
            ++ E        +++  RLFGVSIG KR  RE E G AE      +D  +  Q  + G+D
Sbjct  296  SRIEEGIGLKLDEDLTPRLFGVSIGFKRARREEELGGAEDDDDDKRDAVMVTQEDEQGSD  355

Query  293  VKSEP--ENGEDNEESPWL  243
            VKSEP  EN  D+ + PWL
Sbjct  356  VKSEPMEENNSDDHDGPWL  374



>gb|KJB52055.1| hypothetical protein B456_008G244400 [Gossypium raimondii]
Length=304

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 105/168 (63%), Gaps = 16/168 (10%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSP-GTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLC  570
            V+P+NSG+EQV+SS+S P  T     +   +T EL+ ENERLR+EN++L++EL+Q+K LC
Sbjct  124  VSPTNSGDEQVISSHSPPVATILHRMTSCTTTPELLEENERLRRENMQLSQELTQLKGLC  183

Query  569  NNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPa--tatatAGCGGENQTEPDEMRA  396
            NNI  LM+N++     S +  AE      K LDL+ A  +A +T   G +   E +++  
Sbjct  184  NNILTLMTNHASGQLESHSILAEG-----KALDLLSARDSARSTEDSGSKEVAEEEDVTP  238

Query  395  RLFGVSIGSKRVR-EGEDGSAEQDHDLRLQQ----PGTDVKSEPENGE  267
            +LFGVSIG KR+R EGED   E  +  +++Q    P + +K EP  G+
Sbjct  239  KLFGVSIGVKRLRKEGED---EMQNSFQVRQQDTEPASKMKEEPWMGK  283



>gb|KJB52056.1| hypothetical protein B456_008G244400 [Gossypium raimondii]
Length=311

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 105/168 (63%), Gaps = 16/168 (10%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSP-GTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLC  570
            V+P+NSG+EQV+SS+S P  T     +   +T EL+ ENERLR+EN++L++EL+Q+K LC
Sbjct  131  VSPTNSGDEQVISSHSPPVATILHRMTSCTTTPELLEENERLRRENMQLSQELTQLKGLC  190

Query  569  NNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPa--tatatAGCGGENQTEPDEMRA  396
            NNI  LM+N++     S +  AE      K LDL+ A  +A +T   G +   E +++  
Sbjct  191  NNILTLMTNHASGQLESHSILAEG-----KALDLLSARDSARSTEDSGSKEVAEEEDVTP  245

Query  395  RLFGVSIGSKRVR-EGEDGSAEQDHDLRLQQ----PGTDVKSEPENGE  267
            +LFGVSIG KR+R EGED   E  +  +++Q    P + +K EP  G+
Sbjct  246  KLFGVSIGVKRLRKEGED---EMQNSFQVRQQDTEPASKMKEEPWMGK  290



>emb|CBI34728.3| unnamed protein product [Vitis vinifera]
Length=306

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 99/173 (57%), Gaps = 26/173 (15%)
 Frame = -2

Query  755  SKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKS  576
            ++ V+P+NSG+EQV+SSNSSP T             ++ ENERLR+EN +L +EL+Q++ 
Sbjct  137  ARAVSPTNSGDEQVLSSNSSPAT-------------ILEENERLRRENSQLTQELTQLRG  183

Query  575  LCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRA  396
            LCNNI ALM+NY+    ++            +PLDL+              + E D +  
Sbjct  184  LCNNILALMTNYAAGQIDAGGIPEG------RPLDLLTERQLPVEAGQSGVKAEGD-LSP  236

Query  395  RLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENG--EDNEESPWL  243
            RLFGVSIG KRVR   D   E + + + QQ   +VKSEP +G  + +++ PWL
Sbjct  237  RLFGVSIGVKRVR--RDEEEESEKEAQTQQ--QEVKSEPLDGSSDHHQDPPWL  285



>ref|XP_010422122.1| PREDICTED: heat stress transcription factor B-2b [Camelina sativa]
Length=370

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 104/195 (53%), Gaps = 33/195 (17%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAID-----------ASQGGSTSELIGENERLRKENIELNK  597
            +PSNSGEEQV+SSNSSP  AA              +   +  EL+ ENERLRKEN++L++
Sbjct  177  SPSNSGEEQVISSNSSPAAAAAATGGVVGVGLQRTTSCTTAPELVEENERLRKENMQLSQ  236

Query  596  ELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGC------  435
            EL+++KSL  NIY LM+N++   ++ +N   E      KPLDL+P     +         
Sbjct  237  ELTKLKSLYANIYTLMANFTPGQADCANLLPEG-----KPLDLLPEKQGMSEEAMAMASR  291

Query  434  --GGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGT-------DVKSE  282
               G +    D++  RLFGVSIG KR R  E+  A ++ D   Q+  T       DVK E
Sbjct  292  IDAGSDLKLDDDLTPRLFGVSIGFKRARREEELGAAEEEDDDRQEAVTREGEESSDVKPE  351

Query  281  P--ENGEDNEESPWL  243
            P  EN   N   PWL
Sbjct  352  PMEENNSSNHNGPWL  366



>gb|EYU29725.1| hypothetical protein MIMGU_mgv11b015037mg [Erythranthe guttata]
Length=284

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 97/168 (58%), Gaps = 26/168 (15%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAA-------IDASQGGSTSELIGENERLRKENIELNKELS  588
            ++P+NSG+EQV+SSNSSP   A       + A    +T+E++ ENERLR+EN +L++ELS
Sbjct  122  ISPANSGDEQVLSSNSSPAAIAVVTAAAPLRACSSTTTAEILEENERLRRENAQLSQELS  181

Query  587  QMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatA---GCGGENQT  417
            ++KSLC NI+ +MS+Y+ N    ++          +  +L P   T  A   GC   N+ 
Sbjct  182  RLKSLCGNIFTMMSSYATNQGERASPEG-------RSAELTPEAETTAAEEDGCAAVNE-  233

Query  416  EPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPEN  273
            E +EM  R+FGV IG KR+++  D         ++   G D KSEP +
Sbjct  234  EVEEMCPRIFGVPIGVKRLKKSSDD--------QIHPRGFDCKSEPSD  273



>ref|XP_010455582.1| PREDICTED: heat stress transcription factor B-2b-like [Camelina 
sativa]
Length=375

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 105/194 (54%), Gaps = 32/194 (16%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAA---------IDASQGGSTS-ELIGENERLRKENIELNKE  594
            +PSNSGEEQV+SSNSSP  AA         +  +   +T+ EL+ ENERLRKEN++L++E
Sbjct  183  SPSNSGEEQVISSNSSPAAAAAATGVVGVGLQRTTSCTTAPELVEENERLRKENMQLSQE  242

Query  593  LSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGC-------  435
            L+++K L  NIY LM+N++   ++ +N   E      KPLDL+P     +          
Sbjct  243  LTKLKGLYANIYTLMANFTPGQADCANLLREG-----KPLDLLPEKQGMSEEAMAMASRI  297

Query  434  -GGENQTEPDEMRARLFGVSIGSKRVREGEDGSA-------EQDHDLRLQQPGTDVKSEP  279
              G +    D++  RLFGVSIG KR R  E+  A        QD   R  +  +DVK EP
Sbjct  298  DAGSDLKLDDDLTPRLFGVSIGFKRARREEELGAAEEEDDDRQDAVAREGEESSDVKPEP  357

Query  278  --ENGEDNEESPWL  243
              EN   N   PWL
Sbjct  358  MEENNSSNHNGPWL  371



>ref|XP_010919270.1| PREDICTED: heat stress transcription factor B-2c-like [Elaeis 
guineensis]
Length=326

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 101/198 (51%), Gaps = 31/198 (16%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAIDASQGGS---------TSELIGENERLRKENIELNKEL  591
            +P NSG+EQV+SSNSSPG      + G            +EL+ ENERLR+EN++L+ EL
Sbjct  140  SPGNSGDEQVLSSNSSPGGGQQPPAAGAGRAPPPGCSGAAELMEENERLRRENMQLSHEL  199

Query  590  SQMKSLCNNIYALMsnysgnn----snssnqsaesslqSLKPLDLMPatatatAGCGGEN  423
             QMK+LCNNI+ LMS Y+ +     + +S  S    L+   PLDLMP   +       E 
Sbjct  200  GQMKNLCNNIFLLMSKYASSQQQGCATASAASGGPPLEVAPPLDLMPLMRSPE----AER  255

Query  422  QTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEP-ENGEDNEESP-  249
                +    RLFGV I  KR     D   E D        G +VK EP + G D ++S  
Sbjct  256  VNAEEGPSTRLFGVPIRLKRSL--CDDPEEADTS------GPEVKPEPLDPGADPQDSST  307

Query  248  ----WLRQCHRQNQRVCN  207
                WL  C   NQRVCN
Sbjct  308  DHRRWLLCCPPPNQRVCN  325



>ref|XP_009760921.1| PREDICTED: heat stress transcription factor B-2b [Nicotiana sylvestris]
Length=332

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 115/187 (61%), Gaps = 22/187 (12%)
 Frame = -2

Query  752  KTVTPSNSGEEQVVSSNSSPGTAA-----IDASQGGSTSELIGENERLRKENIELNKELS  588
            + V+PSNSG+EQV+SSNSSP   A     +  +   +T EL+ ENERLRKEN +L++EL+
Sbjct  147  RLVSPSNSGDEQVLSSNSSPAATAAAVAVLRTTTCTTTPELLEENERLRKENAQLSQELN  206

Query  587  QMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEP-  411
            +++SLCNN+Y LMSNY+GN S +     +      + L+L+PA   A    GG   T   
Sbjct  207  RLRSLCNNVYNLMSNYTGNPSETLAGIPDG-----RALELLPAGQVAADMDGGATATPAE  261

Query  410  -------DEMRARLFGVSIGSKRVREGEDGSAEQDHDL--RLQQPGTDVKSEP-ENGEDN  261
                   +++  RLFGVSIG KRVR   +  +E++  +  ++Q  G+DVKSEP ++G  +
Sbjct  262  CSGVKAEEDISPRLFGVSIGVKRVRRSSEEESEREGRVQDQVQLHGSDVKSEPLDSGSGH  321

Query  260  EE-SPWL  243
             +  PW+
Sbjct  322  HDGQPWI  328



>ref|XP_010434580.1| PREDICTED: heat stress transcription factor B-2b-like [Camelina 
sativa]
Length=375

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 105/194 (54%), Gaps = 33/194 (17%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAA---------IDASQGGSTS-ELIGENERLRKENIELNKE  594
            +PSNSGEEQV+SSNSSP  AA         +  +   +T+ EL+ ENERLRKEN++L++E
Sbjct  184  SPSNSGEEQVISSNSSPAAAAAATGVVGVGLQRTTSCTTAPELVEENERLRKENMQLSQE  243

Query  593  LSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGC-------  435
            L+++K L  NIY LM+N++   ++ +N          KPLDL+P     +          
Sbjct  244  LTKLKGLYANIYTLMANFTPGQADCANLLPG------KPLDLLPEKQGMSEEAIAMASRI  297

Query  434  -GGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGT-------DVKSEP  279
              G +    D++  RLFGVSIG KR R  E+  A ++ D   Q+  T       DVK EP
Sbjct  298  DAGSDLKLDDDLTPRLFGVSIGFKRARREEELGAAEEEDDDRQEAVTREGEESSDVKPEP  357

Query  278  --ENGEDNEESPWL  243
              EN   N   PWL
Sbjct  358  MEENNSSNHNGPWL  371



>ref|XP_009130190.1| PREDICTED: heat stress transcription factor B-2a-like [Brassica 
rapa]
Length=266

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 98/188 (52%), Gaps = 56/188 (30%)
 Frame = -2

Query  764  AQPSK-TVTPSNSGEEQVVS-SNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKEL  591
            AQ +K  V+PS+SGEEQ +S S+SS G        GG ++EL+ ENERLR ENI+L++EL
Sbjct  133  AQTAKMVVSPSSSGEEQAMSPSSSSTG-------NGGLSTELLEENERLRSENIQLSREL  185

Query  590  SQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEP  411
            +QMKSL  NI+ LMSNY+G +S+S              +D+             E +  P
Sbjct  186  AQMKSLYGNIFGLMSNYAGASSSSHEMM----------MDI-------------EEEASP  222

Query  410  DEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENGEDNEESPWLRQCH  231
                 RLFGVSIG KR R                  G  VK+        EE+PWLR  +
Sbjct  223  -----RLFGVSIGLKRTR----------------SEGVHVKTVSTAA---EETPWLRHYN  258

Query  230  RQNQRVCN  207
              NQRVCN
Sbjct  259  LANQRVCN  266



>ref|XP_004143930.1| PREDICTED: heat stress transcription factor B-2b [Cucumis sativus]
 gb|KGN50137.1| hypothetical protein Csa_5G155480 [Cucumis sativus]
Length=341

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 109/199 (55%), Gaps = 28/199 (14%)
 Frame = -2

Query  767  PAQPSKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
            PA  +  ++P+NS EEQV SSNSSP  A   ++   +T EL+ ENERLRKEN++L+ EL+
Sbjct  140  PAVLAHVISPANSAEEQVTSSNSSP-MAFQRSTSCTTTPELVRENERLRKENMQLSHELT  198

Query  587  QMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatat-----atAGCGGEN  423
            Q+K LCNNI +LM+NY+          +       K L+L+PA        A +    E 
Sbjct  199  QLKGLCNNILSLMTNYASGQHQQLESGSVRDG---KALELLPARQVMEDEGAVSDGAHEV  255

Query  422  QTEPDE----------MRARLFGVSIGSKRVREGEDGSAE----QDHDLRLQ-QPGTDVK  288
            + + +E          M  +LFGVSIG KR+R   +   E    Q+H    + + G+++K
Sbjct  256  RLKMEEKMTAAAAAVGMTPKLFGVSIGMKRMRREIEEEEEEMVGQNHVQSEEGETGSEIK  315

Query  287  SEP--ENGE--DNEESPWL  243
            +EP  EN E  D   SPWL
Sbjct  316  AEPLDENSEHPDGSASPWL  334



>gb|KFK27929.1| hypothetical protein AALP_AA8G449200 [Arabis alpina]
Length=293

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 92/189 (49%), Gaps = 44/189 (23%)
 Frame = -2

Query  749  TVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLC  570
             ++PSNSGEEQ VS    P +       G S  EL+ ENE+LR +NI+LN+ELSQMKSLC
Sbjct  141  VLSPSNSGEEQPVS----PSSWYCQTGTGLSV-ELLEENEKLRIQNIQLNRELSQMKSLC  195

Query  569  NNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARL  390
            +NI+ LM        +S   S+  S   +KP++ +PA            + E +E   RL
Sbjct  196  DNIFNLM--------SSYAGSSSGSHDVVKPVEFLPAK-------VVVEEEEEEEASPRL  240

Query  389  FGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENGEDNEE--------SPWLRQC  234
            FGV IG KR R                  G  VKS                  +PWLR C
Sbjct  241  FGVPIGLKRTRSE----------------GVQVKSSVRGENSGGGNGGGVEETTPWLRYC  284

Query  233  HRQNQRVCN  207
            +R NQRVCN
Sbjct  285  NRVNQRVCN  293



>ref|XP_010933854.1| PREDICTED: heat stress transcription factor B-2c [Elaeis guineensis]
Length=348

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 107/208 (51%), Gaps = 44/208 (21%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPG---------TAAIDASQGGSTSELIGENERLRKENIELNKEL  591
            +P NSG+EQV+SSNSSPG            +      S +EL+ ENERLR+EN  L+ EL
Sbjct  148  SPENSGDEQVLSSNSSPGGEGQQQPPAVGRVPPPGCTSAAELMEENERLRRENQHLSHEL  207

Query  590  SQMKSLCNNIYALMsnysgnnsnssnqsa-------esslqSLKPLDLMPatatatAGCG  432
             QMK+LCNNI  LMS Y+      +  +A       ESSL+   PL+L+P   +      
Sbjct  208  GQMKNLCNNILLLMSKYASTQQQGAAIAADGGRGGGESSLEVAMPLELIPERWSQ-----  262

Query  431  GENQTEPDEMRA--------RLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEP-  279
             E + E   ++A        RLFGV IG KR R G D          LQQ   DVK EP 
Sbjct  263  -EEEAEEARVKAEEGPGPTPRLFGVPIGLKRSR-GADSEG-------LQQSAPDVKREPL  313

Query  278  ENGEDNEE-SP----WLRQCHRQNQRVC  210
            + G D ++ SP    WL    R+NQRVC
Sbjct  314  DPGADPQDLSPDDRRWLLCRPRRNQRVC  341



>ref|XP_010540690.1| PREDICTED: heat stress transcription factor B-2b [Tarenaya hassleriana]
Length=356

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 107/196 (55%), Gaps = 33/196 (17%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAA----------IDASQGGSTS-ELIGENERLRKENIELN  600
            ++PSNSGEEQV+SSNSSP   A          +  +   +T+ EL+ ENERLRKEN++L+
Sbjct  162  ISPSNSGEEQVISSNSSPAGMAAAAGAAGSGFLQRTTSCTTAPELMEENERLRKENMQLS  221

Query  599  KELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCG---G  429
            +EL ++K L +NIY LM+N+S    + SN  +E      KPLDL+      T       G
Sbjct  222  QELRKLKGLYDNIYVLMTNFSAGQVDCSNLLSEG-----KPLDLLLGRQAVTVASRMEEG  276

Query  428  ENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQP------------GTDVKS  285
                  +++  RLFGVSIG KR R+ ++  AE + +   +Q             G+DVKS
Sbjct  277  SGLKLDEDLTPRLFGVSIGVKRARQEDEMEAEAEEEDDERQQTGRGSNSQEGERGSDVKS  336

Query  284  EP--ENGEDNEESPWL  243
            EP  EN   N   PWL
Sbjct  337  EPVEENNSSNHNEPWL  352



>ref|XP_008790507.1| PREDICTED: heat stress transcription factor B-2b-like [Phoenix 
dactylifera]
Length=329

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 96/190 (51%), Gaps = 23/190 (12%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAIDASQG-------GSTSELIGENERLRKENIELNKELSQ  585
            +P NSG+EQV SSNSSPG     A+ G        S +EL+ ENERLR+EN +L+ EL Q
Sbjct  144  SPENSGDEQVFSSNSSPGGGQQPAAVGRALPPGCSSAAELMEENERLRRENKQLSHELGQ  203

Query  584  MKSLCNNIYALMsnysgnnsnssnqsae-----sslqSLKPLDLMPatatatAGCGGENQ  420
            MK+LCNNI  LMS Y+ +       +A+     SSL+    L+ MP   +          
Sbjct  204  MKNLCNNIVLLMSKYASSQQQGGATAADRGGGGSSLEVATSLEPMPERWSQ---------  254

Query  419  TEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENGEDNEESPWLR  240
             E      RLFGV I  KR R G D    Q     ++    D  ++P++   +    WL 
Sbjct  255  -EASGPSPRLFGVPIRLKRSR-GSDAEGPQQSAPYVKPEPLDPGADPQDLSSDHRGSWLL  312

Query  239  QCHRQNQRVC  210
             C R NQRVC
Sbjct  313  CCPRPNQRVC  322



>ref|XP_002864765.1| hypothetical protein ARALYDRAFT_919451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41024.1| hypothetical protein ARALYDRAFT_919451 [Arabidopsis lyrata subsp. 
lyrata]
Length=299

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 110/192 (57%), Gaps = 38/192 (20%)
 Frame = -2

Query  749  TVTPSNSGEE---------QVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNK  597
             V+PSNSGE+         QV+SS SS       +  GG + EL+ ENE+LR +NI+LN+
Sbjct  135  VVSPSNSGEDTNNNNNMNNQVMSSPSSWYCQT--SGNGGLSVELLEENEKLRSQNIQLNR  192

Query  596  ELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQT  417
            EL+QMKS+C+NI++LMSNY G+ +   + S   S    +P++ +PA          E + 
Sbjct  193  ELTQMKSICDNIFSLMSNYVGSQTTDRSYSPGGSSS--QPVEFLPAKRF------SETEV  244

Query  416  EPDEMRARLFGVSIGSKRVR-EGEDGSAEQDHDLRLQQPGTDVKSEPENGEDNEESPWL-  243
            E +E   RLFGV IG KR R EG          +++++    V +    GE+++E  WL 
Sbjct  245  E-EEASPRLFGVPIGLKRTRSEG----------VQVKR----VSTAAVVGENSDE--WLT  287

Query  242  RQCHRQNQRVCN  207
            R C+R NQRVCN
Sbjct  288  RHCNRTNQRVCN  299



>ref|XP_004308106.1| PREDICTED: heat stress transcription factor B-2a [Fragaria vesca 
subsp. vesca]
Length=289

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 102/185 (55%), Gaps = 29/185 (16%)
 Frame = -2

Query  758  PSKTV-TPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQM  582
            P+K V +P+NSGEEQV ++ ++   ++  + +     +L+ ENERLRKEN+ L KE++++
Sbjct  133  PAKLVNSPANSGEEQVTTTTTT-TASSSSSPRPRIPWQLVEENERLRKENLRLTKEVAEI  191

Query  581  KSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEM  402
            K LC+N++ ++        +S   +       L  L+L P       G  G       E 
Sbjct  192  KCLCHNVFTMV--------SSYACANPPEGGELTRLELAP-----GKGFSGR------ET  232

Query  401  RARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENGEDNEESPWLRQCHRQN  222
              ++FGV IG+KR RE   G   +    R Q+   DVKSE     D+ ++PWL+QCHR N
Sbjct  233  SPKIFGVEIGAKRAREEGGGGGGEG---RWQR--GDVKSE---ACDHSDTPWLKQCHRAN  284

Query  221  QRVCN  207
            QRVCN
Sbjct  285  QRVCN  289



>ref|XP_008799550.1| PREDICTED: heat stress transcription factor B-2b [Phoenix dactylifera]
Length=324

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 106/208 (51%), Gaps = 49/208 (24%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPG------TAAI--DASQGGSTS--ELIGENERLRKENIELNK  597
            ++P NSG+EQ +SSNSSPG       AA+   A+  G +S  EL+ ENERLR+EN++L+ 
Sbjct  137  LSPGNSGDEQALSSNSSPGREQQQPPAAVGRPAAPPGCSSVPELMEENERLRRENMQLSH  196

Query  596  ELSQMKSLCNNIYALMsnysgnnsnssnqsaesslq----SLKPLDLMPatatatAGCGG  429
            EL QMK+LCNNI  LMS Y+ +    +                PL+LMPA          
Sbjct  197  ELGQMKNLCNNILLLMSKYASSQQLGAAAGGGGGGGPPLEVAPPLELMPA----------  246

Query  428  ENQTEPDEMRA--------RLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEP-E  276
              +  P+E R         RLFGV IG K  R   D + E +        G +VK EP +
Sbjct  247  --RRSPEEERVKAEVGPSTRLFGVPIGLK--RSLRDAAEEANPS------GPEVKPEPLD  296

Query  275  NGEDNEESP-----WLRQCHRQNQRVCN  207
             G D ++S      WL  C R NQRVCN
Sbjct  297  PGADPQDSSADHRRWL-CCPRPNQRVCN  323



>ref|XP_007158472.1| hypothetical protein PHAVU_002G155300g [Phaseolus vulgaris]
 gb|ESW30466.1| hypothetical protein PHAVU_002G155300g [Phaseolus vulgaris]
Length=356

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 78/212 (37%), Positives = 114/212 (54%), Gaps = 44/212 (21%)
 Frame = -2

Query  752  KTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTS-----ELIGENERLRKENIELNKELS  588
            + V+P+ SG+EQV+SSNSSP     + +   +TS     EL  ENERLRKEN++LN+ELS
Sbjct  143  RAVSPTTSGDEQVLSSNSSPIAGNSNNTVHRTTSCTTAPELSEENERLRKENMQLNQELS  202

Query  587  QMKSLCNNIYALMsnysgnnsnssnqsaesslqSL-----KPLDLMPatatatAG-----  438
            Q+KSLCNNI ALM+NY+   S    +S+ S+++++     K L+L+PA   ++A      
Sbjct  203  QLKSLCNNIIALMTNYASGFSRQQLESSTSAVRTVPVPEGKALELLPAKHLSSADDAVHV  262

Query  437  --------CGGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQP-------  303
                    C   N  E +    +LFGVSIG KR R   +   E +   ++          
Sbjct  263  GGAAGFVPCTTANAAEAEV--PKLFGVSIGLKRCRTECEAEQEGEEQNQMHTLALTQAQT  320

Query  302  ----------GTDVKSEPENGE--DNEESPWL  243
                      G DVKSEP +G+  D+++  WL
Sbjct  321  QTQSSQEPDGGPDVKSEPLDGDESDDQDGRWL  352



>emb|CDP09791.1| unnamed protein product [Coffea canephora]
Length=317

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 105/185 (57%), Gaps = 21/185 (11%)
 Frame = -2

Query  758  PSKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMK  579
            P + V+P+NSG+EQVVSSNSSP  A        +T E++ ENERLRKEN +LN+EL++++
Sbjct  129  PMRVVSPANSGDEQVVSSNSSPA-ATTVLPTTCTTPEILEENERLRKENAQLNRELNRLR  187

Query  578  SLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatat-------AGCGGENQ  420
             LC NIY LMSNY+GN + +S           + LDLM              AG G    
Sbjct  188  GLCGNIYNLMSNYAGNQAETSGGELLEE----RALDLMTGRRVTVEMDGGGAAGGGAVKA  243

Query  419  TEPDEMRARLFGVSIGSKRVREGEDGSAE---QDHDLRLQQPGTDVKSEPENGE-DN--E  258
             E +++  RLFGVS+G KRVR  +D   E   +DH    +   ++ KSEP +   DN  +
Sbjct  244  EEEEDVSPRLFGVSLGVKRVRRSDDEDNEIQGRDHK---EADASEGKSEPSDCRVDNHRD  300

Query  257  ESPWL  243
            +  WL
Sbjct  301  DQAWL  305



>ref|XP_003611134.1| Heat stress transcription factor B-2b [Medicago truncatula]
 gb|ACJ85855.1| unknown [Medicago truncatula]
 gb|AES94092.1| heat shock transcription factor B2A [Medicago truncatula]
Length=359

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 83/225 (37%), Positives = 111/225 (49%), Gaps = 60/225 (27%)
 Frame = -2

Query  764  AQPSKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTS-----ELIGENERLRKENIELN  600
            A P + V+P+ SG+EQVVSSNSSP      A+   STS     EL+ ENERL+KEN++L+
Sbjct  139  AAPVRMVSPATSGDEQVVSSNSSPIAVNNGATVQRSTSCTTAPELVEENERLKKENMQLS  198

Query  599  KELSQMKSLCNNIYALMsnysg------nnsnssnqsaesslqSLKPLDLMPatatatA-  441
             ELSQ+K LCNNI A+MSNY+        +S S+  +    +   K LDL+P    + A 
Sbjct  199  NELSQLKGLCNNILAMMSNYNSGFSRQLESSTSAATARGVVVTEGKILDLLPLRNVSLAE  258

Query  440  --------------GCGGENQTEPDEMRA----RLFGVSIGSKRVR--------------  357
                           C   +  EP E++A    +LFGVSIG KR R              
Sbjct  259  ENVVVNLGGAAGGLPCETMSLMEP-EVQASQVPKLFGVSIGLKRCRTENEVEPEREEREQ  317

Query  356  -------EGEDGSAEQDHDLRLQQPGTDVKSEPENGE-DNEESPW  246
                        S E D        G+DVKSEP +G+ D++E  W
Sbjct  318  HQQMQVQMQTQSSQETDR-------GSDVKSEPRDGDSDDQERRW  355



>ref|XP_010255485.1| PREDICTED: heat stress transcription factor B-2b-like [Nelumbo 
nucifera]
Length=314

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 93/175 (53%), Gaps = 7/175 (4%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPG---TAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSL  573
            +P+NS +EQVV+S S P      A  A+   S +EL+ ENERLRKEN+ L  EL+Q+K+L
Sbjct  137  SPTNSSDEQVVTSTSPPSNVPATACRATSCNSAAELLDENERLRKENMHLKHELTQLKNL  196

Query  572  CNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRAR  393
            CN+I  LM+ Y+ +   + +  AE     L P+  +   + A    G       +E+  R
Sbjct  197  CNSILVLMTKYANSQQENCSFLAEKPPLDLLPVKRISEDSDADTLVGQSRVKTEEEISPR  256

Query  392  LFGVSIGSKRVR----EGEDGSAEQDHDLRLQQPGTDVKSEPENGEDNEESPWLR  240
            LFGV IG KR R    E E    +Q    +LQ PG + +   +   +N+   WL+
Sbjct  257  LFGVPIGVKRARGCEEEEEQEEQQQQQQQQLQPPGPEAEPWDQQKSENQNHSWLK  311



>ref|XP_010061278.1| PREDICTED: heat stress transcription factor B-2b-like [Eucalyptus 
grandis]
 gb|KCW90728.1| hypothetical protein EUGRSUZ_A02804 [Eucalyptus grandis]
Length=329

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 100/180 (56%), Gaps = 27/180 (15%)
 Frame = -2

Query  749  TVTPSNSGEEQVVSS-NSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSL  573
             ++PS+SG+EQV+SS +SSP +A         T+E++ ENERLRKEN  L++EL+QMKSL
Sbjct  147  VISPSSSGDEQVMSSQHSSPPSAC----GQNCTAEIMDENERLRKENAFLSRELTQMKSL  202

Query  572  CNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRA-  396
            CNNI +LMS Y+ N       S   +    + LDLMP       G GG      DE    
Sbjct  203  CNNILSLMSGYAPNGRPQEASSRPVA----RALDLMPVKRPTGGGGGGGGGDGDDEEEEE  258

Query  395  ------------RLFGVSIGSKR---VREGEDGSAE-QDHDLRLQQPGT-DVKSEPENGE  267
                        +LFGV++G KR   +REGE       D  LRLQQPG+  VK EP +G+
Sbjct  259  EEDEEEDGEGSPKLFGVALGMKRGREIREGEVAVMSGSDAMLRLQQPGSGGVKFEPSDGD  318



>ref|XP_011029218.1| PREDICTED: heat stress transcription factor B-2b [Populus euphratica]
 ref|XP_011029219.1| PREDICTED: heat stress transcription factor B-2b [Populus euphratica]
Length=340

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 109/190 (57%), Gaps = 25/190 (13%)
 Frame = -2

Query  755  SKTVTPSNSGEEQVVSSNSSPGT--------AAIDASQGGSTSELIGENERLRKENIELN  600
            ++ V+P+NSG++Q +SS SSPG         + +  +   +T E++ ENERLRKEN  L+
Sbjct  153  ARAVSPANSGDDQGISSTSSPGGAGTAGGANSFLRTTSCTTTPEILEENERLRKENSALS  212

Query  599  KELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGC---GG  429
             EL+Q++ LCNNI  LM+NY+      ++ +  + +++   L+L+P             G
Sbjct  213  HELTQLRGLCNNIMVLMNNYASPQLEGNSNNNLADVKAA--LELLPVADEVAVSGRPRDG  270

Query  428  ENQTEPDEMRARLFGVSIGSKRVR----EGEDGSAEQDHDLRLQQPGTDVKSEPENG---  270
               TE  E+  RLFGVSIG KRVR    + E+G+ +Q      ++ G+DVK+EP +G   
Sbjct  271  AAATE-SEVSPRLFGVSIGFKRVRIDEEDEEEGNRQQTEG---KEHGSDVKAEPLDGSTG  326

Query  269  -EDNEESPWL  243
              D+++  WL
Sbjct  327  NSDHQDQRWL  336



>ref|XP_002298053.1| heat shock transcription factor HSF29 family protein [Populus 
trichocarpa]
 gb|EEE82858.1| heat shock transcription factor HSF29 family protein [Populus 
trichocarpa]
Length=343

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 111/191 (58%), Gaps = 24/191 (13%)
 Frame = -2

Query  755  SKTVTPSNSGEEQVVSSNSSPGT--------AAIDASQGGSTSELIGENERLRKENIELN  600
            ++ V+P+NSG++Q +SS SSPG         + +  +   +T E++ ENERLRKEN  L+
Sbjct  153  ARAVSPANSGDDQGISSTSSPGGAGTAGGANSFLRTTSCTTTPEILEENERLRKENSALS  212

Query  599  KELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLK-PLDLMPatatatAGC---G  432
             EL+Q++ LCNNI  LM+NY+      ++ ++ ++L  +K  L+L+P            G
Sbjct  213  HELTQLRGLCNNIMVLMNNYASPQLEGNSGNSNNNLAEVKAALELLPVADEVAVSGRPRG  272

Query  431  GENQTEPDEMRARLFGVSIGSKRVR----EGEDGSAEQDHDLRLQQPGTDVKSEPENG--  270
            G   TE  E+  RLFGVSIG KRVR    E E+G+ +Q      ++  +DVK+EP +G  
Sbjct  273  GAAATE-SEVSPRLFGVSIGFKRVRIDEEEEEEGNRQQTEG---KEHESDVKAEPLDGSS  328

Query  269  --EDNEESPWL  243
               D+++  WL
Sbjct  329  GNSDHQDQRWL  339



>gb|AFK40914.1| unknown [Medicago truncatula]
Length=359

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 110/225 (49%), Gaps = 60/225 (27%)
 Frame = -2

Query  764  AQPSKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTS-----ELIGENERLRKENIELN  600
            A P + V+P+ SG+EQVVSSNSSP      A+   STS     EL+ ENERL+KEN++L+
Sbjct  139  AAPVRMVSPATSGDEQVVSSNSSPIAVNNGATVQRSTSCTTAPELVEENERLKKENMQLS  198

Query  599  KELSQMKSLCNNIYALMsnysg------nnsnssnqsaesslqSLKPLDLMPatatatA-  441
             ELSQ+K LCNNI A+MSNY+        +S S+  +    +   K LDL+P    + A 
Sbjct  199  NELSQLKGLCNNILAMMSNYNSGFSRQLESSTSAATARGVVVTEGKILDLLPLRNVSLAE  258

Query  440  --------------GCGGENQTEPDEMRA----RLFGVSIGSKRVR--------------  357
                           C   +  EP E++A    +LFGVSIG KR R              
Sbjct  259  ENVVVNLGGAAGGLPCETMSLMEP-EVQASQVPKLFGVSIGLKRCRTENEVEPEREEREQ  317

Query  356  -------EGEDGSAEQDHDLRLQQPGTDVKSEPENGE-DNEESPW  246
                        S E D        G+DVK EP +G+ D++E  W
Sbjct  318  HQQMQVQMQTQSSQETDR-------GSDVKFEPRDGDSDDQERRW  355



>ref|XP_006590529.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X1 [Glycine max]
Length=355

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 109/205 (53%), Gaps = 50/205 (24%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSP-----GTAAIDASQGGSTS-ELIGENERLRKENIELNKELSQM  582
            +P+ SG+EQV+SSNSSP         +  +   +T+ EL+ ENERLRKENI+L+ ELSQ+
Sbjct  147  SPTTSGDEQVLSSNSSPIAGNNNNNTVHRTTSCTTAPELLEENERLRKENIQLSNELSQL  206

Query  581  KSLCNNIYALMsnysgnnsnssnqsaesslqSL------KPLDLMPatatatAGCG----  432
            K LCNNI +LM+NY+   S    +S+ S+++++       PL+L+PA   ++A       
Sbjct  207  KGLCNNILSLMTNYASGFSRQQLESSTSAVRTVPVPDGKAPLELLPAKHVSSADDALHVG  266

Query  431  -------GENQTEPDEMRARLFGVSIGSKRVR-------EGED-------------GSAE  333
                          +    +LFGVSIG KR R       EGED              S E
Sbjct  267  GAAGAAACATGNAAEAEVPKLFGVSIGLKRCRTECEAEPEGEDQNQMQTRAQTQSQSSQE  326

Query  332  QDHDLRLQQPGTDVKSEPENGEDNE  258
             DH       G+DVKSEP +G+D++
Sbjct  327  PDH-------GSDVKSEPLDGDDSD  344



>emb|CDX90804.1| BnaA03g24840D [Brassica napus]
Length=320

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 97/191 (51%), Gaps = 39/191 (20%)
 Frame = -2

Query  749  TVTPSNSGEEQVVSSNSSPGTAAID------------ASQGGSTSELIGENERLRKENIE  606
             ++PSNSGEEQV+SSNSSP                   +   +  EL+ ENERLRKEN++
Sbjct  143  VLSPSNSGEEQVISSNSSPAGTGGGGGGGSVGVAPQRTTSCTTAPELMEENERLRKENVQ  202

Query  605  LNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatat-----A  441
            L++EL+++K L +NIY LM           +         LKPLDLMP     +      
Sbjct  203  LSQELTKLKGLYSNIYKLM-----------SNFTSGGADCLKPLDLMPERQEMSEEAIET  251

Query  440  GCGGENQTEPDEMRARLFGVSIGSKRVREGED---GSAEQDHDLRLQQPGTDVKSEP--E  276
            G G +  T       RLFGVSIG KR R  ++    + E+D +   ++ G++ KSEP  E
Sbjct  252  GAGLKLLT------PRLFGVSIGVKRARRDQELGAAAVEEDDNQEEEEQGSEDKSEPMEE  305

Query  275  NGEDNEESPWL  243
            N   +   PWL
Sbjct  306  NNSVDHNGPWL  316



>emb|CAA87075.1| heat shock transcription factor 29 [Glycine max]
Length=298

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 104/191 (54%), Gaps = 38/191 (20%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAIDASQGGSTS-----ELIGENERLRKENIELNKELSQMK  579
            +P+ SG+EQV+SSNSSP     + +   +TS     EL+ ENERLRKEN++L+ ELSQ+K
Sbjct  90   SPTTSGDEQVLSSNSSPIAGNNNNTVHRTTSCTTAPELLDENERLRKENMQLSNELSQLK  149

Query  578  SLCNNIYALMsnysgnnsnssnqsaesslqSL------KPLDLMPatatatAG-------  438
             LCNNI ALM+NY+   S    +S+ S+ +++        L+L+PA   ++A        
Sbjct  150  GLCNNILALMTNYASGFSRQQLESSTSAARTVPVPEGKAALELLPAKHVSSADEAGHVGG  209

Query  437  ---CGGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQ--------------  309
               C   N  E +    +LFGVSIG KR R   +G AE +   ++Q              
Sbjct  210  AAPCATANAGEAEV--PKLFGVSIGLKRCRTECEGEAEGEDQNQMQTRAQAQTQTQSSQE  267

Query  308  -QPGTDVKSEP  279
               G+DVKSEP
Sbjct  268  PDHGSDVKSEP  278



>ref|XP_010676525.1| PREDICTED: heat stress transcription factor B-2b-like [Beta vulgaris 
subsp. vulgaris]
Length=337

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 93/160 (58%), Gaps = 19/160 (12%)
 Frame = -2

Query  767  PAQPSKTVTPSNSGEEQVVSSNSSPGTAAID----ASQGGSTSELIGENERLRKENIELN  600
            P    +T +PSNSG+EQV SSNSSP    +      +  GS++E++ ENE+LR+EN  L+
Sbjct  154  PPVAVRTASPSNSGDEQVHSSNSSPSPIVVTPQRTTTNCGSSTEILEENEKLRRENFNLS  213

Query  599  KELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSL--KPLDLMPatatatAG----  438
            +EL+ ++ LCNNI ALMSNY+     +   +    L+ L  KP+ + P     ++G    
Sbjct  214  QELNHLRGLCNNILALMSNYASGQHETGGLTEGRQLELLLAKPVTVEPEHCGGSSGGATA  273

Query  437  CGGENQTE--------PDEMRARLFGVSIGSKRV-REGED  345
             GG+   E        P +   RLFGVSIG+KRV REG++
Sbjct  274  SGGDKVEEEIEEGEGCPCQPCPRLFGVSIGAKRVRREGDE  313



>gb|KEH43737.1| heat shock transcription factor B2A [Medicago truncatula]
Length=303

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 103/184 (56%), Gaps = 22/184 (12%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCNN  564
            +PS SGEEQV+SSNSS            ST+ L+ ENERL+KEN++L KE+  MKSL +N
Sbjct  137  SPSISGEEQVISSNSS---------PSISTAALLDENERLKKENMQLAKEMEDMKSLYSN  187

Query  563  IYALMsnysgnnsn--ssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARL  390
            I+ L+SNY  + +   +  + + S+   +K L L+P        C GE+    D    +L
Sbjct  188  IFNLLSNYVNSQTEGGAEGKESCSTASPVKTLRLLPEKR-----CNGEDAAVEDR-NPKL  241

Query  389  FGVSIGSKRVREGEDGSAEQDHDLRLQQP-GTDVKSEPENGEDNEESPWLR--QCHRQNQ  219
            FG++I +KR REG     E D  L L      D+KSEP +    E+   +R  QC+R NQ
Sbjct  242  FGIAIDAKREREGR--CIEDDVVLSLNHSVHVDLKSEPFDSRKGEKRKMMRLNQCYRANQ  299

Query  218  RVCN  207
             VCN
Sbjct  300  SVCN  303



>ref|XP_011081009.1| PREDICTED: heat stress transcription factor B-2b [Sesamum indicum]
Length=311

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 106/173 (61%), Gaps = 18/173 (10%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAAIDASQGG-STSELIGENERLRKENIELNKELSQMKSLC  570
            ++P+NSG++QV+SSNSSP   A   +      +E++ ENERLR+EN +L +EL+Q++SLC
Sbjct  150  ISPANSGDKQVLSSNSSPAATAATPTPPVLRAAEILEENERLRRENWQLRQELNQLRSLC  209

Query  569  NNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARL  390
             NIY LMS Y+ N   ++   A       + L+LMP T +      G    E +EM  R+
Sbjct  210  GNIYNLMSIYATNQCEAALPEA-------RALELMPETPSKAEE-AGAKAEEEEEMCPRI  261

Query  389  FGVSI-GSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENG---EDNEESPWL  243
            FGVSI GSKR++  E+G   +D  +R +  GTDVK EP +    +++EE P L
Sbjct  262  FGVSIRGSKRLKRTENG---KDDAMRAR--GTDVKLEPSDAKSSKNHEEPPRL  309



>ref|XP_007209340.1| hypothetical protein PRUPE_ppa008441mg [Prunus persica]
 gb|EMJ10539.1| hypothetical protein PRUPE_ppa008441mg [Prunus persica]
Length=331

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 81/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSP----GTAAIDASQGGSTSELIGENERLRKENIELNKELSQMK  579
            V+PSNSG+EQV+SSNSSP     T         +TS+++ ENERLRKEN++L+ EL+Q++
Sbjct  148  VSPSNSGDEQVISSNSSPVAPPATMLSRIRSCTTTSDVLEENERLRKENMQLSHELTQLR  207

Query  578  SLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCG-----------  432
             LCNNI ALM+NY+            S +   KPL+L P      +  G           
Sbjct  208  GLCNNILALMTNYASGQLEGGGGGGGSVMDEGKPLELSPVQEAEPSENGVVREGSKAEAS  267

Query  431  -GENQTEPDEMRARLFGVSIGSK  366
              E + E +E R RLFGVSIG K
Sbjct  268  AEEEEDEEEETRPRLFGVSIGVK  290



>gb|AFQ93675.1| heat shock transcription factor HSFB2b [Glycine max]
Length=339

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 104/191 (54%), Gaps = 38/191 (20%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAIDASQGGSTS-----ELIGENERLRKENIELNKELSQMK  579
            +P+ SG+EQV+SSNSSP     + +   +TS     EL+ ENERLRKEN++L+ ELSQ+K
Sbjct  131  SPTTSGDEQVLSSNSSPIAGNNNNTVHRTTSCTTAPELLDENERLRKENMQLSNELSQLK  190

Query  578  SLCNNIYALMsnysgnnsnssnqsaesslqSL------KPLDLMPatatatAG-------  438
             LCNNI ALM+NY+   S    +S+ S+ +++        L+L+PA   ++A        
Sbjct  191  GLCNNILALMTNYASGFSRQQLESSTSAARTVPVPEGKAALELLPAKHVSSADEAGHVGG  250

Query  437  ---CGGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQ--------------  309
               C   N  E +    +LFGVSIG KR R   +G AE +   ++Q              
Sbjct  251  AAPCATANAGEAEV--PKLFGVSIGLKRCRTECEGEAEGEDQNQMQTRAQAQTQTQSSQE  308

Query  308  -QPGTDVKSEP  279
               G+DVKSEP
Sbjct  309  PDHGSDVKSEP  319



>ref|XP_003517459.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X1 [Glycine max]
 ref|XP_006573765.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X2 [Glycine max]
 ref|XP_006573766.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X3 [Glycine max]
Length=355

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 106/191 (55%), Gaps = 38/191 (20%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAIDASQGGSTS-----ELIGENERLRKENIELNKELSQMK  579
            +P+ SG+EQV+SSNSSP     + +   +TS     EL+ ENERLRKEN++L+ ELSQ+K
Sbjct  147  SPTTSGDEQVLSSNSSPIAGNNNNTVHRTTSCTTAPELLDENERLRKENMQLSNELSQLK  206

Query  578  SLCNNIYALMsnysgnnsnssnqsaesslqSL------KPLDLMPatatatAG-------  438
             LCNNI ALM+NY+   S    +S+ S+ +++        L+L+PA   ++A        
Sbjct  207  GLCNNILALMTNYASGFSRQQLESSTSAARTVPVPEGKAALELLPAKHVSSADEAGHVGG  266

Query  437  ---CGGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQ-------------Q  306
               C   N  E +    +LFGVSIG KR R   +G AE +   ++Q             +
Sbjct  267  AAPCATANAGEAEV--PKLFGVSIGLKRCRTECEGEAEGEDQNQMQTRAQAQTQTQSSQE  324

Query  305  P--GTDVKSEP  279
            P  G+DVKSEP
Sbjct  325  PDHGSDVKSEP  335



>ref|XP_010055608.1| PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor 
B-2b [Eucalyptus grandis]
Length=340

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 112/206 (54%), Gaps = 43/206 (21%)
 Frame = -2

Query  749  TVTPSNSGEEQVVSSNSSPGTAAIDASQGG-------------STSELIGENERLRKENI  609
            TV+P+NSG+EQV+SS SSP  A   A+                +  EL+ ENERL+KEN+
Sbjct  137  TVSPANSGDEQVISS-SSPPVALATAAVAAASPSVVHRSPSCTTAPELLEENERLKKENM  195

Query  608  ELNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatat-atAGCG  432
            ++++ELSQ++ LCNNI +LM+NY    S+SS+ + E      + L+LMPA    A   C 
Sbjct  196  QMSQELSQLRGLCNNILSLMANYVSRQSDSSSAAPEG-----QALELMPARQAEAAEDCA  250

Query  431  G-------ENQTEPDEMRA-RLFGVSIGSKRVREGEDGSAEQDHDLR-----------LQ  309
            G       E  TE     A RLFGVSIG KR R  E+ S   D ++R            +
Sbjct  251  GPPSAAALERTTEEAATVAPRLFGVSIGGKRQRIEENSSNGGDEEMREADRAAPVPPDER  310

Query  308  QPGTDVKSEPENGEDN----EESPWL  243
            +PG +VKSEP +G  +    E+  WL
Sbjct  311  EPGGEVKSEPLDGSRDHHGGEDPSWL  336



>emb|CBI31816.3| unnamed protein product [Vitis vinifera]
Length=296

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 76/132 (58%), Gaps = 13/132 (10%)
 Frame = -2

Query  758  PSKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMK  579
            P   V+ SN  +E+++SSNS             +T+ LI ENERLRKEN+ELN+EL++MK
Sbjct  117  PISPVSSSNCADERLISSNSP-PATTTTPHATSNTAGLIDENERLRKENVELNRELNRMK  175

Query  578  SLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMR  399
            +LCNNI+AL+S+   NN   +    +      KPL+  P           E   E +EM 
Sbjct  176  TLCNNIFALISSNYTNNIFGNVSQTD------KPLNRFPEKQF-----SSEMMIE-EEMT  223

Query  398  ARLFGVSIGSKR  363
             RLFGV+IG+KR
Sbjct  224  PRLFGVAIGAKR  235



>ref|XP_002872608.1| hypothetical protein ARALYDRAFT_911518 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48867.1| hypothetical protein ARALYDRAFT_911518 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 100/194 (52%), Gaps = 32/194 (16%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAIDASQGGSTS-----------ELIGENERLRKENIELNK  597
            +PSNSGEEQV+SSNSSP  AA         S           EL+ ENERLRK+N  L +
Sbjct  185  SPSNSGEEQVISSNSSPAAAAAAIGGVVGGSLQRTTSCITAPELVEENERLRKDNERLRR  244

Query  596  ELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQT  417
            EL++ K L  NIY LM+N++    + ++  AE      KPLDL+P     +      ++ 
Sbjct  245  ELTKYKGLYANIYTLMANFTPGREDCAHLLAEG-----KPLDLLPERQGMSEAMAMASRI  299

Query  416  EP-------DEMRARLFGVSIGSKRVRE--GEDGSAEQDHDLR--LQQPG---TDVKSEP  279
            E        +++  RLFGVSIG KR R       + E+D D R  + Q G   +DVK+EP
Sbjct  300  ETGIGLKLDEDLTPRLFGVSIGVKRARREEELGAAGEEDDDRREAVAQEGEQSSDVKAEP  359

Query  278  --ENGEDNEESPWL  243
              EN   N    WL
Sbjct  360  MEENNPANHNGSWL  373



>ref|XP_006287969.1| hypothetical protein CARUB_v10001204mg [Capsella rubella]
 gb|EOA20867.1| hypothetical protein CARUB_v10001204mg [Capsella rubella]
Length=372

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 104/189 (55%), Gaps = 27/189 (14%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAID----------ASQGGSTSELIGENERLRKENIELNKE  594
            +PSNSGEEQV+SSNSSP  AA             +   +  EL+ ENERLRKEN +L++E
Sbjct  185  SPSNSGEEQVISSNSSPAAAAAATGVVGVGLQRTTSCTTAPELVEENERLRKENRQLSQE  244

Query  593  LSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCG---GEN  423
            L+++K L  NIY LM+N++   ++ +N   E      +PLDL+P     T   G   G  
Sbjct  245  LTKLKGLYANIYTLMANFTPGQADCANLLPEG-----RPLDLLPEKQGMTEDIGIDTGIG  299

Query  422  QTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHD-------LRLQQPGTDVKSEP--ENG  270
                +++  RLFGVSIG KR R  E+   E++ D        R  +  +D+K+EP  EN 
Sbjct  300  LKLDEDLTPRLFGVSIGVKRARREEELGVEEEEDDDRQEAVTREGEQSSDLKAEPMEENN  359

Query  269  EDNEESPWL  243
              N + PWL
Sbjct  360  SSNHDGPWL  368



>ref|XP_009345447.1| PREDICTED: heat stress transcription factor B-2b [Pyrus x bretschneideri]
 ref|XP_009345448.1| PREDICTED: heat stress transcription factor B-2b [Pyrus x bretschneideri]
 ref|XP_009345449.1| PREDICTED: heat stress transcription factor B-2b [Pyrus x bretschneideri]
Length=335

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 95/180 (53%), Gaps = 38/180 (21%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTA----AIDASQGGSTSELIGENERLRKENIELNKELSQMK  579
            V+PSNSG+EQV+SSNSSP  A    A       STS+++ ENERLRKEN+ L+ EL+Q++
Sbjct  148  VSPSNSGDEQVISSNSSPVAAPAMLASRIRSSTSTSDVLEENERLRKENMHLSHELTQLR  207

Query  578  SLCNNIYALMsnysgnnsnssnqsaesslqSL--KPLDLMPat----atatAGCGGEN--  423
             LCNNI ALM+NY+     S              + L+L P      A   AGC G N  
Sbjct  208  GLCNNILALMTNYASGQLESGGGGGGGGGGVEDGRTLELSPVKEAEPAAEDAGCDGANAE  267

Query  422  --------QTEPDEMRARLFGVSIGSKRV------------------REGEDGSAEQDHD  321
                    + E +EMR RLFGVSIG KRV                  +E  DGS ++D+D
Sbjct  268  ASGTEEEEEEEEEEMRPRLFGVSIGVKRVRRDEDEEEEHREGSEGAKQEPSDGSLKRDYD  327



>ref|XP_008238806.1| PREDICTED: heat stress transcription factor B-2b [Prunus mume]
 ref|XP_008238807.1| PREDICTED: heat stress transcription factor B-2b [Prunus mume]
 ref|XP_008238808.1| PREDICTED: heat stress transcription factor B-2b [Prunus mume]
Length=332

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 82/144 (57%), Gaps = 17/144 (12%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSP----GTAAIDASQGGSTSELIGENERLRKENIELNKELSQMK  579
            V+PSNSG+EQV+SSNSSP     T         +TS+++ ENERLRKEN++L+ EL+Q++
Sbjct  148  VSPSNSGDEQVISSNSSPVAPPATMLSRIRSCTTTSDVLEENERLRKENMQLSHELTQLR  207

Query  578  SLCNNIYALMsnysg--nnsnssnqsaesslqSLKPLDLMPatatatAGCG---------  432
             LCNNI ALM+NY+              S +   KPL+L P      +  G         
Sbjct  208  GLCNNILALMTNYASGQLEGGGGGGGGGSVMDEGKPLELSPVKEAEPSENGVVREGSKAE  267

Query  431  --GENQTEPDEMRARLFGVSIGSK  366
               E + + +EMR RLFGVSIG K
Sbjct  268  ASAEEEEDEEEMRPRLFGVSIGVK  291



>ref|XP_004140783.1| PREDICTED: heat stress transcription factor B-2b-like [Cucumis 
sativus]
 gb|KGN57358.1| hypothetical protein Csa_3G181940 [Cucumis sativus]
Length=293

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 96/171 (56%), Gaps = 19/171 (11%)
 Frame = -2

Query  767  PAQPSKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
            P+    T+T ++SGEEQV+SS+ +P  A          +ELI EN+RLR+E ++L ++L 
Sbjct  137  PSVQVLTLTGNSSGEEQVISSDETPTRAL---------AELIDENDRLRREKVQLTEQLD  187

Query  587  QMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPD  408
            ++KSLCNNI++LMS++  +   +S +  ES L+S K LDL P          GE  T   
Sbjct  188  EVKSLCNNIFSLMSSFVESQFKNSFKVRESVLESAKSLDLFPVKRP-----AGEEGTAEV  242

Query  407  EMRARLFGVSIGSKRVREGEDGS---AEQDHDLRLQQPG-TDVKSEPENGE  267
            +         IG+KR RE  +G+   AE D  LRLQ P    VKSE  N +
Sbjct  243  KEEEEERN-QIGAKRAREYREGATERAEDDTTLRLQPPDRWVVKSERINCQ  292



>emb|CDY59386.1| BnaC09g52680D [Brassica napus]
Length=361

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 105/195 (54%), Gaps = 36/195 (18%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSP--------------GTAAIDASQGGSTSELIGENERLRKENIE  606
            +PSNSGEEQV+SSNSSP              G      +   +  EL+ ENERLRKEN++
Sbjct  171  SPSNSGEEQVISSNSSPAAAAAASGGGGGQVGVVLQRTTSCTTAPELVEENERLRKENVQ  230

Query  605  LNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGE  426
            L++EL+++K L +NIY LMSN++   ++ + +         K LDLMP            
Sbjct  231  LSQELTKLKGLYSNIYTLMSNFTSGQADCAPEG--------KALDLMPERMGEDMATASG  282

Query  425  NQT-----EPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQ-------QPGTDVKSE  282
             +T       +++  RLFGVSIG+KR R  E  +AE++ D R +       + G+DVKSE
Sbjct  283  VETGIGLKLDEDLTPRLFGVSIGAKRARRDELVTAEEEDDERREGSNQEGGEQGSDVKSE  342

Query  281  P--ENGEDNEESPWL  243
            P  E+  D    PWL
Sbjct  343  PMEEDNSDEHNGPWL  357



>ref|XP_002509743.1| Heat shock factor protein, putative [Ricinus communis]
 gb|EEF51130.1| Heat shock factor protein, putative [Ricinus communis]
Length=337

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 107/196 (55%), Gaps = 32/196 (16%)
 Frame = -2

Query  758  PSKTVTPSNSGEEQVVSSNSSPGTA------AIDASQGGSTSELIGENERLRKENIELNK  597
            P+  ++PSNS EEQ++SSNSSP  A       +  +   +T E++ ENERLRKEN +L+ 
Sbjct  146  PACAISPSNSSEEQLISSNSSPVAAAAVAAPIVRTTSCTTTPEILEENERLRKENSQLSH  205

Query  596  ELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatata-----tAGCG  432
            EL+Q+K LCNNI ALMS YS    N  N    S+     PL+L+P T TA       G  
Sbjct  206  ELTQLKGLCNNILALMSKYSSGQLNDHNNDNNSNN---HPLELLPVTQTASQPKEAVGTP  262

Query  431  GENQTEPDEMRARLFGVSIG-------SKRVREGEDGSAE-QDHDLRLQQPGTDVKSEPE  276
              +    +++  RLFGV IG        +  ++G +   E Q+H+LR     +DVKSEP 
Sbjct  263  PSSAAVDEDVSPRLFGVCIGVKRKRKEEEEEKQGSNNQQESQEHELR-----SDVKSEPL  317

Query  275  NGE-----DNEESPWL  243
            + +     D+ +  WL
Sbjct  318  DRKTSMQTDHHDPTWL  333



>ref|XP_011030077.1| PREDICTED: heat stress transcription factor B-2a [Populus euphratica]
 ref|XP_011012366.1| PREDICTED: heat stress transcription factor B-2a-like [Populus 
euphratica]
Length=294

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 95/189 (50%), Gaps = 50/189 (26%)
 Frame = -2

Query  743  TPSNSG-EEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCN  567
            T SNS  +EQV+S +SSPG +           +LI ENERLRKEN++L  EL++MKSLC 
Sbjct  139  TSSNSSSDEQVISGSSSPGLSV----------DLIDENERLRKENVQLKGELTEMKSLCA  188

Query  566  NIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARLF  387
            NI++L+SNY+ +      +         K LDL+P       G             AR+F
Sbjct  189  NIFSLVSNYANSREGKGVK---------KMLDLLPKKEEEQEG-------------ARIF  226

Query  386  GVSIGSKRVR-----EGEDGSAEQDHDLRLQQPGT--DVKSEPENG---------EDNEE  255
            GV +G KR R       E    E    L+L+QPG    +K E  NG           +++
Sbjct  227  GVEVGVKRGREGSGDMEEGEGEEDGMQLQLRQPGCGGGLKIE-TNGCQDGNSNGGGGDQD  285

Query  254  SPWLRQCHR  228
            +PWL QCHR
Sbjct  286  APWLEQCHR  294



>ref|XP_009124795.1| PREDICTED: heat stress transcription factor B-2b [Brassica rapa]
Length=357

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 103/199 (52%), Gaps = 33/199 (17%)
 Frame = -2

Query  767  PAQPSKTVTPSNSGEEQVVSSNSSP-------------GTAAIDASQGGSTSELIGENER  627
            PA P   V+PSNSGEEQV+SSNSSP             G      +   +  EL+ ENER
Sbjct  164  PAVP-HAVSPSNSGEEQVISSNSSPAAAAAASGGGGQVGVVLQRTTSCTTAPELVEENER  222

Query  626  LRKENIELNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatata  447
            LRKEN++L++EL+++K L +NIY LMSN++   ++ + +         + LDLMP     
Sbjct  223  LRKENVQLSQELTKLKGLYSNIYTLMSNFTSGQTDCAPEG--------RALDLMPERMGE  274

Query  446  tAGCGGENQT-----EPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQ----PGTD  294
                    +T       +++  RLFGVSIGSKR R  E    + +      Q     G+D
Sbjct  275  DMATASGVETGIGLKLDEDLTPRLFGVSIGSKRARRDEVEEEDDERREGSNQEGGEQGSD  334

Query  293  VKSEP--ENGEDNEESPWL  243
            VKSEP  E+  D    PWL
Sbjct  335  VKSEPMEEDNSDEHNGPWL  353



>ref|XP_008437221.1| PREDICTED: heat stress transcription factor B-2b [Cucumis melo]
Length=339

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 107/194 (55%), Gaps = 27/194 (14%)
 Frame = -2

Query  755  SKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKS  576
            +  ++P+NS EEQV SSNSSP  A   ++   +T EL+ ENERLRKEN++L+ EL+Q+K 
Sbjct  143  AHVISPANSAEEQVTSSNSSP-MAFQRSTSCTTTPELVRENERLRKENMQLSHELTQLKG  201

Query  575  LCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatat-AGCGGENQTEP----  411
            LCNNI +LM+NY+    +     +       K L+L+PA       G   +   E     
Sbjct  202  LCNNILSLMTNYASGQHHHFESGSVRDG---KALELLPARQVMEDEGAVSDGALEVRLKM  258

Query  410  -DEMRA--------RLFGVSIGSKRVREGEDGSAE----QDHDLRLQ-QPGTDVKSEP--  279
             ++M A        +LFGVSIG KR+R   +   E    Q+H    + + G+++K+EP  
Sbjct  259  GEKMAAAAAAGVTPKLFGVSIGVKRMRREVEEEEEEMVGQNHVQSEEGETGSEIKAEPLD  318

Query  278  ENGE--DNEESPWL  243
            EN E  D   SPWL
Sbjct  319  ENSEHPDGSASPWL  332



>ref|XP_009398726.1| PREDICTED: heat stress transcription factor B-2c-like [Musa acuminata 
subsp. malaccensis]
Length=350

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 109/212 (51%), Gaps = 41/212 (19%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCNN  564
            +P+NSGEEQV+SSNSSPG     A+   S+ EL  ENERLRKEN  L++EL+QMKSLC++
Sbjct  143  SPANSGEEQVLSSNSSPGPPPSVAAGSSSSVELTEENERLRKENTRLSRELAQMKSLCSH  202

Query  563  IYALMsnysgnnsnssnqsaesslqSLKPLDLMPata-----------------tatAGC  435
            I  L+S Y+          A     ++  L+LMPA                       G 
Sbjct  203  ISVLISKYADEGGGGRAAEAPPPPSTV--LELMPARREEEELEEEDEEEELQEAETETGM  260

Query  434  GGENQTEPDEMR-ARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPEN-GEDN  261
              E   + +EM  ARLFGVSIG KR RE ED         + + P  +VKSEP +   D 
Sbjct  261  EVEGAVKAEEMTSARLFGVSIGGKRARE-ED---------KAEDPTPEVKSEPSDPASDT  310

Query  260  EE--SP------WLRQCHRQNQRVCN*KGREG  189
            +E  SP      W+  C R  +R C+  G EG
Sbjct  311  KEDISPERHQRSWVVYCPRPVRRACH--GAEG  340



>ref|XP_011073942.1| PREDICTED: heat stress transcription factor B-2b-like, partial 
[Sesamum indicum]
Length=266

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 105/181 (58%), Gaps = 16/181 (9%)
 Frame = -2

Query  767  PAQPSKTVTPSNSGEEQVVSSNSSPGTAA----IDASQGGSTSELIGENERLRKENIELN  600
            PA P + ++P+NSG+EQV+SSNSSP  A     +      S  E++ EN+RLR+EN +L+
Sbjct  93   PAVPVQ-ISPANSGDEQVLSSNSSPAAAGATTPMAVRSSTSAPEILEENDRLRRENSQLS  151

Query  599  KELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQ  420
            +EL++++SLC NIY +MSNY+ N  ++S             ++L+        G GG+ +
Sbjct  152  EELNRLRSLCGNIYNIMSNYAANQGDASTGVLPEGGA----MNLIQVMEGEECGGGGKAE  207

Query  419  TEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEP-ENGEDNEESP-W  246
             E +    ++FGVSIG+KR+++ E+   E       Q  G + KSEP E+G +    P W
Sbjct  208  EEGERW-PKIFGVSIGAKRLKKNEEVEGEDQG----QAVGANAKSEPSESGSNKNHDPQW  262

Query  245  L  243
            L
Sbjct  263  L  263



>emb|CDY64186.1| BnaC03g73070D [Brassica napus]
Length=310

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 95/174 (55%), Gaps = 27/174 (16%)
 Frame = -2

Query  719  QVVSSNSSPG---------TAAIDASQGGSTS-ELIGENERLRKENIELNKELSQMKSLC  570
            QV+SSNSSP          + A+  +   +T+ EL+ ENERLRKEN++L++EL+++K L 
Sbjct  145  QVISSNSSPAGTGGGGGSVSVALQRTTSCTTAPELMEENERLRKENVQLSQELTKLKGLY  204

Query  569  NNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARL  390
            +NIY LMSN++   ++ +           K LDLMP     +     E  T    +  RL
Sbjct  205  SNIYKLMSNFTSGGADCA-----------KTLDLMPERQEMSEE-AIETGTGLKLLTPRL  252

Query  389  FGVSIGSKRVREGED---GSAEQDHDLRLQQPGTDVKSEP--ENGEDNEESPWL  243
            FGVSIG KR R   +    + E+D +   ++ G+D KSEP  EN   +   PWL
Sbjct  253  FGVSIGVKRARRDHELGAAAVEEDDNQEEEEQGSDDKSEPMEENNSVDHNGPWL  306



>ref|XP_008439190.1| PREDICTED: heat stress transcription factor B-2b-like [Cucumis 
melo]
Length=297

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 94/173 (54%), Gaps = 24/173 (14%)
 Frame = -2

Query  764  AQPSKTVTP---SNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKE  594
            A PS  + P   ++SGEEQV+SS+ +P  A          +ELI EN+RLR+E ++L ++
Sbjct  141  AIPSVQLLPLTGNSSGEEQVISSDETPTRAL---------AELIDENDRLRREKVQLTEQ  191

Query  593  LSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTE  414
            L ++KSLCNNI++LMS++  +   SS +  ES L S K LDL P    A      E + E
Sbjct  192  LVEVKSLCNNIFSLMSSFVESQFKSSFKVRESVLASAKSLDLFPVKRPAGEEERAEVKEE  251

Query  413  PDEMRARLFGVSIGSKRVREGEDG---SAEQDHDLRLQQPG-TDVKSEPENGE  267
                        IG KR RE  +G   +AE D  LRLQ P    VKSE  N +
Sbjct  252  ETN--------QIGVKRAREYREGATETAENDTTLRLQPPDRWVVKSERINCQ  296



>gb|KDO65439.1| hypothetical protein CISIN_1g042043mg [Citrus sinensis]
Length=121

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 73/139 (53%), Gaps = 28/139 (20%)
 Frame = -2

Query  650  ELIGENERLRKENIELNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLD  471
            EL+GENE+LRKEN +LN ELSQ+K LCNNI ALM   +   S   +  +    +++  LD
Sbjct  3    ELLGENEKLRKENAQLNNELSQLKGLCNNILALM---TNYASGQLDNVSLPEGKTVDELD  59

Query  470  LMPatatatAGCGGENQTEPDEMRARLFGVSIGSKRVRE-GEDGSAEQDHDLRLQQPGTD  294
            L P                      RLFGVSIG+K  R   E+   +        +PG+D
Sbjct  60   LTP----------------------RLFGVSIGAKCARREEEEEQNQLQQQQGENEPGSD  97

Query  293  VKSEP--ENGEDNEESPWL  243
            VKSEP   N + ++E PWL
Sbjct  98   VKSEPLDANNDHHQEPPWL  116



>emb|CDX86761.1| BnaA09g21510D [Brassica napus]
Length=361

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 106/195 (54%), Gaps = 36/195 (18%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGT-------------AAIDASQGGSTS-ELIGENERLRKENIE  606
            +PSNSGEEQV+SSNSSP                 +  +   +T+ EL  ENERLRKEN++
Sbjct  171  SPSNSGEEQVISSNSSPAAAAAASGGGGGQAGVVLQRTTSCTTAPELAEENERLRKENVQ  230

Query  605  LNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGE  426
            L++EL+++K L +NIY LMSN++   ++ + +         + LDLMP            
Sbjct  231  LSQELTKLKGLYSNIYTLMSNFTSGQTDCAPEG--------RALDLMPERMGEDMATASG  282

Query  425  NQT-----EPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQ-------QPGTDVKSE  282
             +T       +++  RLFGVSIG+KR R  E  +AE++ D R +       + G+DVKSE
Sbjct  283  VETGIGLKLDEDLTPRLFGVSIGAKRARRDEVVTAEEEDDERREGSNQEGGEQGSDVKSE  342

Query  281  P--ENGEDNEESPWL  243
            P  E+  D    PWL
Sbjct  343  PMEEDNSDEHNGPWL  357



>ref|XP_009400005.1| PREDICTED: heat stress transcription factor B-2b-like [Musa acuminata 
subsp. malaccensis]
Length=354

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 91/207 (44%), Gaps = 33/207 (16%)
 Frame = -2

Query  752  KTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSL  573
            + V+P+NSGEEQV+SSNSSPG      +     +EL  ENERLRKEN  L ++L+Q+ ++
Sbjct  143  RAVSPANSGEEQVLSSNSSPGPQTPATTGSSGPTELREENERLRKENARLLRDLAQITNV  202

Query  572  CNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRA-  396
            CN I  L+S Y+ +  +               L+LMPAT         E Q E D   A 
Sbjct  203  CNQIAVLVSKYAADGGSGGGGGTTEVGAPPPILELMPATRV-------EKQEEEDADTAA  255

Query  395  ------------------------RLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVK  288
                                    +LFGVSI  KRVRE E                    
Sbjct  256  AVEDGVIKVEEWTSEPRTPAGPSPKLFGVSIVGKRVREEETDQDPTPAVKPDPFDPGPDP  315

Query  287  SEPENGEDNEESPWLRQCHRQNQRVCN  207
             E  + E ++ S W+  C R  +R CN
Sbjct  316  KEATSPERHQRS-WVVYCPRPIRRSCN  341



>ref|XP_002321902.2| hypothetical protein POPTR_0015s13390g [Populus trichocarpa]
 gb|EEF06029.2| hypothetical protein POPTR_0015s13390g [Populus trichocarpa]
Length=286

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 81/154 (53%), Gaps = 33/154 (21%)
 Frame = -2

Query  752  KTVTPSNSGEEQVVSS-NSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKS  576
            KT + S+S E+ V+S+ +SSPG +           EL+ ENERLRKEN+ L  EL++MKS
Sbjct  144  KTSSNSSSDEQVVISTRSSSPGLSL----------ELLDENERLRKENVRLKGELTEMKS  193

Query  575  LCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRA  396
            LC NI++L+S++         +         K LDL+P       G             A
Sbjct  194  LCGNIFSLVSDFESLREEEEEEVR-------KVLDLLPMKEEVGDG-------------A  233

Query  395  RLFGVSIGSKRVRE-GEDGSAEQD-HDLRLQQPG  300
            R+FGV +G KR RE   D   E+D   LRL+QPG
Sbjct  234  RIFGVEVGVKRGRELSGDMEVEEDGMQLRLRQPG  267



>ref|XP_004245637.1| PREDICTED: heat stress transcription factor B-2b [Solanum lycopersicum]
Length=325

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = -2

Query  650  ELIGENERLRKENIELNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLD  471
            ELI ENERLRKEN +LN+EL++++SLC+N+Y LMSNY+ N ++            L    
Sbjct  183  ELIEENERLRKENAQLNQELNRLRSLCSNVYNLMSNYTANPADIPAGILGGRALELLRTG  242

Query  470  LMPatatatAGCGGENQTEPDEMRARLFGVSIGSKRVRE-GEDGSAEQDHDLRLQQPGTD  294
             +     A            ++M  RLFGVSIG KRVR   E+ S +QD    +Q  G+D
Sbjct  243  QVDGGGAAITAAESSGFKADEDMSPRLFGVSIGVKRVRRSSEEESEDQDQ---VQPHGSD  299

Query  293  VKSEPEN--GEDNEESPWL  243
            +KSEP +     +++ PW+
Sbjct  300  MKSEPLDSGSAQHDDQPWI  318



>ref|XP_009606739.1| PREDICTED: heat stress transcription factor B-2b [Nicotiana tomentosiformis]
Length=322

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 107/185 (58%), Gaps = 28/185 (15%)
 Frame = -2

Query  752  KTVTPSNSGEEQVVSSNSSPGT-----AAIDASQGGSTSELIGENERLRKENIELNKELS  588
            +  +PSNSG+EQV+SSNSSP         +  +   +T EL+ ENERLRKEN +L++EL+
Sbjct  147  RMASPSNSGDEQVLSSNSSPAATAAAAVVLRTTTCTTTPELLEENERLRKENAQLSEELN  206

Query  587  QMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEP-  411
            +++SLCNN+Y LMSNY+GN S +     E      + L+L+P    A    GG   T   
Sbjct  207  RLRSLCNNVYNLMSNYTGNPSETPAGIPEG-----RVLELLPTGQVAAEVDGGATATPAE  261

Query  410  -------DEMRARLFGVSIGSKRVREGEDGSAEQDHDL--RLQQPGTDVKSEPENGEDNE  258
                   +++  RLFGVSIG KRVR   +  +E++  +  ++Q  G+DVKSEP       
Sbjct  262  CSGVKAEEDISPRLFGVSIGVKRVRRSSEEESEREGRVQDQVQLHGSDVKSEP-------  314

Query  257  ESPWL  243
              PW+
Sbjct  315  -LPWI  318



>ref|XP_008652977.1| PREDICTED: heat stress transcription factor B-2c-like [Zea mays]
 tpg|DAA62420.1| TPA: hypothetical protein ZEAMMB73_805208 [Zea mays]
 gb|AIB04896.1| HSF transcription factor, partial [Zea mays]
Length=394

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 99/199 (50%), Gaps = 28/199 (14%)
 Frame = -2

Query  764  AQPSKTVTPSNSGEEQVVSSNS-----SPGTAAIDASQGGSTSELIGENERLRKENIELN  600
            A P +  +PS S +E V+SSNS      P  AA  +    ++ +   ENERLR+EN  L 
Sbjct  166  ALPVRPASPSLSTDEHVLSSNSGSAEDHPQAAASGSVSASASGDTGEENERLRRENARLT  225

Query  599  KELSQMKSLCNNIYALMsnysgnnsnssnqsaessl---------------qSLKPLDLM  465
            +EL QMK LCNNI  LM+ Y+ +    ++ +  S +                    L+LM
Sbjct  226  RELGQMKKLCNNILLLMTKYASSQQLDASAALSSVVNCSGESSEAVPAPPPLPPAILELM  285

Query  464  PatatatAGCGG-ENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQ-DH----DLRLQQP  303
            PA         G   + +PD+  +RLFGVSIG KR+R+ +D   EQ DH    D++ +  
Sbjct  286  PACPGLATAAAGLVAEADPDQA-SRLFGVSIGMKRMRDDDDTGEEQADHGAAADVKTEAS  344

Query  302  GTDVKSEPENGEDNEESPW  246
                + EP + E  ++ PW
Sbjct  345  DPQHRMEP-SPESPDQHPW  362



>ref|XP_010458062.1| PREDICTED: heat stress transcription factor B-2a-like [Camelina 
sativa]
Length=314

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 103/196 (53%), Gaps = 27/196 (14%)
 Frame = -2

Query  761  QPSKTVTPSNSGEE---QVVSSNSSPGTAAIDASQ------GGSTSELIGENERLRKENI  609
            Q +  V+PSNSGE+   QV+SS+    +  +  +        G + EL+ ENE+LR +NI
Sbjct  135  QTTLVVSPSNSGEDNNNQVMSSSPPSSSWYVQTTTTTGNNGAGLSVELLEENEKLRNQNI  194

Query  608  ELNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGG  429
            +LN+EL+QMKS+C+NI+ LMS+Y G++ + S         S          AT    C  
Sbjct  195  QLNRELTQMKSVCDNIFTLMSSYVGSHPDRSYSPGGGGGSSSH------QPATKKRFCDV  248

Query  428  ENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENGEDNEESP  249
            E + E +E   RLFGV IG KR R      +E  H ++     T    E    + +EE P
Sbjct  249  EGEEE-EEASPRLFGVPIGLKRTR------SEGLHQVKSVSTTTAPVGE---KKSDEEPP  298

Query  248  WLRQ--CHRQNQRVCN  207
            WLR    +R NQRVCN
Sbjct  299  WLRYYNYNRTNQRVCN  314



>ref|XP_004957414.1| PREDICTED: heat stress transcription factor B-2c-like isoform 
X1 [Setaria italica]
Length=401

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 83/175 (47%), Gaps = 25/175 (14%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNS-----SPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMK  579
            +P+ S +EQV+SSNS      P      +    ++ +   ENERLR+EN  L +EL QMK
Sbjct  171  SPALSSDEQVLSSNSGSAEDHPQAVPSGSGGASASGDTGEENERLRRENARLTRELGQMK  230

Query  578  SLCNNIYALMsnysgnnsnssnqsaessl---------------qSLKPLDLMPatatat  444
             LCNNI  LM+ Y+ +    ++ +  S +                    LDLMP+  +  
Sbjct  231  KLCNNILLLMTKYASSQQLDASAALSSVVNCSGESSEALPPPPPLPPAILDLMPSCPSLA  290

Query  443  AGCGGENQTEPDEMRARLFGVSIGSKRVREGED-GSAEQDHDLRLQQPGTDVKSE  282
                G       E  ARLFGVSIG KR RE +D G    DH       G +VK+E
Sbjct  291  TAAAGLVADADPEQAARLFGVSIGLKRTREDDDTGEEPADHG----SAGAEVKTE  341



>ref|XP_004957416.1| PREDICTED: heat stress transcription factor B-2c-like isoform 
X3 [Setaria italica]
Length=395

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 83/175 (47%), Gaps = 25/175 (14%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNS-----SPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMK  579
            +P+ S +EQV+SSNS      P      +    ++ +   ENERLR+EN  L +EL QMK
Sbjct  171  SPALSSDEQVLSSNSGSAEDHPQAVPSGSGGASASGDTGEENERLRRENARLTRELGQMK  230

Query  578  SLCNNIYALMsnysgnnsnssnqsaessl---------------qSLKPLDLMPatatat  444
             LCNNI  LM+ Y+ +    ++ +  S +                    LDLMP+  +  
Sbjct  231  KLCNNILLLMTKYASSQQLDASAALSSVVNCSGESSEALPPPPPLPPAILDLMPSCPSLA  290

Query  443  AGCGGENQTEPDEMRARLFGVSIGSKRVREGED-GSAEQDHDLRLQQPGTDVKSE  282
                G       E  ARLFGVSIG KR RE +D G    DH       G +VK+E
Sbjct  291  TAAAGLVADADPEQAARLFGVSIGLKRTREDDDTGEEPADHG----SAGAEVKTE  341



>ref|XP_004957417.1| PREDICTED: heat stress transcription factor B-2c-like isoform 
X4 [Setaria italica]
Length=336

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 82/175 (47%), Gaps = 25/175 (14%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNS-----SPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMK  579
            +P+ S +EQV+SSNS      P      +    ++ +   ENERLR+EN  L +EL QMK
Sbjct  106  SPALSSDEQVLSSNSGSAEDHPQAVPSGSGGASASGDTGEENERLRRENARLTRELGQMK  165

Query  578  SLCNNIYALMsnysgnnsnssnqsaes---------------slqSLKPLDLMPatatat  444
             LCNNI  LM+ Y+ +    ++ +  S                      LDLMP+  +  
Sbjct  166  KLCNNILLLMTKYASSQQLDASAALSSVVNCSGESSEALPPPPPLPPAILDLMPSCPSLA  225

Query  443  AGCGGENQTEPDEMRARLFGVSIGSKRVREGED-GSAEQDHDLRLQQPGTDVKSE  282
                G       E  ARLFGVSIG KR RE +D G    DH       G +VK+E
Sbjct  226  TAAAGLVADADPEQAARLFGVSIGLKRTREDDDTGEEPADHG----SAGAEVKTE  276



>ref|XP_004300764.1| PREDICTED: heat stress transcription factor B-2b [Fragaria vesca 
subsp. vesca]
 ref|XP_011463820.1| PREDICTED: heat stress transcription factor B-2b [Fragaria vesca 
subsp. vesca]
 ref|XP_011463821.1| PREDICTED: heat stress transcription factor B-2b [Fragaria vesca 
subsp. vesca]
 ref|XP_011463822.1| PREDICTED: heat stress transcription factor B-2b [Fragaria vesca 
subsp. vesca]
 ref|XP_011463823.1| PREDICTED: heat stress transcription factor B-2b [Fragaria vesca 
subsp. vesca]
Length=355

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 9/74 (12%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPG---------TAAIDASQGGSTSELIGENERLRKENIELNKEL  591
            +P+NSG+EQV+SSNSSP          T    A    ST+E++ ENERLRKEN++L+ EL
Sbjct  150  SPANSGDEQVISSNSSPMAVPTPAPAVTLLQRARSCNSTAEILEENERLRKENMQLSNEL  209

Query  590  SQMKSLCNNIYALM  549
            +Q++ LCNNI  +M
Sbjct  210  TQLRGLCNNILGMM  223



>sp|Q6Z9C8.1|HFB2B_ORYSJ RecName: Full=Heat stress transcription factor B-2b; AltName: 
Full=Heat stress transcription factor 2; Short=rHsf2; AltName: 
Full=Heat stress transcription factor 21; Short=OsHsf-21 
[Oryza sativa Japonica Group]
 dbj|BAD09238.1| putative heat shock factor RHSF2 [Oryza sativa Japonica Group]
 dbj|BAD09926.1| putative heat shock factor RHSF2 [Oryza sativa Japonica Group]
 dbj|BAG95195.1| unnamed protein product [Oryza sativa Japonica Group]
Length=390

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 95/191 (50%), Gaps = 34/191 (18%)
 Frame = -2

Query  767  PAQPSKTVTPSNSGEEQVVSSNSSPGTAAI-------DASQGGSTSELIGENERLRKENI  609
            P   ++  +P  SGEEQV+SS+SSP    +         S G ++ ++  ENERLR+EN 
Sbjct  161  PVTTTRDGSPVLSGEEQVISSSSSPEPPLVLPQAPSGSGSGGVASGDVGDENERLRRENA  220

Query  608  ELNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKP----------------  477
            +L +ELSQM+ LCNNI  LMS Y+      +  ++ ++  +                   
Sbjct  221  QLARELSQMRKLCNNILLLMSKYASTQQLDAANASSAAGNNNNNNCSGESAEAATPLPLP  280

Query  476  --LDLMPatatatAGCGGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQP  303
              LDLMP+   A +     +  E   M A+LFGVSIG KR+R   DG  + DH       
Sbjct  281  AVLDLMPSCPGAASAAAPVSDNEEGMMSAKLFGVSIGRKRMR--HDGGGDDDH-------  331

Query  302  GTDVKSEPENG  270
               VK+EP +G
Sbjct  332  AATVKAEPMDG  342



>ref|XP_009415832.1| PREDICTED: heat stress transcription factor B-2a-like [Musa acuminata 
subsp. malaccensis]
Length=346

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 77/154 (50%), Gaps = 22/154 (14%)
 Frame = -2

Query  755  SKTVTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKS  576
            S+  +P+NSGEEQV+SS+SS G     A      +EL  ENERLRKEN  L +E++QMKS
Sbjct  136  SRARSPTNSGEEQVLSSDSSSGPFPTVAVGPCGVAELGEENERLRKENERLAREVAQMKS  195

Query  575  LCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTE------  414
            LC  I +L+S +  +       +  +       L+LMPA   A      E + E      
Sbjct  196  LCGQIASLISRHVSDRQEGGGGAEAAPF-----LELMPARPGAEEAFYNEVEEEEDVKPE  250

Query  413  ----------PDEMRARLFGVSIGSKRVREGEDG  342
                      P     RLFGVSIG KR R  EDG
Sbjct  251  DATSEEVPPSPPGASPRLFGVSIGVKRPR-SEDG  283



>gb|EAZ07882.1| hypothetical protein OsI_30138 [Oryza sativa Indica Group]
Length=373

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 95/192 (49%), Gaps = 35/192 (18%)
 Frame = -2

Query  767  PAQPSKTVTPSNSGEEQVVSSNSSPGTAAI-------DASQGGSTSELIGENERLRKENI  609
            P   ++  +P  SGEEQV+SS+SSP    +         S G ++ ++  ENERLR+EN 
Sbjct  143  PVTTTRDGSPVLSGEEQVISSSSSPEPPLVLPQAPSGSGSGGVASGDVGDENERLRRENA  202

Query  608  ELNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKP----------------  477
            +L +ELSQM+ LCNNI  LMS Y+      +  ++ ++  +                   
Sbjct  203  QLARELSQMRKLCNNIILLMSKYASTQQLDAANASSAAGNNNNNNNCSGESAEAATPLPL  262

Query  476  ---LDLMPatatatAGCGGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQ  306
               LDLMP+   A +     +  E   M A+LFGVSIG KR+R   DG  + DH      
Sbjct  263  PAVLDLMPSCPGAASAAAPVSDNEEGMMSAKLFGVSIGRKRMR--HDGGGDDDH------  314

Query  305  PGTDVKSEPENG  270
                VK+EP +G
Sbjct  315  -AATVKAEPMDG  325



>ref|NP_001062423.1| Os08g0546800 [Oryza sativa Japonica Group]
 gb|AAQ23056.1| heat shock factor RHSF2 [Oryza sativa Japonica Group]
 dbj|BAF24337.1| Os08g0546800 [Oryza sativa Japonica Group]
Length=616

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 95/192 (49%), Gaps = 34/192 (18%)
 Frame = -2

Query  767  PAQPSKTVTPSNSGEEQVVSSNSSPGTAAI-------DASQGGSTSELIGENERLRKENI  609
            P   ++  +P  SGEEQV+SS+SSP    +         S G ++ ++  ENERLR+EN 
Sbjct  304  PVTTTRDGSPVLSGEEQVISSSSSPEPPLVLPQAPSGSGSGGVASGDVGDENERLRRENA  363

Query  608  ELNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKP----------------  477
            +L +ELSQM+ LCNNI  LMS Y+      +  ++ ++  +                   
Sbjct  364  QLARELSQMRKLCNNILLLMSKYASTQQLDAANASSAAGNNNNNNCSGESAEAATPLPLP  423

Query  476  --LDLMPatatatAGCGGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQP  303
              LDLMP+   A +     +  E   M A+LFGVSIG KR+R   DG  + DH       
Sbjct  424  AVLDLMPSCPGAASAAAPVSDNEEGMMSAKLFGVSIGRKRMR--HDGGGDDDH-------  474

Query  302  GTDVKSEPENGE  267
               VK+EP +G 
Sbjct  475  AATVKAEPMDGR  486



>ref|XP_011048671.1| PREDICTED: heat stress transcription factor B-2a-like [Populus 
euphratica]
Length=287

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 77/153 (50%), Gaps = 36/153 (24%)
 Frame = -2

Query  743  TPSNSGEEQVVSS--NSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLC  570
            +P++S +EQVV S  +SSPG +           EL+ ENERLRKEN+ L  EL++MKSLC
Sbjct  147  SPNSSSDEQVVISTRSSSPGLSL----------ELLDENERLRKENVRLKGELTEMKSLC  196

Query  569  NNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARL  390
             NI++L+S++                   K LDL+P       G             AR+
Sbjct  197  GNIFSLVSDFENLREEEEEVR--------KVLDLLPMKEEGGDG-------------ARI  235

Query  389  FGVSIGSKRVRE---GEDGSAEQDHDLRLQQPG  300
            FGV +G KR RE     +   E    L+L+QPG
Sbjct  236  FGVEVGVKRGRELSGDMEEEEEDGMQLQLRQPG  268



>ref|XP_009130189.1| PREDICTED: heat stress transcription factor B-2a-like [Brassica 
rapa]
Length=255

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 91/187 (49%), Gaps = 55/187 (29%)
 Frame = -2

Query  764  AQPSKT-VTPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
            AQ +KT V+PS+SGE+Q +S +S           GG + EL+ ENE+LR +N ELN+EL+
Sbjct  123  AQTAKTAVSPSSSGEDQTMSPSSW-------TGSGGLSEELLEENEKLRSQNKELNRELA  175

Query  587  QMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPD  408
            QMK L  NI+ LMSNY+G                        +++        E ++ P 
Sbjct  176  QMKFLYGNIFGLMSNYAGA-----------------------SSSHEMMTEIEEEESSP-  211

Query  407  EMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENGEDNEESPWLRQCHR  228
                RLFGVSIG KR R                  G  VK+        EE+PWLR  +R
Sbjct  212  ----RLFGVSIGLKRTRS----------------EGVHVKTVSTAA---EETPWLRHSNR  248

Query  227  QNQRVCN  207
             NQRVCN
Sbjct  249  ANQRVCN  255



>gb|KHM99149.1| Heat stress transcription factor B-2a [Glycine soja]
Length=238

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 61/108 (56%), Gaps = 20/108 (19%)
 Frame = -2

Query  485  LKPLDLMPatatatAGCGGEN--QTEPDEMRA----RLFGVSIGSKRVREGEDGSAEQDH  324
            +KPLDLMP   +      GE+   T P E+      +LFGV+IG+KR REG  G      
Sbjct  136  VKPLDLMPVKRS-----SGEDAADTVPKEINLIPNPKLFGVAIGAKRAREGGGGGDCGGG  190

Query  323  D-----LRLQQPGT-DVKSEP---ENGEDNEESPWLRQCHRQNQRVCN  207
                  LRL   G+ DVKSEP   +N  +N+++PWL  C+R NQRVCN
Sbjct  191  GEEDTLLRLHHAGSADVKSEPLDFQNHRENQKTPWLSPCYRTNQRVCN  238



>ref|XP_006659656.1| PREDICTED: heat stress transcription factor B-2b-like [Oryza 
brachyantha]
Length=371

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 94/179 (53%), Gaps = 34/179 (19%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSP-GTAAIDASQGGSTSELIG------ENERLRKENIELNKELSQ  585
            +P  SGEEQV+SS+SSP     +  +  GS S  +       EN+RLR+EN +L +ELSQ
Sbjct  161  SPVLSGEEQVISSSSSPEPPFLLPQAPSGSGSGCVASGDMGEENDRLRRENAQLARELSQ  220

Query  584  MKSLCNNIYALMsnysgnnsnssnqsa------------esslqSLKPLDLMPatatatA  441
            MK LCNNI  LMS Y+      +  +A             + L     LDLMP+ A A A
Sbjct  221  MKKLCNNILLLMSKYASTQQLDAANAAGGNCSGESAEAAATPLPPPAVLDLMPSCAAALA  280

Query  440  GCGGEN-QTEPDEMRARLFGVSIGSKRV-REGEDGSAEQDHDLRLQQPGTDVKSEPENG  270
                    T+ + M A+LFGVSIG KR+ R+G+D +AE             VK+EP +G
Sbjct  281  VAATPAPDTDEEAMSAKLFGVSIGRKRMRRDGDDRAAE-------------VKAEPMDG  326



>ref|XP_009397638.1| PREDICTED: heat stress transcription factor B-2b-like [Musa acuminata 
subsp. malaccensis]
Length=294

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 77/159 (48%), Gaps = 37/159 (23%)
 Frame = -2

Query  764  AQPSKTVTPS-NSGEEQVVSSNSSP-------GTAAIDASQG--GSTSELIGENERLRKE  615
            A P+  V  S  SG+EQV S+ SSP             AS G  G  SEL  EN RLR+E
Sbjct  130  AAPANRVMSSETSGDEQVRSTTSSPSGFQPEPAAVVAWASPGSSGGASELAEENNRLRRE  189

Query  614  NIELNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGC  435
            N +L++EL QMKSLC NI  LM+ Y+    N +                  A  TA +G 
Sbjct  190  NKQLSQELGQMKSLCTNIMQLMAKYALFRKNGA------------------AATTAVSGG  231

Query  434  GGENQTEPDEM--------RARLFGVSIGSKRVREGEDG  342
            GG +   P E           RLFGVSIG KR R GEDG
Sbjct  232  GGASAAPPLEAGGSSGERGSTRLFGVSIGFKRNR-GEDG  269



>ref|XP_003578478.1| PREDICTED: heat stress transcription factor B-2c [Brachypodium 
distachyon]
Length=399

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 75/166 (45%), Gaps = 23/166 (14%)
 Frame = -2

Query  638  ENERLRKENIELNKELSQMKSLCNNIYALMsnysgnns-------------nssnqsaes  498
            EN+RLR++N  L +EL QMK LCNNI  LMS Y+                 +  +  A  
Sbjct  220  ENDRLRRDNTRLTRELGQMKKLCNNIVLLMSKYAATQQPDGPASLSSVVNCSGESALAPP  279

Query  497  slqSLKPLDLMPatatatAGCGGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDL  318
                   LDLMP+ +      G     EPD   ARLFGVSIG KR R+ +DG   ++   
Sbjct  280  PPLPTAILDLMPSCSALATAAGLAVDGEPD-TSARLFGVSIGQKRSRDSDDGGGREEDPR  338

Query  317  RLQQPGTDVKSE-----PENGEDNEESP----WLRQCHRQNQRVCN  207
                 G DVK E     P++ E + + P    W     +   R CN
Sbjct  339  DDGGEGADVKPEQADRRPDSQERSPDGPDQHSWPIYRPKPVYRACN  384



>emb|CDY67248.1| BnaCnng54110D [Brassica napus]
Length=252

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 69/143 (48%), Gaps = 47/143 (33%)
 Frame = -2

Query  635  NERLRKENIELNKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPat  456
            NERLR ENI+L++EL+QMKSL  NI+ LMSNY+G +S+S              +D+    
Sbjct  157  NERLRSENIQLSRELAQMKSLYGNIFGLMSNYAGASSSSHEMM----------MDI----  202

Query  455  atatAGCGGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPE  276
                     E +  P     RLFGVSIG KR R                  G  VK+   
Sbjct  203  ---------EEEASP-----RLFGVSIGLKRTRS----------------EGVHVKTVST  232

Query  275  NGEDNEESPWLRQCHRQNQRVCN  207
                 EE+PWLR  +  NQRVCN
Sbjct  233  AA---EETPWLRHYNLANQRVCN  252



>ref|XP_009389775.1| PREDICTED: heat stress transcription factor B-2b-like [Musa acuminata 
subsp. malaccensis]
Length=304

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 50/81 (62%), Gaps = 10/81 (12%)
 Frame = -2

Query  764  AQPSKTVTPSNSGEEQVVSSNSSPGTA---------AIDASQGGSTSELIGENERLRKEN  612
            A P+  V+P NS EEQ +SS SSPG           A   + GG TS+L  EN RLR+EN
Sbjct  138  APPNLVVSPVNSNEEQGLSSTSSPGCVQPAPVTSGWAAPGTSGG-TSDLAEENSRLRREN  196

Query  611  IELNKELSQMKSLCNNIYALM  549
             +L++EL QMK +CNNI  L+
Sbjct  197  KQLSQELGQMKGMCNNIMQLI  217



>gb|EPS72138.1| hypothetical protein M569_02618 [Genlisea aurea]
Length=280

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 79/136 (58%), Gaps = 18/136 (13%)
 Frame = -2

Query  737  SNSGEEQVVSSNSSPGTAAIDASQ-GGSTSELIGENERLRKENIELNKELSQMKSLCNNI  561
            SNS EEQ +SSNSSP      A +   S+ +++ EN+RL+KEN  L++EL  ++ LC +I
Sbjct  127  SNSAEEQAISSNSSPTITHPPALKLCPSSFDILMENDRLKKENSRLSEELHHLRGLCGSI  186

Query  560  YALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARLFGV  381
            Y+LMSNY+ N++ ++++S + +       D  P     +     E Q+ P     R+FGV
Sbjct  187  YSLMSNYATNSAAATSRSGDVA-------DAQP-----STSLNEEEQSYP-----RIFGV  229

Query  380  SIGSKRVREGEDGSAE  333
             IG+KR R  E G  E
Sbjct  230  PIGAKRARRCEPGEME  245



>emb|CAB63803.1| heat shock factor 7 [Arabidopsis thaliana]
Length=328

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 102/195 (52%), Gaps = 32/195 (16%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAA-----------IDASQGGSTS-ELIGENERLRKENIEL  603
            V+PSNSGEEQV+SSNSSP  AA           +  +   +T+ EL+ ENERLRK+N  L
Sbjct  135  VSPSNSGEEQVISSNSSPAAAAAAIGGVVGGGSLQRTTSCTTAPELVEENERLRKDNERL  194

Query  602  NKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGC----  435
             KE++++K L  NIY LM+N++    + ++   E      KPLDL+P     +       
Sbjct  195  RKEMTKLKGLYANIYTLMANFTPGQEDCAHLLPEG-----KPLDLLPERQEMSEAIMASE  249

Query  434  --GGENQTEPDEMRARLFGVSIGSKRVRE--GEDGSAEQDHDLR--LQQPG---TDVKSE  282
               G      +++  RLFGVSIG KR R       + E+D D R    Q G   +DVK+E
Sbjct  250  IETGIGLKLGEDLTPRLFGVSIGVKRARREEELGAAEEEDDDRREAAAQEGEQSSDVKAE  309

Query  281  P--ENGEDNEESPWL  243
            P  EN   N    WL
Sbjct  310  PMEENNSGNHNGSWL  324



>ref|NP_192903.1| heat stress transcription factor B-2b [Arabidopsis thaliana]
 sp|Q9T0D3.1|HFB2B_ARATH RecName: Full=Heat stress transcription factor B-2b; Short=AtHsfB2b; 
AltName: Full=AtHsf-11; AltName: Full=Heat shock factor 
protein 7; Short=HSF 7; AltName: Full=Heat shock transcription 
factor 7; Short=HSTF 7 [Arabidopsis thaliana]
 emb|CAB39937.1| heat shock transcription factor-like protein [Arabidopsis thaliana]
 emb|CAB78209.1| heat shock transcription factor-like protein [Arabidopsis thaliana]
 gb|AAM13205.1| heat shock transcription factor-like protein [Arabidopsis thaliana]
 gb|AAP37830.1| At4g11660 [Arabidopsis thaliana]
 gb|AEE83036.1| heat stress transcription factor B-2b [Arabidopsis thaliana]
Length=377

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 102/195 (52%), Gaps = 32/195 (16%)
 Frame = -2

Query  746  VTPSNSGEEQVVSSNSSPGTAA-----------IDASQGGSTS-ELIGENERLRKENIEL  603
            V+PSNSGEEQV+SSNSSP  AA           +  +   +T+ EL+ ENERLRK+N  L
Sbjct  184  VSPSNSGEEQVISSNSSPAAAAAAIGGVVGGGSLQRTTSCTTAPELVEENERLRKDNERL  243

Query  602  NKELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGC----  435
             KE++++K L  NIY LM+N++    + ++   E      KPLDL+P     +       
Sbjct  244  RKEMTKLKGLYANIYTLMANFTPGQEDCAHLLPEG-----KPLDLLPERQEMSEAIMASE  298

Query  434  --GGENQTEPDEMRARLFGVSIGSKRVRE--GEDGSAEQDHDLR--LQQPG---TDVKSE  282
               G      +++  RLFGVSIG KR R       + E+D D R    Q G   +DVK+E
Sbjct  299  IETGIGLKLGEDLTPRLFGVSIGVKRARREEELGAAEEEDDDRREAAAQEGEQSSDVKAE  358

Query  281  P--ENGEDNEESPWL  243
            P  EN   N    WL
Sbjct  359  PMEENNSGNHNGSWL  373



>dbj|BAJ85352.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=402

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 93/207 (45%), Gaps = 34/207 (16%)
 Frame = -2

Query  731  SGEEQVVSSNSSPG------------TAAIDASQGGSTSELIGENERLRKENIELNKELS  588
            S EEQV+SSNS               +A   A+ G S+ ++  EN+RLR++N  L +EL 
Sbjct  177  SSEEQVLSSNSGSAEELPLAPSGSGGSAPGGAAAGSSSGDMGEENDRLRRDNARLTRELG  236

Query  587  QMKSLCNNIYALMsnysgnnsns--------------snqsaesslqSLKPLDLMPatat  450
            QMK LCNNI +LMS ++ +                   +  A         LDLMP+ + 
Sbjct  237  QMKKLCNNIVSLMSKFASSQQQDGGPGSLSSVVNCSGESALAPPPPLPAAILDLMPSCSA  296

Query  449  atAGCGGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSE----  282
                 G      PD   ARLFGVSIG KR R+ ED  A ++        G DVK E    
Sbjct  297  LATAAGFAVDGGPD-ADARLFGVSIGLKRARDEEDEDAVREERPNGDGDGADVKPEEAAD  355

Query  281  --PENGEDNEESPWLRQCHRQNQRVCN  207
              P+ G +  +S W     +   R CN
Sbjct  356  RRPDGGSEERQS-WPIYRPKPVYRACN  381



>gb|KCW72116.1| hypothetical protein EUGRSUZ_E00555 [Eucalyptus grandis]
Length=316

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 14/80 (18%)
 Frame = -2

Query  749  TVTPSNSGEEQVVSSNSSPGTAAIDASQGG-------------STSELIGENERLRKENI  609
            TV+P+NSG+EQV+SS SSP  A   A+                +  EL+ ENERL+KEN+
Sbjct  137  TVSPANSGDEQVISS-SSPPVALATAAVAAASPSVVHRSPSCTTAPELLEENERLKKENM  195

Query  608  ELNKELSQMKSLCNNIYALM  549
            ++++ELSQ++ LCNNI +LM
Sbjct  196  QMSQELSQLRGLCNNILSLM  215



>gb|AFW65023.1| hypothetical protein ZEAMMB73_676522 [Zea mays]
Length=383

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 91/184 (49%), Gaps = 29/184 (16%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNS--------SPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
            +P  SGEEQV+SS+S         P   +   S G  + ++  ENERLR+EN  L +EL 
Sbjct  165  SPVYSGEEQVLSSSSPEPPSLQQHPPAPSGSGSGGVVSGDVGEENERLRRENARLARELG  224

Query  587  QMKSLCNNIYALMsnysgnnsnssnqsaes-------slqSLKP-----LDLMPatatat  444
            QMK LCNNI  LMS Y+      + + A +       S  +  P     L+L+P+     
Sbjct  225  QMKKLCNNILLLMSKYAATQQPDAAKEAAAGNCTGESSDAAAAPPLPSILELLPSCRADP  284

Query  443  AGCGGENQTEPDEMR-ARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENGE  267
            A        E DE   ARLFGVSIG KR+R+      E DH   +     +VK+EP +  
Sbjct  285  APAAAGTDHEDDEKAGARLFGVSIGRKRMRD------ESDHHAGVC--AAEVKAEPVDAR  336

Query  266  DNEE  255
             +++
Sbjct  337  PDQQ  340



>gb|AFW65024.1| heat shock factor protein 7 [Zea mays]
 gb|AIB04895.1| HSF transcription factor, partial [Zea mays]
Length=370

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 89/184 (48%), Gaps = 29/184 (16%)
 Frame = -2

Query  743  TPSNSGEEQVVSS--------NSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
            +P  SGEEQV+SS           P   +   S G  + ++  ENERLR+EN  L +EL 
Sbjct  152  SPVYSGEEQVLSSSSPEPPSLQQHPPAPSGSGSGGVVSGDVGEENERLRRENARLARELG  211

Query  587  QMKSLCNNIYALMsnysgnnsnssnqsaes-------slqSLKP-----LDLMPatatat  444
            QMK LCNNI  LMS Y+      + + A +       S  +  P     L+L+P+     
Sbjct  212  QMKKLCNNILLLMSKYAATQQPDAAKEAAAGNCTGESSDAAAAPPLPSILELLPSCRADP  271

Query  443  AGCGGENQTEPDEMR-ARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENGE  267
            A        E DE   ARLFGVSIG KR+R+      E DH   +     +VK+EP +  
Sbjct  272  APAAAGTDHEDDEKAGARLFGVSIGRKRMRD------ESDHHAGVC--AAEVKAEPVDAR  323

Query  266  DNEE  255
             +++
Sbjct  324  PDQQ  327



>ref|NP_001149902.1| heat shock factor protein 7 [Zea mays]
 gb|ACG37151.1| heat shock factor protein 7 [Zea mays]
Length=371

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 89/184 (48%), Gaps = 29/184 (16%)
 Frame = -2

Query  743  TPSNSGEEQVVSS--------NSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
            +P  SGEEQV+SS           P   +   S G  + ++  ENERLR+EN  L +EL 
Sbjct  153  SPVYSGEEQVLSSSSPEPPSLQQHPPAPSGSGSGGVVSGDVGEENERLRRENARLARELG  212

Query  587  QMKSLCNNIYALMsnysgnnsnssnqsaes-------slqSLKP-----LDLMPatatat  444
            QMK LCNNI  LMS Y+      + + A +       S  +  P     L+L+P+     
Sbjct  213  QMKKLCNNILLLMSKYAATQQPDAAKEAAAGNCTGESSDAAAAPPLPSILELLPSCRADP  272

Query  443  AGCGGENQTEPDEMR-ARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENGE  267
            A        E DE   ARLFGVSIG KR+R+      E DH   +     +VK+EP +  
Sbjct  273  APAAAGTDHEDDEKAGARLFGVSIGRKRMRD------ESDHHAGVC--AAEVKAEPVDAR  324

Query  266  DNEE  255
             +++
Sbjct  325  PDQQ  328



>gb|EMT20815.1| Heat stress transcription factor B-2b [Aegilops tauschii]
Length=375

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 88/176 (50%), Gaps = 26/176 (15%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSP-------GTAAIDASQGGSTSELIGENERLRKENIELNKELSQ  585
            +P  SG+EQV+SS+SSP          +   S G ++ +L  ENERLR+EN  L +EL Q
Sbjct  161  SPVLSGDEQVLSSSSSPEPPFLNQYAPSYSGSGGVASGDLGEENERLRRENSRLTRELGQ  220

Query  584  MKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPat----------atatAGC  435
            MK LCNNI+ LMS Y+      +      S +S +   L              A   A  
Sbjct  221  MKKLCNNIFVLMSKYTHGQQADAADVGNCSGESAETTALPLPPVLELLPSCPNAPTAADL  280

Query  434  GGENQTEPDEMRARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENGE  267
            G E++ E  +M ARLFGV IG KR+R   DG      DL  +    +VK EP + +
Sbjct  281  GAEDEEE--KMSARLFGVCIGRKRMR--HDG-----EDLTSRGAAAEVKPEPMDAQ  327



>ref|XP_008677301.1| PREDICTED: heat shock factor protein 7 isoform X1 [Zea mays]
Length=370

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 91/184 (49%), Gaps = 29/184 (16%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSS--------PGTAAIDASQGGSTSELIGENERLRKENIELNKELS  588
            +P  SGEEQV+SS+S         P   +   S G  + ++  ENERLR+EN  L +EL 
Sbjct  152  SPVYSGEEQVLSSSSPEPPSLQQHPPAPSGSGSGGVVSGDVGEENERLRRENARLARELG  211

Query  587  QMKSLCNNIYALMsnysgnnsnssnqsaes-------slqSLKP-----LDLMPatatat  444
            QMK LCNNI  LMS Y+      + + A +       S  +  P     L+L+P+     
Sbjct  212  QMKKLCNNILLLMSKYAATQQPDAAKEAAAGNCTGESSDAAAAPPLPSILELLPSCRADP  271

Query  443  AGCGGENQTEPDEMR-ARLFGVSIGSKRVREGEDGSAEQDHDLRLQQPGTDVKSEPENGE  267
            A        E DE   ARLFGVSIG KR+R+      E DH   +     +VK+EP +  
Sbjct  272  APAAAGTDHEDDEKAGARLFGVSIGRKRMRD------ESDHHAGVC--AAEVKAEPVDAR  323

Query  266  DNEE  255
             +++
Sbjct  324  PDQQ  327



>gb|AEB26596.1| heat shock factor B2c [Hordeum vulgare subsp. vulgare]
Length=362

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 56/115 (49%), Gaps = 15/115 (13%)
 Frame = -2

Query  638  ENERLRKENIELNKELSQMKSLCNNIYALMsnysgnnsns--------------snqsae  501
            EN+RLR++N  L +EL QMK LCNNI +LMS ++ +                   +  A 
Sbjct  203  ENDRLRRDNARLTRELGQMKKLCNNIVSLMSKFASSQQQDGGPGSLSSVVNCSGESALAP  262

Query  500  sslqSLKPLDLMPatatatAGCGGENQTEPDEMRARLFGVSIGSKRVREGEDGSA  336
                    LDLMP+ +      G      PD   ARLFGVSIG KR R+ ED  A
Sbjct  263  PPPLPAAILDLMPSCSALATAAGFAVDGGPDA-DARLFGVSIGLKRARDEEDEDA  316



>dbj|BAD46358.1| putative heat shock factor [Oryza sativa Japonica Group]
Length=414

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 68/162 (42%), Gaps = 30/162 (19%)
 Frame = -2

Query  755  SKTVTPSNSGEEQVVSSNSSPG-----------TAAIDASQGGSTSELIGENERLRKENI  609
            ++  +P++S EEQV+SSNS  G                     S  ++  ENERLR+EN 
Sbjct  171  TRAGSPAHSSEEQVLSSNSGSGEEHRQASGSGSAPGGGGGGSASGGDMGEENERLRRENA  230

Query  608  ELNKELSQMKSLCNNIYALMsnysgnnsn---------------ssnqsaesslqSLKPL  474
             L +EL  MK LCNNI  LMS Y+                    SS             L
Sbjct  231  RLTRELGHMKKLCNNILLLMSKYAATQHVEGSAGISSIANCSGESSEAVPPPPPLPPAIL  290

Query  473  DLMPatatatAGCGGENQT---EPDEMRARLFGVSIGSKRVR  357
            DLMP+                 EPD   ARLFGVSIG KR R
Sbjct  291  DLMPSCPALATAAAAAGLAIDGEPDP-SARLFGVSIGLKRTR  331



>ref|NP_001063726.1| Os09g0526600 [Oryza sativa Japonica Group]
 sp|Q652B0.1|HFB2C_ORYSJ RecName: Full=Heat stress transcription factor B-2c; AltName: 
Full=Heat stress transcription factor 24; Short=OsHsf-24 [Oryza 
sativa Japonica Group]
 dbj|BAD46357.1| putative heat shock factor [Oryza sativa Japonica Group]
 dbj|BAF25640.1| Os09g0526600 [Oryza sativa Japonica Group]
Length=454

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 68/162 (42%), Gaps = 30/162 (19%)
 Frame = -2

Query  755  SKTVTPSNSGEEQVVSSNSSPG-----------TAAIDASQGGSTSELIGENERLRKENI  609
            ++  +P++S EEQV+SSNS  G                     S  ++  ENERLR+EN 
Sbjct  171  TRAGSPAHSSEEQVLSSNSGSGEEHRQASGSGSAPGGGGGGSASGGDMGEENERLRRENA  230

Query  608  ELNKELSQMKSLCNNIYALMsnysgnnsn---------------ssnqsaesslqSLKPL  474
             L +EL  MK LCNNI  LMS Y+                    SS             L
Sbjct  231  RLTRELGHMKKLCNNILLLMSKYAATQHVEGSAGISSIANCSGESSEAVPPPPPLPPAIL  290

Query  473  DLMPatatatAGCGGENQT---EPDEMRARLFGVSIGSKRVR  357
            DLMP+                 EPD   ARLFGVSIG KR R
Sbjct  291  DLMPSCPALATAAAAAGLAIDGEPDP-SARLFGVSIGLKRTR  331



>gb|EAZ09820.1| hypothetical protein OsI_32108 [Oryza sativa Indica Group]
Length=446

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 66/158 (42%), Gaps = 30/158 (19%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPG-----------TAAIDASQGGSTSELIGENERLRKENIELNK  597
            +P++S EEQV+SSNS  G                     S  ++  ENERLR+EN  L +
Sbjct  175  SPAHSSEEQVLSSNSGSGEEHRQASGSGSAPGGGGGGSASGGDMGEENERLRRENARLTR  234

Query  596  ELSQMKSLCNNIYALMsnysgnnsn---------------ssnqsaesslqSLKPLDLMP  462
            EL  MK LCNNI  LMS Y+                    SS             LDLMP
Sbjct  235  ELGHMKKLCNNILLLMSKYAATQHVEGSAGISSIANCSGESSEAVPPPPPLPPAILDLMP  294

Query  461  atatatAGCGGENQT---EPDEMRARLFGVSIGSKRVR  357
            +                 EPD   ARLFGVSIG KR R
Sbjct  295  SCPALATAAAAAGLAIDGEPDP-SARLFGVSIGLKRTR  331



>ref|XP_008241456.1| PREDICTED: heat shock factor protein HSF24 [Prunus mume]
Length=288

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGT---AAIDASQGGSTSELIGENERLRKENIELNKELSQMKSL  573
            TPSNSGEE   +S SSP +    A++ +  G  S+L GENE+L+KEN  L+ EL+Q K  
Sbjct  120  TPSNSGEEMASTSTSSPDSKNPGAVETAAMGQASDLSGENEKLKKENENLSSELAQTKKQ  179

Query  572  CNNIYALM  549
            C+ +   +
Sbjct  180  CDELVGFL  187



>gb|AFI61331.1| HSF3 [Triticum aestivum]
Length=314

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 7/72 (10%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSP-------GTAAIDASQGGSTSELIGENERLRKENIELNKELSQ  585
            +P  SG+EQV+SS+SSP          +   S G ++ +L  ENERLR+EN  L +EL Q
Sbjct  153  SPVLSGDEQVLSSSSSPEPPFLNQYAPSYSGSGGVASGDLGEENERLRRENSRLTRELGQ  212

Query  584  MKSLCNNIYALM  549
            MK LCNNI+ LM
Sbjct  213  MKKLCNNIFVLM  224



>gb|AJR10106.1| heat-responsive transcription factor [Triticum aestivum]
Length=374

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 7/72 (10%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSP-------GTAAIDASQGGSTSELIGENERLRKENIELNKELSQ  585
            +P  SG+EQV+SS+SSP          +   S G ++ +L  ENERLR+EN  L +EL Q
Sbjct  153  SPVLSGDEQVLSSSSSPEPPFLNQYAPSYSGSGGVASGDLGEENERLRRENSRLTRELGQ  212

Query  584  MKSLCNNIYALM  549
            MK LCNNI+ LM
Sbjct  213  MKKLCNNIFVLM  224



>ref|XP_007202372.1| hypothetical protein PRUPE_ppa009274mg [Prunus persica]
 gb|EMJ03571.1| hypothetical protein PRUPE_ppa009274mg [Prunus persica]
Length=299

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGT---AAIDASQGGSTSELIGENERLRKENIELNKELSQMKSL  573
            TPSNSGEE   +S SSP +    +++ +  G  S+L GENE+L+KEN  L+ EL+Q K  
Sbjct  120  TPSNSGEEMASTSTSSPDSKNPGSVETAAMGQASDLSGENEKLKKENENLSSELAQTKKQ  179

Query  572  CNNIYALM  549
            C+ +   +
Sbjct  180  CDELVGFL  187



>dbj|BAK04233.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 7/72 (10%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSP-------GTAAIDASQGGSTSELIGENERLRKENIELNKELSQ  585
            +P  SG+EQV+SS+SSP          +   S G ++ +L  EN RLR+EN  L +EL Q
Sbjct  169  SPVLSGDEQVLSSSSSPEPPFLNQYAPSYSGSGGVASGDLGEENLRLRRENSRLTRELGQ  228

Query  584  MKSLCNNIYALM  549
            MK LCNNI+ LM
Sbjct  229  MKKLCNNIFVLM  240



>ref|XP_010235376.1| PREDICTED: heat stress transcription factor B-2b-like [Brachypodium 
distachyon]
Length=345

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 79/202 (39%), Gaps = 69/202 (34%)
 Frame = -2

Query  755  SKTVTPSNSGEEQVVSSN--------SSPGTAAIDASQGGSTSELIGENERLRKENIELN  600
            + T +P  S EEQV+SS+        S+    +   S  G   +L  EN+RLR+EN  L 
Sbjct  133  TATTSPVLSAEEQVLSSSSSSERELPSAFPPPSCSGSGSGVGGDLGDENQRLRRENARLA  192

Query  599  KELSQMKSLCNNIYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGG---  429
            +EL  MK LCNNI+ALMS Y+                   PLD     +     C G   
Sbjct  193  RELGHMKKLCNNIFALMSKYASA-----------------PLDAPAPASAGGGNCSGESP  235

Query  428  ------------------------ENQTEPDEMRARLFGVSIGSKRVR----EGEDGSAE  333
                                     +  E  +M A LFGV IG KR+R     G  G+AE
Sbjct  236  LPPPPPPTPPSLELLLSSSSPGPPADADEEKKMSAMLFGVCIGRKRMRNDDGHGVGGAAE  295

Query  332  QDHDLRLQQPGTDVKSEPENGE  267
                         VK EP +G 
Sbjct  296  -------------VKPEPMDGR  304



>gb|ABG73443.1| heat shock factor [Oryza brachyantha]
Length=408

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 41/77 (53%), Gaps = 12/77 (16%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPG------------TAAIDASQGGSTSELIGENERLRKENIELN  600
            +P++S EEQV+SSNS  G                      ++ ++  ENERLR+EN  L 
Sbjct  169  SPAHSSEEQVLSSNSGSGEEHRQASGSGSAPGVGGGGAVSASGDMGEENERLRRENARLT  228

Query  599  KELSQMKSLCNNIYALM  549
            +EL  MK LCNNI  LM
Sbjct  229  RELGHMKKLCNNILLLM  245



>gb|ACG25742.1| heat shock factor protein 4 [Zea mays]
Length=302

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 62/139 (45%), Gaps = 30/139 (22%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCNN  564
            TP++SG +  VSS+  PG A +     G+ +EL  EN RLR+EN  L +EL++ + +C++
Sbjct  128  TPTSSGGDAAVSSSPPPGLALVAT---GAMAELEEENARLRRENARLARELARARRVCDS  184

Query  563  IYALMsnysgnnsnssnqsaesslqSLKPLDLMPatatatAGCGGENQTEPDEMRARLFG  384
            +  L+  Y         +         KP+                           LFG
Sbjct  185  VRHLVWRYDHGGDEVGEEDERHGAAGAKPM---------------------------LFG  217

Query  383  VSIGSKRVREGEDGSAEQD  327
            V+IG KR RE   G  +++
Sbjct  218  VAIGRKRSREDGHGGGDEE  236



>emb|CAH66855.1| OSIGBa0103M18.7 [Oryza sativa Indica Group]
 emb|CAH67030.1| OSIGBa0139P06.3 [Oryza sativa Indica Group]
 gb|EEC77818.1| hypothetical protein OsI_17023 [Oryza sativa Indica Group]
Length=305

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -2

Query  740  PSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCNNI  561
            P++SG E  VSS+   G A I A   G+ +EL  EN RLR+EN  L +EL++ + +C+ +
Sbjct  126  PTSSGGEPAVSSSPPRGAAGIAAGVSGAVAELEEENARLRRENARLARELARARRVCDGV  185

Query  560  YALM  549
              L+
Sbjct  186  RRLV  189



>ref|NP_001053591.1| Os04g0568700 [Oryza sativa Japonica Group]
 sp|Q7XRX3.2|HFB2A_ORYSJ RecName: Full=Heat stress transcription factor B-2a; AltName: 
Full=Heat stress transcription factor 1; Short=rHsf1; AltName: 
Full=Heat stress transcription factor 14; Short=OsHsf-14 
[Oryza sativa Japonica Group]
 emb|CAE02248.2| OSJNBb0032E06.3 [Oryza sativa Japonica Group]
 dbj|BAF15505.1| Os04g0568700 [Oryza sativa Japonica Group]
Length=305

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -2

Query  740  PSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCNNI  561
            P++SG E  VSS+   G A I A   G+ +EL  EN RLR+EN  L +EL++ + +C+ +
Sbjct  126  PTSSGGEPAVSSSPPRGAAGIAAGVSGAVAELEEENARLRRENARLARELARARRVCDGV  185

Query  560  YALM  549
              L+
Sbjct  186  RRLV  189



>gb|AAQ23055.1| heat shock factor RHSF1 [Oryza sativa Japonica Group]
Length=288

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -2

Query  740  PSNSGEEQVVSSNSSPGTAAIDASQGGSTSELIGENERLRKENIELNKELSQMKSLCNNI  561
            P++SG E  VSS+   G A I A   G+ +EL  EN RLR+EN  L +EL++ + +C+ +
Sbjct  109  PTSSGGEPAVSSSPPRGAAGIAAGVSGAVAELEEENARLRRENARLARELARARRVCDGV  168

Query  560  YALM  549
              L+
Sbjct  169  RRLV  172



>ref|XP_009375707.1| PREDICTED: heat stress transcription factor B-1-like [Pyrus x 
bretschneideri]
 ref|XP_009350716.1| PREDICTED: heat stress transcription factor B-1-like [Pyrus x 
bretschneideri]
Length=295

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGT---AAIDASQGGSTSELIGENERLRKENIELNKELSQMKSL  573
            TPSNSGEE   +S SSP +    +++ +     S+L  ENE+L++EN  LN EL+Q K  
Sbjct  120  TPSNSGEEMASTSTSSPDSKNPGSVETAAPSQVSDLSDENEKLKRENENLNSELAQTKKQ  179

Query  572  CNNIYALM  549
            C+ +   +
Sbjct  180  CDELVGFL  187



>ref|XP_009391581.1| PREDICTED: heat stress transcription factor B-2b-like [Musa acuminata 
subsp. malaccensis]
Length=293

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = -2

Query  764  AQPSKTV-TPSNSGEEQVVSSNSSPGTAAI---DASQGGSTSELIGENERLRKENIELNK  597
            A P+  + +PS+SG +QV+ +N S G   +        G  SE+  ENERLR+EN +L++
Sbjct  133  AAPTNRIGSPSSSGGDQVLFTNPSSGRVRLPAAAEGGSGGASEIAEENERLRRENEQLSR  192

Query  596  ELSQMKSLCNNIYALM  549
            EL Q K LCN+I  LM
Sbjct  193  ELDQTKGLCNDILQLM  208



>ref|NP_001152384.1| heat shock factor protein 7 [Zea mays]
 gb|ACG47338.1| heat shock factor protein 7 [Zea mays]
Length=377

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 84/156 (54%), Gaps = 27/156 (17%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAIDASQ----GGSTSELIGENERLRKENIELNKELSQMKS  576
            +P  SGEEQV+SS+SSP   ++   Q       + ++  ENERLR+EN  L +EL QMK 
Sbjct  153  SPVYSGEEQVLSSSSSPEPPSLLQQQPTPSASGSGDMGEENERLRRENAWLARELGQMKK  212

Query  575  LCNNIYALMsnysgnnsnssnqsae--------sslqSLKP-----LDLMPa--------  459
            LCNNI  LMS Y+      + ++A         SS  +  P     L+L+P+        
Sbjct  213  LCNNILLLMSKYAATKQPDAAKAAAAGNCSGGESSGAAAAPPLPSILELLPSCRRDPASA  272

Query  458  -tatatAGCGGENQTEPDEMRARLFGVSIGSKRVRE  354
                A A  G E++ + ++  ARLFGVSIG KR+R+
Sbjct  273  AVDAAAAAAGTEHEVD-EKAGARLFGVSIGRKRMRD  307



>ref|XP_008680871.1| PREDICTED: heat shock factor protein 7 isoform X1 [Zea mays]
 tpg|DAA48372.1| TPA: heat shock factor protein 7 [Zea mays]
 gb|AIB04797.1| HSF transcription factor, partial [Zea mays]
Length=414

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 84/156 (54%), Gaps = 27/156 (17%)
 Frame = -2

Query  743  TPSNSGEEQVVSSNSSPGTAAIDASQ----GGSTSELIGENERLRKENIELNKELSQMKS  576
            +P  SGEEQV+SS+SSP   ++   Q       + ++  ENERLR+EN  L +EL QMK 
Sbjct  188  SPVYSGEEQVLSSSSSPEPPSLLQQQPTPSASGSGDMGEENERLRRENAWLARELGQMKK  247

Query  575  LCNNIYALMsnysgnnsnssnqsae--------sslqSLKP-----LDLMPa--------  459
            LCNNI  LMS Y+      + ++A         SS  +  P     L+L+P+        
Sbjct  248  LCNNILLLMSKYAATKQPDAAKAAAAGNCSGGESSGAAAAPPLPSILELLPSCRRDPASA  307

Query  458  -tatatAGCGGENQTEPDEMRARLFGVSIGSKRVRE  354
                A A  G E++ + ++  ARLFGVSIG KR+R+
Sbjct  308  AVDAAAAAAGTEHEVD-EKAGARLFGVSIGRKRMRD  342



>gb|EEE70081.1| hypothetical protein OsJ_30075 [Oryza sativa Japonica Group]
Length=401

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 48/112 (43%), Gaps = 19/112 (17%)
 Frame = -2

Query  638  ENERLRKENIELNKELSQMKSLCNNIYALMsnysgnnsn---------------ssnqsa  504
            ENERLR+EN  L +EL  MK LCNNI  LMS Y+                    SS    
Sbjct  176  ENERLRRENARLTRELGHMKKLCNNILLLMSKYAATQHVEGSAGISSIANCSGESSEAVP  235

Query  503  esslqSLKPLDLMPatatatAGCGGENQT---EPDEMRARLFGVSIGSKRVR  357
                     LDLMP+                 EPD   ARLFGVSIG KR R
Sbjct  236  PPPPLPPAILDLMPSCPALATAAAAAGLAIDGEPDP-SARLFGVSIGLKRTR  286



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1655620752480